3IAXA

The crystal structure of the tolb box of colicin a in complex with tolb reveals important differences in the recruitment of the common tolb translocation portal used by group a colicins
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
399
structure length
399
Chain Sequence
DSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolB
publication title The crystal structure of the TolB box of colicin A in complex with TolB reveals important differences in the recruitment of the common TolB translocation portal used by group A colicins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 99
structure length 399
sequence length 399
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3iaxA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 3iaxA01
2FPCA 2FP8A 3U0SA 2GVWA 4HW6A 2GVUA 5GX5A 1QBIA 1IJQA 1C5KA 1N7DA 3Q6PA 3V1SA 3S8VA 4GNAA 2DSOA 2IARA 3HLIA 3V65B 2IAVA 2W8BB 4GN8A 2IAXA 3HLHA 1Q7FA 3V64C 2IAUA 5EX7A 2DG1A 3E5ZA 3AMRA 3LI3A 3SRGA 4O5TA 1CVMA 2FPBA 1C9UA 3BYCA 1V04A 2OJHA 1CRUA 2GHSA 2W8BA 4Q1UA 3TC9A 2GVXA 2HQSA 2ISMA 4GN7A 4HHOA 1CQ1A 3LI5A 2FP9A 3IAXA 2DG0A 3SREA 3SOBB 3LI4A 2QE8A 3S94A 4GNBA 3Q6TA 3G4HA 2VAQA 4O5SA 5GTQA 1E1AA 2IASA 1CRZA 4HHQA 3WW9A 2IAPA 5FWWA 5GX1A 4GNCA 5GX2A 5GX4A 2POOA 2P4OA 2V91A 1RWIA 4JMLA 4ZLRA 3KYAA 3AMSA 5D9BA 1PJXA 3WWAA 5D9DA 2IAQA 4GN9A 4PWZA 3KGGA 2IATA 3SOVA 2IVZA 3HRPA 5GX3A 1QLGA 3FW0A 3G4EA 1POOA 3S8ZA 4IMBA 3S2KA 3A9GA 3DR2A 3O4PA 3P5BL 4R40A 2G8SA 2IAWA 3I1CA 2GVVA 3SOQA 3Q6KA 2IAOA 1NPEA 4IYGA 1H6LA 4A0PA 1RWLA 3FVZA 4DG6A 3DASA 5D9CA 3A9HA
chains in the Genus database with same CATH superfamily
1NQXA 3OZEA 1YC2A 2GXSA 3N5KA 3U4CA 4EW2A 3I30X 3A6JA 2P5SA 3FE2A 1IONA 3LHDA 3PICA 1CHNA 4BUZA 1PL7A 3ACCA 3OICA 4K81B 5GINE 3DBRA 3URKA 1DJLA 5KTTA 3TDNA 2XGJA 2J67A 1CP2A 3RHTA 3Q5EA 2OZPA 4GNKA 4F1WA 5CFRA 2DSOA 3AVQA 4XGKA 1FOEB 1KRHA 1MAWA 3RVSA 1Z68A 4YMVA 2NSYA 1OXUA 4RABA 1BN6A 2L42A 3HJAA 2V7VA 3ZDBA 2PBRA 4XPZA 4B5LA 2ZUSA 1HG0A 1S7CA 4ZQHA 1Y4AE 3HJFA 3C5HA 4R01A 3FZYA 3HXOA 1AHNA 4LYHA 5B58T 4LE1A 1YDWA 1XL0A 2NO5A 2PLAA 4M9XA 4NE7A 1UKVY 3ONWA 4XQEA 2IYRA 2JANA 5ALYA 3EXHC 3GDOA 1KJIA 3FRHA 1E9FA 3BIWA 4P4NA 5FIUA 1KZHA 4ER6A 2WV7A 3S81A 3SR0A 1T13A 1QH1A 1ZIDA 3LC0A 3NC4A 4WUVA 4BBAA 4RLFA 3N7TA 3PITA 3P4YA 4ENSA 2Q2QA 4B31A 4JJKA 2XNJA 2R8ZA 3OKCA 2IWRA 4YW5A 2WB4A 3SXUB 3TS1A 4DARA 3KQKA 4QIHA 4MPTA 4TL7A 3WMRA 2BDEA 4ZVLA 4W5WA 1RI5A 1SURA 3TIIA 1TT5B 5JATA 2A9PA 5JMOA 1JA1A 4LY9A 5T4HA 1QP4A 3N8GA 2VTBB 4Q7QA 2WWGA 4HCJA 4JLJA 4ZCRA 2O4CA 3OESA 3SMVA 1OVGA 3RH0A 4DMUB 4C2UA 5JSZB 1R2QA 1LX7A 3QVTA 4IWYA 3HKBA 2YJTD 3HYRA 1G2QA 5K6TA 4GMDA 4RD6A 5DK4A 5LJIA 2HMSA 3T5AA 4HGRA 1XPUA 1PG2A 2IAPA 3HZRA 2QMZA 1DVRA 2F12A 1CVIA 3LGSA 4PLZA 1QHFA 2PH5A 2XWSA 4FQ7A 1K7EB 2PJUA 3BD9A 4JC5A 2F3TA 3C43A 3AFNA 2B3DA 3G8DA 4CDRA 2OBMA 3IURA 4HFMA 4IFBA 4C20A 1ZK3A 1N78A 4MR7A 2D5IA 3NIBA 1J06A 1ZXXA 1NHWA 2RG1A 1GNLA 2PS1A 1RAIA 4Q6BA 5EN4A 3HVRA 1BHJA 4UNQA 2PLNA 1W36C 4XSVA 4JVSB 1QS0B 2FN3A 4ER5A 4CDGA 3AJAA 1SOMA 3G59A 2C1XA 3VTAA 5IM4F 2REQA 4B7CA 3L4BC 1R8YA 3WP0A 4ITVA 3NX4A 4XILA 2BT4A 3P9RA 4Q4HA 1C9KA 1PR9A 2W2LA 1YJCA 5AVTA 2XQGA 1V7QA 5KBYA 2KBEA 3IQFA 3V8PA 3PDUA 3TAUA 1RMQA 5F4ZA 3MMNA 3SJZA 5FA8A 4DE5A 5HGXA 5JAUA 1O54A 2NTNA 2OG1A 3LRTA 4E2XA 1O9BA 4K9OA 2CXOA 2UDPA 5DBOA 2E4XA 3BTVA 1WB9A 1F12A 3DUFA 2BR4A 1DDOA 4II3A 1PZEA 1S96A 1MORA 4B7NA 2V4MA 5HCIA 4B84A 2H52A 3DLHA 4HLNA 4YJ2A 3FCAA 1UADA 2PUHA 3KJQA 4NMWA 2XCRB 1T2DA 2OESA 4U8HA 1I1HA 1QR2A 3D5EA 5AVWA 1QTNA 2G04A 1KJWA 2Y3IA 4LMAA 2GVWA 5ARCA 5GP1A 5JMTA 1IQPA 1GUZA 3SZUA 3AHFA 4BO6A 4HDNB 4Z7JA 1YJBA 2IHTA 3FBWA 5C5DA 2JJMA 1E3LA 2AVDA 4MEBA 4P3NA 4FHEA 2NVUB 3BWXA 3NHWA 4YAEA 3NH6A 5IZCC 2DUWA 1DWOA 1M73E 4LHXA 3ZD8A 2NVUA 4FSHA 4B6EA 1SIUA 3KFXA 4XD2A 2BONA 1FCJA 3VUFA 4ZEOA 1B2RA 4HXEB 4LGMA 5DN9A 3N28A 2F17A 3KQVA 4ZOAA 3DZBA 4CIXA 1ZUWA 4AMVA 1P2FA 1MS4A 5LQUA 4EG0A 4AP5A 4YECA 3JPYA 2ID8A 3W5SA 4Q00A 4YMWA 1NT4A 1OROA 2PM8A 4LRYA 4L57A 5EE1A 3WRYC 2AK3A 2FKAA 2C4NA 2FPIB 3CYFA 5D5HA 3OPXA 4ZVUA 3TQQA 3VHRA 5TGTA 2V4UA 4R1OA 1XHFA 1H4QA 4HUQB 4OXKA 4PGGA 2DETA 2BR3A 4GXRA 3X1WA 1U65A 1K8RA 2RAVA 5EUBA 3TCNA 1FFEA 3N2KB 3QPAA 3P96A 4IL5A 4AJHA 4BUCA 4DM7A 3S2ZA 1FF9A 3TIFA 1IUPA 3W6ZA 3NHJA 1IAVA 1N8SA 2YIDA 2JG3A 5CMLA 5KDOA 1CULC 3A6GA 4JR0A 4CKBB 2XCIA 4HEJA 2C07A 1RHQA 3KVNA 2WC1A 4IYJA 2QWAA 1RXVA 1H9CA 4PNPA 1OFGA 1YR6A 1U1EA 7GPBA 1ZH0A 4F5YA 1PGNA 1GZ7A 3NC1C 4FDTA 1N0HA 4F4FA 3LQFA 2QE6A 2IYOA 3EWIA 2IBTA 3H11B 4J94A 4MV9A 1Q20A 3OQIA 5EERA 2WD8A 5E38A 4C5CA 1N77A 5JD4A 4IF6A 1B6SA 3AWDA 2VDNB 4AC9A 4XYLA 4OGLA 4I55F 4B43A 1NN3A 1YBVA 1Z2NX 3A2NA 3KT0A 4M46A 4EOGA 2SNIE 1H6AA 4P34A 2XQJA 2OV6A 3LXUX 1PZGA 4P33A 3K36A 2B25A 1D9XA 2XDQB 2X58A 2PSSA 1L9KA 1S4MA 4NYMQ 1S3IA 2PL3A 3VSAA 1UINA 4ZVQA 2JHCA 3N76A 1BQ3A 1VI2A 1K3TA 1MO4A 1FDUA 3ZDZB 1YCGA 4IQ4A 2G80A 3RDPA 3WLEA 5KOJB 3NM6B 4IHKA 3U4MA 4EUEA 2EZTA 3BHNA 4MYRA 3BTUA 3H18A 5IASA 2YA8A 3CPJB 1T0JB 3W7AA 1DJQA 4RPIA 1SWVA 3SOVA 2XCSB 1E3MA 2WM3A 4YMLA 4L3OA 1GSHA 3GO4A 5JYYA 2NP6A 4BGIA 3HXMA 4MQFA 1LW7A 1B42A 4P7JA 3S27A 4LJ6A 3H5VA 4PZZA 4Y0VA 4WY8A 4JH0A 2IV3A 1IY9A 3M3PA 1PF7E 1ORVA 2VJQA 1B9TA 4JS0A 1NJ1A 1RC0A 2B98A 2Q99A 4G24A 2BHNA 2G06A 4L5IA 1Z83A 4JFAA 4S05A 2B1QA 3ZLJA 5PGMA 3C3YA 2JGFA 1X8LA 3R3SA 1KQGA 1E9BA 1JX6A 4NTZA 4B3SB 3L49A 1Y3BE 4M1MA 4IILA 4OJQA 1NC1A 2W6IA 3TBHA 1A9OA 4EI2A 3EJWA 3K70C 3OWXA 3JVVA 3GW8A 2WSIA 4ZFNA 4EG8A 1T36B 1J9EA 3FA2A 2BHTA 1DUIA 4I1OA 5ADUS 1H69A 1NMQA 1NDQA 3TZKA 1MS0A 2ZJ6A 4EO9A 2W5OA 3T5GA 2VK4A 4EKYA 4YCSA 3O1IC 1QG6A 2IOFK 4UM9B 2F64A 8OHMA 4PSKA 4ESOA 3DMDA 4HZIA 3H5OA 1HKUA 5DSZA 3HLIA 3N86A 3HB5X 3AI1A 4XIYA 2BKUA 1J0DA 4RSGA 5DSXA 5TPZA 1U3VA 1TVKB 4DILA 2UZ1B 4PZAA 2EAUA 5GZ1A 1R1DA 2OSBA 1JHOA 3B3FA 3TXXA 4G4JA 4NY1A 2G1KA 4XWWA 1RLMA 1X7WB 5EX7A 3TVDA 1XQWA 4NV3A 3OKAA 1MZPA 4MTCA 4YJ2F 4QFMA 2P91A 2DCMA 1BH6A 2AGVA 3WKBA 4DIBA 2OJHA 1KJQA 3OUTA 3DCNA 2Z4SA 2QJRA 3DXYA 1NMZA 4U7PB 2RGYA 3CGWA 2GBPA 4ETWA 3OZWA 1T8TA 2ETXA 1XWIA 2CJPA 3MILA 1GTG1 1ECBA 2FZLA 3KTDA 2Q7XA 3ZCXA 4HLUA 1G291 2CD9A 5J9FA 3M81A 1ZO8A 1WR8A 3UC1A 4BLRA 1Q3TA 1UFRA 4CFSA 2ZAGA 1SXIA 3BSWA 3H1EA 3UAOA 3U39A 3OJXA 5A5VA 4AKSA 4MZEA 1QFXA 4CQLA 4TMVA 4LMBA 3ON5A 4RL4A 3JS5A 2J6CA 5EESA 4N82A 3INBA 2CC2A 4MWUA 4G65A 4BCDA 1HUQA 1Z5WA 2CNDA 5IT5A 4BIMA 2P41A 2I6UA 2TMKA 3D2BA 3D0OA 3LBHA 4KAFA 4LOIA 3TD2A 2HW8A 1XLTA 1M5UA 2ATEA 3VJRA 2HU7A 4UEJA 3B69A 1DQSA 3OO1A 4ZIRA 1CJSA 3K96A 4D43A 2P6PA 1KS9A 4BLTA 1JA9A 5BQ5A 4ZEMA 3LG2A 1AHIA 1CY1A 4KQ6A 4FOYA 3C8ZA 3A4NA 1OV4A 3D7LA 3HBAA 2G9QA 3OJFA 4R1QA 4NFYA 4XLZA 3D1LA 1XPRA 1L5SA 3CZPA 2ZYUX 1Z35A 2YXEA 3IKMB 3O93A 2ORED 1NYQA 4Q1BA 4RMJA 4RLQA 3MNFA 5EZ5A 2P4QA 2V9ZA 4M8IA 4OYLA 1QTRA 1OH6A 3EC2A 3OIYA 3PIDA 3QWAA 1AKTA 1P0PA 2Y1OA 4PEVA 3JRXA 4EB8A 4DLSA 3D3NA 4G07A 2DWQA 2GYYA 1NRXA 1W4CA 4NS1A 4H7FA 1ECLA 4Y9RA 1BDMA 1MH9A 1TIBA 3IPYA 1V4BA 5EKUA 3ZDEA 2I0FA 2EVWX 3E7DA 1SPBS 3IKVA 4Q21A 2J9FA 2O8NA 3RUIA 4OB7A 1X9HA 3QWIA 4XMIA 1C7FA 4PVCA 2OV3A 4UMVA 4ACBA 3UB3A 1T2AA 2B8JA 3AILA 3EPRA 5L4SA 4BMSA 2CT8A 2C96A 4DCVA 1X2JA 2EQBA 5I6DA 1C80A 3QWHA 5HXAA 1U7WA 4LRSB 4G5OA 5EWJA 3NHRA 4N8EA 1DAEA 1M34B 4JGBA 3FRIA 1KMHA 4GB1A 3E3AA 4LVOA 4RJJA 3DR5A 1WAMA 4YUZA 1MZ6A 3G9UA 1MEJA 3NTVA 3E03A 1PTJC 2VNSA 2H9YA 2X3YA 3OF2A 4QGFA 3VX3A 5JJKA 1RKQA 4AJOA 1EFTA 5LUAA 1X1TA 1DRUA 5EY5B 4EECA 3FPLA 3A6KA 1XDBA 2PCJA 3NM5A 3W5DA 2WD7B 5ALIA 2FSVC 3INNA 4IS2A 1Z33A 1ZNZA 3AI2A 2XVMA 1CUDA 3QOYA 4G1FA 5A4JA 4V2IA 2CW5A 2BFWA 2E89A 2QAJA 3B5IA 3VDRA 1QP8A 3Q9SA 4PLVA 5LMNB 4OYRA 2DR2A 1SG0A 3LUKA 3C3PA 2XCYA 4HAYA 4MVYA 4XH9B 3SFZA 4IHAA 1Z0UA 2VK5A 2LBPA 2WINI 4KG7A 1K2VN 2DHQA 2IY9A 5DP1A 4V02A 2DG1A 1UFQA 2EJBA 2HJWA 4XMBA 2H1OA 2BSQA 2HB6A 2ZANA 3OJ0A 3ZLUA 3QMWA 1C30A 2VS1A 1M8JA 3TGPA 4Q9AA 4DSUA 3ZEIA 2OLJA 2VATA 3TC9A 3SQLA 2AHRA 2WE8A 3O2QB 2IZ5A 1QUFA 2JDIA 1LH0A 2GAIA 4F2WA 5GZ6A 4UFPA 4FR0A 4OSEA 4HD8A 4YW2A 2Q1WA 3RS8A 4D8TA 2G83A 1B0ZA 1YDGA 1Q2UA 3T3PB 2GN4A 4CMBA 1C3VA 2GHQA 3CF0A 2DPHA 1S01A 5D3ZA 4AMUA 3BN3A 1S0IA 3QFTA 3WA6A 2JAOA 2OKGA 3BDVA 2BBTA 3PUZA 5IF3A 2O6HA 5FBWB 3RIMA 3IS3A 3L6CA 5A3SA 3TD6A 4QATA 1PS9A 2AI2A 2J3QA 4PS0A 5SZKB 1MQ8B 2HHAA 3QLVC 4XIIA 1CNMA 2WHPA 1FLNA 5C4MA 2HT8A 5KO2A 2RHRA 3AHGA 5EIWA 3L1JA 3LD9A 4OKIA 5DGHA 3BRWA 4ZTZB 2WWYA 4FWIB 1TECE 4MWYA 2ZQ5A 3KPJA 3EA5A 1C0IA 2IOHA 3DLTA 3T9DA 1XTRA 3D7KA 2G07A 1RZRD 3QFCA 4DA6A 2RAFA 3A4TA 2ECOA 3ZWNA 4YBRA 2RK3A 1YT5A 1L5MA 1T6NA 1KI8A 1ZN7A 2A0XA 5CLIA 1ENPA 3WB9A 1I30A 4PXYA 5CX4A 3KYAA 2VDUE 1NLYA 3Q0EA 2WVGA 3ZD7A 2P5UA 1NFQA 4NONA 2ST1A 2C29D 2JFYA 5TS3A 1LSSA 5LLTA 3OPNA 1HRDA 4ENRA 3FUVA 4BFUA 2NZWA 5K0EA 2VXCA 2VRCD 5H0IA 2YICA 4AD8A 1PK9A 2YYAA 2FW8A 3ICWA 2PNJA 1A2BA 1JU9A 3I2JA 4DSTA 2Z3VA 5EJFA 1IVSA 1IN4A 3HUFA 3KWLA 1XRQA 1MNAA 2QT9A 4WZBE 4RTPA 4YRPA 4FI3F 4UQPA 1J0EA 2VJLA 2BGKA 3NU1A 3QPUA 3O9MA 4FC7A 4LQCA 4P22A 3UO8B 5K6AA 3TW8A 4A8JC 1XCMA 2W2NA 1PL8A 1Y48E 3TRJA 3M0EA 1FDSA 5AYVA 2JFFA 4C7VA 4MZAA 2E48A 3CR3C 4HDNA 1F8FA 1OXSC 1D1TA 4TM8A 4LNUB 1QGUB 1ABFA 1WV1A 2FWIA 4JQSA 3IA2A 3EGXB 4MUIA 4QO7A 3ZS9A 3IRUA 4H17A 4MCHA 3ZJTA 3BC1A 3C5EA 3FLMA 4Q47A 2PVPA 5JS7A 5KINB 2VIIA 3UWSA 4CNBA 4FEYA 5FD8A 1WPQA 5H59A 5JDIC 4WD3A 3DE6X 3S8YA 1N4DA 4WLFA 2FWAA 2HU8A 3NHMA 3NYRA 1U28C 4CU2A 3QXGA 3RAFC 1IJQA 4LTNA 3VOSA 2GEDA 4G9GA 3A6HA 1F0NA 1PJSA 1WCIB 2WKPA 4K46A 3JYNA 3ESQA 1KZ4A 1U81A 2IYVA 3ISJA 4X7MA 5T5QA 3X1JA 3U3DA 5KKAA 3FMPB 3OJCA 5EHNA 2FE1A 2JNWA 3SIWA 4F06A 2FMTA 4GN8A 1JFFB 2YIVX 3G82C 2QENA 2D7DA 4LF9B 1NR5A 2PX4A 2ZRQA 4LA4A 2QDKA 2P2SA 3FVQA 3WNBA 5CB4B 4B3IA 3EY4A 1BVRA 3FM9A 3KOWA 3PV0A 2I34A 4B3HA 4BUJA 4E21A 1E2PA 1E32A 5F3RA 1FUUA 1YR8A 3SQDA 3K1AB 1PW5A 3RT9A 3CZ4A 2BL4A 2QB5A 5HOEA 4I81A 4I7EA 4XJAA 4CKBA 2X2FA 1U4SA 1TCUA 1U1CA 3FZEA 2BGJA 2HK7A 2VPJA 1XFDA 4EHJA 1XNRB 1SCNE 1IUKA 1C41A 1QZUA 2EU8A 2QX7A 2ZTHA 4S2UA 4Y2RA 3RRMA 2HO5A 2CY0A 5BPFA 1CZRA 1ADGA 1WD5A 3SE7A 5DWDA 1FXSA 3MYRA 1GL3A 4CEIA 4I9HA 3OU6A 4Q1AA 4K40A 1GPMA 2WG1A 3TLEA 3JYHA 1QFSA 1BFDA 1UM8A 3MQ4A 5ER6A 1TKRA 3O4FA 1BFKA 2AEPA 4G5QA 4LZJA 3P27A 2Q3FA 1KY5A 4IVNA 4J3JA 4RNCA 4YJDA 3T7TA 3TIXB 3DS8A 4I5IA 4EEZA 2OORC 1T8PA 4TGLA 5C1DA 2O8BB 3IAHA 3TQTA 3TLGB 2W71A 4JXZA 5C7YA 1U7UA 1BXZA 3A71A 1LQ2A 1Q11A 3F0TA 3MMXA 3AUSA 4B79A 4HLQB 4ER7A 1GTJ1 4A2WA 3NUZA 3MG9A 2XTNA 2C78A 2Z1DA 3OA2A 5BQPA 4QUGA 1Z12A 2XT0A 2C1ZA 3RIHA 1WETA 2X42A 3C6XA 3PWSA 4FBLA 5E3JA 2PUEA 1GPH1 2H1FA 3VJKA 1U4NA 1KKMA 3BAFA 1WU8A 4WNAB 4R9VA 2FY8A 3V1TC 5ICCA 4AGTA 1WNFA 2P4OA 2C88A 4X3OA 1GGHA 4GOMD 5F5LA 3PDHA 1NVWQ 4RA6B 3D0RA 1XWWA 4OFZA 3AB8A 4HVLA 3LSTA 1T8WA 4TN1A 4EEXA 5I4IA 4BNYA 1YTLA 3UBMA 3NOVA 1INLA 1UOPA 3NDPA 3RFTA 2VW1A 1G8KA 2AQIA 3MWKA 2W83A 4QVGA 5CHEA 3AVVA 4XASA 4JB3A 2ZYRA 4EG7A 3D7SA 2LW7A 3S8MA 1EB8A 1S1MA 2QWKA 1Y37A 4O2AA 1RPTA 1IEXA 1FDWA 3C8HA 4WKNA 3U49A 3W8DA 5MDHA 3R3ZA 1PWHA 5A9TA 3ZWMA 3L0ZA 1S2NA 3I5XA 3OCVA 2PX0A 1EQUA 2GEKA 3HC7A 2V45A 3MMSA 3F6SA 5BN4B 1IH8A 1A5ZA 2A5DA 2QT1A 3ITEA 2BDTA 4YJKA 5DIZA 2J9XB 4RDHA 2N47A 4HLCA 4URUR 5LC1A 5HHTA 4KR3A 3A9UA 1D2GA 1DQRA 3PD0A 2NYUA 3CUTA 1LI5A 3EXAA 3TFQA 3VV3A 4D6YA 1U9IA 4HS9A 2C03A 2C83A 1QPGA 4FVKA 4PZLA 4BO7A 1QGDA 1W5FA 3M3HA 4MEJA 1YZ3A 4RWZA 3KSBC 1AS3A 4HZWA 4DYDA 2BFEA 1CQWA 2IY8A 3H87A 4MRSA 4X5OA 3WKAA 2DAPA 4ZJPA 2R1VA 5L95A 3FRJA 3QWFA 5JNVA 4XUEA 5IJWA 3FTFA 2XTAA 1G6Q1 5AKEA 2YA4A 3AVXA 3E22A 1X7WA 1SK9A 3EXHB 2IE0A 4GBJA 3SXJA 2RSLA 2X1MA 5AD1A 2OCIA 3LCCA 1VDZA 3H3XA 2HT6A 3TI3A 1ELOA 2OHVA 3RJ5A 3GCGA 1P2GA 4PHTA 1E94E 2ADOA 1NQOA 2II6A 5E1DA 3H9JA 5EE9A 1I5RA 5EVCA 3A9VA 3TR5A 3WSVA 3UG6A 1LK0A 3QUTA 3GNQA 3DL2A 3HA2A 2JARA 3DCIA 4Q05A 4E0BA 4KC0A 5L7TA 4ZJUA 3ADDA 2YZGA 2W6MA 1N1MA 4YZ1A 3GXOA 4JX8A 2ZBPA 2CL0X 2CNBA 2GSWA 3QYAA 2FH5B 1AQJA 1YBFA 2X1VA 3GVCA 3QEBZ 2AOWA 4FGUA 2O4UX 4PRZA 3B2QA 5EHQA 1ZRSA 2Y9MB 1MP0A 2QTGA 3JR3A 1OFUA 1Z34A 3JV7A 4E88A 4EPVA 3P9PA 2O9JA 2AOVA 3PDIB 1Y3CE 4FFNA 2YNMD 3A14A 3IP3A 3DT9A 4KS3A 1FSPA 4XXHA 3DEYX 4ND5A 5SY6A 4HH1A 1KJJA 4XA8A 1TK9A 1ZAYA 2IUEA 2NVBA 3CCCA 1FL9A 5C2JB 1YB7A 3OA0A 1QG4A 2HDNB 2ZSIA 5ALNA 4A0RA 3O8CA 5KU1A 3I01M 4A0HA 3IUMA 3KV3O 2Q6LA 1B93A 3GJ8A 7NN9A 1DILA 3JYLA 4M4UA 2ACVA 4RUKA 1I4OA 5IDWA 3IKJA 3HA3A 1NLMA 1OLSA 1R64A 2GJAA 2IIQA 2ZRNA 1RZ3A 2ZRCA 3S5JA 1NBOA 3OFSA 5E95A 2QR3A 1NKTA 1EBBA 3I9NA 5IAOA 1V1MA 3KJHA 1GIAA 3LHSA 3CLRD 3B1VA 3DTTA 2JVIA 2R5NA 4PZDA 3SX4A 4EDHA 4TYYA 1YDEA 1AGRA 1IVDA 2C8VA 3I12A 5H5JA 5BP7A 5EJ9A 5FWWA 1ZK1A 1JFRA 1M1YE 2MMCA 3V4RA 2H92A 3K2QA 7MDHA 1F2TB 2ZQYA 3D2LA 2P1DA 4BGUA 1XKLA 4D5GA 4F5ZA 2IHZA 3C3MA 3X44A 2ZM5A 2AYYA 2VXBA 5HGJA 3T3NA 4B6FA 5A9SA 1TW2A 5F64A 3AY6A 4A73A 5D9DA 1CG6A 2PZGA 4R0MA 1K27A 1UAGA 3REQA 5CDUA 4LZZA 4NZYA 4OIMA 5KREA 1A1VA 3SICE 5BRJA 2RHMA 4WBNA 4POAA 5AVZA 1JZTA 4JF7A 1MOQA 4LHEA 3ZVKA 4ARCA 1IMOA 1ONPA 2HA6A 5DBGA 1N6DA 1T2EA 2V59A 5DXAA 3AZPA 3V7FA 4QYSA 5U9CA 4M4SA 4NYJQ 5TE9A 5IJ9A 2DWUA 3QU5A 3QNWA 1HY3A 4BRWA 2DFDA 1EHIA 2SCUB 1ST3A 3E05A 5GV7A 2BM1A 4B85A 1ZP6A 4MCJA 5MN6A 5FYQA 1G60A 3ZXIA 5LQCA 4NCIA 1B8PA 2GZDA 3QEJA 3U48A 1Z22A 3AFGA 3WK5A 4F3NA 2GUGA 2WD7A 4ZD6A 1SBHA 3V8RA 2EFCB 2Z58A 4CMHA 2V98A 1CF2O 4YJHA 3OIGA 5F4BA 3PXUA 1LTQA 1CC1S 2F3UA 4J7CA 3P8ZA 5FWAA 5JO9A 3WI7A 3S2EA 1IUCA 1XIVA 1NM5C 3NEAA 2RGBA 4X1OA 1Z15A 1E1NA 1YKGA 2CYBA 3EZ7A 2QQGA 2FU5C 3V8MA 2Y0DA 1CYDA 3TR0A 2A1UA 3DE4X 5EVJA 4XJ9A 5DZSA 2BF7A 5HBRA 1BMTA 1NVBA 4JEHA 4J0HA 1IN8A 2PX8A 5BPHA 3MMPA 3A4LA 2VKQA 2Z9DA 5EKXA 4KQ1A 3RWMB 3ZU5A 2K2WA 3MBIA 1FS6A 1C7EA 2BEWB 2QGZA 1OE0A 2AJTA 4UBNA 2X23A 3NT4A 1X15A 2DBZA 3FLAA 1H6CA 1FYFA 1RWNA 3O8QB 3PUIA 3QELB 3T9AA 4BNMA 4D81A 4OX9B 2IS4A 2GVNA 3ABOB 3OZAA 2W42A 2OHXA 4E94A 3VHLB 5KNDD 2F9FA 3PVCA 2CDRA 3ITDA 2Z30A 4Y1EA 3GDFA 5TT0A 3LZDA 4HDKB 3LFHA 2B94A 3U3MA 3BT7A 5KTSA 4F8JA 4KXMA 8MHTA 1I24A 1KQPA 4B6JA 4US0R 4EJSC 4DEXA 3ETEA 2DECA 4M9QA 4CMEC 4COOA 5BSTA 2NT4A 2VQFB 5C32A 3WSTA 2Z32A 3TR6A 1A9RA 3I5UA 5CT5A 3HCNA 3DE7X 4YJGA 1TFUA 4X91A 1B2LA 3RIEA 5B7GA 5BV1A 3ZHZA 1CEXA 1Z45A 3HJHA 3N74A 3UXHA 1WLYA 1HTWA 1W0CA 2FFHA 2LNDA 3O3NB 4LHVA 1JG2A 4RZXA 3H42B 1U0HC 4DL9A 5IEBA 5DGXA 4KACA 4OVKA 3FNEA 3IJEB 3LUCA 1QK4A 1E7WA 2D0DA 2Y0PA 3A3OA 3BWCA 2FPGB 4C3OB 4TVKA 3H71A 4CLXA 5K0TA 5AKJA 1RU3A 1V96A 2VPIA 2R1ZA 1IB6A 4TL9A 5AM1A 5HX7A 1IUBA 3BIOA 4LJ9A 2OHOA 3B13B 1I6MA 3KBOA 1Q6ZA 2CZCA 3V1MA 2J6HA 3PHIA 4Q1EA 3ZGOA 3RVPA 3T5DA 3T1HB 1JKXA 3AV3A 5IC5A 1SU6A 1W5SA 1V11B 3GRAA 1VPDA 3S99A 3WLMA 2X1HA 2XF2A 3ZGNA 4U8GA 4Q3OA 4E5KA 4G0UA 1ZESA 4NICA 3EF3A 3AY0A 3PD1A 2Q0XA 1GNRA 5GGYA 3RYTC 1TYDE 5D7NA 2I91A 1TO1E 3CBQA 1FFDA 4R5HA 2VUTA 1Q22A 3K70B 5ANRB 5FV7A 1EJ0A 1SHTX 5DXFA 1OD6A 1YFLA 1BS1A 3PT9A 2RDMA 3A26A 4CBVA 2KPOA 4FGJA 4CKXA 1NJGA 2XWBF 3DDNA 3QEAZ 1OCEA 1OHHD 3OIVA 4N18A 4QKQA 1R6DA 5DTIA 2D6FA 1C9YA 1F5NA 2BSAA 3KB2A 3S40A 1MX1A 2YHIB 2PV7A 1N6FA 1M2FA 1EAYA 1RXCA 1M8KA 4YJ3A 4OQ4A 2QBYA 1QNFA 4N1AA 5GONB 4QREA 1R4ZA 4W7IA 5J5CA 1HFWA 1V7ZA 2KYRA 4LFCB 4H7IA 4CT4B 4DHWA 4LZAA 3SN6A 4AVYA 1XQ6A 2H2IA 3NLLA 4B7AA 3QQPA 5KHAA 5JCOC 3DSRA 4Q18A 5KWEA 4MDFA 3HJBA 5KPDA 4I0WB 2FR8C 1GLNA 1K4YA 3DASA 2ZVDA 2VP0A 3V7YA 3GRKA 3K8YA 1D2AA 1A5BB 2MINB 1RMYA 2I1QA 1IWOA 1V2HE 4KAAA 4BN4A 2FEWB 2V6MA 2Y92A 5EXEA 1PNTA 3ZG6A 4DLZA 1B41A 4KPFC 4E4YA 4RTQA 2NU7B 2VP3A 2D2XA 1ULUA 1XMOB 3Q7IA 4IXTA 4LZWA 1JN0A 2R11A 5FRDA 2Z2YA 5CB4A 1J42A 1NFFA 2IX9A 3GEDA 4JI5B 4ZMBA 1RBYA 2BFMA 2VC2B 1Z4YA 4MV3A 1BD3A 5EIFA 1GARA 1Z37A 1PD1A 2UZIR 2WJGA 3VZDA 4C1NA 3TJRA 5UKDA 4B3BA 4BKMA 2ZYDA 4U2GA 4TV8A 1YJXA 3SYKA 2PE5A 3M5PA 4NNJA 4TS3A 1CT9A 1SGWA 2ZI9A 3GFQA 4Q03A 2Q29A 5JG7A 2PRZA 3RARA 1K6EA 2HK6A 2NSLA 2PR7A 3MUFA 2FA9A 3GG9A 5JNTA 2XKJE 4UE3S 5IVHA 3GB9A 4MKHA 3WQSB 2GT1A 3AL0C 1PS0A 4D9HA 3G02A 3K16A 4RH1A 3NNSA 2OCGA 1MXFA 2FMIA 3UPUA 3DDCA 4C76A 1EHCA 4P3XA 4ED9A 2Z3WA 3F46A 4DLWA 2C2HA 2MT9A 3GCXA 5LDHA 1BRTA 3SGLA 1Z4VA 2YH2A 3EUWA 1TQDA 3CX8A 4K6CA 3WHLA 4YZ3A 4B47A 5A4KA 4KK4A 2JS7A 2PT6A 3NBMA 1XMVA 3WIDA 1ZA1A 3KNZA 1RKUA 2YX1A 1JHPA 3FOCA 2IV7A 1NP3A 5C5EA 4IBOA 4UZFA 3OZVA 2YC2C 3NWOA 1YJ5A 2VCYA 4FGWA 4LDRA 4MRNA 4QPZA 1K7FB 1R6AA 1W19A 2RONA 4ZT5A 1GO2A 3ED1A 2G5TA 4MVJD 3RYHB 1G5IA 1KK3A 4PXAA 1MZVA 1OWOA 1TPYA 1B6GA 1KJ8A 3HWRA 3USCS 1GSOA 16PKA 2CFRA 3BJIC 4WNAA 1G8SA 1G98A 1D8AA 1IULA 2G7MC 2QL5A 4ZK6A 1OFHA 3EASA 2C4KA 5F51A 1YJAA 1XAGA 5AQEA 1IUNA 3UUGA 4PONA 4A7PA 4DV3B 4JB0A 2YWDA 3JWGA 4NF2A 2IQIA 4ZGCA 2NW6A 4FXPA 4ZGBA 2QNRA 5C3UA 5JXJA 3EQ9A 2HK9A 2J3KA 5EZYA 3KPVA 2Z5VA 2E1RA 2JIZA 1G5TA 1XHEA 2H0RA 3M4ZA 1NVVQ 1EX6A 2ZWMA 3LRXA 1NMSA 5EA2A 1DAHA 3H97A 1XU9A 2NO9A 3M1IA 4MX8A 4FFRA 4XGQA 3O0TA 4QXPA 3I9LA 3DHEA 2OUIA 2G09A 3JTMA 4KW7A 3RUHA 2GR9A 2IJGX 4WE3A 1WSWA 2B4TO 1KAQA 4KZKA 1AQ6A 5HKKA 3TX2A 1JNXX 2ENWA 3FPJA 3DAPA 3KFLA 4MVXA 4BNZA 1GTL1 2VYVA 3ESRA 1E6CA 3N1UA 4OLFA 4RY0A 4NBSA 1CZOA 1REQB 1V8OA 3PHGA 1NXWA 3PGXA 4G8BA 1MO6A 5DX8A 4XJQA 5LLDA 1CB0A 1TQ4A 2PXAA 4EVRA 3IIIA 2R6HA 4ALNA 4B6SA 3SILA 4GDFA 1WB4A 3R3UA 5SZJA 3TLAA 1JQ3A 2Y9PB 4JI6B 2PX5A 2XQVA 3DW3X 2VYFA 4NYIQ 5K01A 1SUAA 3JQAD 5HF6A 1Z7WA 4Q16A 1SM4A 3AKZA 2GCGA 1TJPB 5IARA 4DDHA 1TCVA 3LLUA 2AMLA 3RG8A 4DUPA 4JV5B 4RTLA 5GVSA 1RHRA 1R6UA 4FFMA 4RWEA 1W0OA 5EPEA 3K53A 3MWJA 3RHFA 1KFEB 3ZDCA 2OKCA 4JYCA 2MDTA 1U2PA 1VJTA 4LRXA 1YRYE 2XKAA 5TR9A 2BTOA 1Y7HA 1HXHA 1XDGA 3OURA 4B5KA 3L0OA 1I1QB 5DT2A 1VJ0A 2W2OA 4DLNA 1JL3A 1TMYA 2I2CA 3Q0IA 1VIYA 3E8SA 1PZMA 1NRIA 4Q9HA 3C48A 1AMOA 1M2OB 1Y5MA 2F1IA 1PJTA 1ISGA 1ZJ4A 1HE8B 5C81A 1NPDA 2E85A 4RVFA 3SF0A 3IAAA 3ZHOA 3NAGA 2QVXX 2REBA 2WIBA 3IT2A 4DNOA 2HH9A 2HMUA 3KJEA 3ODPA 4DS3A 4Z49A 3E9CA 2K2QB 3BSSA 3DMFA 2R7LA 5BMOA 5KWJA 4K28A 2DWOA 2WMNB 4MROA 3Q3IA 2P2NA 2H2FA 2AG0A 2HBYA 4FIDA 1PJCA 2D2IA 1QQTA 3QNMA 4TT3D 4A26A 1M2KA 4PYLA 3RRNA 5ICFA 4LQDA 1ZH6A 3K7EA 3CMCO 4KQCA 4U00A 4CIAA 1CRLA 1MX9A 2ZI6A 3P4UA 4X61A 5IH7A 5D5PA 1NXOA 3MOIA 1HDZA 4YT2A 4YHHB 1W5EA 2WQ6A 2ZWIA 4K05A 2YWXA 3PQCA 2CDCA 4INJA 3OIUA 4M0KA 3S0JA 3QKSB 4ZYTA 3L6RA 1E8TA 4C01A 4QN6A 3UXEA 3K9BA 4LK2A 3ALWA 1XD2B 3NALA 1XTPA 4ZYYA 3W79A 1DZIA 1R7RA 1Z2CA 4AP6A 4UJ5A 2PMWB 5EP4A 5G0WA 3LI5A 5CB4F 2XOXA 1P2SA 3JD3A 4FQ5A 4JA0A 3RS4A 5CCEA 3KVYA 4RJLA 4ZOBA 1H2XA 1A7AA 3GNLA 1LNSA 1T4DA 2F2TA 2VCEA 4WKBA 3TM5A 4CF3A 1I7DA 3KKMA 3IH5A 3SSMA 5KQGA 3G2QA 3UJ7A 3ZHVA 1QDUA 1R5OA 3X2SA 2WQ7A 5CDFA 1TLFA 3BCHA 3SHVA 4K2AA 2WJHA 3SLIA 1ZGCA 4IGFA 5BT9A 1TZMA 4TWJA 3GYBA 1L3BA 1G21E 3DEIA 5KQPA 1GAQA 3MAJA 4TMZA 3D11A 2Q2OA 4BMYA 3AVPA 2CB9A 2D7CA 3T61A 1WB5A 3ZCRA 1N25A 4M0LA 1RSZA 4CM5A 4MWBA 4O8ZA 1LPBB 1WQ3A 2O57A 3ENVA 3CB2A 4NABA 1FP2A 1OKKD 1XA0A 1ZRMA 2C9MA 2X19A 2M6RA 2EW1A 2GD1O 2EARA 1OLXB 2PU5A 3K92A 4JT2A 3FGZA 3OCXA 4C30A 4G2NA 4IXNA 4Z2YA 3RVJA 4A8JB 4PCLA 2E7ZA 5ALFA 1TRHA 1ZIPA 2JGNA 4ND2A 2BVNA 2VLBA 4ASUA 4DGSA 3OM0A 1T3SA 3DEKA 4DLRA 5IZCA 2QW1A 2F62A 1KC1A 3DZKA 1W581 4RFSA 4WFJA 3VR5A 4B7MA 4FFWA 3PSHA 3FCUB 3HVHA 3T99A 4RD2A 2OD7A 1N7JA 3QLJA 2OVFA 1P74A 3E3NA 3VOTA 2ANCA 3IUPA 2FI1A 1VMEA 1HT2E 3UGTA 4HAZA 3GLVA 3MB8A 2JLVA 3O3MB 4K9DA 5NULA 3ZKWA 1WBJB 3FTPA 1NBME 1ZGGA 5H16A 5B1YA 5BR1A 3FKSD 1JBEA 5KZMB 5IT9A 4GD3Q 2BKXA 3TBFA 1XMQB 4O4LA 3KQMA 1YNOA 4WA7A 3Q10A 5BSUA 2B8TA 2MU1A 4GRDA 4MKFA 1E6LA 4RK0A 2Z3ZA 4XWKA 5CFZA 4KS1A 1EDDA 4RCVA 2BGMA 2OHGA 4KWTA 5E6RB 2M6KA 3OHSX 3F3YA 1AQUA 1KVSA 2HUPA 4OHUA 2AVNA 4RX1A 5DTJA 3ZGVA 4J91A 4D3ZA 3RSGA 5HJ5A 3AYXB 5EKSA 4K9LA 1KQ3A 2HMYB 4TTJA 5AW3A 1XKTA 1BXRA 1MWEA 4EVIA 4JOCA 3UA4A 4QD3A 2NMVA 2J45A 4O5AA 2Z04A 1PT7A 3V80A 2DERA 2PMFA 2BEWA 3B1KA 5BYBA 3B9QA 1BH2A 3HGTA 4L3VA 4J3NA 3QELA 3UK6A 1SXQA 1QU3A 2X8BA 1VB3A 4D45A 4IDBA 2RHGB 2V7QD 3UJHA 3V65B 1AVTA 3JQ7A 1AC5A 1USVA 4RNDB 3G49A 1JNYA 1JDBB 2Q5QA 4HBGA 4HDKA 1C3OB 1FBTA 3T1EA 1N0IA 1UDBA 3O9JA 2OLEA 3HBJA 4TMKA 2VQSA 4J4BA 2WSLA 4YMUA 3A1CA 3H16A 3T1NA 1R6BX 4UHFA 2P79A 1NA5A 2YQ4A 2EFJA 2ZT6A 3KR0A 2FQQA 3M4YA 3WNQA 1A95A 3D8TA 1N36B 5JAMA 4PHFA 4L78A 5CAEA 3QV2A 4QT4A 5AJHA 5LQJA 1V3DA 2IY7A 2Z6VA 3VR4A 5JPCA 1G9XA 2I6SA 1IVGA 3JASB 3NV7A 1DU4A 2NV2B 1U6KA 5HJEA 2WKRA 3CKYA 4GSLA 5GV8A 4ZZ1A 4KN5A 4BZQA 1G8YA 1KC3A 5AKKA 4D8UA 5FBQB 4PZ9A 5K0JA 1MAVA 1V5EA 4KN6A 4AG6A 1P4SA 3TX6A 2R00A 2B78A 2YTZA 4L4RA 4WK4B 3UMMA 2GJ4A 1E3WB 2GXUA 1P31A 4L9RA 3WXMA 2WFZA 3BGIA 1SO7A 1FTNA 3OQVA 4DQDA 2OSVA 2VEOA 4L8VA 4N39A 2CD7A 1GZ5A 3T7RA 4B9EA 1JLMA 2I9KA 2O8DB 2IODA 4PZYA 4IUBS 5B6PA 3KZVA 5M1ZA 3M6VA 4WEFA 2PH7A 2ZBGA 1NNAA 3MLBA 4WPGA 2W70A 3STUA 4DR1B 5DLEA 1Z8NA 4ZO9A 3T1TA 3R8XA 3I2YX 2A14A 3H2IA 3EDQA 1YCDA 2EW8A 2Q5OA 5DYGA 4F3CA 1MXHA 2QN2A 2YN4A 1NQVA 4P5PA 2LZ0A 1J0CA 4HGQA 4V0ME 3O74A 3CG4A 3ACBA 3IQEA 4PC3A 4QN4A 2J1LA 2IP4A 2PWZA 3JQ8B 3UMSA 1OV6A 1K97A 4UMEA 4FYXA 5FPYA 5HRCA 2C9CA 4WEQA 4YAWA 1JPJA 2ZE5A 2Y0CA 3K0CC 2BERA 2XGOA 1GG2A 3IDQA 3P9QA 2A1TS 1OZFA 3ALXA 1OFTA 5AJTA 3VVLA 5TGZA 2YW2A 1KR2A 1YR1A 1F0KA 2YHIA 5A3VA 3RCBA 3IBCA 2A5FA 4P0PB 3PEFA 3NBXX 3UAVA 5K0GA 1M0TA 5F78A 1OW3B 2EFHB 2OMEA 4KAXA 4QNMA 1Z7BA 2H1RA 4YWJA 3FWPA 4EYEA 3O82A 4MX0A 1XTUA 3MRTA 5K3DA 3FTCA 4XGNA 3THXB 1CZHA 2V3WA 3C6KA 4ZICA 2C4UA 3IUQA 1XOEA 3DUWA 3HS3A 5E8JA 2DKOA 4DRXB 2MINA 3VH2A 2V03A 3KZXA 4OBXA 2PJRA 2QE7A 2XN4A 2R1UA 4LPKA 1FFWA 1L4BA 2NU7A 2HCTA 5E4FA 3K0KA 3FZGA 5HZGA 3GT7A 1RRKA 2H1CA 4IDQA 4X20A 1ZC4A 4A0SA 1SXJE 1ZJWA 4KUEA 1LS6A 2YV3A 2HT5A 1SCBA 3JWJA 3PUJA 3VC3A 2GZ3A 3CR8A 3DGEC 1WZIA 2GFQA 5EEGA 5ALVA 2GVUA 1A69A 4DM3A 3MWDB 4IKEA 5L8VA 1JS1X 3K94A 3BCUA 1Y6GA 2QRZA 1PG0A 1UCFA 5JEEA 2OGZA 1XELA 3D6AA 2O54A 3L7OA 4CKYA 1CVLA 3LC2O 4EF5A 3GGSA 5JWOA 3S2GA 2J5BA 3O8RA 2WG0A 1ZISA 3V2UA 1RPJA 1WCV1 1GZ6A 2VF7A 4XOGA 1U1GA 4OOFA 5HTOA 2CNKA 3OEWA 4LYEA 3D31A 4RHEA 2VDVE 3T5PA 2VWGA 1HC7A 4MNTA 3AMRA 4UUPA 2CF5A 3N39C 3MS7A 2OA0A 2XA2A 2J5XA 1YUMA 5HJ2A 3OE5A 4UUOA 1S2MA 1NBAA 3D1VA 3TJMA 3P26A 3KKLA 5DM4A 1ACMA 1N6NA 2GZSA 2CNLA 1HT3A 1UZLA 3UMRA 4YAIA 5JZSA 4KQ9A 2X0FA 2H11A 4XOIA 4C4RA 2EJTA 1SQ6A 1FQWA 1VHDA 3BE5A 3K2EA 5AJYA 4A6PA 2VPPA 2SIMA 1MBZA 1RRPA 1W73A 2W2TA 4CM7A 4DDWA 5KEIA 1MA0A 1MX3A 1SRQA 3SI7A 3V3KA 2IC5A 3BUSA 2FHPA 2IYEA 5LMUB 5I5EA 1S3FA 1YIAA 4DCGA 2LCIA 3LSYA 3W4KA 3KKOA 3F71A 2JHAA 2R6R1 3G9QA 3OE7D 1NY5A 4WOPA 5C8YB 2RFLA 3GJZA 1QZZA 4EHDA 1KVUA 3C1AA 3HUTA 2I3ZA 2YZKA 3OT1A 4OYHA 5J43A 3OZCA 1R0LA 3HCPA 3T3EA 4M0CA 2AX3A 2YC4C 1U0GA 4QEDA 3A37A 3AQ4A 2PUBA 3IUEA 3I8SA 1JG3A 4PFJA 1SQ5A 5AM4A 4B1FA 4BCCA 1M75A 1M2VA 1OBOA 1XF1A 2G5GX 3BCSA 3NHZA 3TI7A 3W8EA 2ZWPA 4UTVA 2PXCA 4OA5A 4NBNA 4ZPJA 1K3UB 4Q19A 4R2KA 4KVZA 2PA3A 4NBKA 3AZQA 1QJCA 5M3BA 2HTWA 4E09A 4ZJZA 3GVLA 1KQOA 1M6VB 2NWQA 3WFJA 3MTJA 3OU7A 2ERCA 4XJUA 2YXLA 4RD4A 4IVRA 4C3ZA 4V1CB 5I51A 2I7CA 2I6XA 2FWBA 2N1BA 2FSVA 2OBNA 1YV9A 2VP2A 1NQWA 2JBHA 1T4CB 3V55A 2QW0X 1AY0A 1DXYA 4MJ3A 2JW5A 1ISJA 4LPSA 2WTEA 3LUHA 2NU8A 4LXHA 3LDGA 3ANMA 5CB6A 1DE0A 2CXTA 3PRYA 1YDFA 3JAKB 1AKMA 2X2OA 4DV1B 4BKOA 1T1RA 4DCNA 3FH0A 3T0FA 3T34A 3ULKA 4J43A 4QN3A 2VK8A 3AFMA 2G8SA 3HUEA 1INGA 3HVUA 4JAVC 5D6NA 5ED0A 2XZJA 5LQDA 1WRBA 3GEEA 3H8SA 1FXUA 1V1JA 2XAAA 1MF7A 1QSGA 3AR3A 3DNPA 3P2JA 4L85A 3WWDA 1L7QA 4L4ZA 4BTEA 5B2EA 1NW7A 3LGXA 5SZIA 5KYNA 1KH2A 4KIFA 4WGGA 5H81A 1XHLA 1JLKA 5K05A 1ADYA 2R751 3NHSA 2Q62A 3B82A 4UAUA 2W2PA 1O7JA 3L79A 3BMNB 3T7DA 1XU7A 5FUMA 5HQ3A 5KYGA 3ZJUA 1AK2A 4YACA 1CD5A 1VKOA 1EUCB 1TUIA 4FE3A 4RHUA 2F1OA 4TYMA 4W1RA 1VXRA 5G1NA 3TTUA 4N41A 5JJLA 1EH5A 4P5DA 3BTOA 2ZETA 3C4JA 2AEJA 2IYNA 3KTAB 3LKVA 5GONF 4KLAA 4N47A 2C98A 2QS9A 3F78A 1TAGA 5AM2A 1KZ7B 1E77A 1QRDA 5FUXA 2FG7C 4NZMA 4EJSB 1NLFA 5DGDA 2BE9A 2VP5A 3EVFA 3RR2A 3VHXB 4D97A 4E14A 2R6JA 4JHXA 4NE9A 2AZMA 3QLVA 2PUFA 2FMUA 3EGOA 3EXFB 1XZIA 4RGYA 3VPXA 4D42A 3ESAA 4QGAA 4ZCIA 4YB8A 2QUKA 3RYCA 3VDNB 2ZRGA 1H1LA 2WKQA 3E8MA 3MBKA 1Z2DA 2FOXA 4BKQA 4NG5A 1DIGA 5F2KA 4YR9A 4DJ5X 4YH1A 4RBNA 1XZHA 5AKLA 1E5XA 4KFRA 4OBWA 4UBMA 5JASA 4DA4A 1P75A 4K1IA 3OPVA 3GJ5A 3WQRA 1J07A 4LQ4A 3T52A 2HWUA 2TMDA 3DE2X 3HU1A 4XQ9A 3BQNB 1EXWA 4GM4A 3GGGA 1NVGA 5IXSA 4U3JA 1ESZA 2GBCA 1IG3A 1XQYA 1TU4A 3QVXA 4BVLA 1SCDA 4WQMA 3DPSA 3J7TA 4XCVA 4R2MA 4MA5A 3IELA 2Y1XA 3GHYA 4XVUA 4UUMA 5GADl 1BKYA 1N6PA 3FYHA 4M0MA 2I8AA 1GQQA 3ESDA 5T4EA 5K20A 4R5MA 5I5GA 4I8IA 2OP1A 3A06A 1UT6A 5JNSA 1HYHA 4PBTA 2IU4A 3R8CA 4A8JA 1HE4A 4RV9A 5FKJA 1JAYA 3ZHUA 1E1YA 1O94D 2XUKA 1KERA 3JQFC 4SLIA 4PFKA 2HTFA 3IAFA 1HEIA 2PSHA 2W90A 3LXXA 3I0ZA 3NO0A 2V9PA 2PYDA 3NT2A 4YALA 1V16A 5ALGA 3RBVA 5AM3A 2AEEA 3RRJA 5G02A 3KDAA 1N33B 1EK6A 1U7ZA 3E8XA 4GOOD 1WV0A 5GPBA 3AIOA 1ISPA 5JCXA 1UJNA 2CHUA 1YS6A 3KR2A 5HZMA 2W6JA 4KP7A 1HDYA 2QPTA 2H0AA 1U28A 2HJGA 4AKHA 1E2QA 2OAQ1 4GUAA 2JFPA 3VV2A 3K09C 5JHHB 1Q7BA 1WM1A 2HA4A 4G56A 3QLUA 3S3TA 3RVRA 4HZUB 4IH9A 2QVLA 1FSGA 3CF6R 1U7DA 1KSJA 2DUJA 3IVAA 1CY7A 1BSVA 3NW9A 4RJKA 5E6RA 4CM8B 3M1YA 1MU0A 3F7NA 4HDCA 4RTRA 5L4NA 2C8LA 3TTTA 4A8HA 4DT1B 3OM8A 3TSWA 1XKQA 2QHXA 3OC6A 4M49A 3WHIA 5JQGB 1XN1A 9MHTA 1HRKA 1JJ7A 4OXYA 4UBLA 4AJNA 3FNQA 1VHJA 5AHOA 1GRNA 2EWWA 2G5CA 3RKRA 4Z9FA 2K5UA 3KPYA 2Q7OE 3CZ5A 5EKDA 3LC7O 4ZVKA 1ZNXA 3ZOKA 1NW6A 1DDGA 1NOKA 3MAGA 4LV6A 4DV6B 4DIOA 2C0CA 1BWPA 1G5RA 4PX9A 2H85A 4F5WA 4B4WA 1NUAA 1VSQA 1PP4A 1EK2A 3GGCA 1RBMA 2XOEA 3GFTA 3LA8A 4WY5A 3VNSA 2QNIA 1FNBA 2QZJA 2FQWA 1SVMA 4RQUA 2IAVA 1O0BA 2IL1A 2BFFB 2OORA 1SC6A 2ZJ1A 4BJ3A 4YR7A 1E79A 1XTVA 3WGUA 4LOKA 5ENZA 1G64A 1W8IA 1GRVA 3NH9A 1OU4A 4CF6A 3JASA 4DG5A 4FP2A 1CUXA 2XYVA 3ET4A 1P2DA 3W6UA 5KNBH 5K0FA 2HSZA 2QNBA 1PFUA 3CRW1 3RFFA 4R68A 4Z51A 1QPZA 2UU9B 3SRGA 1UMCB 1YFZA 2GD2A 3N59A 3R7AA 5BN5A 5CJJA 3RHSA 4Q7KA 4YW4A 2PIAA 1U9ZA 2WICA 3CNLA 3I04M 3QG5A 3QVWA 4IDOA 4KDFA 1IM8A 2HBZA 4MW0A 3G9XA 2WJ3A 3QE4A 3MF4A 4MJUA 4BFSA 2EJWA 4L15A 3T7AA 3QEMA 4NJEB 1RAGA 4ZP1A 3SU8A 5E3HA 2G28A 2DYKA 4UU1A 5F23A 3LVFO 5JMPA 1DUVG 3BKXA 3ZGYA 1NF3A 1UPFA 3ZWKA 1QVAA 3PYLA 4AJKA 4PAGA 5A1TA 1VDMA 2ZR7A 1ESNA 3SOBB 3IB3A 4G0MA 4JNKA 4LF5B 1EGMB 3UA3A 3R7BA 3S2YA 4AY5A 1ORRA 2C9DA 1VP9A 2ZRAA 3F6EX 3ONVA 3VKWA 2F67A 3CT4A 3D5QA 1SKQA 5M7EA 1WKBA 2B2NA 2PAFA 1E6MA 4M9UA 2EKDA 2XBUA 4AIIA 1R37A 3EXG2 4JC0A 2WUGA 4X90A 4MARA 4PO1A 4BO0A 5ENVA 1XQ9A 3I76A 3JQ8A 3I09A 3T06B 4W63A 4NK5A 5A7FA 2A5GA 3EW9A 3W5JA 3ETDA 1EVJA 1SCUA 1R0KA 1A4GA 1NF8A 3G2HA 5DW0A 5IJ0B 1P0IA 1RRVA 2ZTVA 3RFVA 5EWLB 4OHOA 3UHAA 2HRCA 4CW7A 3U62A 3V48A 1Q16A 3GFOA 2POOA 3BBPA 2D3WA 4QX6A 2PRKA 2CCKA 3HJNA 3JAWA 4BAUA 1FRZA 1S18A 2D1YA 3JQAB 1CJVC 2NU6B 3KXLA 3AMSA 3O4JA 2O2SA 4XM0A 5JADA 2NZJA 5AK4A 5FTLA 5A71A 2GM3A 4K1LA 4YBZA 5JS8A 2QR2A 4KQFA 1T15A 4DWVA 2O3UA 4DB2A 3NBAA 3OLXA 4DRXA 4CLRA 2FHSA 4GDJA 1PR3A 1OR8A 2C3OA 3H6GA 4FOLA 5ILQA 2BWJA 4MZXA 1YVUA 3TNDA 4MKZA 4BJ5A 5K8IA 4X1KB 3L8FA 2IA5A 3AXTA 1YHNA 3DEFA 3S2KA 4YFVA 5EJ2A 1CDEA 3WWPA 4G63A 4AZVA 2JGEA 5IN4A 5KU7A 1DEHA 1VZ3A 1PWZA 2OBBA 1AT1A 1M6YA 2FVYA 2UUPA 3A3NA 3DWGA 3ORYA 4UQOA 3MTEA 1CNEA 3SANA 2DPYA 4CMIA 3DMRA 1V35A 3MT9A 1T3GA 4F0JA 2ZS9A 1G5QA 3DZIA 3OZRA 4D3SA 1QE0A 1HV8A 2JFNA 3BGVA 2HTVA 4OBEA 3RO7A 2PKEA 4TKZA 4EO4A 3HYLA 4BVBA 4MQEA 1U5AA 4D9EA 1V95A 4ZU3A 5FI3A 1T4GA 3KS9A 5CIWA 3ICOA 1U7XA 5L3ZA 2RAUA 4UM7A 3BF7A 3ZVRA 2WFLB 3NTQA 4BGEA 4FD3A 2IU0A 3B3AA 3IYLW 4YMGA 4QFBA 4ILEA 3ZE0B 1INYA 1YK1A 3G5MA 3Q6MA 5FBHA 5WRFA 3WB2A 5GX5A 4KRFA 2CFIA 3IR6A 3BA6A 4BNVA 3DP9A 5TNXA 5LIPA 2LRHA 3EMVA 4GR4A 4QU0A 4CPLA 1Y8QB 5HSGA 4GWGA 5JYEA 3IVGA 4GMHA 4C07A 4HQLA 2BHLA 5AXBA 1G7RA 1RABA 1Q7TA 1L7VC 4LCBA 4JP5A 5L51A 3ESXA 3O47A 2OLKA 4L4XA 1POXA 4JYZA 1D6MA 4HWOA 4Q3NA 3ZW9A 3JU4A 1Z73A 4O4IB 1ECCA 4LSWA 4OQYA 3UJBA 1JDUA 4EEKA 1L9XA 5BOSA 2B34A 2P30A 1XDSA 1TM5E 2CJYA 1C0KA 1OYOA 3A9WA 2ORWA 3CCBA 4NE2A 3T7SA 3R7WB 4NRDA 2IUYA 2WOJA 5FPTA 2B1IA 1P0FA 3WWOA 2G1PA 1JV2B 3TLZA 1O6BA 1WQ1R 1IPEA 3SS7X 4OU5A 3BZBA 1MNQA 2VK7A 4RDXA 3KC2A 2ZRJA 2NV0A 4N9QA 3LP6A 1PT5A 3KXIA 1Z88A 3A6ZA 4Y9UA 3UVEA 1TUEA 1C1XB 1FXWF 3CNOA 4XWYA 4C7OB 2DWCA 3ITNA 3O1LA 3DD5A 4MUMA 5KAMA 2D1TA 4ZJYA 2ZR0A 5TT1A 1L5QA 4GOND 2Y1CA 1O9GA 4I99A 3B9PA 3WICA 2ENUA 4N03A 5D3KA 1PBTA 3SVTA 2V7BA 3CUVA 4LJAA 3EZLA 3G9TA 1R9MA 2ID4A 1VG9B 1G7SA 1C7IA 3ELBA 1BEEA 4IOLA 4ALKA 2I33A 4Z1OA 5FWXB 1Q7RA 4RENA 5D3QA 1JIIA 2PXXA 4Y30A 2Z95A 1EDOA 2I1LA 1L5VA 2FPMA 4MUHA 1YJQA 4I08A 2HX1A 5EHZA 1U6DX 2FZEA 4V1CA 3T4PA 5T41A 4V0OA 4W99A 4UU8A 4O02B 1JI0A 1LDYA 1QG2A 3RF6A 1DX6A 1LPNA 1HQYE 2AQ8A 3FPAA 5KSPA 4G4SP 4U2FA 3WA7A 3C1OA 3VH3A 4CEJB 5I3ZA 1W30A 2X9NA 4KHZA 4LJ5A 4HTFB 3DOOA 3L2OB 3B20A 1NM5A 4UEWA 2F11A 4UVDA 2P6RA 5JV5A 2A0YA 4RKYA 2ZPTX 2Y4NA 4JI0B 2WJPA 4D8SA 3KKKA 4MV6A 3RODA 2PL9A 4OM8A 1KWGA 3H5WA 4XFKA 4TMYA 2AWOA 5HWSA 1NBIA 3WN7A 2XQIA 3M4NA 2ZYSA 1RKVA 2JAWA 3RGGA 4PBSA 5U4XA 2Z2IA 3AF1A 3SKXA 3ICVA 1M8PA 2PUJA 3P5BL 3UKJA 4MV5A 2IP1A 1VSUA 3C85A 3PNOA 5C1IA 1XJQA 2FP3A 4BX2A 2FPPB 1I6LA 1Z5GA 2CDNA 1E7QA 2H4HA 2IYYA 3GJ3A 3FPBA 3PFHA 2LR0A 1P6QA 4K2HA 4OXXA 2MYNA 4RA9B 5ALPA 3IE1A 5FWYB 1DQYA 4G26A 4ZVPA 4B8YA 3N2GB 2AG5A 3RWOA 2LE0A 2PSDA 3CYEA 3GFPA 3NWJA 2EF1A 2VJNA 2VN8A 1P3Y1 1AQLA 1KHTA 1CUSA 2PRYA 4FP9A 4G9BA 2JJ2D 2R6AA 4RZ2A 3VVCA 1W47A 4HLDA 1F06A 1UP6A 1I9GA 3A3KA 4XX1A 4I9UA 2XH8A 5HKOA 2PY6A 4BJHB 1JVNA 1U0NA 2OV1A 4GGOA 4K9NA 3VHXA 3UPTA 1CZNA 2AL7A 1NQUA 4UCWA 5ERYA 2EX1A 2CLIB 4MWOA 4HAWA 4RKEA 4RKRA 2VHYA 5G40A 5SY9A 4J76A 1J25A 3GWGA 5BRAA 4LXXA 1TLTA 3N7AA 4UKDA 2FEXA 1A04A 2VSFA 3BD7A 4G36A 5KSYA 3HZZA 5ECDA 2V7XA 5T8KA 1AH2A 4RSHA 5AM0A 3EXEB 2NXEA 3HCDA 1XCJA 3EVGA 1LXCA 4E2WA 1SLLA 2Z6UA 3PXAA 4DLLA 4F4IA 2HWWA 2QK4A 1M10A 2SICE 5FL7D 1LLCA 5LM3A 2VTKA 4XQGA 4ZV7A 2R6DA 3V8BA 4LZLA 4DYVA 2ZBEA 2ZXEA 1GGMA 2O7RA 1AHPA 1RJ9B 3R0XA 2D5BA 2R1TB 3ENWA 1UAAA 1QIHA 1Z4OA 3C3KA 2GA9A 3N53A 4TS1A 2VL7A 3F98A 3I6ZA 3OTWA 4P31A 1NYLA 1L7PA 2OOKA 1F4PA 3RT1A 1JR3A 2GDZA 2QP3A 4Q3DA 3IAUA 1C9JA 4JBIA 3EH1A 5C53B 5K3AA 2PT5A 3NQ41 5E7QA 2WAOA 3WHKA 5JTTA 1IL0A 3H2ZA 3A9CA 2BH2A 4C0WA 4FD2A 4K87A 1IHXA 3VPDA 4G5GA 4CNQA 2EJUA 2FPSA 4YGXB 3UAXA 5CG1A 5K8CA 2E82A 2XYPA 3GUYA 3PF9A 2DBYA 1W5AA 2XMDA 4HX5A 1MG0A 4PAOA 5KNCH 4GLJA 4B33A 2C7OA 1J9ZA 3NOQA 4CM4B 4IJ6A 5EINA 3UH1A 1L4GA 4MDHA 4D80A 1I7SB 3ADBA 1B9SA 1U2GC 2OVBA 5LYYA 3ZN2A 4AN1A 2VAQA 1UMBB 5H3LA 4IDEA 3DEZA 1XVLA 4MWQA 4WX2B 2ZAIA 1FUKA 4K6MA 2AXNA 1LWNA 3SSOA 3WL8A 2UZAA 5T4BA 2PEZA 3M5DA 5I9IA 4A91A 1SHJA 2BCEA 3EVCA 3EQ7A 3REGA 4AQYB 1KO4A 5JCOA 1NJ5A 1T43A 1W88B 4DWOA 1R0RE 1BDBA 4BEVA 5C80A 2FPKA 5C8YF 5JXHA 3OIWA 1F2DA 2FR8A 2VT7A 3BYZA 3ENQA 1HDGO 1TL7C 3ND8A 2IHNA 2Q3JA 1US8A 2PZAA 3E1GA 4QEZA 4FOTA 4Y6OA 4A03A 5M2QA 2IOYA 2AGSA 5E6UA 1SBTA 1K7CA 2D5LA 3DMYA 5CW1A 3IP5A 2ECFA 3SJUA 3S1SA 3I73A 1RPZA 1HDRA 3H9BA 2ZUBA 2JFOA 2QRNA 2DFNA 3JD1A 3QBTA 5DHSA 4EO7A 1WXXA 3N8IA 2WR8A 3S2IA 1DUSA 4UU7A 3NBQA 4Y0AA 2C8KA 2HSJA 3AFHA 4IJQA 7ADHA 1ONSA 2FPWA 1UPUA 3R24A 3UK1A 2KSQA 1LVHA 4M1SA 3QW4B 1TCAA 3KOYA 1RJDA 2RGDA 3DF9A 1Z0FA 1FRNA 4HDMA 1RAFA 1UC5B 4RTKA 5D86A 1CUCA 1BOOA 3R9WA 1XQVA 2DSNA 2HA5A 2B2XA 3WYAA 1PYDA 3LX6A 4V24A 2INGX 4WFQA 4CUKA 3EDYA 5D87A 1C81A 3WLAA 1IRXA 4AY4A 4N5LA 3JD2A 4DPKA 1GL6A 1L4KA 2WPDA 1F6DA 1HWYA 4I00A 2BMEA 3NWPA 2AD1A 2I4TA 3WG9A 4RDIA 3PUYA 4XJXA 4M7OA 1YBMA 2GWRA 2DRIA 2RIPA 2CLDX 1PDVA 2VPWA 2VO1A 2VHZA 1ZS9A 3GQBB 4JHLA 2VA8A 1P3DA 4M2LA 2JRLA 3GC6A 4WTOA 4CMCA 1RNLA 3HPQA 1RS0A 4JA2A 4WVFA 3WRYA 1FJ2A 1BRMA 4Q7LA 3IPLA 3LE8A 4Z4IA 1U9YA 2NVWA 1JIXA 4EMSA 4ASCA 1QO7A 3KYCA 3PVZA 3QGMA 3TPCA 4EMTA 2OHJA 1FLDA 3EEQA 3BCRA 4H15A 1GUYA 3KT3A 3B60A 1G3IA 1VM6A 4KVAA 5ESRA 3ZBQA 3LFTA 2ZLBA 3CURA 4JL6A 2FWPA 1SOWA 1USUA 4HX9A 4B6QA 4BQFA 2VNIA 4NJEA 1M2GA 2XHZA 2F59A 5JVDB 4CUJA 5J23A 2B1JA 3MT7A 3W78A 4G0VA 4NFHA 4O4HB 3DD1A 2FSSA 1I51A 4NBLA 4JI7B 4YCBA 2EJVA 1PWYE 1RHKA 2QY9A 1K7XB 1H93A 2CXQA 1DEOA 3JVUA 3K3PA 2X4DA 4HH3C 1ZOSA 3OCJA 4UCXA 5DFAA 4CKWB 4NOMA 1ZITA 1KSHA 3H13A 5ECGC 3HHEA 2ZKLA 3TQFA 3T1QA 4XMAA 4BFTA 4KRXA 1P0MA 1X7YA 1V9LA 3EF0A 1W6RA 4PPNA 4BKRA 1W4LA 4JR1A 5IJ0A 3HRKA 3UAGA 4TSFD 4PW0A 4NN9A 1C3XA 2PYIA 4WN9B 5EWLA 1M2JA 1QXSA 4B3XA 1L5WA 4X1YA 4D4IA 5KTNA 1WSAA 2BFDB 1NATA 3G2PA 3K4PA 3BWEA 3KZMA 4GSKA 4W6ZA 4EA7A 2IUUA 1ZD2P 2NU6A 4EHHA 3HN2A 1E1MA 2X6RA 3CW2A 5JWRA 1U0EA 2OTCA 1NCDN 2RARA 4K26A 2JK1A 5FOSA 3ZWAA 4YUYA 2FLUX 1VRWA 5LBUA 3A2MA 3GJRA 1XDWA 4M6WB 4JI3B 3BB1A 3EVZA 1YL7A 2V8BA 3E35A 4X4AA 1B00A 1D2MA 2QYSA 4HGZA 5IBRA 5IFKA 1CY8A 4HDOB 3ZHXA 2IZ1A 4KXWA 2PKYX 4BX0A 3OEYA 3JARA 2IKSA 3EXIA 2CFOA 4MITA 4IDGA 1W76A 2ODEA 2CJFA 3EZ6A 5HYVA 2JA1A 5L3SB 1FLVA 2C61A 2MSNA 2OWDA 3U40A 5LWQA 1GR1A 3EBLA 1QG0A 3DGFC 1QVRA 5AJZA 1EWRA 1A88A 5F7XA 1J1UA 1CQJB 4KFCA 4M1QA 3RV4A 3VO2A 2GZAA 4CH9A 2XTZA 4UPEA 1MIOB 4Z8XA 3VZCA 2GD0A 4FDUA 1XEWY 4RMGA 2W2MA 5BN3B 5BNIA 2B1RA 3UB4A 1PV4A 4AB1A 2QI9C 1RQ2A 2WFLA 1YZHA 1YHZA 4P4SA 2WTMA 4TN5A 3Q6KA 3K2IA 1U0FA 2E5LB 3EQ6A 4GR5A 1ZIYA 1ZJYA 2VTDA 2Z2JA 3T41A 2NQ8A 2PH1A 1JTFA 2YVQA 3MHTA 4P32A 3U4DA 1N4AA 1KH3A 2O5VA 5E1BA 4P98A 1Z50A 4XLLA 3HCRA 1I2ZA 4EAQA 5FA6A 3U0SA 1HI9A 2A4KA 1B15A 2UVPB 5AJWA 5JNLA 1KIMA 2C4HA 3HCWA 1JEOA 3H0KA 3PXXA 4TMXA 5U1PA 5AIBA 2ID9A 2Q4BA 3FNFA 4GZLA 5T3UA 1YR7A 1W94A 1KORA 1RXUA 3HNRA 4O4IA 4OJYA 2WTUA 3QI2A 4X7PA 1XLVA 2CVZA 4L8GA 5JQGF 2GF0A 5L40A 1IXZA 3CKMA 1AK1A 2RH8A 1OYVA 1V3EA 3CH7A 5DK6A 3OI7A 1GGNA 1P1HA 3C8UA 2VK2A 3QVOA 5E1OA 1OMOA 2ZPAA 4RULA 3R74A 4I1IA 4YEDA 4KGZA 4FFPA 1RWOA 4XPIB 3UAZA 1S8AA 2HAEA 3WK7A 1JMYA 1E3EA 4JLVA 4RY8A 2RH4A 4YP1A 1DKUA 1C1XA 3PDWA 1CPYA 4P7BA 3UJDA 4URVR 4HQ6A 3QUCA 2FJUA 2EFDB 2F4VB 1W96A 1UJCA 1WEHA 3AX6A 1WEKA 4S35A 3AETB 1ZCJA 1G3QA 2O52A 3GLHA 3TAHA 1AB6A 1M74A 4Y2XA 3GU3A 3DKPA 5HCUA 1HDOA 1TCCA 4BZPA 2GO1A 4IJMA 4IIVA 4I3HA 5CLQA 4FFBA 1WZ2A 3IXMA 1XEFA 3HBFA 4ZO7A 2GPSA 1EQ2A 3RTBA 1R4NA 1L5YA 4FHFA 1WB6A 3N8HA 2IHBA 4LDJA 4CODB 4G8DA 4M9SA 4TQUS 1GJRA 3WBBA 4DY6A 5IUJC 3HNPA 1V3UA 5KCZA 4ONEA 4M3MA 2F43B 3IPAA 4TTQA 1JQDA 2YFHA 3D8RA 1XL1A 5CGQB 4A0QA 1UP4A 4OAQA 1VYHA 4DCUA 1A97A 2JEOA 4PZCA 2FYTA 4PCAA 2A86A 4MIYA 1U1IA 1DC4A 5D85A 1CS4C 3H5IA 2D62A 1WMDA 4NHEA 4YMTA 2QTRA 2HT1A 4TPKA 2ECKA 2ZR9A 3NFRA 5AW1A 1GN9A 3L18A 1A4IA 3ZK8A 3WLLA 1S89A 2JAXA 1Y6QA 3CXRA 2OM2A 4LJSA 3JWHA 3GMTA 3OZTA 1R0YA 1F38A 4QU8A 1I3KA 1XZNA 1IDOA 3GD5A 2BBSA 4YLEA 5JU6A 4LEIA 4AW9A 2HF9A 2JFUA 2GTHA 2PRSA 4C05A 4Z86A 4L8FA 5LOVA 1UMDA 2P67A 3IBFA 4LYAA 1LBQA 1VG0B 2QJWA 2XOKD 3A31A 3EQ8A 3IV7A 2BCJQ 1NNCA 3LF1A 1E64A 2VFAA 1XMPA 3N2GA 1N92A 1IXRC 1V6SA 2XD9A 3HGMA 1B1AA 1ODTC 5YASA 4V0RA 4YUWA 1CF4A 2C57A 3AJDA 5CM8B 5I7FA 4G1EB 1YE8A 4E6EA 1U0BB 3LIPA 4FR2A 5JJ5A 2R4TA 3AVWA 4OKNA 1YVEI 2EP5A 2EP7A 3UWPA 5IAGA 1A9ZA 1JIQA 1MVNA 1P2BA 1DTEA 2XADA 3B52X 3GRPA 1LZLA 5HFJA 1K98A 3RREA 1XB2A 3HY4A 3IP9A 3HZHA 4FZ3A 1VGQA 1VXOA 1IBSA 3FNGA 2ZFUA 4Q4LA 4YK7A 4CIBA 2OCKA 1S1CA 3BXFA 1OX6A 4JLDA 3TMYA 4DSOA 4E5YA 5BQ3A 1FBNA 4A6XA 5L4LA 1IOZA 4WZBB 1J7KA 3MINA 1IB0A 3KJNA 1HX7A 3WE7A 2FP8A 2QUAA 4H7DA 1IPHA 1F17A 1Y9JA 5LA6A 2OILA 1ZHOA 3EXEA 3PQDA 1KIAA 2GN0A 5K0SA 1OH5A 3L8ZA 1A96A 3FR8A 3ADPA 5KPJA 3R5TA 1YR9A 3ZDAA 3RNOA 2C54A 4RPKA 4PC1A 4PG5A 3UB2A 4GNAA 2ABWA 3A7EA 1ZW1A 1CIVA 4JJ4A 4X6YA 4ZT6A 5KWSA 2OYRA 3H83A 5GZ3A 3MJFA 3D6FA 1NUSA 4IDHA 2YA5A 4HGPA 4HZVA 2GCEA 2VCHA 4OGWA 3TUIC 3UQYS 4XD7D 1Y3DE 2O8CA 2EF0A 4C4XA 2QX6A 2I4NA 4AGIA 1VPVA 1NBMD 4E12A 1X7XB 2L69A 2VP9A 2D3TA 4P7GA 2H4JA 4JI8B 2QRGA 1TJYA 1W36B 4MTLA 2VNAA 3PRJA 5CU7A 2SKEA 1N0WA 1BXKA 4Z3OA 1GPNA 4TX1A 1SNTA 3IEPA 4CL8A 3PQ5A 4XTCS 2ISMA 1W5TA 4BLWA 4CM9A 3HXQA 2XCLA 4NKRA 3F5MA 4GBMA 1UKBA 1J09A 4MDEA 4CI9A 1Q0SA 3VYRB 1KRXA 3HWSA 3P7MA 4C7BA 4O4IF 1IHDA 1U4OA 4DC0A 3MUOA 3EFEA 3T5BA 4WW0A 3FJYA 3W9YA 1ZJ5A 4JLMA 5F12A 2Q46A 3RBAA 3UMFA 3ETLA 1CP3A 1FFBA 1THGA 1Y1RA 1Y82A 2A9QA 1EGAA 2HY7A 3HDTA 4PZEA 1P9RA 3RAEC 1VECA 2HWXA 3L77A 4GKJB 1SZPA 2Q41A 4YY8A 1H0KA 4AO6A 3GDGA 1RYMA 1ZCBA 2WU8A 4H08A 5TC4A 3OECA 4LJYA 5JFTA 3ZCQA 2O05A 2WHRA 4N7MA 4QPNA 1PLLA 4D1YA 5C5CA 2A5LA 1W4BA 2OZKA 3GARA 4NATA 1LDNA 4BYGA 2IDMA 3G5UA 2BI4A 4YCJA 1PX0A 4K6FA 4F3KA 4TZKA 3H2YA 1HPLA 4QPPA 3PE4A 2YJNA 8ABPA 4MP6A 3CU5A 1E89A 5ABPA 1RM5A 1T29A 3WWAA 1V2IA 1Q3KA 4D4HA 3GUUA 1KDTA 5BUSA 3KYIB 1FU8A 2YIMA 4AULA 2VDQB 5NN9A 1YB4A 3IALA 1PLJA 4EGAA 4LZNA 4N8DA 2W7TA 2IYXA 3Q3GE 5AJVB 1W8NA 3AM1A 1R8JA 1HZZC 1K5DA 3FROA 3BVPA 4RTJA 1ZD5A 4LF7B 4HQRA 3BA1A 4MWCA 1U0JA 2XHEA 5ALDA 5IKMA 4R40A 4ZODA 1X74A 1EFHA 2GAOA 1YVRA 3K9GA 3PZBA 5SICE 4AY2A 3L6BA 3GVPA 1FB5A 2B36A 4EFLA 2WTBA 1OC4A 2PL1A 1KHHA 1T2NA 2Q5HA 4IGKA 1KH1A 3LDHA 2E0IA 3EJ6A 2NUTB 2P4SA 1ZD3A 1EB9A 4YPOA 2VUIB 1DRWA 3HY3A 2CJWA 3V9PA 1ZM3A 5CFMA 4GF5A 1DARA 1RXEA 3H75A 4YP6A 5KDDA 1KWKA 4PNHA 3IC5A 4EH1A 1QK5A 4O2BA 4Y2TA 4B2IA 3PUXA 1CY2A 2QZSA 3ZEAA 2AFHB 5A4FS 4Q6KA 2OK7A 1BMFD 2XVAA 2PCLA 3LT5A 4QYTA 4WLVA 4LI3X 4QJ3A 2EKBA 4CTKA 5HKBA 3LH5A 1AUVA 3HKEA 1ND5A 3HKDA 3UMGA 1BHQ1 1H4TA 4R0NA 2P7IA 3V1YA 1YACA 3ZHSA 4JBXA 5KQMA 4QGHA 4G89A 2YWFA 1VMDA 5TEVA 2FDXA 2PTHA 3WIBA 4YWHA 4I9FA 4BNIA 1KYQA 1X87A 1UWVA 2L0XA 2AYXA 2V96A 4UVGA 4EY8A 2QRQA 1N2HA 1F2UA 5LQSA 3B85A 4EGCB 4JP1A 2QQ5A 1NV8A 3TZCA 2BC9A 5K8VA 4CKWA 3ADOA 3AKDA 4Z6KA 1BX1A 3A70A 2DLDA 1I13A 2BW0A 3N7UA 3I8OA 3ZXSA 4IJWA 4MUBA 2QWHA 3CEPB 4CGZA 3DTVD 1MJ5A 1A3CA 3L93A 4OMFG 3RUAA 4HYQA 4IIJB 3EUAA 1CR4A 1YCHA 2YOHA 2BFBB 4TTRA 3IQIX 1NAIA 1SXJC 1DJNA 1QRRA 1R9GA 3TICA 3K2BA 4CLDA 4F2PA 5L45A 4HVTA 3AESA 4QNNA 4JASB 1YI0A 2I78A 4LK3A 4DXHA 1K8QA 4IEEA 4MW9A 3AR7A 5IF9A 4JLBA 3V6MA 1YVPA 2F0ZA 3C7TA 4TS9A 3I9MA 3V33A 1OAKA 4KGXA 4Y2GA 5JCJD 3FG9A 3OCZA 4GOJA 3R7SA 3UUEA 1PWXA 4QECA 1Z9BA 2A1IA 4ALIA 4INPA 4MHTA 2CE2X 1WX1A 3H1AA 1Z74A 2GF2A 2IASA 1JH9A 1TZKA 3L6DA 5JQWA 2P6UA 3Q4GA 2D5AA 3TVYA 2CLLB 3RIYA 3Q7QA 4DUYB 1FQKA 2B4KA 3JY6A 1G38A 3ZGZA 1ZNYA 2RHJA 1DKPA 3M6LA 2XI4A 5DM1A 4ZMSA 4RL6A 3T7KA 2F3PA 2SKDA 2LUOA 3IKTA 3GA0A 1NXXA 3CEMA 2WB2A 2Q1TA 3INYA 5KI6A 3C3EA 3QYFA 2IK8A 4HEHA 3TZEA 2VJDA 4HSEA 4KR0A 5DNCA 1O96B 2F28A 1TA4A 1UL1X 3CZ9A 1NN1A 3FMFA 3MJEA 2DH6A 2IP2A 2W6PA 4FS3A 5FNSA 3HDQA 1IVBA 2IUSA 3GD7A 4G1VA 2OFOA 2BP7B 2RKWA 4U0KA 1M1YB 3RSQA 1QONA 4MW6A 2IBMA 1ZUIA 3CM0A 1P73A 4IMIB 4NBTA 3P5SA 4AZ3B 1J8FA 4UTZA 5BXYA 3A9GA 3U6BA 3S2UA 1G5PA 1LWOA 4QOEA 1J2RA 5DBFA 3TTWA 1M7HA 1X1QA 3IEIA 3R09A 2DKFA 3C6ZA 4FW9A 4GKAA 3W9BA 3JZMA 4LS3A 4MVJM 3T15A 4TVSA 1KO5A 1E3DA 2PFKA 2JCSA 5E9JA 5A9RA 2PZBA 3DLPX 2QLMA 4EQ6A 4EQZA 4F72A 2IYAA 4D4MA 1S2IA 5CCBA 2Z5GA 1GZUA 1I5EA 1TJ3A 3DZHA 2ADFA 1DI0A 2HPZA 2P6MA 4QE3A 4RHTA 4HNAA 4QTXA 3WWEA 2Y0BA 1IBCA 1WMAA 1UEJA 2RB5A 2VPZA 3NJRA 3O90A 3PDJA 4H7JA 1LJ8A 2LGJA 1XTIA 4I2VA 3UC5A 5A4DA 1UBJS 1AKNA 4GKVA 2HMVA 5CA0B 3L82B 2DLNA 4LTMA 5D3MB 2ZZKA 3SHOA 3PT5A 1K75A 3SVZA 4OBBA 4A82A 3I04A 3PYXA 4K8RB 2WW8A 1ULBA 3G0IA 4EJ2A 3TUZC 5LBTA 2G88A 4XPIA 2JH9A 3A25A 4JLSA 3WLOA 4K03A 2RIRA 1ONNA 3FI9A 2W8BB 1EDEA 4HDSB 4K0RA 5AESA 3HU3A 1X42A 1Y0BA 2J5RA 2RHDA 4GYYA 3WGVA 4GXTA 1QIGA 4HH0A 4OOEA 4PRLA 3WGOA 1YZTA 1PQPA 2PUWA 3MA0A 4EI7A 2O3RA 4EPYA 5E8RA 3JQFA 2X6TA 4AZSA 4EENA 4DCOA 1M0SA 3BB3A 2GN6A 3DMNA 3KUCA 4OB8A 2X4LA 1UBRS 4RD1A 2HUNA 1GFZA 4QPJC 1Z6GA 5JNUA 2ZUEA 1BCSA 2XZPA 1ZCZA 3DV0B 5AI9A 3LF2A 4DPMA 3F7TA 3KXKA 3IQHX 1Z2OX 5J5AA 4NMMA 4LVUA 1Z56C 2UXCB 1LQUA 4PGHA 1AXEA 3R6DA 1O57A 2OCYC 2F43A 1G3RA 4BRUA 3HUUA 1JHQA 1J39A 2JIMA 3L1KA 4FK8A 4I4LA 4UARA 4P58A 2EWMA 1EWTA 4GZ6A 3EIEA 4YRKA 5JVDF 1D4OA 4MLDA 1M72A 3ND9A 3K9WA 3BFKA 2P3OA 4O4HF 2Z1NA 1YIDA 3ZWPA 5COAA 1U8YA 1VKJA 2A94A 2BMDA 2QN3A 3LT4A 2XZIA 2OM6A 1E4VA 4KIJA 4N8SA 1H05A 4OG2A 2WZBA 4OREX 4HR7A 5TEWA 3WBJA 2P8SA 1S2GA 2ONJA 4ZCMA 1HMPA 2FR0A 3WTCA 2I03A 3BM5A 4PYOA 3RG2A 3ZZUA 1FVXA 2Z8YM 1RQGA 4NXNB 1HK7A 2WTAA 3MJTA 1QAOA 2FCAA 3Q9NA 4D99A 2BEJA 3JSXA 4J0KA 1ZHHA 4M89A 4ZAZA 2Z2KA 1EVIA 1W0JA 4NP6A 3IBGA 1AKYA 2JFQA 4GX1A 1RBQA 1ZMBA 1NDHA 1UKZA 3C0KA 4PAQA 4Z3DA 3OLVA 3IILA 1FU4A 1Y9EA 3ZI4A 1IXYA 4ZEVA 1XRLA 1ZYUA 3IR7A 1NR1A 1OLUB 1GAXA 4WGFA 3C74A 2DP4E 5T6BA 4BDSA 3TI5A 3RS5A 3VTFA 5E6SA 2MR5A 4DQUA 3AVUA 4PR3A 3QLEA 4AK9A 2D13A 2V1XA 4G9EA 621PA 1WG8A 4ZYWA 1J56A 1WXWA 1WW8A 4IGIA 3U9LA 1YJ8A 2BMAA 2ZRMA 3AZOA 3M89A 4ES6A 2QZ9A 3N0WA 1PR6A 3CNQS 2GAAA 4MMYB 2PQMA 2W2LD 3KAKA 5DP2A 5IJXA 3RU9A 3VAYA 1GPKA 3LLMA 3NBUA 3VR1A 3RTCA 3CY6A 4EYQA 1FC0A 4FYHA 3O0DA 2QY6A 2FP4A 4PSUA 3ZBTA 4WZBA 1TQ8A 1VL1A 3AEUB 3B7GA 2O1WA 3DBOB 3DR3A 1K1EA 1UANA 2VA9A 3ZBUA 1PWEA 4YZ4A 3I5YA 2J08A 4P6VF 1GZ3A 3FZNA 4Y6RA 1SCJA 4UAJA 2HXSA 3EHDA 3E9YA 4IX9A 5F7ZA 1AKRA 5TQ0A 3V1LA 2XE7A 2HJ9A 1Y3FE 3E9RA 4DNPA 1NI4A 1TJ5A 3KEGA 4G41A 3RPEA 4BEJA 5AHRA 1NF9A 4M54A 4QUHA 3RRZA 1H3FA 2JI4A 2C5BA 2QOEA 4IH1A 3RUFA 5LWHA 3CKLA 4ZQBA 5FTMA 3HZOA 1GRQA 4MC7A 2JL1A 3EMKA 3IVMA 1L7NA 3LPCA 4JUAA 1SIOA 2EG5A 5DNYB 3GZNA 3EAFA 1YB6A 2W43A 1X7XA 2HJHA 1XJ5A 1E66A 5CBKA 1EVYA 4GOXA 3VGJA 3AQIA