3IAXA

The crystal structure of the tolb box of colicin a in complex with tolb reveals important differences in the recruitment of the common tolb translocation portal used by group a colicins
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
399
structure length
399
Chain Sequence
DSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein tolB
publication title The crystal structure of the TolB box of colicin A in complex with TolB reveals important differences in the recruitment of the common TolB translocation portal used by group A colicins.
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 399
sequence length 399
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3iaxA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 3iaxA01
3G4EA 2IAPA 1QLGA 5D9CA 2POOA 5GX4A 4O5SA 3S8VA 1POOA 2DSOA 2FPCA 3FVZA 4HHOA 4Q1UA 4DG6A 5GX3A 2GVVA 3SOVA 1CRUA 2IAUA 2V91A 2P4OA 2VAQA 4IMBA 2IAWA 4GNCA 3V64C 1RWIA 3SRGA 2IAXA 3LI3A 3P5BL 1C5KA 2IAOA 2IAQA 3BYCA 3O4PA 2IAVA 3HLHA 2IATA 3A9GA 3G4HA 2ISMA 4HHQA 2DG1A 2GVXA 2GVWA 3Q6PA 3S2KA 1RWLA 2IASA 5FWWA 2FP9A 3AMSA 4JMLA 3V1SA 3SREA 1CRZA 2GVUA 3WW9A 4IYGA 3KYAA 2W8BA 2IARA 4R40A 3U0SA 4A0PA 4GN8A 3HRPA 3FW0A 1Q7FA 4GN9A 1CVMA 1E1AA 3Q6TA 3HLIA 4O5TA 3V65B 1IJQA 3SOQA 3SOBB 3LI5A 5EX7A 5GX1A 1C9UA 4GN7A 2FPBA 3KGGA 3Q6KA 3TC9A 4PWZA 2G8SA 1H6LA 2HQSA 2DG0A 2IVZA 4GNBA 4ZLRA 2FP8A 3I1CA 1N7DA 1V04A 3DASA 1QBIA 3LI4A 5GX2A 1NPEA 3A9HA 5D9BA 3AMRA 2QE8A 2OJHA 5D9DA 1PJXA 3DR2A 4GNAA 3E5ZA 3S94A 3S8ZA 3WWAA 1CQ1A 2GHSA 5GTQA 4HW6A 5GX5A 2W8BB 3IAXA
chains in the Genus database with same CATH superfamily
1JIIA 2FW7A 1EFRA 4MKGA 5EIEA 4PPFA 3ILYA 5CFPA 1ICEA 1YQUA 2DKNA 3KKKA 4UOQA 1HL7A 1INFA 2PFSA 1T0UA 1X94A 3JALA 1ONPA 3CINA 4HHOA 5I9BA 2NZWA 3TNFA 4D97A 1Z4JA 3HYCA 2REQB 3NTRA 5DTEA 5KQGA 2C8JA 4MRMB 3N2NA 3BCUA 1VRWA 2YOFA 4K05A 2ODPA 4QJBA 2H6EA 1GR1A 1WZCA 4CKWB 1E5TA 3C6QA 3WRVA 2Y4NA 3A72A 2J6HA 2ORWA 5I7EA 5D1HA 3ZGYA 3FRIA 4C03A 1N92A 1ZGHA 3PWZA 3A1FA 4IIHA 5PNTA 2XBMA 3BAZA 5C1PA 2TSYB 1AJEA 4IV5A 1LRLA 3CZRA 4ZPJA 3RRXA 4I19A 2R8PA 3QIAA 4CTMA 2WUDA 4HATA 1X2BA 2DX7A 2J46A 2V3WA 2WOJA 1J97A 3FB1A 4U0JA 5BW4A 3F47A 1M2HA 2NPFA 5AOCA 2DWPA 2ZJZA 3RRZA 4D5EA 1T5OA 1FFCA 1U9JA 4CH9A 4JUBA 1UJ5A 2VS1A 3URMA 1NC3A 4HR7A 5E0OA 3RVKA 2R97A 3L92A 1FRVA 2JLWA 5CX1B 4DY4A 4GPBA 2R6JA 1Q3KA 4I3HA 4EMTA 4NK5A 2IOFA 2REBA 3WI7A 4MW0A 3LC2O 4CXMA 3X1KA 1IQRA 4ZYLA 4JB0A 3PL1A 4UMEA 2F0ZA 2PYIA 4B35A 4RSMA 1GIAA 4ZEMA 2HBZA 3GLVA 3G1UA 4F4UA 3DC7A 3FFWA 3JAKA 5DHFA 1PYGA 1OXVA 3AIIA 4FWTA 1A4IA 3VDRA 4Z2YA 1TJPB 1QSGA 1A97A 4ZEWA 4Q3OA 4A15A 2RHWA 2DFTA 1G63A 1ZCZA 3KSZO 4EOGA 3KR1A 3CL0A 3GRPA 3WJ2A 3G1TA 3CVXA 1TU4A 1QHHB 3FNFA 1VCOA 2PJUA 4EUEA 3NJ8A 3ORQA 4J0CA 4WCDA 1ZM7A 5FPPA 4X1IA 4EG7A 2B7CA 2RHBA 3QKSB 4M22A 2VK1A 1N3YA 1TTHA 1ZN7A 4KR3A 1GAXA 1M2KA 2FUNB 1IUOA 2BDUA 3AHCA 3VHXB 3WNDA 2NZJA 3W7VA 4XB2A 3D6NB 3PNMA 4KR2A 2WIDA 3HVUA 1MZ6A 1CW2B 3DHYA 2V3CC 3GN2A 3FDZB 1YBHA 2A9PA 3R6WA 2NX2A 1A8HA 4MWDA 4EUNA 2X1HA 4RPHA 1HE3A 1T1RA 3LT4A 3QFSA 2ARKA 3QH4A 2FP8A 1E9BA 4H0CA 4LYDA 3ADPA 4IIJF 1EUCB 5BR4A 4RADA 1E94E 4NPCA 5LMNB 1I6KA 1XVAA 4ZCSA 1P18A 4MKXA 4KRFA 3CMMA 3A32A 3DAPA 4UDOA 1Q22A 2XBUA 4CMHA 5CHYA 3R9XB 3HYTA 2QM7A 1Z38A 3F9IA 4A8JA 3DLIA 4QIHA 5D7BA 3AESB 4B6OA 4W6QA 3ROKA 3OM9A 3ELBA 3GJ7A 1QHIA 2CLHB 1Z37A 4H60A 4LDRA 1LSOA 1ND5A 4OQFA 5EI5A 4ZJUA 4JSYA 1WUKS 1YUNA 4FJ0A 4D4JA 3ZE7A 3WBFA 4E5SA 4FVKA 5K8IA 2V03A 2CDRA 5HW0A 4PCAA 2O1SA 4PQYA 3ZQKA 3KQTA 5JZ9A 4M0MA 3WLIA 3ILVA 5DP2A 1LPOA 3E9EA 4RMJA 2WZQA 4LX0A 1ZGGA 2O5VA 1T1IA 3HPQA 4TMKA 4WGGA 5JNVA 3CVUA 3D7LA 3JYLA 1RPTA 1HT1E 4LRUA 3NH6A 4KTVE 3T4XA 3V8QA 3HVJA 2XMGA 2GUWA 3DZGA 3MT7A 3PYXA 1WPQA 4HDSA 4N0MA 5KHOC 5L4NA 3HXMA 1B3BA 2QSJA 4WXMA 1TMKA 1JHYA 5J2TF 2CLOB 2P78A 4PZCA 2ZTSA 4ZZ3A 2JI4A 1USVA 3ZCTA 4R1QA 3IT0A 1UL1X 2ZKIA 3WIVA 2IHYA 2CF5A 2W2LD 3A9UA 1W5AA 4C0KA 4EZEA 1R50A 4ALLA 1JI0A 1PJQA 5JD3A 1YL7A 1LBSA 2AX3A 3L8FA 3O92A 3RIEA 1ISRA 4AWAA 4CFZA 4I2VA 3GA7A 4DV5B 1M2OA 3K1JA 3TIIA 3AVOA 5IEJA 3SWWA 2EW8A 1U8TA 2QORA 1AV7A 1K4MA 2P4EA 1YZYA 3PHBE 4QFCA 3EEIA 4IDQA 2JFVA 1MFPA 2NN3C 4G5QA 1E3SA 3UVEA 5A5GA 5HKKA 1C41A 4URXR 1U04A 2QE6A 2V96A 3FPKA 4MR8A 4UUNA 1U1EA 4KMRA 3NGLA 1WCQA 3E4DA 2BRUA 4RYDA 4AXXA 2ZJ7A 2E4WA 3FMPB 3ZI0A 4WY2A 3BN3A 1X7YB 2KLHA 4PR0A 5FR2A 4JQYA 4KN9S 1R0SA 3W4IA 5C52B 4J9TA 1LK7A 4I8DA 1PV2A 4KFRA 1XU4A 4QT4A 3AKEA 1BX0A 1X1QA 2NIPA 2ENWA 4M8LA 4BZQA 3GUZA 4IYGA 2Z56A 4YAOA 3UA4A 3WTCA 4QSMA 1GLNA 3B9QA 4LQCA 4QXMA 3RVBA 3EXEB 4KFCA 1E2EA 3P2EA 1XLTC 5JI2E 2XVAA 2OHOA 5EFZA 3W34A 3ZTYA 4E6PA 4F84A 2XUFA 2I1LA 3BWXA 4TSRA 1O5OA 2ISCA 1R8QA 1ML3A 1N6LA 5AYVA 1V2HE 4XLZA 3USZA 4DR3B 1PL8A 1EJ6A 1LWOA 3NBYC 4LRTB 4EB3A 5K20A 2F3UA 4CU2A 5BOSB 4HNTA 2ECOA 3HZHA 3IERA 3EC2A 3WWOA 4OOEA 1LDNA 1TYBE 2VPYA 4MGEA 1RQGA 2IRWA 4QELA 5FNZA 3UWKA 1VC2A 2Q41A 3TJMA 3JD4A 2C58A 1SUCA 2G9QA 3KJXA 1QO0A 4BNMA 4D1YA 3GRZA 3QNUA 3P2KA 4CPYA 4DM4A 3U2QA 1BVUA 2XCUA 5CXSA 1HWYA 1L8XA 2OAQ1 3HQ4O 3QYAA 1M3SA 2AOUA 3T1NA 5LKRA 2EGUA 3B53X 4G4JA 4YVFA 1AHNA 3PJEA 3KOMA 3NV9A 3G3EA 2GZ3A 3U3DA 3NJ4A 1S0JA 3DE0X 4JP1A 4BLWA 1DPGA 4CKCB 5HYVA 3VKGA 3I3SR 4FYKA 4DR1B 1YI1A 3CMCO 2E0IA 2EQ5A 3N74A 4JD5A 2HBQA 3FSJX 4PONA 2ZSAA 3KJEA 5EWMA 3IQDB 2HIMA 1UCFA 3LW8A 1ODSA 3GZNA 1TI7A 1EWRA 2R6AA 5MF6A 5AKXA 2OZLA 4ZVKA 4RL6A 3O31A 5KVCA 1A82A 1WMEA 4L02A 1CHDA 3VR5H 3JQBA 4M89A 1EG2A 5CH3A 2Q8PA 2BPOA 2WHYA 5L9AA 2W8BB 2VF8A 4I6EA 4HS4A 3CX7A 3FWHA 2V7GA 3PVSA 5T41A 1KNQA 4IP0A 3O9JA 3ROZA 3RROA 4OK5A 1G5QA 5K3EA 4UNRA 4DNQA 4Q7MB 3MPOA 3WP0A 5TY0A 5KX5B 1FLNA 3QE9Y 1WY7A 4DPMA 2V65A 4LHEA 3BDAA 3HA5A 4EKGA 2ZR0A 4X66B 1F1JA 2H4HA 2GJAA 3KB6A 1IRXA 3KOOA 4CM1A 1OZAA 7YASA 1ORRA 1QB7A 3ESDA 4MITA 1HDOA 3MWDB 4PLPA 5DNAA 3B52X 4RY8A 3DFZA 1FQKA 1MOQA 1JPJA 4F4JA 3VPHA 3RC1A 1EHYA 1ZSYA 1D0SA 4YXWD 2DKFA 4G1VA 1T34A 2WJAA 3AHIA 5TJ9A 8GPBA 1E9FA 1DXQA 3VZQA 5K0ZA 3KS9A 3TTTA 3UJ6A 2C4AA 3NRJA 5TF4A 5CFRA 1KO5A 5D00A 4ZEXA 5IH7A 2B4QA 2O1EA 3B20A 1INLA 4K6GA 4WEQA 4XUEA 3G2QA 2IATA 1WCXA 4FMCF 2XITA 5JFOA 4TN1A 4R54A 4AKHA 2ISMA 1M0SA 1CR2A 1RWLA 3V1SA 1J0DA 4JH0A 4XIFA 2JLUA 5BSHA 3SYNA 2QB5A 2KWIA 4PHFA 1VIVA 3TL6A 4AP5A 2FPRA 2GZSA 1YFJA 4MQFB 5EJFA 3B89A 4Q1VA 3ICCA 3ZOKA 3PB3A 1ZGZA 4QN3A 1GXSA 3DTTA 2YA5A 2JIQA 1DEXA 3IRUA 4BO5A 5REQB 5DKFA 3TLKA 1CJCA 1SWVA 3SYLA 4G3XA 4ARVA 3QWAA 4Y0NA 3ASVA 1JDVA 1R4ZA 4V0QA 3IMGA 2CKMA 3VHQA 4S05A 3W5JA 1FU4A 1NNSA 3G7SA 4LS3A 3I2GA 4NONA 2O5EA 2JC3A 3RWBA 5IJ0A 1EK1A 3HB7A 5E0KB 3FGPA 3VR6D 1QVWA 1TAQA 1KJZA 4KE8A 4A16A 1FTQA 1U1DA 5GX1A 3DEKA 3ZY4A 1BGVA 5GGXA 3ZE1B 5JCXA 4P3OA 3M2PA 4GMHA 1NZFA 2X9MA 3T5CA 2HWWA 1WDLA 2FPSA 3FYTA 3S40A 5K45A 4GO1A 2QU8A 4M86A 2YN4A 2HPHA 3BCHA 1QF7A 3X1YA 2PUTA 4L4RA 4UHCA 4DRYA 1KO1A 2QWGA 3Q8LA 3IYLW 1YR9A 1GCUA 4IGAA 2FRDA 5FNSA 1U8ZA 2ATEA 3L3BA 3MN1A 2CSXA 3AVVA 2XA1A 2JCSA 1FYDA 5HIJA 4CR7A 3A06A 4KLCA 3EXHC 3FCAA 4NE2A 3KQMA 3T1VA 1QDEA 1IFXA 1PSWA 1VTKA 4EHBA 5EJEA 1X1TA 5DCUA 3KSBC 1O0CA 3FTFA 2LW7A 4B32A 1XD9A 1NFQA 1XF1A 2J9XB 4K86A 4B5LA 5KEIA 1IXYA 3VUFA 1Q0HA 1XRLA 4H18A 4G5GA 5BYKA 1EQAA 4ZVRA 4EEKA 5AVRA 3FBTA 1SQ6A 2Y4OA 5BWMA 4GM1A 3UXHA 2XCTB 1TM1E 1RWOA 4QGHA 5JJKA 2G72A 1KEEA 1V1JA 3AI1A 2AI2A 1GU7A 1QPGA 3PE6A 4QX6A 3QI7A 3WHKA 2O8DB 1A1SA 4QBHA 1R3DA 5DN6A 2QXYA 1JSRA 1QKIA 1XMOB 2ZDGA 3VHRA 3UHAA 1W0PA 4NENB 4OJMX 1RMTA 4DRXB 3MS7A 4A6EA 1LPNA 4WNAA 4HH4A 1LC3A 4PBSA 2GCOB 1AUOA 3C43A 3PS9A 2VYVD 4MVJF 2MSLA 4QHYA 3K1AA 2F00A 5HM6A 1A9TA 1GZ5A 5L3QA 4B33A 5KTNA 5A3QA 2QN1A 2FGJA 1M6HA 4FFDA 1DRVA 3FWYA 1L5WA 1F8CA 3C3WA 3WGUA 4ENTA 5KNDA 1AO3A 3R8FA 1JT2A 4IKEA 5I9TA 2JRCA 3HEBA 2OV8A 3BF8A 4LJYA 4V2UA 3I37X 4Z1MD 3AL3A 4TV8F 3EGVA 3LL4A 2VW2A 4J7UA 1D2MA 4YDRA 1KAMA 1N1TA 5F73A 1K2VN 3E9NA 3NC0C 4DLAA 4AZTA 1P2TA 2V91A 2P8JA 2V7WA 2YUIA 3HB1A 4L7QA 1IOVA 4YQZA 1ARZA 1XKQA 1WV0A 1RXCA 2YYSA 3OE4A 4KOAA 1QMGA 4O08A 4TLEA 3OP4A 3AXTA 5CW2A 1KE2A 2IYSA 2YDTA 2GNPA 3BKWA 3CG4A 3VVCA 2GN8A 3HDJA 4G0WA 3PWTA 3HMQA 3MLAA 1YR6A 3KJFA 1KJ8A 1RLOA 1E0JA 4WZZA 4MQ4A 2HLDA 1QKKA 1MB0A 3FMVA 2TMYA 3NOOA 4LZWA 4O2AB 3K38A 2WPDD 3SSMA 4EFNA 3HCDA 2I6FA 1L7XA 2GVWA 5M2QA 4M1KA 4J49A 2JGDB 3RU3A 1BDBA 1POXA 1PLKA 4IQKA 2PEZA 4E15A 1CUDA 2F17A 4ZT3A 1TKAA 3S55A 3S70A 3E5RA 2AXPA 3SREA 3PQ3A 2FPPB 3Q72A 3VU9B 4UHJA 2O8FA 5CK4A 1W36C 4JASB 4TXNA 4UU1A 2BC9A 3JQCA 2JHCA 2UUPA 3DDZX 1ORIA 5LD2C 1MG0A 3G1WA 4US1R 5DU2A 1L4NA 1A88A 1C3XA 2ZI6A 2V4MA 1U9CA 1T4CB 2HSGA 2M6RA 2Z5FA 4WE3A 3WJ7A 3E1GA 4YRNA 4B3CA 5DK4A 3PI7A 4IGEA 1EM8A 1MO3A 1TPZA 4MA4A 1U7UA 2YY6A 2N0SA 4HWSA 3E35A 3V80A 1Y0BA 4HPJB 2PWZA 1CS4C 2VAPA 2GAAA 3C0KA 3FFBA 4ZY3A 2ZSFA 3NLLA 3ZDFA 3VQTA 1QJ4A 4QU9A 3ONVA 1B6SA 2CFRA 1COWD 1HT0A 3L7DA 4FNMA 1NMBN 4GLBA 2AC7A 4P4LA 1MH9A 4AIRA 4BO2A 5JTTA 3NANA 2ZAMA 4A2WA 3K1YA 3CV3A 3QTTA 4W7SA 2AOWA 3PA6A 4P22A 4TWZA 5AUQA 4DMMA 3JVIA 3GX1A 1X9IA 2UXCB 3W06A 1PL0A 3DZDA 4WLVA 4ZANA 4LUCA 3I1CA 4MB0A 3HKDB 1YUBA 3HRHA 5BXYA 4TQ9A 3AVQA 4UM8B 5CH8A 5FBHA 1GKYA 2ZIUB 4ZAVA 3SF8B 3QM1A 4GDMA 2NT3A 5E9JA 3TSAA 1NBMD 3CH6A 1XG5A 4KL8S 2X0DA 1ECPA 1M9NA 1O6FA 1QG0A 3MJDA 4MVJD 3U4AA 1UDRA 2GF2A 2V45A 3CWCA 5CT4A 8ABPA 4Z4HA 4BE9A 4QDOA 1LDMA 3T3IA 4EO4A 5SICE 2C7RA 4RENA 1Y6RA 2NO4A 1YXMA 3F7MA 2OXFA 2GVZC 1BSVA 3CN7A 1A04A 2OV4A 4QICA 5IZCC 2QE7D 1DTEA 4E08A 1EQ2A 1YWGO 3FCUB 3LK6A 4CIDA 1L4UA 2CD9A 4W5NA 1IZYA 1W0KA 4GYKA 4P0PB 5BSRA 2QRLA 2QJOA 4MYRA 1POOA 2A4MA 3PI6A 1L5HA 2HTYA 2KE5A 2SCUB 5KC8A 4IOMA 4RZHA 2Q4RA 4DWWA 3K5WA 3OU2A 2BEWA 3AP1A 1E2QA 4BMZA 1WABA 4YW3A 3K1TA 5LOVB 4TYWA 3DDWA 1E8UA 1JR4A 1PFWA 4L6CA 4KS2A 1KHTA 1PF7E 2RK4A 4U7PB 4GKVA 4K8RB 5JO9A 2IWHA 2IYZA 4N3AA 4UUAA 5EGNA 5BMVA 5I7FA 1EP3B 4CPMA 4JJAA 2FEAA 4LXUA 3NG1A 4HCJA 1OA0A 4YRTA 1BWPA 1UT6A 2JHPA 4KIGA 4OGGA 1TQHA 2R5NA 1FMLA 4REOA 1JQBA 1XCPA 3CLHA 1Y1RA 3IKMB 1C7IA 3QK7A 2CGEA 4IH4A 3HLYA 4P7KA 1SVNA 3VZSA 1JIUA 5JATA 4Q4DA 3EZ9A 3ZWCA 2C2YA 3PIIA 4JI8B 1GA1A 4DA7A 2C77A 2ZAYA 4JBNA 2CC2A 5C1DA 1CETA 3RQIA 2VN8A 1X77A 3KM0A 4LJ4A 5BUSA 3M82A 4UM5A 1KI9A 2WTEA 2F9MA 2XT9A 1RWBA 4YFYA 1Z4ZA 3IKVA 3L6OO 3SOPA 3LP5A 3T54A 1Q1BA 2ETVA 3IBGA 3GZJA 1Q6YA 2PANA 3D4IA 3P4XA 3TLGB 1GFWA 2HWUA 3VI4B 3TCXB 3OQBA 3G6KA 3V4PB 3TJZA 3BVPA 1GZ7A 5FV7A 4L7VA 4J91A 3CZPA 4UULA 3OT5A 3JD1A 3BJEA 2JB9A 3T1HB 1QZTA 4LPKA 1O57A 3SD7A 4C0SA 5LLDA 2YJ5A 3QPBA 5C53B 2DY1A 3EFBA 4FSDA 4IUYA 2J3IA 4O4JB 5TPZD 3ENVA 1DVRA 3IDQA 4Q9HA 3RVSA 3WRYA 4PANA 4F9EA 2I3ZA 3E9YA 2VP6A 3DH0A 5JH7B 4I1PA 2UUOA 1HYQA 3MBKA 4H1HA 2H07A 4IBOA 4IMPA 4XB6B 3RANA 1YC5A 1R2QA 4Q7EA 4XYBA 4PZEA 5C51B 2ZROA 2MSWA 4Q0MA 2X8LA 4WK0B 4FQ5A 3BZBA 1W2HA 1VHDA 1FFAA 1PR0A 3K4PA 1CJMA 2CB0A 2JFWA 1KJJA 4OYRA 1Z0AA 2XTZA 4P08A 4KQ6A 1AS0A 3ZDRA 5BR1A 1OAOA 2RHOA 4REQB 4RKFA 3VO2A 2PUCA 1N5LA 2VSMA 3NBAA 4RM3A 1SXPA 3UT5A 4PWZA 4OAQA 4MYDA 1C1XA 5DBHX 5EE9A 3KYIB 3DBLB 3TLBA 3MHTA 2IY8A 4HEQA 4RIEA 4D43A 5F3WB 1U9ZA 2FN9A 2PX0A 3UK1A 1YV9A 1U8YA 2YASA 3E7PA 1M2OB 4WK4B 2WIKA 2QLLA 1IK6A 2XQIA 4A92A 1QIHA 4GYJA 2P3OA 4F6RB 1F0KA 5DIFA 4F4IA 3SDBA 1Z5NA 3SR4A 5EXTA 4QLOA 3V4VB 1UJ4A 1GRRA 2FZGA 3DC2A 3D4BA 4S1TA 4XQGA 4C6TA 4AY6A 4MR8B 2HLHA 2K7ZA 1NW8A 1N0HA 2XXJA 3RSQA 3UJDA 4AZ0A 5ICCA 4GM0A 4YJ3A 8OHMA 2GASA 1ATIA 1YQXA 2ENUA 3TE7A 3HSSA 1X9GA 1SB8A 1NVKA 3GR6A 2ZBFA 5A9SA 1DC6A 1UBGA 4UM7A 2BH9A 3FNGA 3AT1A 1ISJA 4RW0A 4NCNA 4P80A 2OM2A 2XDQA 1J2RA 4FJ1A 2VL7A 2QTBA 3W9BA 4Q19A 4AQYB 4PAWA 1ULAA 3WGNA 1YMUA 4YK7A 4RGVA 3C7DB 3HA7A 4CMKA 5A9TA 1V25A 4P84A 4F7DA 4PX3A 1XTIA 2YV2A 4Z1OA 3IV9A 1G20A 3NDJA 4N76A 1XMQB 1VFPA 4IXMA 3TI6A 2WMNB 5H83A 1DBWA 3WFJA 3EIEA 1QAMA 3B8EA 3EA4A 4QEZA 4KQIA 2IZ6A 5IWAB 1W2WB 3BRCA 3CEJA 3DKIA 1DIOB 3E2MA 3IELA 3OZDA 5FI5A 5GJCA 3UXEA 4HN4B 4JT4A 3RPEA 1IM8A 2FRXA 4HDRA 1RI1A 1GTZA 2BJWA 1NNCA 4D46A 1ZAKA 2PMKA 1AG9A 2QTCA 1YZLA 4KKXB 4RVUA 4WZBB 4D0LB 4HDMA 4NBSA 5A6VA 1EFPA 3JQ8B 3KXKA 2L2QA 3GYBA 5DEIA 3UOAB 1DQPA 1M2VA 4C0JA 2AOUB 3IEVA 2O0LA 1G16A 3ZZNA 3L8EA 3M4XA 3KKQA 1Y89A 4IUBS 2VJAA 3R3VA 3LY7A 2ZS8A 3BBPA 2CZQA 5FJJA 5JHHB 2FX5A 4CHGA 4IOKA 1HY3A 1KK2A 4FS8A 4YMUA 4F9TA 5EXPA 3CKLA 2HT7A 4YRFA 2J31A 2PS9A 1S89A 3RARA 1N5KA 5EWMB 5MN4A 4JJ4A 5DXAA 2W5NA 3O1JC 4RY9A 2IHVA 1OFTA 5MGBA 3A1NA 4C05A 3PD0A 3BE8A 5D5PA 1DELA 3SEAA 3UMYA 1K2WA 2ZRCA 5TMBA 1NMZA 1JBKA 3AEYA 3BTSA 4BTVA 1QRRA 1A77A 2QLMA 1AA9A 3HI6A 5A02A 2YZMA 2XVYA 4ZRMA 1AK1A 2R0QC 2F8TA 4FU0A 1ZM4A 4N82A 1Z3CA 2NQ8A 3AJEA 4P93A 1GARA 2WWIA 1TEHA 4IGIA 5I4BA 3NT5A 4RH1A 5DHPA 1GKKA 1QFXA 5EJ6A 1TT5A 3FVVA 2DLDA 1QRSA 2UZAA 4ZV7A 4IHJF 3LQ1A 3CU5A 3E2PA 3KVRA 4CL8A 3V3TA 1W5FA 1LCIA 4O4LA 3KGGA 1Q21A 5J9FA 2EL9A 2DQKA 3RFUA 3T9CA 1JFVA 3K3AA 1RI3A 3EHEA 3B7GA 1HT2E 1D6MA 3FJ1A 3E9MA 2BBTA 1GCOA 1NMCA 1WVMA 4WY8A 1G8AA 4JBLA 4RORA 3SQMA 2IPNA 2G1AA 4JI1B 3TBHA 5FWAA 3TTWA 2J9GA 4RK4A 1A4UA 1J33A 2EFEB 4Y2GA 4J29A 3TBKA 4IGFA 3VAAA 4Q7QA 2WMDA 1CZRA 1TZJA 3RUDA 3E70C 4DZTA 1THMA 1EE1A 4JLWA 2HFJA 4LFAB 1E3JA 2ERCA 2O2GA 2GZ1A 5KYTA 3COSA 3NT2A 4WGFA 2IYEA 2ZPUA 1H94A 2PH7A 2QMEA 3PR3A 4LCJA 5CIYA 3NNNA 3QU2A 4QGGA 2UUCB 4LF4B 3RYFA 4FC6A 3ZD6A 4XMAA 3Q88A 5AM5A 3I30X 3LE8A 3QGMA 4DV4B 2IYXA 2YVQA 1OKKA 2ESRA 3E0QA 4WBNF 2MSCB 1YASA 5GP1A 1GXSB 1UXOA 1M75A 4MH0R 3JPWA 2VZ9A 1J0EA 3CW9A 1ZINA 1W75A 1H5NA 3EDYA 4RZ2A 2F27A 4JZKA 4PIMA 4ASUD 3S1SA 2V59A 3BAFA 3PP8A 5I9SA 1CT9A 5D1NA 1QGAA 4P58A 4AG3A 5HDQA 2FPCA 4FK8A 5IJ0B 1L8AA 4FPOB 3DBHA 1J1ZA 4AROA 1WTAA 2OE2A 3TW8A 3K0AA 3OTGA 1N8NA 1I1QB 1AZSC 1M1YA 1XDZA 3ZWYA 1D4AA 4N9WA 4DLXA 5IBQA 5JNRA 3GT3A 1I2DA 2JARA 2QPOA 4QYXA 3S27A 4QAQA 2D2FA 4ZCTA 2O2YA 5KYKA 3DOHA 3MGKA 3DVAB 2C9ZA 1Z5WA 5AW8A 4JI5B 4C2AA 4K26A 3DWGA 4LRWA 2BKUA 2BFMA 1MNQA 3ILXA 4H7JA 4NBTA 4PBRA 3ZK8A 4I1YA 5FPTA 3WKAA 4AY4A 4XFKA 5F12A 1TIKA 3LHIA 1OQAA 2CF6A 2OBNA 3A58B 1F4LA 1R5NA 3TI8A 2VBIA 3BMNA 1AB5A 1JJVA 4KFTA 4LOLA 4RIHA 3WLOA 5EJ4A 4OFXA 4CF6A 2BSXA 3OURA 4M1WA 5F77A 4D0SA 4IRMA 5FXMA 3UJ3X 3ACCA 4YRSA 3P2OA 4NAHA 3WXMA 4EGAA 3RU2A 3OLWA 2D6FA 4R2XA 3EG5A 3FKSD 4BFYA 2PX3A 4YACA 5JJCA 1L7BA 2DFDA 2R8EA 5EE3A 4N6GA 3LXMA 3IMKA 3QG1A 4QBIA 1GFSA 4K81B 3KV1A 4OHCA 2V7PA 2IIQA 5B1IA 2WAMA 2QI9F 3THWB 3HCNA 3F74A 4GKAA 1SA0B 4Z4IA 4FQ4A 1JU4A 1A4QA 2Q8QA 4KWCA 2XW6A 2IYTA 1BE6A 5H3LA 1GAJA 2IUTA 3OHMA 2CYBA 4OBEA 3AETA 4FLMA 2CDCA 1WU8A 2GN9A 3DB2A 3NCHA 4OTZA 3B6KA 1M72A 1JG1A 1BJIA 4URHA 5L3QB 2A5DA 2HK8A 4NBUA 4F06A 1ODTC 4EMBA 1ZDMA 1SHJA 1ZUNB 2K6GA 2O3SA 3FDJA 2F8SA 2WQ6A 2Q62A 3H1PA 1PAUA 4ICIA 1P31A 3SZRA 5AHOA 5B64A 5BQFA 2OHIA 4FMPA 5JFGA 4R5HA 2R1TA 4RE5A 4DSNA 1DO0A 2JJ1D 3C3XA 2HMSA 4CM3A 1EGQA 1IMJA 1FTWA 1N0UA 4BVHA 2EKZA 1EIWA 4Y9SA 4JJ6A 2XCOA 3D1VA 2WQ7A 4PRZA 5CFLA 1PR3A 3O8QB 3OY2A 3TQTA 1P4SA 1PVVA 1SBZA 4BDSA 5JD6A 4IM7A 1FFEA 2DWUA 8ATCA 1PS0A 1WZUA 2EG5A 4EJ2A 1B0ZA 1C1DA 1EXDA 2O14A 1WOMA 2R84A 3NAQA 2NADA 1G9XA 2OJHA 2JNWA 4HGQA 4KLNA 4UKDA 5HF8A 3GPIA 2RBEA 4BEWA 4E5DA 3GJ0A 4NP6A 5LFAA 2Z9BA 3T12A 1NXSA 3R3XA 5ALTA 1PJXA 2EJBA 1FMTA 3B13B 2C8LA 4YLYA 2XKKA 2JFNA 3MWYW 3DEZA 3T0IA 2A4KA 1W0CA 2PBZA 3C2QA 2ZUDA 3OLYA 1KMHB 4LGCA 4RSGA 5FUYA 2IEBA 5C7OO 5KSWB 2GEUA 1NJ6A 2MSKA 1MAUA 4D79A 1VHTA 4QOGA 2OMKA 3ZGOA 3ZU2A 3T7IA 2O54A 1DKOA 4XGQA 1YZKA 4ZQCB 2CLKB 4BFZA 1KAEA 2H9YA 3CRMA 4L8YA 4NEGA 4CKBB 3FNQA 3VNUA 1YCHA 3AERA 4WJLA 2VRCA 4ZCMA 3E48A 1LBIA 3DEJA 2QRUA 3KL2A 4B7JA 1UKVY 2FEKA 4N5DA 3KQUA 4S1WA 2IJGX 4NCBA 2SHKA 4A0HA 1JYEA 4EA9A 2XXAA 2BR5A 4Q00A 4YONB 4M1SA 1JLKA 1S9DA 1KRHA 5F35A 2QTLA 2GN6A 5C7LO 3QJYA 1EVEA 1DC7A 1AIPA 3QEMA 1RLTA 2PUDA 3AL0C 4JKOA 3Q12A 2I7TA 2ZRNA 3IESA 1JAXA 3RS2A 1Q7CA 1P61B 2BWJA 4CDGA 3T8YA 4NJMA 5EEGA 4AF6A 1RBQA 4NXMB 3F8SA 3SS8A 1KDRA 1JDBB 3ZN2A 5EP4A 4RQAA 5H9VA 4J16A 1NUAA 4FQ8A 1QUEA 3UB4A 2NU7A 1Z29A 3BERA 1L0BA 3DAGA 2O06A 3BWDD 3CZ9A 3V7FA 5ADHA 1KP9A 3SY8A 1HTWA 1L7NA 4E5VA 1QFYA 4O2LA 2IASA 1OFZA 3R74A 3Q85A 2B94A 2B36A 4FZ3A 3F5FA 3UJNA 3RTBA 4DV1B 1L4FA 2WDPA 4MVCA 3DKKA 5GWXA 3KFXA 4JI0B 3QFRA 5T8KC 3DM9B 3LUBA 4ZOLA 3O2NA 4UE2A 5K8VA 3N3BC 3KBBA 4AP6A 3PA8A 1BA2A 4LPSA 3GEGA 4DA4A 4XJUA 1MJHA 1VPVA 1ZC3A 4GMKA 4MINA 2WUFA 1VPLA 2ZYHA 3X1ZA 1KAGA 1U7OA 2GWHA 3II6X 4IICA 3ZJTA 4KN6A 5LP6B 3C48A 3HM9A 4DR6B 3WGMA 3OPVA 1C7RA 2FWBA 3S2SA 1G64A 1JEOA 4RSHA 1G291 3OUUA 4OXYA 2J0SA 2A84A 2CCGA 5CDSA 3TX6A 1QYCA 3PEEA 3HCEA 3Q5EA 1FX1A 1TL7C 4U63A 4FLEA 1W35A 2P65A 1G4AE 5BPHA 3NEYA 2PJRA 4DGRA 2P91A 3AOEC 1HLGA 4TUYA 4LDAA 1GGNA 5HBGA 5JISA 3N2IA 2NXNA 5K3FB 1YVPA 4C7MA 3U09A 2HXYA 2H1SA 3GWGA 5F7XA 1GO2A 3ANNA 5GJWC 3KT8A 5ER6A 4OK3A 1OX6A 3GA0A 2NZVG 1ZKDA 1OBCA 3PC4A 1M66A 4MKIA 2PSJA 2MIIA 3OWXA 1UMCA 4MHTA 1U8UA 4ZU6X 3ROTA 1OWMA 3BX1A 5DSTA 2EZ9A 4C76A 1QGUA 3CWQA 3C74A 1VPTA 2NUAA 3I64A 2F2TA 3KJGA 4H3HB 1WETA 2HCRA 3PFBA 4DCMA 1KXJA 5I7SA 3RK4A 2O52A 4JXZA 1FLDA 4GOKA 1TCUA 4EO9A 1ZH0A 5DOVA 3LBYA 5H3HA 3TZEA 3D2AA 1LH0A 1X7ZB 3WKEA 3WHIA 1NU6A 2OVBA 3GPLA 3KHTA 5CYPA 4ZOAA 1MQ9A 3F8WA 3B6MA 5G1OA 5AVOA 2IQIA 1XTRA 2PSSA 4E1AA 1Q84A 4MV7A 4PYMA 1PQYA 1N3IA 3CNNA 3U4GA 3WV5A 1P2VA 3EF3A 1DUIA 2ZYGA 1W76A 1CR6A 2IK8A 1ZK1A 2AN3A 2NSYA 1RRVA 1X3SA 3OC6A 1I6WA 2R7LA 3CX6A 3KEGA 2TMGA 4OHKA 4XQEA 2RE8A 3ECSA 3DPIA 4IMJB 3I04A 2GF9A 2I78A 1UM9A 4ND5A 3ES9A 2W11A 3MUNA 3OLVA 1ANKA 3AOGA 5CT5A 4U9IS 5H59A 2VYNA 1G55A 5KOIA 1N8TA 4QO8A 1SQFA 3K9HA 4K6FA 4QTTB 3UKOA 4QTZA 2J9YB 4TWBA 3SX4A 3UT5B 4DUGD 6YASA 3EUEA 3AXSA 1C1XB 3O75A 3M6XA 3S81A 3FWPA 2Q6IA 3DMDA 3FHJA 3RRJA 4WHMA 3NAZA 4DDHA 4G36A 1YRHA 1MH1A 4L51A 3JRNA 2GPJA 5JDIA 4RELA 1YB2A 3C4VA 3N9IA 3W6NA 1QU3A 4BX3A 4ZN6A 3S2UA 1XVIA 4QRIA 5E6UA 5EIFA 2CYCA 5JCJA 4B3JA 3C4QA 3ZGXA 4JZYA 2RHLA 1MU0A 1C5KA 1CEQA 2GJ9A 4WKPA 1RABA 4Y1EA 3HYSA 1TM7E 5EKDA 2ZVQX 5ARDA 1WZEA 3OQVA 3WLEA 1WXWA 1BRMA 3LQFA 4ARCA 3CC8A 3K0SA 5I4KA 2BSQA 3AWDA 3C45A 2X40A 3KUXA 3D0OA 1MJGM 5ALJA 2I03A 3AWIA 2I80A 4B80A 5ESDA 1WLSA 4A6XA 4URUR 3S28A 2X8JA 3J80A 2EARA 1ZK2A 1XUOA 2YWXA 5BORA 2VPPA 2I7DA 1N78A 1RLMA 4ND6A 5EVCA 3ZV6A 1VGRA 3EOBI 3TLZA 3VOSA 3MWEB 1CRZA 2KHZA 1E63A 1BHQ1 4DS3A 3ZWQA 5LR6A 3EGOA 1G19A 1P7CA 2C5SA 2RFLA 4NNJA 4Q4HA 4XQ0A 4RY0A 2I62A 2WE8A 5IKEA 1ENZA 2P5YA 2VK8A 5FJIA 3LWZA 2E6KA 4HJXA 3IQFA 4RPCA 1D6JA 2Y0EA 1G20B 3BA6A 3WLTA 4CG0A 3BRWD 4BLRA 2ZAOA 3NXSA 2NPIA 5IAEA 3IDSA 4XMIA 2Y0CA 3AF3A 4E30A 1NUSA 2FR8A 2G8LA 2JEZA 1RHMA 2M32A 3WGZA 4AIIA 4BZXA 4UUBA 4CUJA 2PA3A 1BG6A 1ZVKA 2QSUA 4JLNA 3UWPA 3MINB 2BF4A 1XSEA 4HDKB 4PZPA 2I7CA 5E8RA 3R4VA 1Q15A 2GSDA 1BCRB 4KIWA 4C7BA 1FX0A 4BFCA 4HDMB 4P1ZA 1DINA 3C14C 3EJWA 4D8YA 4F11A 1PZXA 3VR6H 2AMYA 3RAFC 3GCDA 3LRXA 1M2VB 5JRJA 1EVKA 2GN0A 3GGGA 4FOWA 2ZR8A 3CUWA 4P5DA 4JIGA 4EGFA 4FSXA 1PJBA 2DC1A 4FN4A 4PICA 5C4GB 1BW9A 1HMPA 3BQMB 1K8RA 2NYRA 5IXYA 2E4VA 5SZHB 1VSTA 3EIXA 1P91A 4RWZA 3Q2KA 2WVGA 2AEFA 2P2LA 4KQ2A 3JAWB 4DLWA 1A9PA 4CPOA 1ZIDA 4HQ0A 1G8FA 1SVMA 1EVQA 2KSQA 1XZBA 2GETA 2BMDA 3GO4A 4BWVA 2TYSB 4MWLA 1RYZA 2R4QA 3JZDA 2ZRQA 4QREA 4WNYA 4Q1EA 3U6KA 4UQPA 2F62A 2VF2A 3EH1A 3AY0A 3U3KA 1F6DA 2RDMA 2XSZD 4BO3A 1P33A 1RTTA 2FWAA 3JCZA 3B7EA 3U49A 4JUDX 2RJNA 5HR5A 2GXQA 1C0KA 5K0GA 2DXIA 4B8YA 1LJUA 2DJ5A 1N2EA 4RKEA 4EB0A 5F7JA 1IVCA 1EZZA 5AM0A 2AEPA 4Y0AA 1Y4SA 5CT6A 1LLUA 2IX3A 2H31A 1X38A 1G4UR 3BTOA 2Z83A 2BP7B 2QMZA 2YN0A 2DUMA 3DE7X 5LN1A 4UTVA 4HGNA 3OIWA 5KQLA 1SZCA 4RCYA 1TRHA 5KSOA 1J5PA 1YA6A 1OI3A 4MLPA 4BUCA 1T6ZA 1ISMA 4BP1A 3IQZA 2VOJA 3HPRA 3NHUA 3OJOA 2Q2QA 4W1RA 4CQLB 3SJUA 4YP9A 4YRAA 1L5ZA 3ANXA 3D3EA 3IMEA 1F9EA 1DJLA 3C5WP 1OC2A 4NDAA 3S2GA 1WULS 4YFVA 2VLIA 4YQFA 4D26A 3VZRA 5M1ZA 3PQ8A 4FHZA 1EU1A 3ZIUA 4TXMA 4BLUA 1NN3A 2V6IA 1CRWG 4F12A 1W1WA 1NT2A 5ALPA 4FDMA 5KI6A 4BKMA 1G4HA 4ZPXA 4RTQA 2Q3MA 4CETA 2KX7A 4QODA 1G9TA 4QUAA 1G2IA 3T7AA 2B21A 3IBCA 2RKOA 4UU0A 3G2PA 5AHRA 3C1AA 5EYPB 4I36A 1KWGA 3GIWA 3ZXIA 3FPGA 1D1TA 1PW5A 1CRLA 4L2IA 2VSNA 1M1NB 4L95C 1J0CA 4DLYA 2LE0A 3VZCA 1JEAA 4V39A 4HC4A 1M6VB 3FCSB 4IJWA 3ENZA 4N18A 5CNIA 2CKDA 2QVBA 3ELWA 3RWMB 4G37A 1OT3A 3P5SA 3ZHSA 1GEEA 2Q3CA 4UNPA 1Y1QA 5L7YA 2E1RA 1W46A 1UINA 1EUTA 3KQOA 3COZA 3QEOA 1OYWA 1W73A 3KT6A 4I50B 4WFQA 3VA7A 3FSGA 4Z0PA 4NFSA 3CLKA 1ACMA 3E81A 5AJTA 2ONZA 1PX0A 1R6DA 2HU2A 2UZ0A 4ZK6A 5CYGA 4U2GA 1CC1S 5CYFA 4EUKA 4RE6A 1SN7A 2P69A 4E3ZA 1XQXA 4CV2A 3KUDA 4N49A 4NCIA 2NACA 3JD3A 3LYUA 5HWSA 1TCBA 3NFRA 4QT0A 2B3TA 3TW8B 2CXSA 4AJ1A 1J42A 2WSMA 2RHCA 1D9XA 4GP9A 5AI4A 1M1YB 3HDGA 3VH4A 1XDUA 1HETA 1PJTA 3NYIA 5CURA 4CNBA 4E14A 1WZ2A 4JF7A 5FBKA 3E27A 1Y3AA 1YJCA 1QC5A 4FTWA 4GSLA 4L9WA 5T57A 1TO1E 4JXKA 1R4NB 2EJUA 2P6PA 2VNKA 3K16A 1MHTA 4HYYA 4FX2A 4LYEA 4TYQA 4RTOA 4ZT6A 3L8CA 1V04A 3KVNA 2QZSA 2GAIA 2JI7A 4LV5B 5HCUA 3UK2A 3ZBPA 2GEBA 1O9GA 5HPYB 1U6KA 5BWBA 6ABPA 4HVAA 2FYTA 4QQ8A 3EY9A 3ZWPA 1HT3A 1TD1A 1XHFA 2PQ2A 2W2OA 3D54D 5K0SA 5IM4A 1SCIA 1N77A 1ZSNA 1F2UA 1YMQA 2OMEA 3KTAA 4Q3DA 5IS2A 3BWBA 3MAJA 5EJ7A 3UGKA 3FGOA 1PV1A 1Z75A 1CY4A 3BZUA 5DW3A 3RU7A 4PG5A 1UJCA 3OT1A 3PUWA 3ZD8A 2ZI5A 3VGJA 1U3CA 5A4JA 3B82A 3PHIA 3U4DA 4Y2UA 4EB8A 2G28A 1GJRA 4PSVA 2DAPA 2Y77A 2IAPA 3VU0A 3FR8A 2NUPA 4MVJH 5DM70 5B36A 2C5AA 1W8IA 2ONCA 3H5RA 3HYRA 1X14A 1UDXA 3S8YA 2FPWA 5EIBD 4NC9A 5F5NA 3EDOA 4N7MA 4JHLA 1KSHA 2GHRA 4L57A 1QH9A 2ALJA 1OFHA 2C4MA 3ITKA 3A4NA 1B0PA 4IV0A 4ZU3A 4BRWA 2FMXA 4I4IA 2ZYVX 3NHWA 2CLEB 2C7VA 5IUKC 4GMXA 3DVRX 4B85A 3L41A 1Q17A 1Y33E 2WICA 4JIMA 1EFRD 2OCIA 2QRNA 4MQLA 3JATB 4LZJA 4KZKA 3C5CA 2P77A 3HABA 1LLDA 2ZAGA 2JD1A 3K15A 3NONA 2JI6A 3OE5A 3UFXB 1CUBA 1PHRA 1CUIA 3AX6A 4IHJB 5ILGA 4ZYZA 2NZ2A 3L0SA 4PLGA 3NDRA 4QU0A 4AJKA 4HV4A 3FWZA 4OI0A 5JPCA 1P7VA 3O82A 4DCUA 3CR3C 5FBLB 1GZUA 1JR2A 3Q6PA 3AEZA 3BFXA 5K6AA 2FMKA 2PVCA 1MV5A 1QNFA 5IZ4A 2X19A 4ARUA 4HFNA 1XPRA 4X20A 2XMQA 2XOEA 1YVDA 2J59A 3ANTA 3EUFA 3LECA 3WADA 1Y5NA 4IIXA 4I4TA 3K0CA 4MW1A 4RL4A 4WNIA 5B53A 3SGLA 5KDDA 1AQJA 3A3YA 5GMOA 2I4NA 4IQ8A 3TQSA 4GI2A 3WJ1A 4BQRA 2XUDA 3LX6A 3SEFA 1T8TA 5HE8A 2BGUA 4EKNB 1FJ2A 2M1ZA 2PLFA 1SMKA 5DRTA 1CQXA 1LSSA 1VL0A 3CF4G 2G9VA 5ESWA 4EELA 3V8RA 3JR7A 2E37A 2ERXA 2WBLC 4WASA 3SE0A 2AFVA 2IHZA 3VKWA 2QM3A 3L4EA 4KUGA 5E1MA 3EIQA 3TB4A 3TW0A 1VJ1A 3MCTA 5DGHA 5B30A 4CL0A 4PBTA 4HLUC 1PGPA 1UM8A 3U3OA 3RSZA 3HZZA 1G3QA 1J2YA 2IZ5A 3H2KA 3ND6A 1BH6A 1NW6A 4C4SA 5HXAA 2PJZA 3DBRA 1EDOA 1XI2A 2WFLA 5DLPA 1EP1B 5LXTB 4R98A 4PGMA 3OZRA 5IVHA 1DUSA 4R69A 5F3RA 3OM8A 4HNVA 5JVDA 4RTRA 3QBTA 5TPWA 4I3GA 2IYLD 3QOFA 4TM7A 3SJCA 4V1CA 4RAOA 4BN5A 1K7CA 3B70A 1A4XA 2G9NA 3T5TA 4U7WA 1VYUA 2ZSIA 2IU0A 2QYTA 2ZVJA 1BROA 2X1VA 3SXUB 1YOVB 3G0CA 4Z0TA 3WFIA 4CDRA 5BVGA 5HSGA 1L4EA 3A04A 4N7BA 1RNLA 1GPNA 3JQ9A 3BICA 1Q0PA 3PVCA 1ZI9A 3KJZA 3O95A 4XASA 1Y8RB 3DJYA 1JDPA 4KMSA 4F2HA 1T6YA 1JZQA 1ZMRA 4G8DA 1QG6A 1KMQA 3WOVA 3U56A 4ZT4A 4JJZA 2GJ4A 1WXGA 2WIGA 3DFIA 5HJ2A 2XT6A 3NHPA 5NN9A 1N6IA 2VSXA 1V5GA 2XAUA 2HSEA 3OOJA 5A05A 1M5RA 3LVBA 3O0TA 3UF0A 4M7WA 2PGDA 4AKTA 1TD9A 1S01A 2X6QA 4XPIA 2DFPA 2Q3JA 3A7DA 3A14A 5FBRB 3ZZ1A 2C2GA 4N12A 5AKLA 4KP7A 4JGGA 5G41A 5GGYA 3W4JA 1FSPA 1GUAA 1LGYA 1WJGA 2A86A 2XE8A 4I4CA 1GU0A 1Y42X 1E1CA 4UD2A 4KITB 1JE1A 1MUUA 4AWBA 3W8DA 2UXDB 3R5TA 1MIOA 3OBBA 2Y05A 3TL2A 5JZSA 3RODA 1UBOS 3SKYA 4QDJA 1Q83A 2EEZA 4BMYA 4YR9A 2GK3A 2KW5A 1MZ5A 1FNCA 3DZBA 3EFHA 3PHJA 4WA8A 1UODA 2B5WA 2EBFX 1CUZA 1GPUA 3JWJA 1NLFA 3OETA 4LWOA 4BQPA 2AS0A 2PUAA 2PXAA 1T3LA 1NVWQ 4TUYB 5JJ5A 1ZD1A 1FYFA 4M1OA 5DX1A 2WWTA 4RUKA 1PTKA 2LZ0A 2XUPA 2OBXA 1VL8A 4IRUB 2XZLA 1WAMA 4DV6B 3SLIA 1KJWA 2PKQO 4IXWA 4EJ0A 2QUZA 2VNSA 3CZAA 3DSRA 3LT5A 2PRIA 3A6JA 3QUBA 1VMKA 1MCZA 1R5JA 2I2FA 2WF9A 3H0CA 3HB9A 3JV7A 4TRRA 1X3LA 3QI2A 1CZNA 4BO1A 1U2GA 2HY7A 3KYBA 1XO1A 4LEIA 1T13A 1T3TA 4JYBA 3KR2A 1IBMB 4H9GA 4FIZA 4JBXA 4W63A 5C31A 2ZITA 2WDZA 9ATCA 4JJ7A 3ZU4A 1CJUC 1B7GO 4NJEA 3HTXA 1O9BA 5BQPA 1E0DA 1XQ1A 3R77A 4UFNA 4EEXA 2AZTA 3U0VA 3M4JA 3D8UA 4DBLE 1QTRA 2BMEA 5CB4B 3TXYA 3O1IC 1WMDA 3FD8A 2CWDA 4LQ4A 5I4CA 4LJAA 4W5RA 4ZAGA 4FZJA 2O8NA 4F7WA 4U2KA 1W1UA 2PKRA 2ZI7A 2F8MA 1UEIA 1YRAA 4QRDA 2O2SA 5BMOA 5HKKD 5BQ3A 4KFSA 4F46A 3AFIA 2ASVA 2GA9A 3HE3A 1AK2A 3ZDDA 3ZHVA 1Q0TA 3V7UA 2ONYA 1CYDA 3EYAA 4G0MA 1G8JA 3KALA 1YS1X 4K2AA 3WB0A 1UM9B 3T5AA 5DSXA 1GNRA 3DLTA 4M1EA 2OSVA 2P41A 3QMVA 2VDMB 2ZYUX 5E9QA 5ECYA 5HTKA 3UWMA 3T7DA 2G1PA 2AEQA 3B1JA 2UU9B 4RXUA 1R9MA 1P4JA 5JMOA 1SC3A 1ZI6A 1I10A 1YTLA 2WR8A 1TZ2A 2RHTA 3BEQA 2YDXA 4INPA 1M1XB 3TDKA 1Y3CE 1O77A 4ZQGA 4OSPA 2Z30A 4D3SA 4YMLA 1G8YA 5EPUA 5CK5A 2HNKA 5LZ2A 3HCRA 4Z99A 1BWQA 3SHQA 3ZXUB 3VKHA 4JMPA 1IHDA 2VK6A 2ZJ4A 3FYUB 1T9ZA 1Y7PA 3MSXA 2MSNA 3I9LA 4YCCA 5MGNA 3FUWA 5IFKA 5D9DA 4NC5A 1U2RA 3N7TA 2JAQA 3KAKA 4ZCRA 2IU6A 4BLSA 1KR5A 4RA6A 1QO0D 4JSTA 1IZ0A 1NNLA 3SZOA 1WXHA 4D9NA 3V4OA 5JBQA 4DB2A 2B8TA 3EC7A 3V8PA 3ZHBA 3V9AA 3PYLA 2BLLA 4XIIA 5AW5A 1S0IA 3TDMA 5CGJA 5CDFE 2JAHA 2HHLA 2QMQA 3ROEA 2IZ7A 4MK4A 3U3XA 5TQ2B 1GRVA 2OECA 4EVRA 1L5YA 4Q4HB 3R3YA 2RK6A 2ZM6B 4C6SA 2IEGA 4M99A 1Z2CA 4GXRA 2GT1A 1ZCFA 2X8AA 3UGTA 2Y67A 4O1MA 1UWLA 1SOMA 2AUTA 4O1IA 4WXEA 4YMSA 4F04A 4E4TA 5IDQA 1NNEA 1VG0B 3O8OA 2Y1XA 1SKYE 4NESA 3E3AA 3SZMA 2XQVA 3KJIA 5FADA 4NV3A 1SZDA 4MWOA 1V0EA 1UP6A 1XJCA 3ENNA 2H48A 5CLIA 2VCYA 3W05A 1V11A 3ASYA 2B9EA 3NIBA 4NE9A 1SO8A 4Q3CA 3Q2OA 4ZJPA 1CYEA 2FY8A 3MB8A 2GVVA 4GOOD 4OQDA 4LDQA 3OLCX 3OCXA 1PRYA 3OE7A 4ZGWA 2Q6KA 1JMVA 5BQXA 4AUNA 4GRIA 1PEYA 1TAUA 5ERXA 3G2NA 4LF5B 3D59A 2GRUA 4ML3A 2BHRA 3MMPA 3IR7A 1NRXA 2A0KA 4B71A 2IAXA 3O4RA 2X2EA 3OCWA 1Y34E 4NYMR 4F45A 1CQJA 2HM7A 1I32A 2I6TA 2O2EA 3D12A 1D4ZA 2ACEA 1QS0B 2HZBA 3CZ5A 4H59A 2Z9DA 4KDRA 1XCGB 2BHSA 3A6KA 3KXIA 4XM1A 2BGKA 4IXTA 4IIGA 5JCOA 3KTDA 4L74A 5L40A 2DPXA 1VHJA 3DW1X 3JTEA 5F9FA 3ZDZB 4JX9A 5HJEA 2I3BA 1E3IA 1NZJA 1R6XA 1CY6A 2AJ8A 3DDCA 1OY1A 1P73A 2ZE6A 3GAMA 4OJYA 4R51A 3NP9A 1OX4A 5FWDA 5JWHA 3RIHA 3VPAA 1VCUA 4Q9DA 4WK2B 5ALEA 4N47A 4E5MA 5KU7A 2IW3A 3W6ZA 4KNYA 3MHPA 4IF4A 3HVRA 2C5EA 4IVNA 3RUIA 1VB3A 1U0OC 2RGWA 3CUSA 3ESBA 1ISIA 4RVDA 3UKDA 1VSUA 1ZOLA 4C4PA 4D2IA 1GTRA 1KMNA 2OT3B 4ILKA 4L50A 3OCZA 1IVNA 4FEAA 4AN0A 4NNPA 3ZTWA 1SBTA 1BDMA 5BR8B 3VPFA 3KYDB 1AS3A 3TZCA 1ZWKA 1LWNA 2VDNB 5EIHA 2Y27A 1ETHA 3Q3CA 4JCCA 1M2JA 5D01A 5CEJA 4IFNX 5SY4A 5D51S 5A4DA 3KB1A 4BLPA 1WUJS 1JSLA 5JDCA 1JP7A 1XTSA 1GPJA 3DMFA 3MJRA 2NUTB 2HQRA 2G67A 3TSZA 2RD2A 3P5BA 2XGOA 4K9MA 1JWLA 4X3CA 3N5KA 3IBSA 4K3UA 1T26A 1YMVA 3ABZA 4Z7OB 1NR5A 1P60A 3DTVD 4LISA 1IVGA 1AQNA 1SXJA 4B6PA 1RVDA 4BCBA 3SBEA 5BV1A 1Y5IA 1QYIA 5L95A 2OSBA 2QTWB 4KN5A 4S1NA 1W25A 5AUPB 3AF0A 3NHLA 2H2NA 2YHUA 3BUSA 4RETA 1V48A 3M34A 5L4SA 3BIWA 1O0SA 5FPKA 4EPRA 1QV6A 1UDAA 2GLUA 3HO8A 1UXGA 4U0KA 5ENDA 4ZXPA 3T9FA 3U4CA 5D6OA 4HEHA 2QQGA 1VOTA 2KBFA 4NZZA 4OM8A 1Q3HA 2R2AA 4PEVA 4ER5A 2NTNA 2QTAA 3T1YB 1E9EA 4YHHB 2VCEA 3NR2A 3BCRA 5HIKA 1FDRA 3WGLA 3STVA 2P1RA 3KNZA 3NYWA 4UBMA 3VYWA 3FPLA 2WT4A 1MR5A 2VT2A 4ZALA 4J1SA 4BNDA 1V16B 2N3ZA 4DBVO 1Q20A 3HA2A 3JYQA 3LPDA 3WLFA 1VKNA 4RSRA 4X00A 5HUHA 4HL6A 4FKBA 4GGOA 2LKDA 3N0WA 3R5KA 1A5TA 2VPTA 4GQBA 4JLAA 2D0PB 5JLAA 1E9AA 1RXYA 2FQWA 5SYNA 3SIWA 3T7KA 1B8OA 1Q1AA 4EPXA 2I8LA 4MICA 2X4LA 3KJNA 3ACDA 3BB4A 1GLGA 1MTOA 2AI1A 3SBOA 1PG5A 3B51X 5DOZA 3PL5A 4GWKA 2OORA 5TR9A 2O0HA 3PFWO 4CCAA 1XYVA 3D3WA 4LI3X 5FBZA 2FFQA 3QUSA 3RFXA 3PXEA 1S5PA 4XA8A 4ZZ1A 1GILA 1OBFO 1ZJ5A 5DN6D 2VPJA 1HFWA 1R6AA 1N32B 1YGPA 1IPFA 1RAIA 1T5DX 1UDBA 4JC4A 1JN0A 1VSVA 4GQAA 4LRYA 4D4MA 1QC5B 3DP9A 2EJCA 3BD8A 1Z7GA 5I7VA 1AK9A 2YBEA 1F0NA 4C1BA 4G8CA 1DG3A 3COWA 5EP3A 3I83A 2H0RA 3IOEA 1V6SA 1G2PA 2QNRA 3C87A 1HV8A 2GZ2A 2ZBRA 3I2IA 3T9BA 1G6OA 2BHTA 2DGDA 5FI3A 5KNDD 1WKBA 5AOBA 3A9GA 3TQHA 4AZ3B 5K0LA 2GK7A 1WA5A 5HZGA 4BVKA 1OWNA 2EDAA 2WFAA 1XCBA 3WLAA 1WP9A 1ILEA 4X94A 3KTAB 2FQQA 1CY1A 1VSQA 4PO1A 5LCXA 1L3IA 2P7HA 4R3UC 4F8JA 3H6HA 4KK3A 4WSOA 4EYKA 5KVAA 1QRAA 3B38A 1PJZA 2VDQB 3GY0A 1QM5A 4LDZA 4R7GA 3IAS1 2HWXA 1Q1GA 1RPAA 1R15A 4UNNA 5HKLA 5BSKA 4GU5A 2F25A 4B6EA 1N8SA 1RQXA 5C8YB 4OQEA 3N39C 1JEYA 1UBEA 1DADA 3OOSA 5BMVF 2HLDD 4GKKB 1YONA 3DYBA 1JHQA 2P79A 2BMFA 3DT8A 1TKBA 1E6LA 1FFXB 4MQUA 3CVOA 1AO0A 1FBTA 1YS2X 2M6KA 1E6EA 2GQ0A 1Z4PX 2GN2A 1P2DA 3ZWKA 4D99A 5HIAA 2GWRA 4F3YA 2JVJA 3MJCA 4EFDA 2OFOA 3QWFA 3CNOA 4M3NA 3UMVA 3LCCA 2GRAA 3RTEA 3VZPA 2F3SA 2PQ6A 4BGUA 1O95A 1Z33A 3UYLA 1LBEA 4BNLA 5AHKA 2X4IA 2O2HA 2W71A 4EAQA 2P90A 4L4UA 1T4MA 4JL6A 1OV4A 3CJQA 4OKSA 4M9QA 1GN8A 4GF5A 4TMFA 4B3MB 3IOYA 4MCJA 4UHDA 3ZWNA 4JR1A 4ARZA 1XZCA 1Y7LA 2Q5FA 4DARA 3JQQA 4Q9JA 3RIMA 4MV5A 1W44A 1A71A 1EJ0A 4WMLA 2DBRA 2NMVA 1XAIA 1BFDA 2VT6A 5DNEA 3UO8B 2C82A 3SIRA 1SQGA 2ACKA 2BEVA 4FZVA 4YRLA 3MK31 3I5YA 1GQOA 1UKBA 4A4DA 3QLUA 4EQ6B 1WZNA 5C81A 4MRAA 4NH0A 3VVLA 1SC4A 3GIDA 4GZPA 2G80A 4TYNA 3L4BA 4BYGA 1DAPA 1JHAA 3P9XA 2XD4A 4GMDA 4CW7A 2DOKA 5HZKA 2OTCA 3RR2A 5CLFA 3WZ2A 2CHVA 4FDTA 2Q2OA 2RMKA 4Z5XA 1YDHA 4ITVA 4UMDA 3AY3A 1G7SA 2YX1A 3SHTA 2RI1A 1K92A 4ZEOA 4ZHSA 4ID3A 4MO2A 4PHHA 9LDTA 2DWOA 4C0AC 3L84A 1N75A 2JASA 4XVQA 4XRRA 3RFVA 2FP4A 4O6VA 3S1LA 4BV3A 1A8SA 1I5RA 2ILVA 2C31A 4L0MA 2YHIB 3ZLBA 5HQJA 2ZP1A 2NZ8A 3IPXA 4G0OA 4HZGA 4ALJA 4DTIA 4EMUA 2QKYA 4MQ5A 4PGFA 1G6HA 3SSNA 3VU3A 3DMGA 5SY9A 1QZUA 2A9QA 5EJAA 2XB6A 2BONA 4ONEA 2HJRA 2WFLB 3FF4A 1NQTA 2YZGA 4ZV9A 3Q9LA 1V3BA 2UVPB 4WZAA 5D3ZA 3FYSA 5IYZA 5B37A 1W0KD 2OZKA 4CKBA 1WXFA 5C2JB 5JVDB 4UNIA 3RHZA 1L7PA 4H7PA 4ILEA 3WYDA 1E2MA 2VG8A 4TZ6A 5AK0A 1EKXA 4LQDA 2O20A 2PUWA 1PD0A 2XJ9A 3DCIA 3G02A 2F8LA 3KLNA 3DYVA 4HMQA 3U16A 4UARA 3PGJA 4ESOA 2GCPA 2A8YA 4HS9A 2HBRA 3I5UA 3TKYA 1NURA 4JU8A 3SC2A 3BXHA 3QIVA 1CPYA 3VYSB 2EDCA 2VHYA 3GMIA 3UM9A 3EWSA 1RC1A 3I5AA 1NP6A 3GYGA 2WQZA 3KZXA 3QU4A 3H0KA 4K1JA 2ZKLA 3DOUA 3BS4A 4N5MA 5ALZA 3OTWA 4JJEA 3RGWS 2QNBA 2BGGA 2N1BA 3CZ4A 5C4MA 3HP4A 4BNKA 5JRDS 2AG5A 3OOEA 4OD0A 3VNSA 3WMFA 2FLUX 2Q8NA 4WEOA 1FUKA 2B8JA 2VPZA 2B92A 2XMZA 3PGMA 1U28A 1AF7A 1N2CA 3QUTA 4FGSA 4D5GA 5AW1A 1Q6ZA 4BMXA 4CNQA 5D8DA 5EMHA 4CIYA 2C7BA 4R40A 4MRPA 3ZX5A 5C8XA 4ED9A 5GVSA 3BHNA 4JGIA 1UJNA 2R5WA 1J2EA 1WCV1 2XWPA 4HOYA 4L3VA 3ZVRA 4B48A 1IN1A 1YQEA 3A9CA 2QWEA 1T3GA 1U94A 3QPAA 1MIOB 3CX4A 4DLVA 1G6Q1 1O6CA 3VV2A 4ES6A 3RYCA 3B2NA 1SKMA 4XUCA 5A0VA 1DAKA 1MAAA 2GCNA 2OV2A 1GA6A 3FVTA 3QFTA 4LFCB 3LSTA 4KNVA 3A2LA 3K71B 1HX7A 4I9FA 1Y63A 3H97A 2ECFA 5IAKA 1LQ2A 3B7PA 3GK3A 4GWLA 5KBYA 1DKPA 2XNCA 3R8XA 3Q6KA 3TLEA 3PYMA 1YRLA 5CM8B 3W1EA 1TFRA 4EH1A 5CA0B 3WV4A 5C5EA 4FZ5A 4OAPA 4X8OA 2NO9A 2ZEJA 1N36B 5LOVF 3UEOA 4Z4GA 2EX1A 3EQ6A 2IHTA 5JAHA 4QSHA 5JY6A 5KUTA 1HNXB 4QVKA 4HEA6 3D02A 2CXUA 3BILA 4ARBA 2IH2A 1S8AA 1ZR2A 4ZYYA 3HJRA 4FUTA 4G5FA 1VJCA 2C0CA 1VHLA 2HO4A 5D9BA 1MB3A 1Z8HA 3GUCA 1IWPB 1AKWA 3RVRA 1F2TA 3LPAA 2XUOA 1OGJA 2ZRLA 4GT1A 4BECA 1NPTO 1JW9B 2CXQA 1EUDA 1VYHA 3E2IA 4PNEA 1GDDA 2FWPA 3EN0A 4B34A 4CI0B 1FMCA 2O6LA 3D4NA 2O50A 4EG4A 1Y7IA 1H23A 1XU9A 4NJEB 3D1LA 2OV3A 3DFUA 3HNPA 1A5ZA 2HWYA 5JV5A 1H8HA 2LUOA 3R24A 2Z9CA 4L72A 3DAHA 1HXHA 4N7RA 3THYB 1C9NA 5ALKA 4MV1A 1J8FA 3V4RA 1B8PA 1X1EA 4IIDA 2GDZA 4P36A 1WTCA 3HRKA 1Z4NA 3DXFA 3W2HA 5BT9A 3ZCQA 4DG9A 4E07A 4O4LF 3VJLA 2X76A 4IH9A 4GP7A 4K28A 2ONKA 3NBUA 3RJ9A 1W4ZA 4U4AA 4RKQA 4NBRA 1C8KA 1NWHA 2QY6A 4KRGA 3MLBA 1JYFA 4KX5A 1P17A 1JT9A 2J5KA 1R74A 3ABQB 4NABA 2ZWPA 3V8MA 2VK4A 3X1DA 4CODB 4FFLA 4XKJA 1YR1A 2QN2A 3M89A 4WZAE 5LYJA 4B6RA 3C3PA 5A7GA 1E2UA 4HF7A 3NAGA 2XWQA 3VMFA 1O58A 5T64A 4U2FA 3VX4A 3C6XA 1MORA 1WDKA 2MOKA 2OILA 1R4MB 3G2JA 1KAOA 3Q41A 4G1UC 1DIAA 4MWSA 2XLCA 5AP9A 4IMBA 2X8BA 1IQ0A 3EYWA 3S2FA 4LY9A 3TI9A 1RHUA 4U2CA 3OHPA 1LVGA 3Q3GE 4G81A 2QAJA 4XQCA 4Y0VA 4EKEA 3MRXA 5EPOA 1ZJZA 3TPZA 2W43A 4WINA 2VFAA 2XMCA 3MIIA 1NSDA 2YINC 4E22A 3NGMA 1C81A 2NXCA 4CN9A 2DQYA 4EB6A 3KWJA 5DI3B 5BSUA 3VO1A 3FM9A 4NRDA 2EATA 4WA5A 3RSHA 3VM6A 1Z6AA 4A0SA 1PT8A 2X77A 5B7GA 2GLXA 2JRLA 3WLQA 4RANA 2OXEA 5FR1A 1E99A 4I14A 2H2WA 5IXSA 3ZU3A 3PJRA 5TT1A 3FNIA 1N2CE 3UAGA 2YMPA 3W9UA 1NE2A 4GR4A 2I55A 3TPCA 4DADA 1A95A 2BKEA 2VDWA 2WUVA 3WW9A 1FPQA 2I71A 2O1XA 1RKQA 3LNTA 5SZJA 2MT9A 1IYZA 3E3NA 3DTYA 3L1IA 2LV8A 1OAAA 4Y9TA 3WNBA 2JFBA 3PHGA 5JY1A 1YAJA 3AJ8A 1BQ4A 1UXKA 1I1HA 2R44A 1VXRA 3L6RA 4J94A 1HI9A 3WGVA 1QWOA 3HJGA 3IUQA 1GADO 4AYTA 2GD0A 1L7OA 4GNKA 4KI0A 2QAGB 1K5PA 3DXYA 2BZGA 4X91A 2KS6A 3ZKAA 1ISPA 3E22B 2QF7A 2VWQA 2C20A 3HKBB 3MS2A 3OFNA 3EMBA 3FOAA 4QFMA 2Y1GA 2IUUA 2WAOA 2XZIA 3WMEA 2PYDA 2YXLA 1W59A 1I01A 4H15A 4HVTA 4F2GA 3DV0A 4JQOA 1Q1EA 2JFPA 3UB3A 3V3KA 1SIOA 3WHLA 4JNCA 2JLVA 2XHZA 3BIOA 1LFAA 1WHSA 2PL3A 2HIAA 3HJTA 3BA1A 3RLFA 3VH2A 5JYEA 2J48A 3HB0A 4PAGA 3WRXA 1GT91 1SXQA 3S4YA 4XVCA 4TMXA 4GBGA 4DEXA 7AT1A 1UAYA 3VNGA 2JJ2A 2ZCUA 4ENVA 3WNVA 2XNDA 1TK9A 4N65A 1ZNXA 2H4ZA 4IG9A 4GZ3A 5JMTA 1T8RA 4P0TA 4KPFC 4BZWA 4R2LA 2DLNA 3AF4A 1KRWA 4GOLD 1WL8A 3CLTD 1H85A 4B6QA 3RASA 1Z4OA 2XNKA 1L4LA 2CNLA 1CZLA 1KBZA 3BDVA 4FGKA 1OX4B 1H4QA 4RK0A 1CQ1A 2XF8A 2JGNA 3GAFA 3R41A 1KYWA 1VLQA 3PEVA 4D9IA 1NVVR 1R64A 4H53A 1U0RA 5JJBA 4C2BA 5K8CA 1WQ4A 3EAGA 3PDWA 1MS1A 2Q4DA 5IP5A 2OZEA 2D0DA 2LCFA 4FCCA 2D0OB 4OMFG 1WHTB 3TFOA 4EYQA 4V0OA 4AURA 1VJRA 1R27A 1MS5A 1G21B 3JXEA 4M55A 3HWSA 3KU1A 4TSKA 1C29B 2IPOA 4G3NA 2P4UA 2PHZA 3KYCA 5DO9A 3B8HA 4AGIA 5ERGB 1XQ9A 1G18A 2JKYA 2ID4A 1Z8NA 3AW8A 3GRUA 3RADC 1FP7A 1I3NA 1OKKD 4JELA 5GX3A 4UHEA 1Z4QA 2DWCA 2VK5A 3BJZA 1DX6A 3JYOA 4IIFA 2K2QB 4M87A 4B3RB 2GBLC 3R0IA 4Z4FA 2WZDA 2IDJA 3K2EA 3L18A 4L3WA 4QVIA 1C14A 5DSZA 2Z43A 2E89A 4HUJA 1VCIA 4DMLA 1SXJB 5FZNA 2I9PA 2WWXA 3AUKA 2IF0A 4ZO4A 4D9EA 1BVHA 1T3HA 3T52A 1I1OA 2R00A 2WINI 4CRWB 3UMRA 2QQEA 5CDYA 3PTZA 1T9HA 3EAQA 4OHFA 2IAQA 1YE8A 4E0BA 3VPGA 1II9A 1RLUA 4OI2A 3NUQA 5FO0A 1JFFA 2O7NA 2NZUG 2CDBA 3U3JA 2J6CA 4C87A 4B9EA 1YKSA 2QL9A 2WUWE 3CXRA 1L7GA 4HHQA 2VLBA 2JFXA 3SNHA 4ZHQA 5MN5A 1XK6A 2QD2A 5H1YA 1U63A 3QVKA 3QVTA 4YT5A 1Q7BA 1T0JB 2B4AA 1GPAA 1JEQA 3JW8A 4YJFA 4MJ7A 2VTBA 2J67A 4PXSA 4HBZA 1EFDN 3AFMA 2VJOA 4GG1A 4RKRA 2VPIA 5BQOA 4BNDB 4RF3A 4KYIB 1ONNA 1L5RA 1T9BA 1YOBA 3OIVA 4IXNA 1U0BB 3IEKA 3O3CA 3OZSA 1AZLA 4CTJA 1G3MA 1X13A 2XB9A 4Y1RB 3L6VA 3H9UA 1B6TA 5JXWA 3AY7A 1UBMS 5EHNA 1N4AA 5JC1A 1LU9A 3ZHQA 2PUHA 3JZMA 4JUFA 3HRIA 5DX8A 5A04A 3ETHA 3C8UA 5FOTA 4KWEA 3IO5A 4HWKA 3FHLA 1TJYA 3MJFA 2QYOA 4Z49A 3VU8A 2IBMA 2DBYA 1VE9A 2GPYA 4IR7A 4KVZA 1N6HA 3IE2A 4YNBA 3TF5A 1QPZA 3CXUA 4FE7A 3K70B 2QRGA 4MYHA 3ZY5A 2A9RA 5GONB 1BCSB 2NNWB 1QHYA 4QPDA 4MWVA 1ICIA 3N6RA 3RRYA 1A7JA 5G4KB 5B1YA 1G66A 3G2KA 4P98A 2H51A 5I8WA 4DT1A 5IARA 4KR9A 1ZM9A 3DASA 1VLJA 2GPNA 5E2BA 1WR8A 4XIOA 2M2IA 4ZOLF 3H05A 4G0UA 3UY4A 4Q9IA 4PYNA 5AJHA 3U4QA 3DQQA 3DVSX 4C7OA 3DOIA 4XJXA 1LF0A 2QMHA 3UJ7A 2PSFA 3RS4A 2HN9A 1S2IA 3G5AA 3H2JA 2G25A 1NBWB 2Q3LA 5DISB 1CE8B 1QTNA 2Q1SA 2JKBA 4QQKA 2AR7A 1CNFA 2Z5GA 3SLKA 4DA8A 3RE1A 3H72A 1E3WA 4L7CA 1RD4A 1LS1A 2H54A 1THTA 2VHXA 3GNQA 3OC0A 2WWRA 4OUKX 3GA5A 3WMRA 2M9MA 3CLVA 1M7BA 5LJLA 3E03A 4EM6A 4KX3A 2IOHA 3HCFA 4ZEVA 3ST7A 4NKRA 3L7YA 1TIPA 4LA4A 4RZSA 2OCKA 1JEYB 2ACVA 3GJXC 3KSUA 3NETA 3OFJA 4CQMA 5JWOA 4G0YA 2AB0A 1P0PA 2I4OA 3EE6A 2FPOA 3X2SA 5B4TA 1SH7A 3T3HA 5H9WA 3DBIA 3OIDA 2VDPB 4K3YA 3N2GA 3OZ7A 1CF4A 2GKSA 4QOSA 2PS0A 4UAGA 1OOEA 1M7GA 4G86A 1E1MA 4HNAB 1BNCA 1C3LA 2UYYA 1AZTA 5JD4A 5IRCD 4OF4A 1NX9A 4A10A 2YIMA 3CNEA 1VGQA 4FMBB 4KE6A 1EGVB 2Q4TA 3NRCA 3FETA 3B9RA 4IFLX 4RMGA 2W70A 4ZZIA 4TV9B 1AKTA 5DLYA 3HO6A 1SEVA 1JS1X 4PINA 1K3UB 4FDAA 3I32A 3FOEC 2H57A 2WILA 4W4TA 4ARZB 4HVCA 4EHIA 1YDGA 1E2BA 5IN5A 4DC0A 2HSJA 1Q77A 3ETCA 4BL5A 2OO7A 1ABEA 4QUHA 3F5MA 5SV2A 5TEVA 2HHHB 2Y99A 4QJIA 3HDHA 1GPH1 2JCYA 2VI5A 3KUUA 4ND8A 2N75A 3HFSA 3C6MA 3BRQA 1LW7A 1W9HA 2PZFA 4FEGA 1COZA 4OV6B 5COAA 3RC3A 1SG0A 4YCSA 3MMZA 1GNQA 3GEIA 1J23A 2VXBA 1AQYA 4FYYA 4OHXA 4E7OA 1Y1LA 1Y9EA 3M83A 1H0KA 3NXKA 4HQKA 3MTBA 5FNUA 3EZXA 4EWLA 4DUPA 1FTSA 1HYEA 3CGGA 2O8VA 2CHFA 1Z15A 1OWLA 2W90A 4RHCA 5B2DA 4PWYA 3L77A 5HTOA 2DE0X 4RXTA 2MMCA 2DB3A 4M1ZA 3LCJA 2A7XA 1JDNA 3A4YA 3B1XA 4P4NA 1Y82A 3G79A 1JJBA 4AKEA 4AKGA 2C8VA 1BXZA 1EFTA 1B14A 1DZIA 4M0PA 2G77B 2UVDA 4N0PA 1MQ8B 3F97A 5DHSA 1UFOA 1FW8A 1YRWA 5BYAA 2PFKA 2X9QA 1N1MA 4QYWA 3TR0A 5L8VA 3TIAA 3HJNA 5D6NA 5CBPA 3UUGA 5BV0A 2RJ3A 1H5UA 2WHPB 2ZXEA 2PN1A 1ISGA 4AMGA 5HX0A 1Z4KA 2VPXA 3OKCA 4WIAA 5AJVB 3T9EA 4M8NE 2JBAB 3PKJA 4TM8A 4EDHA 1WEHA 3WZLA 1RJ9A 1FBNA 2FSIA 1ZJYA 2BGJA 2ZIXA 5HUNA 2RCNA 3BSFA 3TOZA 1C3OB 2CNBA 3T6KA 2QQFA 2Z6QA 3ZDXB 3QTLA 5M3BA 1QHXA 4IZOA 3F49S 5IANA 2AFIB 5KPDA 3MJVA 2HRRA 2ICAA 4TSFD 3T7SA 2V9ZA 4DQ0A 3INBA 1P9RA 3QW4B 2IA5A 1V1RB 1TZMA 2XB8A 1XELA 5DHQA 1SCUA 4MB2A 5CIQA 3RD5A 3RV3A 1WLYA 3F6CA 3WG9A 2K7FA 3N2LA 13PKA 1BGXT 2BFDA 3HCCA 1YJXA 3OJXA 1E20A 3I62A 3L43A 4UEKA 2A0WA 1KXZA 3ASUA 4KE9A 4N8EA 4UBNA 1K6MA 2YV5A 3MQFA 4YI5A 1X1SA 1BJKA 2QZJA 3GVCA 5ULLA 4F2WA 3FJYA 1WCWA 1BJTA 1XXHB 3TEJA 4DDMA 3CX8A 4F86A 2A30A 4J0QA 3ETEA 3F4BA 3K94A 2BISA 3C3EA 3AV3A 4FHCA 3NYQA 3QW2A 2IZ1A 4G23A 4H7FA 2IEYA 4HADA 3UHJA 3LL7A 4R1OA 3WWZA 4F3NA 4O4HA 3A4VA 1WXDA 4PVDA 4AX4A 2DUWA 3E9DA 5DYWA 5IMBA 2F55A 4IYRA 1H1LA 4YAUA 1U3WA 4C5CA 3USES 1QE0A 4QUGA 5T5QA 4C9BA 4YRMA 2QI9C 3UZUA 3KV3O 5EJ5A 2XYRA 3E7DA 3K2BA 4FMDF 5KJ6A 2Q0QA 1ZONA 3NASA 4HZZA 4LYHA 4PO9A 7NN9A 4AO7A 1P9OA 2E1PA 4BVJA 3JQGB 3H65A 4AS3A 1K32A 1SCBA 1IHYA 1SZJG 3D4OA 4KYUA 5JASA 5FNTA 4UUOA 3H8SA 3B9PA 2PT6A 3Q7PA 1NFFA 3QX9A 4Y18A 4M76B 3HYLA 5H68A 3GFQA 3L6CA 3TYXA 7GPBA 4HGYA 3LYAA 2YH2A 5KYUB 2C4VA 2PX4A 2FEMA 2A0UA 4P54A 2F3QA 2XRZA 2UYHA 2J4CA 4GICA 3M5DA 4JLJA 4B3XA 2BFWA 2R5FA 4E09A 5D3MB 3F8TA 1RJGA 3C3MA 3CRZA 3A6ZA 3L82B 3MQ4A 2D1FA 4FEYA 4GSYA 2Z2ZA 2VCHA 3G2LA 4NV1A 4RHEA 1AQ6A 3ZG6A 3U61B 2XJ4A 2QVLA 1L1FA 4YP0A 1Q57A 3H71A 1QF9A 2VYND 4EPYA 5L3VA 2ODEA 4DEYA 2VF7A 2COEA 3D5EA 1F2TB 2INGX 3KKZA 2AMLA 3P4UA 1U9IA 3IBYA 1WU7A 5JNSA 3BMCB 4RDCA 4JT9A 1EUDB 4XJAA 4GI1A 2BMVA 4AG6A 4DDWA 5L7WA 1EESA 1KORA 1U5BA 3ELDA 3EARA 3IHTA 4KO4S 4Z7JA 1LA2A 3VPDA 3DCNA 5KSYA 5CR9A 2CEKA 3EWIA 5JCJD 4E5NA 1XCMA 1NV8A 4GOND 5JSKA 2AD1A 4O5OA 2ZIWB 2EJWA 2FPMA 4QQFA 5DE3A 5I4IA 2PGXA 4C5AA 2Z32A 2HQ1A 4RZQA 3N2YA 1QONA 2Q3FA 5LWHA 5M34A 1I94B 1E66A 2J33A 1FDUA 3S0JA 1P0FA 2ZT5A 3LQRA 4MIEA 4Y1GA 3PFCA 5AD1A 2QTVA 1KI8A 1X1RA 3E18A 3V65B 5ANRB 1XJ0A 4MCHA 3Q0IA 2V7UA 5KYYB 5LYJB 4LJRA 1NW3A 4J3NA 1UJ6A 1GTL1 1VRVA 2X86A 3DCJA 3LCVB 2PSHA 2YFHA 1GPLA 4ENUA 2QVGA 2V6GA 1TX4B 5HILA 1UKYA 2AYYA 2JDID 1NNBA 3H9CA 1KQPA 1GDHA 3ABIA 1HRDA 1S6YA 3RJ5A 3NBXX 4W8OA 5EP2A 3EULA 1Y80A 3S5UA 1YT5A 1P1KA 3DAOA 1E5QA 3DE5X 1OMOA 2CJWB 4HNSA 4JENA 1KBQA 1GNVA 4B2PA 2XCYA 2BF7A 1G41A 1XDBA 1FQWA 3ET5A 5FT9A 1OH6A 1ONBA 3DMHA 1RYHA 3GCXA 3OZEA 3UH0A 5FBWB 1M34A 2VT3A 3SYKA 3GFOA 1W85B 2D2VA 1ORTA 2ZBUA 3DULA 4PFSA 2FE1A 2Y8EA 3OM1A 3U39A 3USCS 4PG8A 1EXMA 5ED4A 3EMKA 3H6GA 1PL6A 2NQ2C 3RYHA 1I24A 3UG6A 4A2PA 4B6FA 3FMIA 3JQ7A 4XAQA 2FMTA 1N2SA 1ODKA 4NCAA 3I45A 4AKSA 4V02A 1BKYA 1BXGB 3DHWC 4IFTA 4TOIA 4UBIA 5GOZA 2AJDA 2G5PA 3H1BA 1XHLA 4PLYA 3BXXA 3VYTB 5JZMA 2UUAB 3HUUA 2QTMA 4ME6A 4YV7A 1P5RA 4MXDA 1ZK0A 4OXKA 4CG3A 4CM8B 4B3HA 1KQ3A 4MQEB 4QPJC 1VJTA 3GLQA 1W4BA 5AHWA 5F9MA 3IVGA 4RZIA 2F28A 1H4VB 1IHUA 3M81A 3OX3A 1EPUA 5KYGA 5KO2A 2QN7A 1SHZA 1JTEA 2H1IA 1J09A 2AVNA 4MUBA 3I1IA 3TRIA 4DMFA 2O48X 2E48A 1IC6A 2OA0A 3MVEA 4EJSB 3BT7A 5FFFA 1XQVA 2FP3A 3GRKA 1JQLB 2E4UA 1E9RA 4GC5A 3VTFA 4QD3A 3AR6A 5EQDA 7MHTA 4AYWA 3GQBA 4S2EA 1A96A 4MJXA 2AK3A 5IM4F 3TEMA 4UVIA 5JWRA 2QGZA 1HEUA 1W581 3PD1A 2CBGA 3ICOA 3QXSA 4DDUA 4G0QA 1NVUQ 1FZQA 1XX6A 4DIUA 2FAXA 2JCBA 4HZUA 4JROA 1L5GB 3R7LA 1US8B 1FDTA 3KTFA 4BFWA 5A7HA 3TZ6A 2GBCA 2JBWA 3A4MA 1JAHA 3T5PA 3OEYA 2ZWAA 3FOZA 1MF7A 1E2HA 1E79A 5E6SB 2CVOA 4E2WA 3JVUA 1ZQ1A 4AY2A 2W38A 4Z4EA 2PM8A 1WUIS 2AEJA 1OR8A 2YBDA 3E9ZA 3V33A 5KNDH 4ZVQA 1QVRA 2CUKA 4GXTA 3VOAA 1G2OA 3AEUA 4RQBA 2EWWA 4OHWA 5GINE 1F0PA 1CNMA 4IO1A 2V9CA 2W42A 4FWBA 4B8WA 2YV3A 5LMZA 3WBKA 3I2JA 1C1HA 2X14A 2QTRA 3AFHA 4EPWA 4F8EA 3QV2A 4P2GA 5KSPA 5I8ZA 2MYTA 2VHZA 3B7WA 3M1AA 3L4KA 4IJQA 4KU4A 4B74A 4Q9KA 5TSDA 1PNRA 5CM9C 1OXMA 2A3NA 4P33A 2H0AA 1MTZA 1GSOA 2DHQA 4KK4A 5IDYA 2QVYX 3GRFA 3P9RA 4HQNA 3E23A 5TQVA 1NY6A 1VA4A 3OX2A 5DBIA 4L4SA 5TQJA 4CUZA 3HJAA 4UPEA 5ALVA 2RG7A 3QPCA 1E3QA 4IEFB 1ZIYA 4GPTA 3AMVA 2G1KA 3H5IA 3FTDA 4Q47A 4BRSA 2G4CA 4YZ4A 4YUAA 1HE2A 1JKFA 1KEVA 1PEAA 3A26A 5A0TA 1QVZA 3E82A 2QX6A 4ZC8A 3QVXA 4LNAA 2IODA 3UXYA 2HMWA 3H04A 3FSGD 1SQSA 3WQQA 4D42A 4Y3UA 5HS4A 1S1CA 2V0CA 2EG9A 4KFUA 4BX2A 3EWNA 4ZOQI 2WJHA 4MHOA 4B4VA 4MGZR 4XR9A 4YY3B 1BXRB 2ZXUA 1R12A 3A9HA 5EO8A 1BVRA 5F98A 5JROA 1MP0A 4I4TF 1YHYA 1WB6A 4MP8A 3LBHA 3QUCA 1PJAA 1LW6E 4HWPA 4LHXA 4YB8A 5BRJA 2Q3EA 2XUJA 3A1SA 5FOXA 1KIMA 1N1DA 2V5UA 3F46A 2C95A 1NW9B 2P2SA 2JFZA 5DI9A 2QSZA 5HA5A 1JEQB 2WOOA 5JYYA 2J9FB 2WJ4A 4NEHB 4B7CA 2I2XB 2JGKA 1XNQB 3L7AA 1LS6A 2JAUA 3DEYX 3G68A 3H2SA 2XOKA 4DUYB 1INVA 3C6BA 3PSAA 2ZDQA 2PNJA 5LP6A 4NATA