5D9DA

Luciferin-regenerating enzyme solved by sad using synchrotron radiation at room temperature
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
306
structure length
306
Chain Sequence
PVVEKIAELGKYTVGEGPHWDHETQTLYFVDTVEKTFHKYVPSQKKYTFCKVDKLVSFIIPLAGSPGRFVVSLEREIAILTWDGVSAAPTSIEAIVNVEPHIKNNRLNDGKADPLGNLWTGTMAIDAGLPIGPVTGSLYHLGADKKVKMHESNIAIANGLAWSNDLKKMYYIDSGKRRVDEYDYDASTLSISNQRPLFTFEKHEVPGYPDGQTIDEEGNLWVAVFQGQRIIKISTQQPEVLLDTVKIPDPQVTSVAFGGPNLDELYVTSAGLQLDDSSFDKSLVNGHVYRVTGLGVKGFAGVKVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An isomorphous replacement method for efficient de novo phasing for serial femtosecond crystallography.
pubmed doi rcsb
source organism Photinus pyralis
molecule tags Hydrolase
molecule keywords Luciferin regenerating enzyme
total genus 77
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08450 SGL SMP-30/Gluconolactonase/LRE-like region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 5d9dA00
1QBIA 2W8BB 1C5KA 1IJQA 2G8SA 2IAQA 4GNAA 2IARA 3HLIA 3IAXA 4IYGA 3V1SA 2QE8A 1PJXA 5GX1A 2V91A 2ISMA 3SOBB 3Q6PA 5GX3A 2FPCA 4GN8A 1V04A 2W8BA 2FP8A 3BYCA 1CQ1A 2IAOA 3LI4A 3SOQA 5D9DA 4A0PA 2IVZA 4GN7A 1RWLA 2IAVA 3G4EA 4IMBA 1POOA 3KGGA 2GVWA 4JMLA 5GX4A 3LI3A 5FWWA 2IAXA 3S8VA 2GVVA 4GN9A 1RWIA 4HHOA 2IASA 3HLHA 5GX2A 4PWZA 2HQSA 3HRPA 5D9CA 1CVMA 4O5SA 2IAPA 1Q7FA 1H6LA 3SREA 3DR2A 3DASA 3SRGA 3WWAA 4Q1UA 3FW0A 2GHSA 3S94A 2OJHA 3I1CA 4R40A 1N7DA 4O5TA 2VAQA 1CRUA 2IAUA 3Q6KA 3Q6TA 4ZLRA 3AMRA 2P4OA 3S2KA 3AMSA 3P5BL 2DG0A 3KYAA 4GNBA 2FP9A 1E1AA 3E5ZA 5EX7A 5D9BA 1C9UA 5GTQA 3V64C 3G4HA 4HHQA 2DG1A 2IAWA 1NPEA 3U0SA 3TC9A 2GVUA 3V65B 3FVZA 2IATA 5GX5A 4DG6A 1CRZA 3WW9A 2POOA 2GVXA 2DSOA 3A9HA 4HW6A 4GNCA 1QLGA 3A9GA 3LI5A 3S8ZA 3SOVA 3O4PA 2FPBA
chains in the Genus database with same CATH superfamily
3T1EA 4NN9A 1N1TA 5FNRA 1NNBA 2AEQA 1V3EA 1XOEA 2HTYA 4MWYA 3W09A 2V91A 5HX0A 2ISMA 4XIKA 5EO8A 2B8HA 2HT7A 4K1KA 4FPJA 1NMBN 2F12A 1V3CA 3SILA 2FP8A 1N1YA 2YA7A 2IAOA 3LI4A 4MWRA 1W8NA 3SOQA 3GVLA 1W20A 1RWLA 2HU4A 1V0EA 5GX2A 4PWZA 1BJIA 4XHBA 2W20A 3HRPA 1Z4WA 4L7CA 2QWCA 1CVMA 4O5SA 4X4AA 2C4LA 1H6LA 3SREA 4MX0A 3DR2A 5H47A 4QN6A 2F10A 3A71A 2GHSA 1F8CA 1MZ5A 2BATA 3PJQA 4R40A 1MS8A 2IAUA 1NNCA 4KS2A 3SALA 1A4GA 1ZGKA 4YZ5A 4G3NA 2F26A 3AMSA 1MZ6A 2HTVA 5F72C 1IVCA 4GNBA 1N6FA 1V3BA 3GVJA 4M4VA 1IUCA 2YDPA 4K1IA 4XJ9A 2XN4A 4HIZA 3ALWA 3G4HA 4FP2A 1F8DA 2DG1A 2ZB5A 3TC9A 3V65B 2QWGA 1NSBA 4FPKA 3JU4A 4DG6A 1CRZA 1SNTA 4WA3A 3H6JA 4QN7A 3B69A 4CSDA 1SO7A 5B2CA 4HZVA 1B9VA 4K1JA 4M3MA 2FPBA 1USRA 5FZNA 3TI5A 2VK6A 2QWJA 4FZHA 2AEPA 4IN4A 2IARA 4FPYA 3H73A 4QN5A 1W8OA 2QE8A 1PJXA 4FPOB 4N1BA 1EUUA 4B7JA 2VSMA 5GX1A 4GDIA 4CPOA 4XJZA 2A75A 4K3YA 1NN2A 2ZW9A 4CPNA 1INYA 2AH2A 4AH4A 2W8BA 4CHBA 1CQ1A 2VK7A 5D9DA 2ZZKA 2IAVA 3G4EA 4HZZA 4JMLA 3KGGA 4H53A 2GVWA 4CH9A 2IAXA 3S8VA 1IVFA 1OFZA 4QN4A 4H52A 4D52A 2YA5A 4MWWA 5B2DA 3H71A 3TICA 2H2UA 4FPGA 2HQSA 4YW4A 4WA5A 3SANA 1Q7FA 4HZXA 4QN3A 5HUNA 3WWAA 3K39A 4Q1UA 1NCBN 1X2JA 3FW0A 3CYEA 3S94A 2QWHA 2F29A 5HUKA 2HTQA 2AGSA 4XMBA 2XZJA 2XZKA 5FNTA 1INFA 4ZY3A 1NSCA 2BERA 4B7QA 2VW2A 1V2IA 2VAQA 1E8TA 2VVZA 4X47A 2F27A 4FOVA 3Q6TA 2W5OA 4ZLRA 3GVKA 3AMRA 1W0PA 4MJUA 2BZDA 3P5BL 4WEFA 2DG0A 3KYAA 2QWDA 1A4QA 4YW1A 1S0JA 2FP9A 2SLIA 1DIMA 5D9BA 1C9UA 2C4AA 1IVBA 4SLIA 1INWA 2CMLA 4AHAA 1WCQA 5GX5A 5FNQA 3WW9A 3ALXA 4NCSA 3A9HA 4FPEA 1N6EA 4GNCA 1QLGA 4YY8A 4YZ1A 1MR5A 1Z50A 3LI5A 2H2NA 3O4PA 1USXA 1Z4XA 2YA4A 1MS1A 1N1SA 1WCSA 5NN9A 1IVEA 2HT8A 3O9KA 4GNAA 4XJRA 2W38A 3IAXA 2RKCA 4IYGA 4CPLA 4GZWA 2QWKA 4GZXA 2VW0A 1SLIA 4FOYA 4IFJA 4XJAA 3SOBB 3Q6PA 1L7GA 2YDTA 2FPCA 4FP3A 1V04A 3BYCA 3CKZA 1E8VA 4YW5A 2VK5A 4GN7A 5GX4A 1POOA 3LI3A 1B9TA 2GVVA 2ZWAA 4M4NA 1RWIA 2IASA 3B7EA 6NN9A 3HLHA 3L6VA 4YW2A 1A14N 2HTUA 3CL0A 4MWLA 2JKBA 2IAPA 4CPZA 4CPYA 3K36A 3SRGA 1L7FA 1V0ZA 1NCDN 4BBWA 4C1YB 1MS5A 4Q6KA 4GZOA 4MWVA 4KS5A 4XILA 1VCUA 2QWIA 4X6KA 3I1CA 4XMIA 4O5TA 1IUBA 2ZB6A 2BF6A 1CRUA 4D52C 3Q6KA 3NN9A 4GB1A 1IVDA 5CGJA 4GZSA 3H72A 4YZ2A 1NCAN 2SILA 4IFNX 3NSSA 4YZ3A 1MWEA 3TI4A 2DYHA 3E5ZA 5EX7A 2VWDA 3V64C 4MZAA 5FNSA 4XJWA 4HHQA 2YA6A 1MS4A 2IAWA 1B9SA 3TI6A 4D4UA 3U0SA 5F9TA 4B7MA 4FJ6A 1F8EA 3FVZA 4XJQA 2HU0A 2IATA 2W5NA 3D12A 4J9TA 2POOA 1NMAN 2GVXA 1INVA 1S18A 4XIOA 1X2RA 4FOWA 4HW6A 2XCYA 4L7DA 4D52B 2YA8A 3A9GA 3S8ZA 3TI8A 5FZJA 3SOVA 4GZPA 4YZ4A 1WP5A 4B7NA 4KS1A 4XHXA 3K3AA 4D8SA 4HZWA 3O9JA 1QBIA 2W8BB 4CPMA 1C5KA 1Z4YA 1IJQA 4FVKA 1N6DA 1NCCN 2G8SA 2IAQA 4YW3A 4KS4A 3HLIA 4MWQA 3V1SA 2QWFA 2X9MA 5EO7A 1ZI0A 4MWUA 1MS3A 1Z4ZA 4GDJA 2SIMA 3TIAA 1W0OA 5GX3A 2HT5A 3CL2A 4FPHA 4XJ8A 4GN8A 4MZEA 4GZTA 3II7A 3OPZA 4A0PA 2IVZA 1INHA 2FLUX 4IMBA 2QWEA 3UC1A 5FWWA 4MWXA 1EUSA 2F24A 4GN9A 3SLIA 4HHOA 7NN9A 4FPCA 1SUUA 2WOZA 3TI3A 1XOGA 4K1HA 2QWAA 2F25A 1KITA 3TIBA 5HUGA 5D9CA 4KS3A 1N1VA 4M4UA 1IVGA 4GEZA 3ADEA 2QWBA 4I00A 2VSKA 3DASA 4FPFA 4JF7A 3ZGCA 4FOQA 1W21A 4WA4A 1U6DX 1K32A 4XYXA 4FPLA 5FNUA 2OJHA 4MC7A 1S1DA 3VNGA 1N7DA 3WDZA 4GJTA 2VW1A 1NMCA 4L7BA 1SLLA 4DGRA 3WN7A 4ASCA 1L7HA 1NSDA 4X49A 1MS9A 4XJUA 2HTRA 2P4OA 4UF7A 5HUMA 1NNAA 4XMAA 2F0ZA 3S2KA 1F8BA 4XE9A 1E8UA 4ZGCA 2Z32A 5M1ZA 2F28A 2F13A 2XZIA 4FQ4A 4MWJA 4NC5A 4XOGA 1E1AA 3BEQA 3K37A 1Z4VA 1INGA 5GTQA 4WEGA 1INXA 3D11A 4IQKA 1VCJA 3A72A 3NO0A 4AGIA 4UOUA 5JYYA 2F11A 4QNPA 1NPEA 2FHRA 2VPJA 2GVUA 2HTWA 4B7RA 4HZYA 1EURA 1DILA 4AGTA 2DSOA 3ZGDA 4C1YA 1V0FA 1EUTA 4GZQA 4IFLX 1W1XA 3INBA 1V3DA 3K38A 1MS0A 3VNHA 1S0IA 4MJVA
chains in the Genus database with same CATH topology
1QBIA 2W8BB 1C5KA 1IJQA 2G8SA 2IAQA 4GNAA 2IARA 3HLIA 3IAXA 4IYGA 3V1SA 2QE8A 1PJXA 5GX1A 2V91A 2ISMA 3SOBB 3Q6PA 5GX3A 2FPCA 4GN8A 1V04A 2W8BA 2FP8A 3BYCA 1CQ1A 2IAOA 3LI4A 3SOQA 5D9DA 4A0PA 2IVZA 4GN7A 1RWLA 2IAVA 3G4EA 4IMBA 1POOA 3KGGA 2GVWA 4JMLA 5GX4A 3LI3A 5FWWA 2IAXA 3S8VA 2GVVA 4GN9A 1RWIA 4HHOA 2IASA 3HLHA 5GX2A 4PWZA 2HQSA 3HRPA 5D9CA 1CVMA 4O5SA 2IAPA 1Q7FA 1H6LA 3SREA 3DR2A 3DASA 3SRGA 3WWAA 4Q1UA 3FW0A 2GHSA 3S94A 2OJHA 3I1CA 4R40A 1N7DA 4O5TA 2VAQA 1CRUA 2IAUA 3Q6KA 3Q6TA 4ZLRA 3AMRA 2P4OA 3S2KA 3AMSA 3P5BL 2DG0A 3KYAA 4GNBA 2FP9A 1E1AA 3E5ZA 5EX7A 5D9BA 1C9UA 5GTQA 3V64C 3G4HA 4HHQA 2DG1A 2IAWA 1NPEA 3U0SA 3TC9A 2GVUA 3V65B 3FVZA 2IATA 5GX5A 4DG6A 1CRZA 3WW9A 2POOA 2GVXA 2DSOA 3A9HA 4HW6A 4GNCA 1QLGA 3A9GA 3LI5A 3S8ZA 3SOVA 3O4PA 2FPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QBI A;  2W8B B;  1C5K A;  1IJQ A;  2G8S A;  2IAQ A;  4GNA A;  2IAR A;  3HLI A;  3IAX A;  4IYG A;  3V1S A;  2QE8 A;  1PJX A;  5GX1 A;  2V91 A;  2ISM A;  3SOB B;  3Q6P A;  5GX3 A;  2FPC A;  4GN8 A;  1V04 A;  2W8B A;  2FP8 A;  3BYC A;  1CQ1 A;  2IAO A;  3LI4 A;  3SOQ A;  5D9D A;  4A0P A;  2IVZ A;  4GN7 A;  1RWL A;  2IAV A;  3G4E A;  4IMB A;  1POO A;  3KGG A;  2GVW A;  4JML A;  5GX4 A;  3LI3 A;  5FWW A;  2IAX A;  3S8V A;  2GVV A;  4GN9 A;  1RWI A;  4HHO A;  2IAS A;  3HLH A;  5GX2 A;  4PWZ A;  2HQS A;  3HRP A;  5D9C A;  1CVM A;  4O5S A;  2IAP A;  1Q7F A;  1H6L A;  3SRE A;  3DR2 A;  3DAS A;  3SRG A;  3WWA A;  4Q1U A;  3FW0 A;  2GHS A;  3S94 A;  2OJH A;  3I1C A;  4R40 A;  1N7D A;  4O5T A;  2VAQ A;  1CRU A;  2IAU A;  3Q6K A;  3Q6T A;  4ZLR A;  3AMR A;  2P4O A;  3S2K A;  3AMS A;  3P5B L;  2DG0 A;  3KYA A;  4GNB A;  2FP9 A;  1E1A A;  3E5Z A;  5EX7 A;  5D9B A;  1C9U A;  5GTQ A;  3V64 C;  3G4H A;  4HHQ A;  2DG1 A;  2IAW A;  1NPE A;  3U0S A;  3TC9 A;  2GVU A;  3V65 B;  3FVZ A;  2IAT A;  5GX5 A;  4DG6 A;  1CRZ A;  3WW9 A;  2POO A;  2GVX A;  2DSO A;  3A9H A;  4HW6 A;  4GNC A;  1QLG A;  3A9G A;  3LI5 A;  3S8Z A;  3SOV A;  3O4P A;  2FPB A; 
#chains in the Genus database with same CATH topology
 3T1E A;  4NN9 A;  1N1T A;  5FNR A;  1NNB A;  2AEQ A;  1V3E A;  1XOE A;  2HTY A;  4MWY A;  3W09 A;  2V91 A;  5HX0 A;  2ISM A;  4XIK A;  5EO8 A;  2B8H A;  2HT7 A;  4K1K A;  4FPJ A;  1NMB N;  2F12 A;  1V3C A;  3SIL A;  2FP8 A;  1N1Y A;  2YA7 A;  2IAO A;  3LI4 A;  4MWR A;  1W8N A;  3SOQ A;  3GVL A;  1W20 A;  1RWL A;  2HU4 A;  1V0E A;  5GX2 A;  4PWZ A;  1BJI A;  4XHB A;  2W20 A;  3HRP A;  1Z4W A;  4L7C A;  2QWC A;  1CVM A;  4O5S A;  4X4A A;  2C4L A;  1H6L A;  3SRE A;  4MX0 A;  3DR2 A;  5H47 A;  4QN6 A;  2F10 A;  3A71 A;  2GHS A;  1F8C A;  1MZ5 A;  2BAT A;  3PJQ A;  4R40 A;  1MS8 A;  2IAU A;  1NNC A;  4KS2 A;  3SAL A;  1A4G A;  1ZGK A;  4YZ5 A;  4G3N A;  2F26 A;  3AMS A;  1MZ6 A;  2HTV A;  5F72 C;  1IVC A;  4GNB A;  1N6F A;  1V3B A;  3GVJ A;  4M4V A;  1IUC A;  2YDP A;  4K1I A;  4XJ9 A;  2XN4 A;  4HIZ A;  3ALW A;  3G4H A;  4FP2 A;  1F8D A;  2DG1 A;  2ZB5 A;  3TC9 A;  3V65 B;  2QWG A;  1NSB A;  4FPK A;  3JU4 A;  4DG6 A;  1CRZ A;  1SNT A;  4WA3 A;  3H6J A;  4QN7 A;  3B69 A;  4CSD A;  1SO7 A;  5B2C A;  4HZV A;  1B9V A;  4K1J A;  4M3M A;  2FPB A;  1USR A;  5FZN A;  3TI5 A;  2VK6 A;  2QWJ A;  4FZH A;  2AEP A;  4IN4 A;  2IAR A;  4FPY A;  3H73 A;  4QN5 A;  1W8O A;  2QE8 A;  1PJX A;  4FPO B;  4N1B A;  1EUU A;  4B7J A;  2VSM A;  5GX1 A;  4GDI A;  4CPO A;  4XJZ A;  2A75 A;  4K3Y A;  1NN2 A;  2ZW9 A;  4CPN A;  1INY A;  2AH2 A;  4AH4 A;  2W8B A;  4CHB A;  1CQ1 A;  2VK7 A;  5D9D A;  2ZZK A;  2IAV A;  3G4E A;  4HZZ A;  4JML A;  3KGG A;  4H53 A;  2GVW A;  4CH9 A;  2IAX A;  3S8V A;  1IVF A;  1OFZ A;  4QN4 A;  4H52 A;  4D52 A;  2YA5 A;  4MWW A;  5B2D A;  3H71 A;  3TIC A;  2H2U A;  4FPG A;  2HQS A;  4YW4 A;  4WA5 A;  3SAN A;  1Q7F A;  4HZX A;  4QN3 A;  5HUN A;  3WWA A;  3K39 A;  4Q1U A;  1NCB N;  1X2J A;  3FW0 A;  3CYE A;  3S94 A;  2QWH A;  2F29 A;  5HUK A;  2HTQ A;  2AGS A;  4XMB A;  2XZJ A;  2XZK A;  5FNT A;  1INF A;  4ZY3 A;  1NSC A;  2BER A;  4B7Q A;  2VW2 A;  1V2I A;  2VAQ A;  1E8T A;  2VVZ A;  4X47 A;  2F27 A;  4FOV A;  3Q6T A;  2W5O A;  4ZLR A;  3GVK A;  3AMR A;  1W0P A;  4MJU A;  2BZD A;  3P5B L;  4WEF A;  2DG0 A;  3KYA A;  2QWD A;  1A4Q A;  4YW1 A;  1S0J A;  2FP9 A;  2SLI A;  1DIM A;  5D9B A;  1C9U A;  2C4A A;  1IVB A;  4SLI A;  1INW A;  2CML A;  4AHA A;  1WCQ A;  5GX5 A;  5FNQ A;  3WW9 A;  3ALX A;  4NCS A;  3A9H A;  4FPE A;  1N6E A;  4GNC A;  1QLG A;  4YY8 A;  4YZ1 A;  1MR5 A;  1Z50 A;  3LI5 A;  2H2N A;  3O4P A;  1USX A;  1Z4X A;  2YA4 A;  1MS1 A;  1N1S A;  1WCS A;  5NN9 A;  1IVE A;  2HT8 A;  3O9K A;  4GNA A;  4XJR A;  2W38 A;  3IAX A;  2RKC A;  4IYG A;  4CPL A;  4GZW A;  2QWK A;  4GZX A;  2VW0 A;  1SLI A;  4FOY A;  4IFJ A;  4XJA A;  3SOB B;  3Q6P A;  1L7G A;  2YDT A;  2FPC A;  4FP3 A;  1V04 A;  3BYC A;  3CKZ A;  1E8V A;  4YW5 A;  2VK5 A;  4GN7 A;  5GX4 A;  1POO A;  3LI3 A;  1B9T A;  2GVV A;  2ZWA A;  4M4N A;  1RWI A;  2IAS A;  3B7E A;  6NN9 A;  3HLH A;  3L6V A;  4YW2 A;  1A14 N;  2HTU A;  3CL0 A;  4MWL A;  2JKB A;  2IAP A;  4CPZ A;  4CPY A;  3K36 A;  3SRG A;  1L7F A;  1V0Z A;  1NCD N;  4BBW A;  4C1Y B;  1MS5 A;  4Q6K A;  4GZO A;  4MWV A;  4KS5 A;  4XIL A;  1VCU A;  2QWI A;  4X6K A;  3I1C A;  4XMI A;  4O5T A;  1IUB A;  2ZB6 A;  2BF6 A;  1CRU A;  4D52 C;  3Q6K A;  3NN9 A;  4GB1 A;  1IVD A;  5CGJ A;  4GZS A;  3H72 A;  4YZ2 A;  1NCA N;  2SIL A;  4IFN X;  3NSS A;  4YZ3 A;  1MWE A;  3TI4 A;  2DYH A;  3E5Z A;  5EX7 A;  2VWD A;  3V64 C;  4MZA A;  5FNS A;  4XJW A;  4HHQ A;  2YA6 A;  1MS4 A;  2IAW A;  1B9S A;  3TI6 A;  4D4U A;  3U0S A;  5F9T A;  4B7M A;  4FJ6 A;  1F8E A;  3FVZ A;  4XJQ A;  2HU0 A;  2IAT A;  2W5N A;  3D12 A;  4J9T A;  2POO A;  1NMA N;  2GVX A;  1INV A;  1S18 A;  4XIO A;  1X2R A;  4FOW A;  4HW6 A;  2XCY A;  4L7D A;  4D52 B;  2YA8 A;  3A9G A;  3S8Z A;  3TI8 A;  5FZJ A;  3SOV A;  4GZP A;  4YZ4 A;  1WP5 A;  4B7N A;  4KS1 A;  4XHX A;  3K3A A;  4D8S A;  4HZW A;  3O9J A;  1QBI A;  2W8B B;  4CPM A;  1C5K A;  1Z4Y A;  1IJQ A;  4FVK A;  1N6D A;  1NCC N;  2G8S A;  2IAQ A;  4YW3 A;  4KS4 A;  3HLI A;  4MWQ A;  3V1S A;  2QWF A;  2X9M A;  5EO7 A;  1ZI0 A;  4MWU A;  1MS3 A;  1Z4Z A;  4GDJ A;  2SIM A;  3TIA A;  1W0O A;  5GX3 A;  2HT5 A;  3CL2 A;  4FPH A;  4XJ8 A;  4GN8 A;  4MZE A;  4GZT A;  3II7 A;  3OPZ A;  4A0P A;  2IVZ A;  1INH A;  2FLU X;  4IMB A;  2QWE A;  3UC1 A;  5FWW A;  4MWX A;  1EUS A;  2F24 A;  4GN9 A;  3SLI A;  4HHO A;  7NN9 A;  4FPC A;  1SUU A;  2WOZ A;  3TI3 A;  1XOG A;  4K1H A;  2QWA A;  2F25 A;  1KIT A;  3TIB A;  5HUG A;  5D9C A;  4KS3 A;  1N1V A;  4M4U A;  1IVG A;  4GEZ A;  3ADE A;  2QWB A;  4I00 A;  2VSK A;  3DAS A;  4FPF A;  4JF7 A;  3ZGC A;  4FOQ A;  1W21 A;  4WA4 A;  1U6D X;  1K32 A;  4XYX A;  4FPL A;  5FNU A;  2OJH A;  4MC7 A;  1S1D A;  3VNG A;  1N7D A;  3WDZ A;  4GJT A;  2VW1 A;  1NMC A;  4L7B A;  1SLL A;  4DGR A;  3WN7 A;  4ASC A;  1L7H A;  1NSD A;  4X49 A;  1MS9 A;  4XJU A;  2HTR A;  2P4O A;  4UF7 A;  5HUM A;  1NNA A;  4XMA A;  2F0Z A;  3S2K A;  1F8B A;  4XE9 A;  1E8U A;  4ZGC A;  2Z32 A;  5M1Z A;  2F28 A;  2F13 A;  2XZI A;  4FQ4 A;  4MWJ A;  4NC5 A;  4XOG A;  1E1A A;  3BEQ A;  3K37 A;  1Z4V A;  1ING A;  5GTQ A;  4WEG A;  1INX A;  3D11 A;  4IQK A;  1VCJ A;  3A72 A;  3NO0 A;  4AGI A;  4UOU A;  5JYY A;  2F11 A;  4QNP A;  1NPE A;  2FHR A;  2VPJ A;  2GVU A;  2HTW A;  4B7R A;  4HZY A;  1EUR A;  1DIL A;  4AGT A;  2DSO A;  3ZGD A;  4C1Y A;  1V0F A;  1EUT A;  4GZQ A;  4IFL X;  1W1X A;  3INB A;  1V3D A;  3K38 A;  1MS0 A;  3VNH A;  1S0I A;  4MJV A; 
#chains in the Genus database with same CATH homology
 1QBI A;  2W8B B;  1C5K A;  1IJQ A;  2G8S A;  2IAQ A;  4GNA A;  2IAR A;  3HLI A;  3IAX A;  4IYG A;  3V1S A;  2QE8 A;  1PJX A;  5GX1 A;  2V91 A;  2ISM A;  3SOB B;  3Q6P A;  5GX3 A;  2FPC A;  4GN8 A;  1V04 A;  2W8B A;  2FP8 A;  3BYC A;  1CQ1 A;  2IAO A;  3LI4 A;  3SOQ A;  5D9D A;  4A0P A;  2IVZ A;  4GN7 A;  1RWL A;  2IAV A;  3G4E A;  4IMB A;  1POO A;  3KGG A;  2GVW A;  4JML A;  5GX4 A;  3LI3 A;  5FWW A;  2IAX A;  3S8V A;  2GVV A;  4GN9 A;  1RWI A;  4HHO A;  2IAS A;  3HLH A;  5GX2 A;  4PWZ A;  2HQS A;  3HRP A;  5D9C A;  1CVM A;  4O5S A;  2IAP A;  1Q7F A;  1H6L A;  3SRE A;  3DR2 A;  3DAS A;  3SRG A;  3WWA A;  4Q1U A;  3FW0 A;  2GHS A;  3S94 A;  2OJH A;  3I1C A;  4R40 A;  1N7D A;  4O5T A;  2VAQ A;  1CRU A;  2IAU A;  3Q6K A;  3Q6T A;  4ZLR A;  3AMR A;  2P4O A;  3S2K A;  3AMS A;  3P5B L;  2DG0 A;  3KYA A;  4GNB A;  2FP9 A;  1E1A A;  3E5Z A;  5EX7 A;  5D9B A;  1C9U A;  5GTQ A;  3V64 C;  3G4H A;  4HHQ A;  2DG1 A;  2IAW A;  1NPE A;  3U0S A;  3TC9 A;  2GVU A;  3V65 B;  3FVZ A;  2IAT A;  5GX5 A;  4DG6 A;  1CRZ A;  3WW9 A;  2POO A;  2GVX A;  2DSO A;  3A9H A;  4HW6 A;  4GNC A;  1QLG A;  3A9G A;  3LI5 A;  3S8Z A;  3SOV A;  3O4P A;  2FPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...