3E5ZA

X-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
290
structure length
290
Chain Sequence
TLRAARPEFLDLFPAGAEARRLADGFTWTEGPVYVPARSAVIFSDVRQNRTWAWSDDGQLSPEMHPSHHQNGHCLNKQGHLIACSHGLRRLERQREPGGEWESIADSFEGKKLNSPNDVCLAPDGSLWFSDPTYGIDKPEEGYGGEMELPGRWVFRLAPDGTLSAPIRDRVKPNGLAFLPSGNLLVSDTGDNATHRYCLNARGETEYQGVHFTVEPGKTDGLRVDAGGLIWASAGDGVHVLTPDGDELGRVLTPQTTSNLCFGGPEGRTLYMTVSTEFWSIETNVRGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the putative gluconolactonase in protein family PF08450. Northeast Structural Genomics Consortium target DrR130.
rcsb
molecule keywords putative Gluconolactonase
molecule tags Structural genomics, unknown function
source organism Deinococcus radiodurans
total genus 67
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08450 SGL SMP-30/Gluconolactonase/LRE-like region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3e5zA00
3A9HA 2QE8A 5FWWA 1V04A 4R40A 5GX3A 2IAOA 3G4EA 3P5BL 2W8BA 3WWAA 3HLHA 5EX7A 4ZLRA 3SRGA 3Q6PA 1QBIA 3I1CA 2GVUA 3AMSA 5GX5A 2DG0A 3WW9A 2G8SA 2IAXA 1Q7FA 3SOBB 4GNCA 3U0SA 4HHQA 1PJXA 2DSOA 3S8ZA 2OJHA 4DG6A 3DR2A 2FPBA 1RWIA 3SOQA 4HHOA 5D9CA 1C5KA 1CQ1A 1NPEA 3V64C 3E5ZA 3SREA 1C9UA 4Q1UA 2FP9A 4GN9A 3Q6KA 3A9GA 3FVZA 4O5SA 2GVXA 3TC9A 2V91A 2GHSA 2HQSA 2FPCA 4GNAA 4JMLA 5GX2A 2IASA 3KYAA 5GX4A 3LI3A 2IAWA 4IYGA 2DG1A 1CRUA 3V1SA 3DASA 3S8VA 4IMBA 3S94A 4HW6A 1RWLA 2GVVA 3IAXA 3Q6TA 1CVMA 4A0PA 2IARA 3BYCA 3AMRA 1N7DA 1H6LA 3FW0A 2IATA 5D9DA 3S2KA 3KGGA 5D9BA 1IJQA 2IAUA 1CRZA 4GNBA 3HRPA 2ISMA 2POOA 4PWZA 3O4PA 3SOVA 2IVZA 3LI5A 2IAPA 1E1AA 5GX1A 1POOA 2P4OA 3HLIA 4O5TA 3G4HA 2IAVA 2GVWA 4GN7A 2IAQA 2W8BB 4GN8A 2FP8A 3LI4A 3V65B 1QLGA 2VAQA 5GTQA
chains in the Genus database with same CATH superfamily
4YW2A 2BZDA 4D4UA 1Z4VA 1V04A 2IAOA 2QWDA 3G4EA 5FNUA 4B7RA 1MS8A 2H2NA 1F8CA 2F29A 5M1ZA 3Q6PA 3CL2A 4GZXA 4H53A 3O9KA 1B9SA 2GVUA 4FPCA 4MZAA 4K1JA 2VSKA 2AGSA 4XMIA 2G8SA 2IAXA 1V3BA 5FNRA 3SOBB 4GNCA 3K3AA 4HHQA 2HTQA 2HTYA 4G3NA 4M4VA 5EO8A 3S8ZA 3DR2A 1E8TA 1RWIA 1MS3A 1C5KA 4D52A 2QWEA 2QWIA 4C1YB 1C9UA 4MWYA 4KS1A 4XJUA 3TIBA 4Q1UA 3O9JA 3Q6KA 4GN9A 3UC1A 1MWEA 1W21A 2FPCA 4XJZA 2IASA 3KYAA 1N6FA 4YZ4A 1L7GA 5EO7A 1NN2A 3H73A 1CRUA 1MZ5A 2YA6A 3V1SA 3DASA 2FHRA 4IMBA 1VCJA 3S94A 2QWJA 1SUUA 1BJIA 1W1XA 4MJUA 2SIMA 3IAXA 4KS5A 2AH2A 4CHBA 3BYCA 1S18A 4GZQA 1ZGKA 1NSBA 4XJAA 1V3CA 2YA5A 1NCBN 1INHA 3ADEA 4QN5A 2HTUA 2QWCA 1IVGA 4MX0A 2VK6A 1CRZA 4DGRA 4HZWA 2F11A 4CPNA 4MWVA 2VW1A 3T1EA 4GEZA 4GNBA 3A72A 1Z4ZA 1E1AA 3SLIA 1WCSA 5GX1A 4GZSA 4WA3A 2QWKA 3D12A 3CKZA 2IAVA 3A71A 3TIAA 4FP2A 4YW5A 3LI4A 4YZ1A 4XJWA 1IVFA 4B7JA 5GTQA 4NC5A 4IQKA 4QN7A 4HZZA 3A9HA 4XHBA 1INYA 4XJ8A 5FZNA 4L7BA 1F8BA 1N1TA 3WDZA 4AGTA 4AHAA 5GX3A 4FZHA 3HLHA 3WWAA 4CPMA 3K39A 2F0ZA 4XOGA 3SRGA 4WA5A 2RKCA 3ALXA 2HTWA 2YDTA 3B69A 3K37A 1NNBA 1Q7FA 2XN4A 3U0SA 2C4AA 5HUKA 1PJXA 4FOWA 2DSOA 4YW4A 4DG6A 3TI5A 1CQ1A 4WA4A 1V3EA 2BERA 4FOYA 3E5ZA 2VSMA 3SREA 5NN9A 2FP9A 1MS5A 4L7CA 3A9GA 5HUMA 4FPOB 4MWUA 4O5SA 2W5OA 4ASCA 3TC9A 2QWGA 4H52A 2V91A 4FPGA 2F12A 2HT5A 4GNAA 4JMLA 2F27A 1MZ6A 2IAWA 4D52B 2DG1A 2HU4A 5HX0A 1B9VA 2X9MA 4GZPA 4D8SA 4MWJA 1N6DA 4FQ4A 1WP5A 1A4QA 4HZXA 1L7FA 3GVKA 4FVKA 4ZGCA 1CVMA 4A0PA 1N7DA 1KITA 1DIMA 3TI6A 1H6LA 4X6KA 3ALWA 2VVZA 4GZOA 4Q6KA 2HU0A 2YA7A 1SLIA 2QWHA 2W38A 3GVLA 3VNGA 4GB1A 2YA4A 4IFNX 2HT8A 3NN9A 1EURA 4IFLX 3H6JA 4J9TA 3H72A 5B2CA 2XCYA 3II7A 4QN6A 3JU4A 2C4LA 2AEPA 3O4PA 4PWZA 4XMBA 1EUSA 2IVZA 4XJ9A 3H71A 3HLIA 4MZEA 4YY8A 1USXA 2ZB5A 1EUTA 4XJRA 4UOUA 4GN7A 1B9TA 2IAQA 2W8BB 2FP8A 3VNHA 1INGA 4KS4A 2B8HA 3NO0A 5FWWA 3B7EA 1IUCA 4R40A 1EUUA 5CGJA 3P5BL 4K1HA 2W8BA 1V0EA 4CPLA 4NCSA 4ZLRA 1DILA 4D52C 1XOEA 1INVA 3K38A 1W20A 4MWRA 5GX5A 5FNQA 1N1SA 2DG0A 5FNSA 3WW9A 4BBWA 1W0OA 1ZI0A 4GDIA 1A4GA 1USRA 4GZWA 2FPBA 1N1YA 4AGIA 4HHOA 1IVBA 2W5NA 2ZWAA 1NPEA 2A75A 1V3DA 3TI8A 4I00A 3V64C 4B7NA 2VPJA 2JKBA 1SO7A 5JYYA 2F25A 1OFZA 1NSCA 2H2UA 4QN4A 2HQSA 4HZVA 4X47A 4KS3A 4SLIA 5GX2A 1MR5A 1S0IA 4B7MA 1U6DX 4UF7A 1W0PA 4XJQA 4CSDA 3TI4A 1NMAN 1Z4XA 5HUGA 5F72C 1IUBA 4MJVA 4MWXA 4MWLA 3Q6TA 4MWWA 1E8UA 3TI3A 4FPHA 2IARA 1SNTA 1NCAN 3AMRA 2FLUX 4HZYA 3FW0A 2IATA 2HT7A 4KS2A 1INFA 3S2KA 5D9BA 1W8OA 1N1VA 2VWDA 2ZW9A 1NNCA 1F8EA 4MWQA 4CPYA 1SLLA 3BEQA 3SALA 2YA8A 4B7QA 4FOVA 5FZJA 3GVJA 4YW3A 1F8DA 3HRPA 2SLIA 1NCDN 2ISMA 2VW0A 2POOA 1N6EA 2HTVA 3LI5A 1POOA 4XIKA 2AEQA 4CPZA 2GVWA 1XOGA 4HIZA 1A14N 3ZGDA 3V65B 1QLGA 3INBA 2ZB6A 4M4NA 1S1DA 3NSSA 1INXA 2QE8A 1MS9A 1NSDA 3L6VA 3W09A 1MS4A 2Z32A 5EX7A 2F10A 4L7DA 1NMBN 2ZZKA 3OPZA 1W8NA 4K1IA 2XZIA 1QBIA 4C1YA 3I1CA 3AMSA 4XHXA 2BF6A 1MS1A 3CYEA 2BATA 5H47A 1V2IA 6NN9A 2F24A 2QWAA 4M4UA 1NCCN 2OJHA 2VW2A 4FP3A 4FPYA 7NN9A 4IN4A 3SOQA 5D9CA 1S0JA 4XILA 3WN7A 4K1KA 3FVZA 4WEGA 4GZTA 2GVXA 1NMCA 2HTRA 4JF7A 2GHSA 3PJQA 4XE9A 4K3YA 1IVCA 5GX4A 4XMAA 4X49A 3LI3A 4QN3A 1V0FA 4IYGA 4GDJA 4FPJA 1X2JA 2F13A 3S8VA 2QWFA 4FPKA 5FNTA 4YZ5A 1IVDA 1Z50A 2QWBA 1L7HA 2SILA 2F28A 4HW6A 4FJ6A 2VK5A 1RWLA 2GVVA 1Z4WA 2XZJA 1IVEA 4MC7A 2DYHA 4N1BA 3SANA 4YZ3A 4FOQA 1K32A 3TICA 4AH4A 1X2RA 4YW1A 4GJTA 4ZY3A 1WCQA 4YZ2A 4CPOA 5D9DA 3ZGCA 1V0ZA 3KGGA 4XYXA 1INWA 1Z4YA 1IJQA 2IAUA 4IFJA 1VCUA 4NN9A 5HUNA 2VK7A 2W20A 3D11A 5B2DA 4WEFA 1E8VA 3SOVA 4FPLA 2IAPA 4QNPA 2XZKA 4CH9A 2P4OA 3K36A 4FPFA 4O5TA 3G4HA 5F9TA 2WOZA 1MS0A 2YDPA 2CMLA 2F26A 4XIOA 4M3MA 4GN8A 4X4AA 3CL0A 4FPEA 1NNAA 3SILA 2VAQA
chains in the Genus database with same CATH topology
3A9HA 2QE8A 5FWWA 1V04A 4R40A 5GX3A 2IAOA 3G4EA 3P5BL 2W8BA 3WWAA 3HLHA 5EX7A 4ZLRA 3SRGA 3Q6PA 1QBIA 3I1CA 2GVUA 3AMSA 5GX5A 2DG0A 3WW9A 2G8SA 2IAXA 1Q7FA 3SOBB 4GNCA 3U0SA 4HHQA 1PJXA 2DSOA 3S8ZA 2OJHA 4DG6A 3DR2A 2FPBA 1RWIA 3SOQA 4HHOA 5D9CA 1C5KA 1CQ1A 1NPEA 3V64C 3E5ZA 3SREA 1C9UA 4Q1UA 2FP9A 4GN9A 3Q6KA 3A9GA 3FVZA 4O5SA 2GVXA 3TC9A 2V91A 2GHSA 2HQSA 2FPCA 4GNAA 4JMLA 5GX2A 2IASA 3KYAA 5GX4A 3LI3A 2IAWA 4IYGA 2DG1A 1CRUA 3V1SA 3DASA 3S8VA 4IMBA 3S94A 4HW6A 1RWLA 2GVVA 3IAXA 3Q6TA 1CVMA 4A0PA 2IARA 3BYCA 3AMRA 1N7DA 1H6LA 3FW0A 2IATA 5D9DA 3S2KA 3KGGA 5D9BA 1IJQA 2IAUA 1CRZA 4GNBA 3HRPA 2ISMA 2POOA 4PWZA 3O4PA 3SOVA 2IVZA 3LI5A 2IAPA 1E1AA 5GX1A 1POOA 2P4OA 3HLIA 4O5TA 3G4HA 2IAVA 2GVWA 4GN7A 2IAQA 2W8BB 4GN8A 2FP8A 3LI4A 3V65B 1QLGA 2VAQA 5GTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9H A;  2QE8 A;  5FWW A;  1V04 A;  4R40 A;  5GX3 A;  2IAO A;  3G4E A;  3P5B L;  2W8B A;  3WWA A;  3HLH A;  5EX7 A;  4ZLR A;  3SRG A;  3Q6P A;  1QBI A;  3I1C A;  2GVU A;  3AMS A;  5GX5 A;  2DG0 A;  3WW9 A;  2G8S A;  2IAX A;  1Q7F A;  3SOB B;  4GNC A;  3U0S A;  4HHQ A;  1PJX A;  2DSO A;  3S8Z A;  2OJH A;  4DG6 A;  3DR2 A;  2FPB A;  1RWI A;  3SOQ A;  4HHO A;  5D9C A;  1C5K A;  1CQ1 A;  1NPE A;  3V64 C;  3E5Z A;  3SRE A;  1C9U A;  4Q1U A;  2FP9 A;  4GN9 A;  3Q6K A;  3A9G A;  3FVZ A;  4O5S A;  2GVX A;  3TC9 A;  2V91 A;  2GHS A;  2HQS A;  2FPC A;  4GNA A;  4JML A;  5GX2 A;  2IAS A;  3KYA A;  5GX4 A;  3LI3 A;  2IAW A;  4IYG A;  2DG1 A;  1CRU A;  3V1S A;  3DAS A;  3S8V A;  4IMB A;  3S94 A;  4HW6 A;  1RWL A;  2GVV A;  3IAX A;  3Q6T A;  1CVM A;  4A0P A;  2IAR A;  3BYC A;  3AMR A;  1N7D A;  1H6L A;  3FW0 A;  2IAT A;  5D9D A;  3S2K A;  3KGG A;  5D9B A;  1IJQ A;  2IAU A;  1CRZ A;  4GNB A;  3HRP A;  2ISM A;  2POO A;  4PWZ A;  3O4P A;  3SOV A;  2IVZ A;  3LI5 A;  2IAP A;  1E1A A;  5GX1 A;  1POO A;  2P4O A;  3HLI A;  4O5T A;  3G4H A;  2IAV A;  2GVW A;  4GN7 A;  2IAQ A;  2W8B B;  4GN8 A;  2FP8 A;  3LI4 A;  3V65 B;  1QLG A;  2VAQ A;  5GTQ A; 
#chains in the Genus database with same CATH topology
 4YW2 A;  2BZD A;  4D4U A;  1Z4V A;  1V04 A;  2IAO A;  2QWD A;  3G4E A;  5FNU A;  4B7R A;  1MS8 A;  2H2N A;  1F8C A;  2F29 A;  5M1Z A;  3Q6P A;  3CL2 A;  4GZX A;  4H53 A;  3O9K A;  1B9S A;  2GVU A;  4FPC A;  4MZA A;  4K1J A;  2VSK A;  2AGS A;  4XMI A;  2G8S A;  2IAX A;  1V3B A;  5FNR A;  3SOB B;  4GNC A;  3K3A A;  4HHQ A;  2HTQ A;  2HTY A;  4G3N A;  4M4V A;  5EO8 A;  3S8Z A;  3DR2 A;  1E8T A;  1RWI A;  1MS3 A;  1C5K A;  4D52 A;  2QWE A;  2QWI A;  4C1Y B;  1C9U A;  4MWY A;  4KS1 A;  4XJU A;  3TIB A;  4Q1U A;  3O9J A;  3Q6K A;  4GN9 A;  3UC1 A;  1MWE A;  1W21 A;  2FPC A;  4XJZ A;  2IAS A;  3KYA A;  1N6F A;  4YZ4 A;  1L7G A;  5EO7 A;  1NN2 A;  3H73 A;  1CRU A;  1MZ5 A;  2YA6 A;  3V1S A;  3DAS A;  2FHR A;  4IMB A;  1VCJ A;  3S94 A;  2QWJ A;  1SUU A;  1BJI A;  1W1X A;  4MJU A;  2SIM A;  3IAX A;  4KS5 A;  2AH2 A;  4CHB A;  3BYC A;  1S18 A;  4GZQ A;  1ZGK A;  1NSB A;  4XJA A;  1V3C A;  2YA5 A;  1NCB N;  1INH A;  3ADE A;  4QN5 A;  2HTU A;  2QWC A;  1IVG A;  4MX0 A;  2VK6 A;  1CRZ A;  4DGR A;  4HZW A;  2F11 A;  4CPN A;  4MWV A;  2VW1 A;  3T1E A;  4GEZ A;  4GNB A;  3A72 A;  1Z4Z A;  1E1A A;  3SLI A;  1WCS A;  5GX1 A;  4GZS A;  4WA3 A;  2QWK A;  3D12 A;  3CKZ A;  2IAV A;  3A71 A;  3TIA A;  4FP2 A;  4YW5 A;  3LI4 A;  4YZ1 A;  4XJW A;  1IVF A;  4B7J A;  5GTQ A;  4NC5 A;  4IQK A;  4QN7 A;  4HZZ A;  3A9H A;  4XHB A;  1INY A;  4XJ8 A;  5FZN A;  4L7B A;  1F8B A;  1N1T A;  3WDZ A;  4AGT A;  4AHA A;  5GX3 A;  4FZH A;  3HLH A;  3WWA A;  4CPM A;  3K39 A;  2F0Z A;  4XOG A;  3SRG A;  4WA5 A;  2RKC A;  3ALX A;  2HTW A;  2YDT A;  3B69 A;  3K37 A;  1NNB A;  1Q7F A;  2XN4 A;  3U0S A;  2C4A A;  5HUK A;  1PJX A;  4FOW A;  2DSO A;  4YW4 A;  4DG6 A;  3TI5 A;  1CQ1 A;  4WA4 A;  1V3E A;  2BER A;  4FOY A;  3E5Z A;  2VSM A;  3SRE A;  5NN9 A;  2FP9 A;  1MS5 A;  4L7C A;  3A9G A;  5HUM A;  4FPO B;  4MWU A;  4O5S A;  2W5O A;  4ASC A;  3TC9 A;  2QWG A;  4H52 A;  2V91 A;  4FPG A;  2F12 A;  2HT5 A;  4GNA A;  4JML A;  2F27 A;  1MZ6 A;  2IAW A;  4D52 B;  2DG1 A;  2HU4 A;  5HX0 A;  1B9V A;  2X9M A;  4GZP A;  4D8S A;  4MWJ A;  1N6D A;  4FQ4 A;  1WP5 A;  1A4Q A;  4HZX A;  1L7F A;  3GVK A;  4FVK A;  4ZGC A;  1CVM A;  4A0P A;  1N7D A;  1KIT A;  1DIM A;  3TI6 A;  1H6L A;  4X6K A;  3ALW A;  2VVZ A;  4GZO A;  4Q6K A;  2HU0 A;  2YA7 A;  1SLI A;  2QWH A;  2W38 A;  3GVL A;  3VNG A;  4GB1 A;  2YA4 A;  4IFN X;  2HT8 A;  3NN9 A;  1EUR A;  4IFL X;  3H6J A;  4J9T A;  3H72 A;  5B2C A;  2XCY A;  3II7 A;  4QN6 A;  3JU4 A;  2C4L A;  2AEP A;  3O4P A;  4PWZ A;  4XMB A;  1EUS A;  2IVZ A;  4XJ9 A;  3H71 A;  3HLI A;  4MZE A;  4YY8 A;  1USX A;  2ZB5 A;  1EUT A;  4XJR A;  4UOU A;  4GN7 A;  1B9T A;  2IAQ A;  2W8B B;  2FP8 A;  3VNH A;  1ING A;  4KS4 A;  2B8H A;  3NO0 A;  5FWW A;  3B7E A;  1IUC A;  4R40 A;  1EUU A;  5CGJ A;  3P5B L;  4K1H A;  2W8B A;  1V0E A;  4CPL A;  4NCS A;  4ZLR A;  1DIL A;  4D52 C;  1XOE A;  1INV A;  3K38 A;  1W20 A;  4MWR A;  5GX5 A;  5FNQ A;  1N1S A;  2DG0 A;  5FNS A;  3WW9 A;  4BBW A;  1W0O A;  1ZI0 A;  4GDI A;  1A4G A;  1USR A;  4GZW A;  2FPB A;  1N1Y A;  4AGI A;  4HHO A;  1IVB A;  2W5N A;  2ZWA A;  1NPE A;  2A75 A;  1V3D A;  3TI8 A;  4I00 A;  3V64 C;  4B7N A;  2VPJ A;  2JKB A;  1SO7 A;  5JYY A;  2F25 A;  1OFZ A;  1NSC A;  2H2U A;  4QN4 A;  2HQS A;  4HZV A;  4X47 A;  4KS3 A;  4SLI A;  5GX2 A;  1MR5 A;  1S0I A;  4B7M A;  1U6D X;  4UF7 A;  1W0P A;  4XJQ A;  4CSD A;  3TI4 A;  1NMA N;  1Z4X A;  5HUG A;  5F72 C;  1IUB A;  4MJV A;  4MWX A;  4MWL A;  3Q6T A;  4MWW A;  1E8U A;  3TI3 A;  4FPH A;  2IAR A;  1SNT A;  1NCA N;  3AMR A;  2FLU X;  4HZY A;  3FW0 A;  2IAT A;  2HT7 A;  4KS2 A;  1INF A;  3S2K A;  5D9B A;  1W8O A;  1N1V A;  2VWD A;  2ZW9 A;  1NNC A;  1F8E A;  4MWQ A;  4CPY A;  1SLL A;  3BEQ A;  3SAL A;  2YA8 A;  4B7Q A;  4FOV A;  5FZJ A;  3GVJ A;  4YW3 A;  1F8D A;  3HRP A;  2SLI A;  1NCD N;  2ISM A;  2VW0 A;  2POO A;  1N6E A;  2HTV A;  3LI5 A;  1POO A;  4XIK A;  2AEQ A;  4CPZ A;  2GVW A;  1XOG A;  4HIZ A;  1A14 N;  3ZGD A;  3V65 B;  1QLG A;  3INB A;  2ZB6 A;  4M4N A;  1S1D A;  3NSS A;  1INX A;  2QE8 A;  1MS9 A;  1NSD A;  3L6V A;  3W09 A;  1MS4 A;  2Z32 A;  5EX7 A;  2F10 A;  4L7D A;  1NMB N;  2ZZK A;  3OPZ A;  1W8N A;  4K1I A;  2XZI A;  1QBI A;  4C1Y A;  3I1C A;  3AMS A;  4XHX A;  2BF6 A;  1MS1 A;  3CYE A;  2BAT A;  5H47 A;  1V2I A;  6NN9 A;  2F24 A;  2QWA A;  4M4U A;  1NCC N;  2OJH A;  2VW2 A;  4FP3 A;  4FPY A;  7NN9 A;  4IN4 A;  3SOQ A;  5D9C A;  1S0J A;  4XIL A;  3WN7 A;  4K1K A;  3FVZ A;  4WEG A;  4GZT A;  2GVX A;  1NMC A;  2HTR A;  4JF7 A;  2GHS A;  3PJQ A;  4XE9 A;  4K3Y A;  1IVC A;  5GX4 A;  4XMA A;  4X49 A;  3LI3 A;  4QN3 A;  1V0F A;  4IYG A;  4GDJ A;  4FPJ A;  1X2J A;  2F13 A;  3S8V A;  2QWF A;  4FPK A;  5FNT A;  4YZ5 A;  1IVD A;  1Z50 A;  2QWB A;  1L7H A;  2SIL A;  2F28 A;  4HW6 A;  4FJ6 A;  2VK5 A;  1RWL A;  2GVV A;  1Z4W A;  2XZJ A;  1IVE A;  4MC7 A;  2DYH A;  4N1B A;  3SAN A;  4YZ3 A;  4FOQ A;  1K32 A;  3TIC A;  4AH4 A;  1X2R A;  4YW1 A;  4GJT A;  4ZY3 A;  1WCQ A;  4YZ2 A;  4CPO A;  5D9D A;  3ZGC A;  1V0Z A;  3KGG A;  4XYX A;  1INW A;  1Z4Y A;  1IJQ A;  2IAU A;  4IFJ A;  1VCU A;  4NN9 A;  5HUN A;  2VK7 A;  2W20 A;  3D11 A;  5B2D A;  4WEF A;  1E8V A;  3SOV A;  4FPL A;  2IAP A;  4QNP A;  2XZK A;  4CH9 A;  2P4O A;  3K36 A;  4FPF A;  4O5T A;  3G4H A;  5F9T A;  2WOZ A;  1MS0 A;  2YDP A;  2CML A;  2F26 A;  4XIO A;  4M3M A;  4GN8 A;  4X4A A;  3CL0 A;  4FPE A;  1NNA A;  3SIL A;  2VAQ A; 
#chains in the Genus database with same CATH homology
 3A9H A;  2QE8 A;  5FWW A;  1V04 A;  4R40 A;  5GX3 A;  2IAO A;  3G4E A;  3P5B L;  2W8B A;  3WWA A;  3HLH A;  5EX7 A;  4ZLR A;  3SRG A;  3Q6P A;  1QBI A;  3I1C A;  2GVU A;  3AMS A;  5GX5 A;  2DG0 A;  3WW9 A;  2G8S A;  2IAX A;  1Q7F A;  3SOB B;  4GNC A;  3U0S A;  4HHQ A;  1PJX A;  2DSO A;  3S8Z A;  2OJH A;  4DG6 A;  3DR2 A;  2FPB A;  1RWI A;  3SOQ A;  4HHO A;  5D9C A;  1C5K A;  1CQ1 A;  1NPE A;  3V64 C;  3E5Z A;  3SRE A;  1C9U A;  4Q1U A;  2FP9 A;  4GN9 A;  3Q6K A;  3A9G A;  3FVZ A;  4O5S A;  2GVX A;  3TC9 A;  2V91 A;  2GHS A;  2HQS A;  2FPC A;  4GNA A;  4JML A;  5GX2 A;  2IAS A;  3KYA A;  5GX4 A;  3LI3 A;  2IAW A;  4IYG A;  2DG1 A;  1CRU A;  3V1S A;  3DAS A;  3S8V A;  4IMB A;  3S94 A;  4HW6 A;  1RWL A;  2GVV A;  3IAX A;  3Q6T A;  1CVM A;  4A0P A;  2IAR A;  3BYC A;  3AMR A;  1N7D A;  1H6L A;  3FW0 A;  2IAT A;  5D9D A;  3S2K A;  3KGG A;  5D9B A;  1IJQ A;  2IAU A;  1CRZ A;  4GNB A;  3HRP A;  2ISM A;  2POO A;  4PWZ A;  3O4P A;  3SOV A;  2IVZ A;  3LI5 A;  2IAP A;  1E1A A;  5GX1 A;  1POO A;  2P4O A;  3HLI A;  4O5T A;  3G4H A;  2IAV A;  2GVW A;  4GN7 A;  2IAQ A;  2W8B B;  4GN8 A;  2FP8 A;  3LI4 A;  3V65 B;  1QLG A;  2VAQ A;  5GTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...