4JMLA

Crystal structure of the tolb(p201c)-colicine9 tbe peptide(a33c) complex.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
398
structure length
394
Chain Sequence
SGRPIGVVPFQWAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQCLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsically disordered protein threads through the bacterial outer-membrane porin OmpF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/toxin
molecule keywords Protein TolB
total genus 109
structure length 394
sequence length 398
ec nomenclature
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 4jmlA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 4jmlA01
2GVWA 3SOBB 5GX4A 2FPBA 5D9CA 5FWWA 1RWLA 4ZLRA 2IASA 4GN7A 4GNCA 5GX2A 2P4OA 2IAQA 5GTQA 3TC9A 4HHQA 4DG6A 2W8BA 3S8VA 2VAQA 1N7DA 3AMSA 3P5BL 5D9BA 2QE8A 3V65B 2FPCA 3G4HA 3V1SA 3LI5A 2GVUA 4R40A 1NPEA 1C5KA 3Q6PA 2FP9A 1POOA 1H6LA 1CQ1A 2GVXA 4GN9A 3SOVA 3V64C 2G8SA 4O5TA 2IAOA 2IAXA 3I1CA 3DR2A 3IAXA 2HQSA 1QBIA 2POOA 3U0SA 2IARA 3E5ZA 2GVVA 2IAUA 1CVMA 3FVZA 4A0PA 3HLIA 5GX5A 5GX1A 2OJHA 1PJXA 4GN8A 3DASA 2IAPA 2IVZA 1QLGA 3SREA 2DG1A 2FP8A 3WWAA 2V91A 4HHOA 3O4PA 3A9GA 1CRUA 2DSOA 4JMLA 2IAWA 3S94A 3Q6KA 3SRGA 3LI3A 4O5SA 1CRZA 3SOQA 3WW9A 4Q1UA 4IMBA 1V04A 2ISMA 1C9UA 2IATA 5EX7A 2DG0A 5D9DA 3BYCA 3FW0A 3HLHA 1E1AA 1IJQA 4IYGA 1RWIA 3LI4A 4GNBA 3S8ZA 4HW6A 3A9HA 3HRPA 3Q6TA 3KYAA 4PWZA 5GX3A 1Q7FA 3S2KA 3AMRA 4GNAA 2IAVA 2W8BB 3KGGA 2GHSA 3G4EA
chains in the Genus database with same CATH superfamily
2J8ZA 3HB7A 5JCJD 2O8CA 3TI6A 1FXWA 3AG5A 3B6MA 3CLTD 1SKYB 4FOSA 4GD3Q 1VJCA 2ZSUA 4JL6A 2XVYA 4E08A 3E3LA 3KEGA 2HAEA 1TAUA 3D9QX 2IAQA 4D2IA 3I2YX 2NU8A 1XQ6A 4FFBA 1QP8A 1T91A 4D4GA 3DNFA 3VKWA 2I8CA 1HC7A 1TM5E 2VBFA 5AXAA 3N28A 1KE1A 3LDUA 4UUOA 4QAJA 2JHGA 2XDYA 1W85B 2OV1A 3JZDA 1WP9A 4NBNA 4AWAA 5D5HA 1HDIA 1TAQA 1WF6A 3VHRA 3DFKA 3K4HA 3O03A 4AZTA 3DPIA 5JNUA 1MV5A 2F64A 1TYEB 1HDYA 3DWIA 2A67A 1ZZGA 4ID9A 4LE0A 3D43A 1DNPA 3DLHA 2JIZD 4AL4A 4GHWA 1J22A 1RT9A 5JU6A 5H3HA 3TCKA 4GLBA 3CZMA 2VAWA 4IHKA 4UZSA 1LC3A 1KPIA 3O26A 2IE0A 3BL5A 4DJJA 1VL6A 1CQPA 4PY2A 2H5EA 2ZREA 3SC4A 2P9HA 1QBKC 5D3ZA 2HC9A 3KKQA 4PTLA 4XM2A 5KHOC 3K1JA 4DGQA 3ER9A 1C3LA 1O77A 4M9SA 1M8KA 3TBKA 1HFEL 3H6JA 3NETA 3PUJA 5BPFA 4M54A 1SA0A 3WSTA 4BNUA 2IHTA 1WNTA 3OOEA 5ESWA 4FLFA 4KS3A 4DL9A 2PGNA 3AETB 3VGPA 4BVEA 2XODA 1Z2PX 3E9EA 5EP4A 2ZB8A 1JQAA 4LDAA 3L06A 3C6KA 4DB2A 2EU8A 1SVUA 4YZ1A 2I2FA 2IDKA 2V03A 4RK5A 4EKNB 5BSGA 7ABPA 2AE1A 2O8BB 3H42B 3KXDA 3VZSA 4RKEA 5FL3A 4W1PA 3I9LA 4B1FA 3IERA 1G16A 1U0NA 3NV7A 3LKVA 3KUCA 2VF2A 3OTIA 1XTPA 3N6RA 1R7RA 2YV2A 4WXYB 3OZCA 2MIIA 4LISA 4DBZA 1VXRA 4QYSA 2J7PD 5KTPA 4KDEA 3FTNA 4WNYA 2WU0A 2K2QB 2Z8ZA 3C24A 1K8XB 3MTAA 5CXUA 5JWOA 4MPRA 2BL4A 5ED4A 3VYWA 1IAQA 1BU5A 3KXPA 2Z6QA 1Q1ZA 1SEPA 1VI2A 1GAQA 5IF9A 1Z50A 2XHZA 2PWZA 3MWGA 1E3IA 1SN7A 3BL6A 3SC6A 4JASB 2I1LA 4TZTA 2CKDA 3HYTA 4HO1X 5CFPA 1NLZA 4Q1UA 1TK9A 2O6LA 4JLNA 1UMCB 4MVJD 3TM4A 5AM2A 4J0QA 4FNMA 1QANA 1UZUA 1LRJA 1DKLA 3BXEA 4GPZA 4HZXA 3LLMA 5AH0A 3ZV6A 2NVWA 5GONB 1UDCA 3I58A 3BD6A 4B3BA 2O06A 4ZK6A 3DBRB 4MRPA 5KSZA 4LSGA 4HDQB 4Y2HA 2AXPA 3CVVA 5JROA 1MO5A 1KY4A 1NYTA 1SVWA 3EVTA 3TH5A 1JFSA 4J3JA 4KX5A 1M8PA 2P65A 2X6TA 1FDSA 3HXMA 3OSZA 1LVHA 3BJRA 2BDTA 1GILA 4IBOA 4F0JA 3EPHA 1NWCA 4GIBA 5DDIP 1H9BA 1P5HA 3OZDA 3KYAA 4UU8A 1B74A 4G0WA 3IQHX 2FR0A 4AZ3B 2HGZA 3GRUA 5GX3A 3X44A 2ODWA 3QXGA 3LLUA 4FYYA 3ESAA 2XB9A 4TVKA 2G17A 1VFNA 3TLEA 3HA7A 2WAXA 4RKFA 1X8XA 3GZTB 1QQAA 3VJRA 3QVJA 5K8IA 1E0SA 2ZQ5A 5JMOA 1Z38A 3UXHA 2P4UA 2H31A 1NQWA 3ED5A 4KQ9A 5ICCA 4G4SP 1RRMA 5FORA 3R44A 4GX5A 4PE5B 5K0BA 2YA8A 2WK1A 4HX2A 4B2LA 3TW8B 4P0QB 3NANA 2JI6A 5D86A 3W06A 3JVEA 3N3AC 4TLLB 4ENVA 3UUFA 1XZFA 2UZ1B 4RTLA 5EN4A 5I3CA 1KQGA 2HCJB 1YK0A 3CQ9A 3B1XA 1LBEA 1XAIA 4BMZA 4NCAA 1P6UA 1J2UA 5E9QA 2ZYUX 3C3AA 2ZI6A 2E4UA 2VK8A 3FMPB 3SYNA 1T6XA 3OFNA 3QU9A 3TQTA 4X94A 2C0QA 3WLFA 5DYIA 5DNCA 1H8ED 4M7RA 4P53A 1NPEA 1P7ZA 5G0VA 3EX7C 3MFQA 4CVNA 3QYFA 1XPRA 2XCTB 3TS1A 4HFJA 3DD5A 4P2BA 3B70A 3VZDA 2HIHA 2QN9A 3NEAA 2G0AA 2ERXA 1RBQA 4ILEA 4ZZ0A 5B1YA 1P77A 3R2JA 1R6VA 3GPIA 3IEXA 1INGA 1QGZA 1UT6A 5IBPA 2X0FA 3U39A 1X2BA 2WWRA 3EXEA 1WVIA 3WK9A 1ULBA 4LRXA 4WFQA 2LW7A 2I4MA 5H47A 1QH8A 2VPTA 4ZICA 3R76A 3CR3C 2QWIA 4S1PA 4L7CA 3SJCA 3Q3IA 2C4KA 5D85A 1G8KA 1SC9A 2XKJE 3F3YA 3Q5DA 4HQLA 4L72A 5HBGA 1R6BX 1PJ4A 5FP0A 4PAOA 2MSKA 3OCVA 2FOXA 4GWLA 4WAUA 4C5AA 3P32A 4KE9A 4UOEA 4LRWA 3P9SA 4BCDA 2OPHA 3CJTA 4JI0B 3DF7A 3QEKA 2ID7A 2QWJA 3FR8A 1HTWA 1U4SA 2CDCA 1NW8A 3GFSA 1B2LA 3STXA 4Q66C 5HCNA 3WLQA 4KTVE 4M38A 4HAZA 1D5WA 3HABA 4WV3A 4NOMA 4OL9A 4UTOA 3SMQA 4JYZA 1J2TA 1TC2A 3ZBPA 3O4GA 3SK0A 2OZLB 1G5IA 5A71A 4GN8A 5ICEA 4ZEOA 3WSVA 4QTYA 3U80A 2OO5A 4FQ5A 3NV9A 2VYND 1X1QA 3FTFA 4MRMA 1ES9A 2IU3A 3EOBI 3TW4A 1P2UA 3A9TA 5EKTA 2E3JA 4RK0A 3ADCA 2FMXA 4Q4HA 3PEEA 1MV8A 1IY1A 4OYLA 4NU6A 1YXMA 1FQJA 1WPRA 2HADA 2JLBA 3K6RA 2OHGA 2O2SA 1PD1A 2JFHA 1ISHA 2OOSA 2PVCA 4PF1A 4KMSA 4I8IA 2QJTA 1N9ZA 4HZGA 4TL8A 5B1EA 2EG9A 2FWAA 3VR4H 2AG0A 3H3JA 4BNVA 4XMBA 1K9VF 1IC6A 4N0DA 1EFCA 2OV6A 3VR5D 5KZMB 3AU8A 5BSTA 3HCPA 1W49A 1KDVA 2G4CA 4YONB 2WYWA 1M7HA 4KODA 3Q8XB 4QBIA 2NAFA 2ZDQA 1DJNA 6GPBA 4FN5A 1UZLA 1LPMA 1XXHB 2HJRA 2VXBA 3FKJA 3GT3A 3PXAA 4B8ZA 2J0QA 3SJZA 1O0CA 2JFNA 2F3QA 2QD1A 4BASA 1ZU5A 1BAPA 2CXNA 2ZSHA 2ZR7A 1OXSC 4IVQA 1V39A 4M2LA 5CLGA 4E11A 3J80A 3GGDA 4GW3A 3WKDA 2WJPA 5IDQA 3M4JA 2CL5A 3SDBA 1NW3A 1UBKS 3P4YA 2BWJA 2QMUA 1TFUA 2BJVA 3JALA 4QZVA 4YCAA 5EZYA 3GCWA 4BP3A 4OJYA 3N59A 1CJMA 5E6RB 4D8UA 3SOBB 3C8HA 3EVDA 4NK5A 5CT5A 3SYKA 2IOYA 3EGIA 4HDRA 4GYKA 3WO0A 3EEYA 1FXUA 4LVNA 4RETA 2IZ1A 2H3EA 3HCFA 2ZM5A 1XF9A 2X9NA 1ACJA 2XLBA 1GR0A 4FGKA 1HKUA 3AU9A 4Z9XA 1E7WA 1R8XA 4GWKA 4UREA 1E9VA 3R1IA 4IGIA 2NWQA 2IYUA 1IHOA 2IK8A 2QTLA 2XQIA 3HCNA 1N7DA 1BXZA 1XJCA 3QKIA 1Q91A 4I5GA 4BJ6A 4ENRA 2AYXA 1XEFA 2GEDA 2IS4A 4ACAA 2XYRA 4N3BA 1WO8A 4NL4H 4MQ4A 5C8YA 4POOA 3K96A 1R0ZA 5FAKA 3BXHA 1W88B 5AW5A 4EZIA 5BSHA 4I8DA 1PJ8A 2YASA 2E89A 4QU5A 5DTJA 2Z3ZA 4X66B 2YVQA 1IQRA 1JDPA 2UZAA 3IVGA 4NONA 4RM3A 1YRBA 2O2DA 3OJFA 2B1GA 1R37A 5EYPA 1DBSA 2WNHA 1T4MA 1L5FA 2WRZA 1U80A 1A5ZA 2B5WA 2VG8A 1LDBA 1AKQA 3GZNA 4G37A 5FTLA 2EWVA 4K7JA 3RO7A 4ZT2A 4XJZA 2Z09A 4G3XA 1QVAA 3JYNA 2ZSBA 2FSPA 4C07A 4EF6A 1XMSA 2GN9A 4PSUA 2WIAA 4KN9S 4MUBA 5ALJA 1E3TA 1PFYA 4KPYA 2YYAA 4GF5A 4JZYA 4L8LA 4J7AA 3AY3A 4DV3B 5B58C 1CDZA 3A70A 3I8OA 3O7WA 4U3JA 3DC2A 3HZRA 4WBXC 1NYQA 1NVKA 3IAHA 3G02A 4FINA 4US0R 3UAOA 5JTTA 4IJUA 1X15A 3V7FA 1VCHA 2I6TA 2HFJA 2IF2A 2HWKA 1QWSA 2Q4RA 2ZTVA 4CLXA 2O4UX 3C3XA 1XSEA 5EUQB 2IYPA 1B8NA 2V55B 1AGXA 4JYCA 3K9LA 4KRFA 4A92A 2WJ6A 4YGYA 3TTXA 2O3TA 1VHDA 3JD3A 1NKSA 4WVFA 1N8NA 5CLJA 1XTSA 1NJ5A 3LECA 4RHXA 5G4LA 2FUKA 5TRTA 3LCUA 3LUPA 3NRJA 1HYGA 4HAIA 4Y0VA 5E2AA 3QSYA 2D54A 3NGLA 9ATCA 4KGXA 4QD3A 2ZDGA 1HQDA 1A9QA 3FMFA 4JI3B 2PSEA 1J99A 2Q46A 4IMJB 3T1VA 4MRMB 3W6NA 3I62A 4WEGA 1THZA 3JQGB 1IQUA 4L3VA 5AI8A 5DRYA 2IEIA 4I46A 4D9BA 1E99A 5KJ6A 3OHMA 2DUUA 1OFVA 3A3PA 3G8YA 1ISPA 3QG1A 2J3MA 5LOVB 1ULZA 2CYAA 4TUYB 4QHTA 3RT7A 5U9CA 2FRDA 5ALRA 1Z5OA 2ZR0A 2OSBA 2PYZA 3LVQE 4FWBA 4JC5A 4UZEA 3E5MA 4N48A 1V16A 3LC1O 4IFLX 4L28A 5EAIA 3DWGA 4LW8A 2Q8PA 1QQ7A 4TS1A 4X8LA 5DI3B 3DZGA 4ROTA 2FHRA 1NSFA 1TAGA 4KXYA 3TTVA 4RJJA 4YAOA 3TFWA 1RWOA 3IRVA 1LTHR 3EZ9A 5CA1F 3T3GA 5C34B 1IWPB 3CZPA 1DFGA 3GNLA 3QPUA 4ZDKA 4W9NC 2IL1A 4JFAA 4UE6A 2OY0A 3W3AA 2C7GA 5I9SA 1Z5NA 1LS1A 3V1MA 1M1YA 2C3MA 5DHRA 1GQOA 4HI0E 1YONA 3HO8A 4Z6KA 4OGFA 5K7SA 2JVJA 2WICA 1V4NA 1AKYA 5DLYA 5KCMA 1JDBC 3RHSA 4DNXA 5J47A 2RGAA 5KHLB 2XCSB 3HP7A 3MK31 5DNAA 5CEEA 1NR7A 1HDGO 1VIDA 3DTNA 4D4IA 3QPDA 1NUTA 1E1MA 1VE1A 2C2WA 3PC3A 5LOVF 1IHPA 2B4TO 3DV0B 3P0JA 3PGMA 4XJVA 1VL5A 4E4TA 5IM4F 3IULA 4GO1A 4YRMA 1F4VA 3L8CA 3SDZA 1AQIA 3JARB 3IVRA 1OGJA 3WHLA 3H1PA 5AQ1A 1Z16A 1G17A 4YI5A 1P4SA 1VKNA 1JHXA 2E85A 2HMSA 3FDIA 4IMPA 1GZSA 2NW6A 4TRMA 4M8SA 5AT1A 1ODKA 5EWJA 3ETNA 1U0RA 1CP2A 1Z15A 4R5HA 1QH0A 1YRHA 1Z73A 2ZIUB 1NCDN 3OKFA 3Q2IA 2LE0A 4I1VA 4QPCA 5CBPB 5I7WA 4L4SA 4XYBA 5JH7B 4GGMX 4RH3A 1X7ZA 1G7SA 3RDPA 5FUMA 1DKNA 1BD4A 1LQTA 2FQYA 1K4KA 2PT7A 2ZLBA 4OFBA 4P3NA 4WUVA 1SG0A 1XTVA 2NV2B 2VDMB 1MPXA 3T5CA 2ADMA 3ESRA 4ARZB 5J4LA 1E64A 5LZ9A 1T9GR 4MQEB 2OV3A 3NIWA 1SOVA 1PJ2A 3ZZ0A 2I2WA 1X94A 3HN6A 2IOFA 2VW2A 3FDFA 2XPCA 2BKAA 1H69A 5DGHA 1YQGA 2QQFA 2YYSA 4GZQA 1OAKA 4RPLA 4UMVA 4FKBA 2NV0A 4E2XA 4LYEA 1ETHA 1C7EA 5FX2A 3ENNA 2YQ4A 3FNBA 1QS0B 5LA6B 2PJRA 1R50A 4WGFA 3ELBA 1PFVA 3OU7A 2CLOB 2XDQB 4Q1DA 1VE3A 3B6EA 1RWPA 4RF3A 3NNDA 3SQOA 3WLEA 4C4AA 3LA8A 2ODPA 3PLNA 2BFFB 1XOIA 3R7WB 5AK6A 4D52C 1FUIA 2JLVA 2I1WA 3B5IA 3K15A 1P5RA 3AUTA 4JI1B 3U3JA 4JXZA 2QU8A 2WYUA 1CERA 3DTTA 3BZWA 4JXKA 3NPMA 5CA1A 2AJCA 4RK7A 3DVQX 4X6KA 4QOIA 1JZSA 1V45E 3Q7IA 4NDAA 4OQLA 2HYIC 5A4IS 3BAZA 1IBSA 3L2OB 3BB1A 1JWLA 4HOYA 1Z6ZA 2EAUA 1D8TA 3I3OA 4RESA 3UF0A 2WFZA 3NHYA 3P5BA 1GPNA 1PYDA 2CV1A 4YCDA 3IOMA 1KY3A 3SR0A 1OT3A 1V5WA 2C4HA 3H2YA 4EW6A 5K0JA 4FW8A 3J81A 1BS9A 4MKRA 2MINA 2QG6A 2X9LA 3HO1A 4EJFA 3QWIA 2Z4TA 1XMVA 1XKLA 1P1RA 1QIMA 2JIQA 4JBIA 2TSYB 3PQCA 4MLZA 1NVEA 1GAXA 2HSWA 2XCUA 1Z0DA 1OH7A 1RXYA 3A4MA 1XDSA 2ZBUA 1ZC3A 2PX8A 1XZKA 5FNRA 1J5PA 3AEUA 3KETA 5K6AC 1L3BA 4NPCA 4TTRA 4QOHA 3UICA 4KXFB 1OU4A 4Z51A 1ABEA 3L0YA 3RVQA 4ZI7F 5GOZA 2VNKA 3OZXA 4JT8A 4IIFA 1DJLA 2A5DA 2VI5A 3QKRB 1W0KA 1JMVA 3TZBA 4M6WB 5JSZB 1QHHB 2CFSA 1ZYUA 5C1IA 4ZYLA 2DBRA 1PF7E 1C3OB 2C3UA 1V47A 2O5EA 3NPAA 4I2VA 5K45A 3LX5A 1DC8A 3HYCA 1G6Q1 2BBSA 4F5EA 1LXCA 3NOQA 3K3AA 1FNNA 4GGPA 3W5SA 3IUSA 4NPHA 3VTZA 5L6MB 2JH3A 2GJKA 2C2BA 1SVSA 2OCYC 4WCFC 3SJAA 1BIFA 3AR5A 1YR6A 3ZE1B 2GEFA 1MX3A 4GM4A 3VH3A 5A3SA 2SCUB 5I7EA 1W94A 1JEQA 3H73A 1USWA 1YGYA 3JQ7A 5EKDA 1VL1A 3MM4A 3N8KA 3UH1A 1T8WA 1RWWA 3IV7A 5CK5A 3TRIA 2AL7A 3BM5A 4LYAA 4Q3OA 3EDRA 3PNKA 1K63A 1UDBA 5FJIA 3IBCA 5K3BA 2F3PA 4AN1A 2X2PA 3QGMA 4EUHA 5CLFA 3WNZA 4Z1MD 4ZK2A 4UTXA 3L4SO 4TYYA 4AW9A 2LV8A 1T8UA 4QICA 3O0DA 1UIMA 2NUBA 1G98A 3DG9A 2Y4OA 3RTCA 2P9YA 1NXTA 3C7AA 3ETDA 5TQ2A 5JNRA 3KVYA 1TA0A 2BGLA 3EIQA 1AKUA 4BOYA 1HDZA 4BX0A 2AI2A 2X7JA 1C3XA 1KDPA 4HDNB 5TIIA 1Q1BA 3QU4A 4BY9E 5DB4A 1A9XA 2IV2X 1W1UA 3CH5A 4PQGA 5BUCA 8OHMA 3TZCA 3IAM1 1DEAA 1HWYA 4JJIA 3C8MA 3SEFA 4QVIA 3R9XA 4ZQEA 1DAMA 5JSFA 4D42A 1PT7A 1RKQA 4HAUA 3OM8A 1AK9A 1VIAA 4MWUA 4BMVA 2CLLB 2VKTA 1RLOA 4DQKA 3N2NA 1PS8A 2CDNA 2I03A 1KOLA 3IT0A 3R9KA 4EG8A 1O0BA 1XWFA 4XIJA 4YMUA 2POOA 2FUEA 5K0NA 3HR4A 2BFEB 2GAIA 1T0HB 2OC9A 4Q7MB 4XWGA 3FLAA 4JLUA 4R1OA 3CLTC 3WGOA 3O8LA 5EQJB 2IARA 1NVWQ 3JQ9A 1S7GA 1KDRA 5IM5A 3ER6A 1SC6A 3AR8A 2FW6A 2LRHA 3DMYA 1MC1A 2XE4A 2VDJA 3LM8A 3UQYS 2A1UB 1ZK2A 1G3UA 3KL4A 3P8ZA 3EFEA 2OG1A 1QR2A 4I2NA 1EP2B 3E7PA 1HR0B 3TNFA 4MB0A 1PJBA 1LQ2A 4RBNA 4DIUA 1LI7A 1BJIA 4JQOA 5KIAA 1DINA 1H22A 4IVPA 3HM9A 5FHRA 2XBLA 4IH1A 4PLHA 4CV2A 1LZKA 4MW6A 2CB0A 2RAUA 4R05A 2WMNB 4MHTA 2ORIA 3G2IA 4W5HA 3T94A 5EKXA 2WT9A 1PK8A 5CEJA 3GCDA 5JT1A 5AM3A 2BMAA 2UVPA 3KVRA 5IJ9B 1QZ3A 4NH4A 3HLKA 4M9ZA 1LZLA 4CDNA 3T3NA 1X2JA 1U1CA 1Q50A 2R1TA 2QQEA 3KLPX 4BVLA 1XZQA 2JK1A 1T1IA 4RKQA 2I5PO 3GRZA 1UBMS 2FW1A 1KH3A 2KBEA 3SM9A 3WLAA 1FMLA 4ZU3A 4ALMA 4DKJA 3QVMA 4QQFA 4ZQFA 1N6IA 2JBHA 1VLMA 2V58A 2HSGA 2Y6VA 1T5BA 4FR2A 4HRAA 1R5NA 5CEFA 1CUCA 3WOHA 1MB9A 4Z2AA 3GELA 4ZKEA 4RMGA 4D9NA 1N7JA 2YWRA 5KB3A 1MAWA 2C99A 1JSCA 4BNYA 3GGPA 3KJNA 4PFSA 2J0UA 4NH0A 4R6WA 2R97A 2RJ3A 2OV4A 3AKYA 2OLJA 4NCBA 1H8HD 3R77A 5K2OA 1Y7LA 1LUAA 4HB3A 1W20A 2FG7C 2AW3A 3KELA 1H5QA 1H2HA 1PYOA 2O7QA 3ON5A 3TLGA 2FFHA 3RHTA 4B7AA 5CNMA 4WN3A 3SYTA 1QFXA 3C45A 4QRHA 3Q88A 5KSOA 2BJHA 3EVBA 4HMOA 5J2UB 1KZ1A 2XSZA 3TXXA 4OVKA 2J0UB 3CWQA 4WXHA 2DFKB 4LGMA 5DWDA 3WZ2A 2Y1OA 1TEVA 4GDJA 2H08A 3WBFA 4DCPA 1TYBE 1WTCA 3S8VA 3II7A 2A3NA 2FWJA 1Q83A 3FJOA 3HZOA 4MUFA 4YMIA 4RELA 5CDSA 1KI9A 4I4TB 5HS4A 1Z0UA 1RYDA 2PX5A 2IYEA 5E6SA 3PHHA 1PVOA 4DIBA 1PBTA 1MP0A 3NO4A 1RZRA 4OK5A 2FGKA 2AEPA 4P3PA 4N0MA 4LZZA 5THKA 1HT2E 4P93A 1FE8A 1NPDA 2A5GA 1JIUA 2FUNB 3JQ9C 1QBGA 3K6SB 1O4VA 5KOIA 4LOKA 2F0ZA 1OXMA 3DTVB 3HE3A 4TT3D 5IVHA 4ZOLA 2AG1A 4GR5A 2VPZA 5EJ6A 2FE4A 2JLRA 1ECLA 5CCEA 5DT2A 4CDMA 3H75A 5J2UF 1PJSA 1T0IA 1XCJA 3L7KA 1G7TA 4IDOA 4MV0A 3WQQA 5CD9A 2A78A 4YMLA 1YZYA 1FS6A 1KJ9A 2UUOA 4LDJA 4AN0A 2Q6KA 1B16A 2QZPA 4NS1A 2VAMA 2PUGA 2DB3A 1NDHA 1U99A 3LA6A 5AW8A 2A0KA 1XA3A 4H08A 1AKWA 3NLLA 1H2FA 1C1DB 2FTKE 2N42A 4OGGA 4UC0A 3DOEA 3VVMA 3GFTA 4AB1A 5ISMA 4FZRA 1U31A 1Y89A 2IAUA 1F2VA 1O6CA 1QYDA 2P67A 1Y48E 3GP3A 4LHYA 1R6TA 4RE5A 2EIXA 4UM9D 3RBXA 4GPD1 2JEOA 2Z9CA 3AHHA 4O25A 3A2NA 4HP8A 4F60A 4LN1A 4ABTA 4S0XA 2H2WA 4H15A 4CMEC 2Y6UA 5JJCA 1NQTA 3B38A 1XYYA 2ETVA 5EO7A 2XOXA 2ZTMA 1UKAA 1F8YA 3DKRA 4QOGA 4US1R 4XX0A 4ABYA 4BO6A 4BHTA 1LF0A 3PBKA 4D98A 1V25A 3UJ7A 2YVLA 1GPLA 4I99A 4LFAB 4JMLA 3K5IA 2IXAA 3QUBA 1CHNA 3FYUA 5B7GA 4JA0A 2JATA 5FBHA 3OIYA 2VNAA 1KYXA 3V5NA 2AMJA 3K6KA 1TQHA 1ZGAA 3LI3A 5EWMB 3AR4A 1U0GA 3OC0A 1CRZA 1UMCA 2FZ5A 4FGWA 3IVAA 4LYJA 5HQ3A 2ANBA 1PNTA 2PGXA 2SBTA 1V7CA 2OXEA 2CD9A 2ZBVA 4B85A 4BZQA 2IATA 4Z2YA 1YOVB 2JFQA 3DL0A 1CF2O 4RTMA 3OUTA 3ICEA 4YHBA 5F1YA 3PKZA 1TL7C 4RD6A 2V0NA 1WTAA 2WT8A 4Q6KA 3I6BA 4C0JA 4EHJA 1QH1A 2JJ1D 2PMCA 3FUXA 4Z9YA 5KVQA 1GTMA 1RQNA 2YW2A 3QVVA 1PW7A 2BUAA 4DRZA 2A4KA 3PT9A 5H02A 3DMHA 5FCDA 4HW6A 2GNPA 3P9KA 5DYYA 4EW1A 2CNWD 2VSNA 1JH9A 1M2NA 1DCTA 3ETLA 2B8JA 4TVSA 1XQ9A 4IQ8A 3BQ9A 4XB1A 4DARA 2R6DA 3VUEA 4G81A 1ZCZA 5MGBA 1F7VA 5B64A 2BH9A 2EWMA 1IPHA 3MVEA 5FOXA 1JHVA 3Q0EA 4JY7A 4BGUA 2D0DA 3W6ZA 5JYYA 1NU6A 4HGZA 5B3JA 1NRIA 3WG9A 2WOOA 3S27A 1CUJA 1CUXA 3QLUC 3FOAA 2IYAA 4DLTA 5K8LA 4BEVA 1RKXA 1IG0A 3H04A 4TWRA 2HTEA 3U13A 3W6PA 3BK2A 2V4UA 5CG1A 3GGSA 2UUAB 4NZMA 2G5TA 4B3SB 1DBQA 1HF3A 2Q3MA 1ZXXA 5ES4B 4NYIR 3NBQA 2XUZA 4NY1A 4O6VA 3BXPA 1RQGA 1Z6AA 2WG2A 4WFKA 4WK2B 3GJYA 1ZRSA 4QT0A 5FNSA 2I6QA 4BRSA 4YXWA 3W9BA 3BTUA 3LHDA 5LZ5A 2XUQA 4H3VA 1QIHA 2IELA 3AJ9A 3PUYA 5FB3A 3OE4A 1VKHA 3PDWA 4RKWA 3UOGA 3AZPA 1UR5A 1CF9A 2WZBA 5E1OA 2OAQ1 5FBLB 2PAAA 2A92A 3INBA 3D3NA 2XRZA 3LC0A 4QODA 3SXJA 3ZHSA 4BFUA 4CI9A 2FN8A 3B89A 2COEA 1VMEA 3ESZA 3NAZA 3B53X 1V9LA 3ND8A 2GRJA 3HDHA 1P7PA 5ALVA 2OHXA 2ZAOA 1IOVA 3U49A 4NNPA 1WQ4A 2DM6A 4NNJA 2B4YA 3ZTYA 4B5LA 1GEGA 3G7UA 3DFUA 1G1MA 4GEZA 2XF2A 4JVNA 1GCOA 2CMGA 4RMJA 3DEFA 2Y05A 2Z2YA 3S5JA 3KU4A 5JEDA 2OK7A 4PZEA 4CKBB 1T13A 3L7BA 3DBLA 5JS6A 1R15A 1Y3DE 3E8XA 4G41A 4P36A 2PKRA 5SY4A 4HDOB 4KS1A 2DLCX 3PIRA 1P9OA 4G24A 5JDCC 4ER0A 1FPMA 4L57A 2DHRA 2Q2OA 3WGUA 1N34B 3DDOA 2PS9A 4MA5A 1VDZA 1FDWA 1IH8A 1UBNA 1WCV1 3L6DA 5DYTA 3ABZA 2CFTA 1L4BA 2XQGA 3JWPA 2K4MA 2XB4A 1JT9A 1Q22A 4ZAVA 4MLCA 4F4CA 1MEOA 3BMQB 1WWKA 1BA2A 3TUIC 4GMKA 1OREA 2P9TA 4NJEA 3EQ9A 2CXOA 4WLOA 2Z1NA 1ZQ9A 1M6VB 1MMFB 2BKXA 2RH5A 4M98A 4YEDA 3RYHA 3AHJA 5ES3A 4JVOA 2QLLA 3QE2A 2RHTA 3ZH2A 2IWHA 4ZREA 4EM6A 2IYSA 2B1IA 2GHQA 4Q4JB 4TTPA 4BDTA 4DCNA 3LWBA 3A6FA 1LPPA 3NTUA 1JHMA 4KS4A 1N6NA 1KOJA 1YQQA 2DKFA 3C70A 2ZQZA 3CH7A 1E9RA 1ISSA 3SKVA 5JRDS 2WVGA 4Q3LA 8MHTA 1AU9A 1U8ZA 1H2BA 4E2YA 1I2BA 3ZDYB 3E0XA 3OQOA 4OI0A 5CYOA 1M6VA 5HUQA 3HCOA 1DO2A 3RJ5A 2EL7A 4HNGA 2I22A 4RKRA 4NATA 3U3MA 1PRYA 3WW9A 2I8AA 4WECA 5SZHB 3BRSA 1JHQA 1NHGA 2QD3A 1X7ZB 4U9IS 4JOCA 1OWMA 4KPEC 2AK3A 3ICQB 4JKYA 4CRWB 4ITRC 4J4BA 5E3HA 4Z4CA 5AW4A 1J0EA 1KAGA 3A72A 1I1NA 3MRTA 4GPIB 4B84A 1JEYA 3UG7A 1XR3A 3NYQA 1ONOA 3Q98A 4DLXA 5JY1A 4LNUB 4CV0A 1GYRA 1P0QA 3TOZA 2IYRA 4MEJA 1IHYA 3LGAA 5AD1A 5BR7A 1KP9A 2O3RA 1U28C 1PG2A 3MOGA 3TICA 2GN6A 1B0ZA 1PVDA 5THXA 1P9LA 1HT3A 3D3WA 3PFHA 5H3CA 1BD3A 2MU1A 1H2EA 2I76A 3WISA 1ZM2A 1L4KA 3ZWPA 4GRAA 4U2CA 2LIPA 1SA0B 4H6WA 1NT4A 2FGJA 3DA8A 4JK3A 5I51A 5BYBA 1SO7A 5I4CA 2C2GA 1T1EA 3AL3A 3ZJUA 2HSEA 4KMMA 4FE3A 4G63A 3F78A 3WGNA 3T1QA 3A32A 3JAMA 1CNFA 1U2TA 4ETNA 3G7NA 3WIEA 4B32A 4X24A 1FNBA 5JQGB 3VDMA 4IEIA 2NU6A 2XE8A 5EMMA 4IFNX 4CEHA 3R3YA 4EMUA 1FMFA 3BWXA 3V1YA 1PJ3A 1YJCA 2TRSB 3A3NA 4O4IF 4OA8A 1SCBA 3RKUA 1G9SA 1ZKMA 2IJGX 3AHGA 3CLSC 4YDQA 5JCPA 3W5AA 1I5RA 1VCJA 4QN5A 1NXOA 1PI3A 1X7GA 2ZQYA 4R81A 1LBQA 4U7HA 5HQJA 1ZCAA 1SC4A 2XEDA 4PZZA 3KEMA 2DKOA 5CTJA 3U4MA 3HMQA 2EKZA 1MZ5A 3PHBE 3EQ6A 4DDMA 3GYBA 3KSRA 3ZHYA 4DWWA 3OKAA 5DSXA 3THYA 1KIFA 4GS5A 4EZBA 3MS7A 2DFDA 2PXXA 1K6EA 2JIMA 2O0HA 3GA7A 3RAGA 3DZIA 3EK2A 3GUZA 2VK6A 1IBRA 3AP3A 1KS2A 4QVGA 3SOVA 2HQBA 3UV6A 1FSPA 1SKYE 2ACWA 4YAFA 2ZKLA 2PUTA 2QY6A 4M0PA 1NA5A 3ONEA 2G09A 1X6VA 1FLAA 3FUVA 4YJ3F 5IEJA 3DR3A 1EUUA 3ZLVA 2I6SA 3PX3A 2PKYX 1LI5A 1MH1A 2C5BA 1N6HA 3EZNA 3KQKA 4EMBA 2KM1A 1S2IA 2EF1A 4Z8XA 1PCXA 2W8ZA 3U37A 4MW5A 1E96A 2Q3DA 2GZMA 3I9V6 1XTRA 3E5ZA 4N6GA 2GTIA 4XX0B 1ESCA 2B8NA 2PKQP 1SKAA 3HPRA 1ZH6A 2JH9A 2XZKA 2GERA 4HBGA 2H1LA 2B61A 2G9VA 2VP9A 3CIOA 4MRNA 5B1IA 3P94A 3L05A 3FYUB 3ME5A 4LWPA 4MGYR 5LMNB 2E55A 2P77A 2ZANA 5HS6A 2GHRA 4UMFA 1IN5A 3AESA 4R2IA 5KJCA 2O3UA 2VRCD 1L5MA 1ECPA 4MI9A 4NCXA 4CM8A 2GVDC 1C3EA 1G19A 3R0QA 4Z0PA 4DUPA 4UASA 4NBSA 1AK1A 1O08A 1NZJA 1FW8A 5CBPA 4M9UA 3UGJA 1LU9A 1N2OA 3ZE8A 1XXHA 2QNRA 3UTCA 1GYPA 1GPJA 3HTXA 5FLXA 4I4CA 2ZIAA 3OIUA 3IMEA 2COUA 1XL1A 4LXTA 4QXMA 4Y9TA 1BRTA 1QTNA 1TVMA 2CDAA 4BN5A 1P2SA 4YPVA 3UANA 3QE3A 4ND8A 2VHXA 3PJRA 2GJSA 1ZNXA 5AIAA 4KI7A 3RVSA 2X22A 4BJ5A 4NXMB 1XEXA 1SRQA 4JVMA 5L6LB 1L8LA 3VPSA 3R3HA 4CMEA 2QRUA 5IMBA 1S4QA 2AMLA 4KVFA 4X6XA 4KAFA 4S24A 2F3TA 3FYDA 1S8OA 2ZYRA 1E1RA 2HHLA 1WX1A 3MWYW 5ALTA 1GFZA 3STUA 2WWHA 3UWDA 3W8FA 3TAHA 4CQMA 5I6DA 2CFIA 2YHIA 3IBGA 3FRIA 4TVBA 4JBYA 4UCQA 2Q1WA 2PMEA 1OPXA 1K89A 1U3VA 3QU5A 4IV5A 3CE9A 4MIEA 4BB0A 3OM0A 3NFRA 2V65A 1FNCA 2XA9A 3ADOA 4FWTA 3HDQA 3RK1A 2GPYA 2SICE 4WBNB 2ZTUA 1JP7A 3HJTA 4OIMA 4CFYA 1LTKA 1UC5B 1ZCJA 1XYGA 1X7DA 2PU7A 2PE5A 4MS3B 3A6EA 2YIVX 1K27A 3P9QA 4O4HB 3IV9A 3SY8A 1EESA 4HBZA 4M1OA 1L7OA 1VE6A 3V46A 4BBZA 5K0FA 1AO0A 1FRNA 3LTNC 4DCGA 5GPBA 1KAOA 4YQZA 2R8OA 3QKSA 3PNLA 4K1JA 3TQCA 4ZGCA 4ZQCB 3TQSA 3UC5A 4A0QA 1U8XX 2FPWA 3MXOA 2Y1GA 3WGGA 4FILA 4PZLA 2RG7A 5ERXA 5IZCA 1QVZA 1QYRA 2RGNA 4H9GA 1U3UA 1V0ZA 1DKOA 2OCXA 1SKBA 2EZUA 2QSJA 4E07A 1JXQA 3I73A 5GOTA 2X14A 2AZXA 1D6MA 4O4HA 2GPJA 5FA5A 5J59A 3QPAA 3T1YB 2WSLA 2M98A 1NASA 3V2UA 1G8YA 2FUG6 3MTGA 4QO7A 4RHUA 4W82A 3FNHA 3RVDA 3FYSA 5KWSA 1Z37A 4P3XA 3GPBA 3IE0A 4PLZA 2ZT7A 1SUPA 3R8XA 5AJXA 4EENA 3VVLA 2ZIEA 4DT1B 3SXPA 4OXYA 1THMA 2H2DA 3FDZA 2I33A 5ALOA 4ESEA 4O2AB 1QLJA 4JI5B 3LKDA 4R84A 2PPLA 3HB0A 4KAXA 3IAM6 1A96A 2P9FA 5IM4A 4IWXA 1UZAA 1WABA 3MMSA 4MWWA 4KLCA 2JEYA 2XIJA 1QYCA 1MJNA 2Q3EA 5A06A 4OUDB 3NBZC 5F76A 5C52B 4OQZA 1ICIA 4HXFB 1G3IA 3G0GA 3H2HA 5MDHA 2X0NA 1ZN2A 3P4UA 2GXUA 4MWDA 4GYYA 1F8GA 2GVNA 4XM1A 4E94A 1RI5A 1XNHA 3MJTA 4I66A 3AB7A 1LNQA 3KOZA 5K3FB 1WY5A 2AHRA 2OKCA 5FZNA 4LNHA 1U0SY 4HATA 4ND7A 5TARA 2NVUB 1X70A 4HYYA 3EUFA 4UUPA 1TKBA 5DI9A 1NQXA 3DWFA 2F25A 2XNHA 1VM6A 4YJ3B 5EIHA 3VPHA 3DKIA 2WTMA 3FPGA 3X1DA 3IDAA 2ZB3A 3K0CA 4JIGA 4DXDA 3JS5A 4ZPXA 2HJ9A 1XRPA 2NZJA 3IDZA 4H1WA 1U9ZA 1GL6A 2F1IA 2QVGA 4YTEA 1KNXA 4NAHA 1A2BA 1GLGA 4DA6A 3EG9B 4AUMA 3GVPA 1RMYA 1CY1A 2OEPA 2ZYTX 1RC0A 1IVDA 4A8JA 4EL5A 1ZSNA 4HN9A 2IA5A 2YV3A 2CK3D 4P08A 5E0KB 4S05A 3ELWA 2JAWA 1YR9A 3TFQA 4EY8A 1I0LA 1Y81A 4LTNA 1XTTA 4FHCA 4Q34A 1T2DA 1Z33A 2Q6LA 4UU1A 1QP7A 4CF3A 4MO9A 2GM4A 5CLHA 4C6TB 3QV2A 2GSWA 4WZBE 3RSLA 2OCGA 4NS4A 2J3EA 2FB9A 5E0OA 3FPEA 4G1VA 4L27A 5M1ZA 2VC2B 5FWDA 3MJRA 4UARA 2KE5A 3L7MA 3M82A 4JBGA 1OTYA 2WD9A 4QG3A 1LPNA 3N70A 3A3YA 4IS2A 1SH7A 1DAKA 1EFKA 2DULA 2LBPA 3OMLA 1R16A 4IV0A 1DJOA 3GEMA 1G8AA 5AKKA 3FDJA 5IYZF 3PJQA 4J29A 4PC7A 3O90A 4YO7A 2BMFA 1Z25A 3R5TA 3ISJA 1Q3HA 1RHQA 3JRNA 4UPDA 3WGZA 2ALJA 1HQCA 2DX7A 2VL7A 4QDXA 1Y33E 3VVBA 5BQ3A 1S8NA 3B9BA 4GNAA 3GO4A 3L79A 4FP2A 3LYAA 3IGFA 1TQ4A 3H3XA 4H17A 2R6ZA 4ZT4A 5HIKA 4ZTBA 3ROKA 4ALNA 1ADJA 1GPBA 4U2DA 3QHQA 4OP1A 4WZAB 5CH3A 3ILYA 3VBCA 4EBFA 2ORYA 5F3WB 3F2VA 3EW7A 4DJ5X 2H4JA 2B9VA 4YT2A 3Q8WA 5DHQA 1NR1A 4YMHA 1YGPA 2P62A 5EE0A 4TKMA 1NM5A 2AC2A 5HKBA 3F46A 3UJNA 5HJ7A 1UXHA 1PX2A 1MUUA 2RB4A 2YRFA 1SCJA 2YYYA 1AB6A 3FOCA 3FPHA 4C6SA 4F9EA 2XOEA 3UEOA 3K1YA 5JALA 4EEXA 2B2CA 3LIIA 1KHHA 2R6HA 3T9EA 4X0EA 1Y4AE 1P1HA 6ADHA 4B33A 2H1SA 4A27A 2BF7A 3KDPA 1E2MA 1YBHA 3G5TA 5HQTA 2JLZA 4Y0NA 3E9MA 5K9ZA 2VWQA 3WHKA 1S8FA 1OX4B 4IFEA 4WOBA 3R5KA 4BKPA 4OGKA 1DG9A 4HV4A 5KDOA 4AJJA 4OQPA 4L4RA 3PDIB 4UHKA 2RHCA 4KQ2A 1JJ7A 1TC1A 1U0OC 3ORHA 2JAHA 2KX7A 2AOXA 1T9AA 3P0FA 1GTVA 5E1MA 4DXAA 4EGQA 4YUVA 5ALLA 1D2RA 1KJNA 1YVEI 3HJCA 4AJNA 1ZGJA 5L7WA 4IICA 1UC8A 4G5RA 4C0QC 5MN4A 3SZRA 1ST2A 1TYDE 5CCBA 2Y0DA 3TDNA 2YWHA 3S2SA 3FOFC 1CJBA 3FUWA 4B40A 5K0CA 4NENA 4RJLA 4BGDA 3VQTA 2GILA 1JQ5A 3QX8A 4S1TA 1YL5A 3IKJA 3ZYZA 4BLSA 5LQDA 1SBZA 3FCXA 4B74A 1ISIA 1PQUA 2R62A 3H1EA 1OFGA 3CX7A 4HEA6 2VVTA 2EDAA 4U7JA 2FRDC 3DE5X 3FVRA 4P4UA 4JDUA 2YMQA 4W1RA 5FFMA 1WHTB 4XCVA 4OK6A 1W0JD 2C4TA 1WD7A 1J70A 1FYFA 4ETWA 2DQKA 4NENB 4MW2A 1J97A 1XZCA 4WE3A 2W0MA 4X1KA 2JCXA 2W2OA 1TU4A 2VRWA 3ZJ4A 3GC6A 2QVBA 1CUSA 4OLFA 3I6IA 3KO8A 3VJMA 2OFOA 1YRYE 1F60A 1G5HA 1J5XA 1BGWA 1TB4A 1G21A 3OJEA 2QS9A 3IEUA 4GI3A 3S2YA 2OHHA 4MDHA 1I2CA 4HVAA 4Q00A 3GDWA 3V32A 2QR2A 4CYMA 3NM4A 4YROA 3IAUA 1GQSA 1HE5A 1RKUA 4G1BA 2QLJA 2BTEA 2ZRAA 3H72A 3BORA 2FMTA 2PUEA 2IAWA 2BI7A 1XK6A 2G04A 5AXBA 4QPNA 1Y3BE 4U7WA 2NNWB 3L4KA 1W8IA 5I7RA 4O5SA 1OX5A 3TJMA 2VWHA 4EY3A 4ARCA 4PRZA 1F8DA 4BUCA 2XUDA 1R4NB 3CG4A 1CT9A 1N5KA 2CE7A 4XTCS 1BN6A 1FQKA 4C6RA 2VT7A 5IKPA 4MXDA 1Q20A 1RRCA 4O8CA 5IDWA 3JYOA 1SNTA 3L01A 3R5JA 4KQ1A 2B7BA 3L4BC 3NWOA 4PYRA 1CZLA 5BYAA 3TTUA 1US8B 3R74A 4E5VA 1ZM3A 5JJIA 4NDNE 4MZXA 4QAQA 3CVJA 4HNAB 3E5HA 1GJRA 2ZTHA 1SUDA 2DF8A 2E6KA 2FFBA 4B82A 1H8HA 4K81B 2H2HA 1DRJA 1J7JA 2MR6A 4LOHA 4OJKA 3GJQA 2R68A 3ZHOA 1YB6A 5TQ0A 2HOQA 5EZYF 1M76A 1UK8A 5GV7A 1US8A 3MB5A 2HDWA 3VHXB 2XDWA 1KWKA 2FSHA 3OJCA 1MT3A 2GVWA 2CMHA 1KTVA 1NE7A 1NDUA 1LH0A 2YHBA 2LUOA 4H7JA 4RPHA 5GJCA 2X42A 4RE6A 1OLSA 2XZPA 1S3FA 1WLSA 2XWPA 2Y0PA 2RHLA 4K9DA 2AN4A 1L1EA 4Y6QA 4AVYA 1G4UR 4O5AA 3UO8B 4B6GA 2V96A 1EZZA 3IIKA 5D1NA 5ALUA 6AT1A 2W8BA 2G63A 5EIFA 5KYTA 4CPNA 2ZB6A 2X8JB 1S7CA 2ZPTX 4BLTA 3AMSA 1U9JA 3VOTA 3BE8A 1UPUA 5DCUA 3HN7A 3KFLA 3MPUA 4RANA 3UWPA 3R3WA 4F11A 3N6VA 1XN4A 4IJMA 2IBSA 4CHBA 1T9DA 4BO3A 1ZNZA 4FE7A 4C78A 4YW1A 1CJKC 3GFVA 5ITSA 3HU2A 4TTSA 5T3UA 3WQBA 3PYLA 1CJCA 1Q1GA 3LO5A 1EBUA 3D3EA 5C7YA 2NV6A 3HBNA 3I5AA 2QXUA 3WMWA 1NC1A 1NLUA 1TQDA 2KHZA 2Z5LA 4DLUA 1KEZA 3EPLA 1U2QA 2JC3A 1CZKA 3M5WA 4RD4A 4TLBA 2WHPB 3KHKA 3JW8A 4RHEA 1UBTS 4TSFD 2OHVA 4QJ3A 1DP4A 3M1YA 1DU4A 1NMQA 4BZWA 4EF4A 1N33B 4IUDS 1ZPDA 3YASA 5EMJA 1TQ6A 4K86A 4Y2VA 1I24A 3GH3A 3G1UA 3EMVA 5M3BA 1DUVG 1X8LA 3ES9A 3M7IA 4KX3A 3DMTC 3F6BX 5EGSA 3NIFB 3L7JA 4L1KA 2VVZA 2BBOA 1UFKA 5L3RA 1MA3A 2NN3C 4IDQA 2OJHA 1X0XA 2YZMA 3SHVA 5D00A 1ZLYA 3IT3A 4LPSA 2BFOA 3V4OA 2X5KO 1EFAA 2QY9A 1U8UA 5PNTA 3TI9A 5B3KA 3Q9NA 3PUVA 4LRSB 3B69A 5LUBA 3VPAA 2IYNA 1S2GA 3OBIA 2I3DA 4KIJA 2FP4A 5JMTA 1NJ1A 4RA6A 2EJUA 2E6UX 1R4AA 2K87A 1G6KA 2R79A 1BCRA 2BR3A 2Y0BA 5K8CA 4Y1GA 1CJVC 4ZPJA 2AOTA 4WZBB 4NU0A 4O02B 2FG5A 2VRNA 4M21A 4Y1FA 3SPXA 3G5MA 2VK5A 4I19A 1A69A 3AOEC 3OE1A 1N2IA 1V5GA 4IEFB 4MUIA 1Z88A 4CM1A 1QGAA 1SXJB 1VHQA 5B2FA 4REQA 4FP9A 3NUGA 2QTZA 3SZGA 2FHSA 4IKPA 4K1HA 1Z3IX 5EE9A 1W88A 2VYVD 1KA9H 2P0EA 3EE6A 3NHKA 4YDHB 4WMLA 4RK6A 2UYQA 3E9QA 3BEDA 4X45A 4JGBA 2XY4A 1JQLB 2F3UA 3K6SA 1VRCA 4PM4A 3VPXA 1X9IA 1ZNQO 1YQ9A 5M2QA 3M83A 4AFNA 2HXGA 3SALA 1BHQ1 2Z6AA 1AXRA 3H5TA 5B1SA 2Y1WA 3PV0A 1GZVA 2GAJA 3NNSA 3O3OB 3ZBQA 4YASA 3FGOA 4X63A 4OK3A 4W7IA 4AZ0A 3GEBA 5BNTA 4TM7A 2PL1A 2PBZA 4S1NA 4I9UA 4U7GA 1UBUS 1CZRA 4OLBA 1JG6A 5T64A 5FWWA 1JHZA 1WXHA 4CCYA 4EA8A 1TW2A 1DIAA 4JGIA 1R0XA 4KXWA 1IVYA 4MUAA 4PX3A 4Y9DA 1BXRB 5HDBB 3TOSA 1Q7EA 1W4CA 2WA1A 4AICA 1AG9A 1J39A 1L5GB 2Q6TA 2B6HA 3GW8A 5LC1A 2AUNA 1PWZA 4NECA 4OGWA 4XD7D 1RM3A 5H70A 3CKYA 5EZSA 4BV3A 2C7BA 1RE1A 2ZYGA 3NU1A 3PLRA 3SOZA 3SHQA 5B6JA 4P6VF 2P6UA 1PTJA 3UK2A 2VS1A 4D9KA 1TPYA 3MBOA 4A0HA 4F2DA 4BL5A 3G13A 3RTDA 1BU8A 4ESVA 4EKGA 2Q8NA 1K8YB 4ZT6A 1KZ6A 5ECWA 2NQTA 2A57A 3GG9A 4LTMA 4UQLA 4HX5A 1CK4A 2DPLA 3MTIA 3NHPA 4OHZA 5B6IA 1CUEA 4FHZA 3Q3GE 3AGQA 4UM7A 3DPSA 2GEKA 1HE4A 4HDCA 3MAAC 1ZIXA 4OSEA 2WILA 2HCTA 3LO8A 3TPCA 2DG2A 2FSGA 4CPDA 5A04A 4BQEA 2FEPA 3FUUA 1R9MA 3I12A 2AW5A 2EBUA 2Q2QA 3GEHA 3KXKA 3OX4A 5KYUA 4KR6A 1R0KA 2ZSEA 1O54A 2B6NA 4EHKA 5G40A 1QU2A 5BUZA 4WSOA 3NBMA 2M6RA 1DWUA 3F67A 3K4QA 2QPLA 5EUMA 4FZ3A 1YJ8A 5JI2E 1EQUA 3ST7A 4HH4A 2GX6A 3TTWA 5KTMA 4YRFA 3IPYA 1L5NA 3U62A 1N2ZA 1TJNA 3GXOA 1BW9A 1G21B 3T06B 1DS6A 1EFPA 3IHKA 4MV6A 1GT91 4ZO7A 3RVJA 4QLOA 2BZ1A 1CUFA 2GDJA 3VR4D 1Q17A 1TCUA 5CB4B 4ZZ1A 1JQJC 1HRKA 3VZQA 1F0PA 5D5PA 3WDLA 1WZCA 4QFBA 1PJXA 3LNTA 1LWNA 1PFQA 2RC6A 3ZUPA 3OJLA 5JD6A 2QM7A 1GCGA 2YZNA 1JBEA 1BSVA 1OKKD 3NS7A 4WT7A 4GLOA 3W5DA 2JLSA 1YZKA 1I7NA 3IIEA 4RCZA 1K2WA 4X3PA 1IUNA 5DCYA 2I7DA 5EIBD 1NE2A 4F4UA 1ZVVA 4LFBB 5H68A 5AKHA 2CLDX 4IMRA 5JNTA 3O8CA 2XB6A 2O2XA 4I3FA 4TROA 3SN6A 2MINB 3WNVA 5HTKA 4M0LA 2JI4A 4X20A 1D0VA 1JF8A 3N39C 4U0KA 4RVSA 1A88A 2FSVA 2GK4A 4CPMA 2VDUE 2G83A 3Q0TA 1VZ3A 3OQ1A 3PXXA 4FX5A 4WESA 3AUXA 4B3FX 2D4AA 4R83A 4X65B 2C1ZA 5EX7A 1UFRA 2HMUA 2PX3A 5FO1A 3WRXC 5AW3A 2G9RA 1QVWA 1CLUA 4BB9A 2PLWA 2PIAA 3TKYA 2CHQA 5BNWA 5DLDA 1C7ZA 1AKMA 2C4MA 4JKOA 3RRMA 3IILA 3A58B 4LX8A 2JZOA 4B9AA 5AVTA 5K05A 3IURA 1IZ9A 1QFSA 2HO5A 1NDQA 1KGSA 1X19A 2ZBDA 4FFRA 5UKDA 2GN8A 4DS3A 2AYYA 3LUCA 2AEQA 3R3SA 2G67A 1KMQA 4KR2A 4DJDC 1KEPA 2FOIA 4KQKA 2DRIA 1T9ZA 4MDFA 2ZIXB 1A2OA 3MMPA 4V3BA 1P60A 2NU6B 1LJLA 2BFNA 3QQ5A 2R85A 4BAUA 5JJLA 1OW3B 1QAMA 2I67A 4D43A 4HZWA 3LCMA 1WU7A 1F20A 2EERA 2OLKA 2AF4C 2PV0A 3EMDA 5JRJA 4ASUD 3QWFA 1IJEA 1QYIA 5J5CA 4QYXA 3ZUGA 5K99A 3LPCA 2R6JA 4YMVA 2ECFA 3GROA 3DP9A 3RUEA 5KI6A 2BHNA 1ENZA 2PKCA 2QLFA 4QDKA 4BFYA 4YLYA 2CVQA 3C15C 1GAWA 5L7TA 2A84A 1HK7A 4AKEA 3LRXA 3NT2A 4ZMRA 5INTA 1TE2A 4JN6B 1DRKA 3ZEAA 2LDXA 2ZXEA 2JFXA 1VMKA 2Y0CA 3RVRA 3ZWYA 5ADHA 3SOPA 2WQ6A 4EWLA 4FK8A 3RAJA 3JV7A 1EB9A 4O4JB 3O8QB 3C39A 1QZUA 5EQFA 5FPPA 5TPZD 2CJWA 4RGYA 4U1RA 3FPAA 5KTOA 4ZGBA 4OXKA 1XB2A 4X1IA 2PSJA 3WIOA 3EWAA 2XA1A 3PKIA 4QNRA 4KE7A 2W20A 4IQKA 1ADBA 2FFJA 2I1QA 1FMTA 1JTFA 3NTVA 3S1LA 3JQDA 3UUGA 3TYXA 2D5AA 1ACLA 5I7HA 3ZD8A 2CV2A 1IDN1 2QSZA 3ZE6A 4L6AA 3W6OA 2ECQA 1U1EA 4MWXA 1AHNA 3GDFA 3I1CA 1NJSA 3W2EA 2B8HA 3TXYA 1QRTA 2J4FA 1OC2A 2EV9A 1F38A 1A7JA 2AJ8A 4JZKA 4IJKA 3H5IA 4UE2A 1N1MA 5KC9A 4QJ5A 2VF5X 3MT9A 1N5RA 1TW3A 3CEMA 3LRTA 3GL9A 4MHOA 4YV0A 2BJWA 4E5DA 4JB8A 3DZKA 2AR9A 1ZBDA 3D7NA 3AESB 4GNRA 4QX6A 5H82A 1C14A 1DC7A 5LA6F 4AECA 4AWXA 4S04A 4FXPA 2JGMA 2QUBA 1AGNA 3AR7A 1VLQA 4R3NA 2W2KB 4HLDA 4KK4A 4TYQA 4YJDA 2G8NA 2YQ5A 3T9DA 4JJGA 3ZOKA 2ZFUA 3WLSA 3COVA 1ODLA 1BZYA 5JLJA 3A2KA 4PNHA 3D81A 5EIBC 2DSOA 2PZ8A 1BROA 1OCEA 3GU3A 1GAEO 2ZRCA 1L7XA 3JCZA 3DHWC 3SG0A 1DWPA 2I62A 4XASA 1OU0A 2Y8EA 1UMBB 4BBWA 1GEEA 2DUJA 3DT8A 4CEHB 1Z75A 1LQUA 3S44A 1HA3A 2HA3A 2ZGVA 3IO5A 3P2KA 1M72A 4ENUA 4CF7A 2Q1SA 4DADA 2VSFA 3B9QA 3U61B 5ALIA 1E0JA 2O8NA 5G1NA 1PS0A 3VDRA 2V6GA 1WY7A 3AUYA 2GAAA 3HXKA 3LPAA 3SSAA 3T5DA 4JUFA 4L5AA 3L6OO 1OZHA 1NL3A 1PGPA 3BTSA 2ZRNA 1X0VA 4Q1AA 4CL8A 1HQKA 5F1OA 3S2FA 2EP7A 3QKUA 4H35A 1G3QA 3ZDQA 1SAYA 5DIZA 5BOSA 1YQTA 4ND6A 3HVKA 1OZ0A 5FOUA 1RCUA 1R4MB 2GRAA 3R6TA 4CEIB 1WRBA 4Q7LA 5BN1A 3CN9A 1UMKA 4HWOA 1JG4A 1WV1A 1LDMA 2PR7A 2GZ1A 4RTSA 3D8TA 2ZE7A 4RIEA 1R64A 5C1OA 2D06A 2Q9BA 4MVJP 2W43A 2P4OA 4UHBA 3AUSA 3B7GA 1DELA 2RH8A 1P7WA 1LW6E 4YI3A 4Z7QB 2VQSA 4AROA 5DBGA 1Z29A 2QL7A 3V8RA 2RGDA 3DBIA 4FPCA 4P3OA 4URYR 4YDSA 3ZK7A 5FEUA 4NCKA 1JVBA 1Z0SA 4PPGA 2DPXA 1E1DA 4KLNA 2YOGA 3IAEA 1A50B 4RHYA 3ETHA 1T4CB 5IANA 4BRUA 5EFZA 2BEKA 4IUBS 2QTWB 5CVEA 2O0JA 4ZOEA 2C2ZA 5GJVC 3BIFA 3RS4A 4B4DA 4C7BA 1QTQA 1MZPA 4GE0A 3V1TC 1APBA 3ADKA 2V8BA 3LT1A 4MX8A 1Z0JA 3KYCA 5DT9A 2PS1A 1CEEA 2P2YA 5L51A 1VHLA 2Q5QA 2TECE 3H5VA 2DZDA 3PIDA 4B6QA 1EAYA 1SIWA 4RDHA 3FGZA 2BGNA 2V59A 3AV0B 3CF4A 4ILKA 3NHSA 4PZYA 2BKUA 1TCBA 3CRW1 2GFIA 4B7QA 3KKMA 5IFKA 1EX1A 3CZ9A 2YJZA 1I7DA 3QFHA 2Z32A 3D0OA 2H4HA 4AYXA 2HN9A 3NEJA 3GEPA 2J46A 2QR3A 1N3YA 4B17A 3VPFA 1G7RA 2EKBA 1E6EA 1GA1A 1SXJE 4WZAA 1DB3A 16PKA 3L93A 3E7FA 2OBYA 1NFRA 5IC6A 3D54D 4EB6B 1V0EA 2VSOA 2GYYA 2QM8A 2QUZA 1FFCA 4OCZA 1RJGA 1PR3A 1D3AA 1ADGA 4YC7A 5JO0A 4KS2A 3PEUA 3HJRA 1KQFA 3QPVA 4U7DA 1D2EA 3ASVA 3RYHB 1XC7A 4RY8A 5SYAA 2FOLA 1IZZA 5J63A 1RWKA 1DAIA 4MVJA 4YMTA 2PVSA 2X0JA 3EASA 3M3HA 4H6XA 1HE2A 4XFJA 1WXEA 3EEFA 5ENZA 4A8JB 3LV8A 3H7AA 1TDJA 2VJLA 1G42A 2ZYHA 4D99A 5HQ3B 2FUCA 2Y9PB 3RU3A 2V1UA 1BX1A 2I71A 3BWMA 5AESA 1JALA 3IE2A 3PYMA 1HMYA 1VG1A 3H9GA 3SEAA 2VHJA 1FFAA 3E4DA 5TT1A 2DBVO 4JEIA 3GPDG 4C3OB 3M8KA 4DQDA 1XZAA 1Q7CA 2WOZA 4QFCA 1M5UA 1TF5A 3GJZA 2WKQA 4GFDA 4W6ZA 4YXFA 4FOLA 1O9GA 3SZLA 5ALHA 5AUPB 3ZLBA 4J0CA 4XVRA 1DL5A 2J5QA 3TINA 4KUHA 4WZZA 2PUAA 1NVUQ 4MUGA 4POAA 2BVNA 2I4RA 3EZLA 3SF8A 3VNRA 1GQQA 5IJ0B 3ABQB 3C4VA 4FI3F 1U5AA 3AX6A 1MB0A 4OXQA 4D96A 1MAVA 4R68A 4QN3A 3K73O 3QYPA 4F2GA 1GVNB 1B9VA 1QF6A 1TVCA 3UJAA 2F28A 3OG9A 3QH4A 3RIYA 3LCJA 3D6UA 4V0QA 4JC4A 1GHTA 1JIVA 3C3MA 3FN4A 4CLOB 3AEKA 4F71A 4MMZB 4EW3A 2DBQA 1EFVA 3DE7X 4FJ2A 2HHJA 2OXFA 4ZVMA 4QUIA 5G0SA 4A2CA 1SCDA 2ZTLA 1ST3A 4Q82A 3IA7A 1RM4A 3VH1A 1DQYA 2A9OA 2H07A 3G89A 4KO4S 2A3RA 4PPNA 4DMHA 3RROA 3UOWA 4CLHA 1L1QA 3UCEA 4BWYA 1DIGA 3TIIA 2ZAIA 5JI3E 1EK5A 2OMKA 1UJ2A 1ADYA 4EJ2A 1H2RS 1A7UA 1LDYA 2JGEA 2UVPB 3JTMA 4AS3A 1Y0BA 1NV9A 4J3NA 4FYIA 4I7EA 4OQFA 2J3LA 3UXEA 3Q7QA 4IN4A 1P2BA 2P5SA 1GQYA 4GRDA 1HG0A 3KUDA 4CETA 1GLVA 3DT9A 4CUKA 1QK5A 3G82C 3THYB 4LOJA 4X6LA 2Q07A 2DU8A 2GVXA 1DKUA 2JFBA 1SK9A 3E8MA 4YFYA 1CU1A 3K94A 3AERA 4IHJB 4KDCA 4XJSA 5FWNA 1UPAA 4E70A 2O23A 3I6ZA 4DR4B 3HR8A 2XYQA 5DCLA 3V4RA 2TMDA 1JG1A 3WBJA 4AQ7A 3DW1X 3WR5A 4LCEA 3BA6A 3FYTA 1HYEA 2G77B 4D57A 2PMKA 3VMMA 4PC3A 4XMIA 2BONA 4XEHA 1RYEA 1LLQA 3X2FA 2G1PA 1E2FA 2AI1A 2BFEA 2GAOA 4TYPA 3W6UA 1TOAA 2AR0A 1I3CA 4OJMX 4CM3A 3HC7A 1NFQA 2F10A 3UVEA 2Y1FA 3HFGA 2MYNA 4AJ2A 4RNCA 3ZHBA 4LCBA 1BC5A 2EL9A 4XDYA 4ZU6X 1F2DA 1AS0A 4JJFA 1CIPA 4MVWA 5CDFA 4C7VA 3PWZA 4TLAA 2WD7A 2WJIA 3MG9A 3D7RA 3V9AA 2Z4RA 3KKLA 2XADA 4B6SA 5C81A 4PSDA 2SNIE 5JAZA 1ZHFA 4J0KA 5LQUA 1D4FA 1ID1A 2BR5A 5BSVA 3ETCA 4I4TA 5C31A 3RRZA 4BO9A 4BIMA 2AG5A 4HFNA 1BX0A 3IELA 1STOA 4M1EA 4QDUA 4EAQA 1RHRA 3RS8A 4UD6A 3UJ8A 1HNWB 4LUCA 4X54A 4RSRA 1AUOA 4LNUA 4MGIR 1SHZA 4EA6A 4Q9DA 3GJXC 4LZNA 1XJQA 3DOIA 1HMPA 2VYCA 3QEJA 4KXLA 5IBQA 3ZIUA 2RGRA 4DM4A 2C5GA 1KFEB 2WQZA 4MW9A 2IH4A 2W00A 3G5UA 2H17A 4DW8A 4IYGA 1V11A 2Z4SA 3ET4A 1I13A 2HWYA 3I92A 4FCCA 4OB8A 3X0DA 2D7DA 3HDYA 3I4FA 2ZB2A 1H42A 2IUYA 2BYTA 4QPJC 1GCUA 2XNJA 3QVLA 1PG5A 3UJDA 3KTAB 3R7FA 1OTHA 2XYHA 3F5DA 4IQFA 4BPBA 2YWEA 3GZ4A 4ARAA 4FNAA 3O8RA 1JTVA 4DCSA 3HJFA 5F35A 3K1AA 1DQRA 1VCMA 4ARBA 3F5SA 3R7DA 3ICPA 3ETEA 1GU7A 2GA8A 1PBNA 4OXRA 4C4SA 2Z2ZA 1FNSA 1ODFA 2A94A 2I9PA 4FDAA 4XLZA 5FR2A 2CF6A 4L75A 1ND6A 2W0SA 2QM0A 3KNZA 1E3QA 5KX5B 3ZV7A 4R2XA 5LP6C 4DCMA 4GOND 3OH8A 4U9HS 4TUYF 1V48A 4JLPA 5IF3A 1Y6RA 3FFTA 3GWGA 5KJ1A 1O95C 1USUA 2RKOA 5J2UA 3CNNA 2J3KA 2PD3A 4PYIA 4DDKA 3ROFA 4DIMA 5GTDA 3O8OA 2V7XA 4CMBA 3IDSA 1Z63A 3HR7A 2PXHA 1WKVA 2PH7A 1J2YA 1U3WA 2PGOA 3GFRA 2PQ2A 5H0IA 3RR2A 3SSOA 4WY2A 2XT9A 1OI2A 2PSDA 3JY6A 3TQHA 1JEOA 1HKHA 4GOXA 1GSHA 2A5LA 1D2CA 3AUKA 4Q01A 3ABRB 2B98A 1M67A 1H85A 1MO3A 1NVDA 3BMXA 2OWDA 1MWEA 3EOAI 3H9UA 5DF1A 5DTMA 2JLCA 4IDNA 4BMXA 3ELYA 3PVCA 4PQEA 4Z0HO 4MIOA 4CTKA 4CPOA 2JKVA 3FNFA 1NXWA 1YQWA 4V3CA 2FLWA 3VMFA 1Z0IA 3T7DA 3G1WA 1HPLA 1RC8A 4UVGA 3Q85A 4EPRA 3CPSA 3EZGA 3WRWA 1KXZA 1EK0A 2NPFA 2ZZNA 4R1PA 4HQ0A 4M0EA 5DTQA 3B1ZA 3M0EA 4MGKR 1TADA 1DX9A 1VKZA 5KOHB 1JKIA 4M76B 2QL6A 3S7ZA 3SICE 2QW1A 1A8UA 3O1HB 4OAOA 2W2TA 1QX3A 2G72A 4RL4A 2FX5A 3G8DA 5A0VA 1AN0A 4QUBA 1WV0A 4XI9A 3GH1A 4XE5A 3IKLA 1W2WB 2B0JA 4LC9A 4UDNA 1LD3A 3T7EA 5BXQC 4LZAA 4AF8A 3E6AA 3VPCA 3QVOA 1H4TA 2J32A 2Q4DA 1GTJ1 3H99A 3AY0A 4KYIB 3ALWA 3HCAA 3DDCA 1WCIA 1X14A 3DFZA 5EZ5A 5EWLB 4LF8B 3GG2A 5DWVA 3GJ3A 4GYWA 5BW5A 3MTEA 2P3LA 3GMDA 3LKBA 3L1JA 1P1KA 3T7CA 5BN3B 3KYDA 3ZX4A 5REQB 2HCRA 2E82A 1T8TA 1I7QB 3OD1A 1M7BA 2GLXA 3A9GA 3DCIA 2B4KA 4G5QA 1HO3A 1S2LA 3NHBA 4A6XA 2X1MA 1I6LA 4N7BA 1HLDA 3ETGA 3ZW9A 1OGYA 4MR7B 1S1MA 3OAAD 3V3KA 4IHJF 2CXUA 3U4DA 4Q7QA 2NXCA 3HV2A 3JTEA 4RZHA 2QF7A 3LHFA 5EP1A 2XE7A 3V48A 2FZEA 1V43A 4BN4A 5B3LA 3GGJA 4I4LA 2PR2A 2CUNA 2H9IA 3LFUA 4PTYA 1VMIA 2IH5A 1QQ6A 2XMZA 1GUZA 3NRBA 4FFOA 4OB7A 3FOBA 4KC0A 5JJ5A 5DNWA 3LQYA 4HIZA 2MTBA 5JATA 4OM7A 5JH7A 4YQEA 1W30A 3EUEA 4NOKA 3UCXA 4OIFA 1U7UA 5GWXA 5JNLA 3PC7A 2YDPA 5HZKA 2C9MA 1QIJA 2HMVA 5LVAA 2J3IA 5AM4A 1GNRA 4JX9A 4JV5B 3A9HA 2X77A 3RC3A 1Y5MA 4PNEA 5CVDA 5KCZA 4MVJM 4ZHQF 2GRUA 5C46F 2TYSB 3T7JA 3HFRA 2ZSAA 5AOCA 3OPYB 1WMBA 4AO7A 1UJMA 5I9NA 1L5RA 4KTTE 4CODB 4EUFA 1S0JA 4U63A 2J9ZB 1PR4A 3GT4A 1P0PA 2BSXA 1XKTA 2VZ9A 2C4NA 4UBIA 4HGOA 5LMZA 5EGNA 3VC7A 4JXJA 3W90A 1GRNA 5FT9A 3JAWB 1DT5A 3QEMB 3HLTA 2EW2A 4EUKA 1PV1A 4P84A 2DCMA 3FAZA 4D4KA 4IOMA 4CGZA 2RAVA 3HBJA 3A4YA 1XBTA 3VKVA 1GFWA 5F21A 5I7AA 4Q1FA 3G0HA 4EPWA 1UOEA 5TXGA 3RC1A 4EECA 5E3IA 3ZHUA 4EG0A 2XF8A 3P27A 4K9LA 1W0OA 2X13A 4U8GA 2IEDA 1NMCA 2R87A 2RBEA 2FVXA 2JIZA 3FZNA 4O4IB 4RSMA 4O1HA 1YOVA 5G1OA 4XYXA 1FFHA 1YKGA 2VH5R 5HTOA 4QLBA 4XIOA 1M34A 3K53A 3ZU5A 4C2AA 4PLYA 4KQEA 3ZBUA 1UPTA 1FFXA 3B1YA 1RAEA 3UBMA 4EG1A 3U4CA 3CFYA 2EOAA 5K20A 5BN4B 4RLSA 1REQB 3PNOA 2RONA 1LA2A 1K3UB 2GESA 4OD0A 5F3DA 4TMKA 2Q3FA 3GLFA 1XNJA 3OX1A 3LT4A 4HDSA 2C8LA 1TUEA 4ESHA 1QSGA 1FP4A 2DWUA 2ID9A 1YKFA 3OPNA 4KZKA 2VWPA 3M5PA 3M3DA 2VTEA 3MIIA 5KOHA 1AO3A 3A6ZA 4GNKA 1UZMA 1U2EA 3K2BA 4GGOA 1ABBA 5HFAA 4I55A 3R9IA 1E98A 5FHQA 1NBHA 2I3ZA 2NYAA 2Q0QA 4FSHA 3MT0A 3Q7TA 1RM5A 1YA4A 4XEUA 4E22A 2DT8A 4JBLA 3U5TA 3WADA 4B3MB 1QXSA 2WTEA 5JQGF 3QVUA 5KDDA 4RTNA 3DLTA 1Z06A 3G8CA 2BGIA 2MSEB 4IV8A 5C80A 3TG2A 3B3FA 1U0TA 2VDNB 5HUJA 2ZUEA 4Y3UA 1IWBB 2OVBA 1KIAA 1E1KA 1KSHA 2NX2A 2R00C 4CV3A 4X44A 5ELXA 2O1EA 2HT6A 5FUYA 3RM3A 4YY3B 3OSUA 5KUTA 3IDOA 3O4PA 4K3UA 3LT0A 3K9NA 3W8DA 5BOVA 4DCJA 2TMKA 4YZ2A 3R40A 4IW3B 4MKXA 4HGRA 3KXLA 3MBIA 4UBLA 4V38A 5KQSA 3AIMA 2POCA 1B93A 3RNLA 1W0KD 3SOQA 1NUAA 2YOFA 3H4IA 1WDWB 1FUKA 2A1IA 4ZQGA 2XMGA 1X42A 1XD2B 2C9OA 1Z5UA 2X5NA 3T0FA 3WKCA 1VSTA 2EJWA 2ZVQX 1QYVA 3EZ2A 4G65A 4J6FA 4MWTA 4TLCA 5BRNA 3SLRA 3ZWOA 3UHOA 4D3YA 1WIWA 2ZBQA 1V1MA 3L9WA 3OP4A 4CL3A 2W42A 1QH9A 1ZW6A 2WWVD 2P9GA 3KQVA 3U44A 2BZSA 3EA0A 3H1GA 3REOA 1XTIA 1YDGA 2C42A 2PVPA 5TY0A 3UMVA 5BURA 2ZI4A 3ICWA 5AFSA 2AN9A 3MWJA 3CUWA 3MWKA 2PS0A 4RF2A 4WLVA 3FRHA 1LJ8A 4CH9A 1W7AA 3UAVA 1OH5A 3TAXA 3AL0C 4DE5A 4L8WB 4DT1A 2WF5A 2P2CA 2ZWIA 1BN7A 3A05A 5B3JC 1RI3A 1NRWA 3WKEA 4YXWD 5K8VA 1GTRA 1FP6A 3K70C 5D3QA 2V1XA 3D6HA 3NONA 2B1JA 4CIXA 4I50F 2MMGA 2Q1YA 3HVRA 4GZLA 3UAZA 5FTMA 3HU3A 1L4HA 4FEEA 4OAPA 3T5AA 2XGGA 3I1JA 4FEGA 3DEKA 2C2YA 3IHWA 3QF7A 5K3SA 2O8EA 2XNCA 2FMKA 4WA8A 5D6NA 4MYDA 1UM9B 4LVUA 4XB6B 2BE7A 3RUFA 1EZ1A 3RB8A 4CLEA 4OXIA 1GGKA 4Y7CA 1ATIA 1NULA 1W76A 2DBYA 1E7SA 1U04A 3MGKA 3QTBA 1ORHA 5HIAA 1QJCA 1VPWA 3SM3A 3RVNA 5CJPA 3CX3A 3VHLB 4YB8A 4BLPA 2YIMA 3I9MA 3O9JA 4GKBA 2O59A 5LDGA 1JB9A 3F7MA 2PUDA 1M34B 3BXOA 1J8VA 3V7YA 4WVLA 2F00A 4KS5A 3I9KA 1U9IC 1USVA 2HTYA 4INAA 2YXEA 2TMGA 2G6TA 2LCIA 1C3OA 2WNSA 4LYYA 4QOEA 5BUQA 1C8VB 1G6OA 3F4LA 3TLAA 1ZS9A 4C03A 2ES4A 2JIDA 5LOVA 4YIKA 3W7AA 1I9GA 3GLFE 4RXMA 1S1DA 2OWEA 4HAVA 3DMTA 3N2GA 5EQTA 1E4YA 3RSCA 4EQ6B 4WW0A 3HB4X 4KACA 3BS4A 1JDVA 1Y98A 2QJFA 2G07A 2C96A 1ZAYA 2WR8A 2HQRA 3BL8A 3G2MA 3KJXA 3TKAA 3SC2A 2ZJBA 3BPSA 1TF2A 1SU4A 2XAUA 4UAJA 3I52A 1FFDA 1KERA 1PFUA 3JU3A 5SZJA 4A82A 1FMJA 3CISA 2IIVA 4GUAA 1R0RE 1FUUA 1NF8A 2PZAA 1CUYA 1Z4LA 4HNHA 4RFSB 3KK0A 1WB6A 5H3LA 2FKAA 1T5OA 1G8PA 5CTAA 4DLVA 3RYCB 1SO8A 3BCHA 3DV2A 3L7IA 4FX2A 2JJYA 2Z9DA 5IASA 2PO5A 4WA3A 3ADPA 3D0QA 3DUFA 1RMTA 4LRQA 1PEYA 4BPRA 2NZ2A 3D59A 2HMAA 2NUTB 3E3MA 4FGJA 4GI2A 2J9GA 2OK8A 2SLIA 4GZSA 1SUWA 3BHMA 3LJKA 4LMAA 4RZQA 2PRJA 5AMXA 1YFZA 4YZ3A 4NN9A 1FTNA 2C5EA 3QXXA 4J07A 4QJBA 4FYKA 2RCNA 5JDIA 3FBGA 1Z08A 1QCDA 5CX4A 2W71A 4IMBA 2B0CA 3GRVA 2WFLB 1C29B 3QNWA 4PV7A 3UA4A 3ZR4B 4EAAA 4Q15A 3FZQA 3SS9X 3VR2D 2HSJA 4L8VA 4QULA 5BNIA 4LY3A 2BGGA 1NHWA 4IP0A 1TM1E 3L7LA 4OH7A 5DRTA 3CY6A 1KI4A 3EPKA 3PWSA 1XZEA 4Q1EA 5JFOA 4NE9A 3IUPA 3D1VA 3DAYA 2WF7A 3OKPA 1UKBA 2ISQA 3H9JA 4CMAA 1PS9A 4IQGA 3E4CA 4DC0A 1PQ4A 2GHIA 2NU9B 3L4JA 3O3MB 4B4WA 1G5TA 1I7SB 1N8KA 4G25A 4KIFA 5I9IA 2RGWA 4HEJA 2OXRA 4G0NA 1N2SA 3G5AA 4QGGA 1NBMD 4CT4B 4RPIA 3TUJC 1I3KA 2X9VA 4IFBA 4QUHA 1G38A 3P71T 5KJEA 3ND9A 4F5DA 3F73A 3MNFA 3M1IA 4QASA 4B6RA 3RVOA 4RAQA 1TVKA 4MCAA 4K9RA 3KHTA 3HXLA 2CUKA 2OO7A 2WI8A 3TD9A 2VDVE 2ZJ3A 4P83A 3CCFA 1XQYA 4IO0A 1EQ2A 2V9CA 2AZTA 4RD0A 4DRXB 2MSCB 4XX1A 3CCBA 3PQ6A 4EMSA 3JVVA 1M1UA 4DM7A 4IF4A 2CBZA 4B8WA 4QDJA 1JILA 3L84A 4XIKA 2XBMA 1KP3A 4KU4A 1HOTA 3CS3A 4JBWA 5TS2A 3RS3A 1YI1A 5F5LA 3ILVA 4OX9Y 4RQAA 2Z2XA 5BSMA 5I47A 1E5XA 1QFMA 2QLMA 1C0KA 1G63A 1Y8QB 2QGFA 2XNKA 1WDTA 4OPMA 3T4XA 2HJSA 3GAMA 3PQ5A 2SIMA 3ZWMA 1WXQA 4HDNA 5FI1B 4XCXA 3ZV5A 1ECJA 3ZVNA 1CUHA 2D7CA 2JDIA 2CEKA 4TMWA 4IDPA 4FPFA 1I2AA 3VO1A 5LNK6 2GPWA 4OKSA 5GIOE 2OZVA 3EWNA 4A1FA 3DLBA 1POOA 2NO9A 4L22A 5JD5A 2HSZA 1DO8A 2JCVA 2WF8A 2YJ6A 4F6RA 2QRHA 5TGTA 2P6PA 5HGXA 2HDOA 2UKDA 4YW2A 4MWQA 1T43A 2LWIA 5CNIA 2DGDA 2WB4A 2WHQA 2FN9A 4ZVOA 3ZLUA 4AJEA 5TMDA 4DLLA 4O3FA 4CM4B 3F0TA 4EOGA 1TTHA 4ER5A 1L4UA 2K7FA 1ZK4A 1U0EA 5B7QA 3PTAA 3RYFA 2XZJA 3GNSA 1JEYB 5AJWA 3QNUA 2V5UA 4C0KA 1A8PA 1UWCA 3UPTA 4KH1A 2FY8A 4LA4A 2VZLA 4JJ7A 5DHAA 1F5SA 1IBMB 1QZTA 1KJJA 1YBFA 1V37A 1GNSA 4TYWA 4YVFA 5TVKA 2XTAA 4GL4A 4JWTA 2O7VA 3HVHA 4D0LB 4D25A 1GTL1 4NWIA 4C29A 2NP7A 1P2TA 2R6R1 3ZI0A 4Y2GA 4CMKA 2QNIA 1FVHA 1C2YA 2FDXA 4WY5A 3V55A 4KPUA 2HRDA 1GITA 3ESYA 2H54A 1HFKA 2HA4A 2V6MA 2PSSA 5F2KA 3OU2A 3G79A 3OOYA 3ZH9B 4G84A 4K6OA 1P9NA 1WSAA 4HLQB 1ADFA 4D5EA 3QUSA 5J5VA 6Q21A 4DMRA 5IMSA 1CY8A 4F6CA 4EI2A 3GFBA 3OVMA 1P1IA 1XV5A 2OBFA 4MHSA 4WLNA 2FPRA 5D3MB 1HOXA 1U6JA 2HJWA 2G82A 1NI4B 3S0JA 5SY6A 1CDDA 5HZMA 1Z4ZA 1ZIPA 3OT1B 4FJ0A 4P31A 2A33A 5GZ6A 3B52X 4C4YA 2JG3A 4JJZA 4OLHA 1JKMA 1ZUIA 1E9CA 3JZAA 4BFZA 1XTKA 3X1KA 3FZYA 5GVRA 2FF5A 1O5TA 2PZJA 3FJ1A 3ZCRA 5EJGA 5C5DA 4X90A 5C1PA 1AKEA 2GCIA 1RPJA 2VPJA 4B3XA 3BHIA 3OURA 1MRSA 1E2QA 3I9NA 4QDZA 2H51A 1B1AA 4OFWA 1HY3A 1OASA 4LHXA 3N8NA 2VK2A 3UJ9A 1JJAA 2PT6A 4WL0A 3JD0A 3QX9A 3KG2A 4I81A 3K2IA 1Z0AA 2FX3A 4LRTB 1P6XA 1YDMA 4GP7A 4JHXA 4Q03A 5C9ZA 2IS6A 3ADEA 5NLLA 2B20A 1DXQA 1U65A 1Y5IA 4QATA 4GL2A 5CM8B 3G2LA 1Y37A 2L82A 1LRLA 3GUHA 3MYYA 3RV3A 2IZ6A 4ENTA 2RDMA 4ZRDA 2Y1LA 1YDFA 1BRMA 3QBEA 2XUFA 1SQ6A 4EO9A 4YR7A 1HE3A 4DMFA 5BWBA 5H80A 1EK2A 1CCWA 1WM1A 4L9WA 4EEKA 3KR0A 4TGLA 1SM4A 4PG8A 5LDHA 3L6BA 1ML3A 3RSOA 1C9YA 1GGJA 4MWYA 1SHJA 3BGDA 1LNSA 3R5XA 3WP1B 1YVRA 3DXFA 3QI2A 1T1SA 3VI3B 1RRKA 2RGCA 4NULA 4F4JA 2W2PA 3I39X 4XD7A 5HUHA 3D6MA 3P45A 1G8MA 4HWPA 4RAOA 5K2MA 2BHLA 1Z62A 1MQ9A 1SHTX 3ETJA 4PAQA 4UVHA 3UFXB 3VA7A 1VRVA 2Q45A 3AERB 4IHJA 2V7BA 3R6DA 2ONJA 3QBDA 1INHA 2QAJA 4DWVA 3OT5A 1QH1B 4Q9AA 2FWNA 1OIWA 5LCXA 2R4TA 3M6AA 1SZJG 3TSCA 1YIAA 3A9SA 4K03A 3AVVA 1CFJA 1UXIA 1CX9B 1YU9A 5LFAA 1E9AA 1E3MA 1GXSA 1K6MA 4RVOA 3T7RA 3F5MA 3UB4A 4PHTA 4EJSC 3BMNA 5ICFA 2PANA 2XNSA 1T3ZA 1JSLA 4TMYA 4H3HB 4LJYA 3MGGA 2RD2A 3PENA 1E6MA 2QRNA 3KUUA 4LYHA 3Q8MA 5L3QB 3AC0A 4ZAYA 1SVOA 3Q6MA 4B4OA 3UA3A 2VYNA 2OBXA 4GX0A 5ARDA 4FZVA 3IEMA 2I4LA 4X49A 3SHOA 4AI6A 3QVTA 1CVMA 1CFZA 2HK7A 2O2JA 1SWWA 4X92A 3H0KA 5IJXA 2ACKA 3RTGA 1NSCA 1A8QA 4MA4A 1CV2A 4YJ3A 4ZV9A 2UZ4A 2WAYA 5BV7A 2C92A 3DKKA 2C0PA 1QMGA 4Z4QA 4AQDA 5KTNA 3S70A 1V2HE 2BR4A 5HBRA 3SHTA 4CQLA 1EE2A 3FMOB 1B6RA 4RYLA 2QWCA 2J31A 4ROSA 3VR5A 2FEXA 1J5EB 5AI6A 3DJYA 4K9PA 1DZIA 1P18A 4WPGA 4X20B 3ZCSA 3VAYA 4DUYB 2F11A 4RU1A 2RAFA 1OXBB 1KPGA 2CWWA 1ZJYA 3IEIA 4OJTA 1B6GA 1I01A 5DGCA 2Q5EA 2X4IA 1UJNA 4FW9A 1I2ZA 1X2RA 1U2GC 5JFTA 1OFIA 3PU6A 4ZVTA 2BFDB 3DAPA 4KWHA 4YRLA 3UC9A 3EQ7A 2BEUA 2VYQA 1AS2A 1R74A 5EG5A 4ZCIA 2JIOA 2JIRA 1LDEA 4IDEA 3IUBA 3U4GA 2CJPA 1XKQA 4IIUA 3DAHA 3MT7A 3JAKA 4JIMA 4OB6A 2AEJA 2J9RA 4J49A 4LZOA 1B0PA 5DK6A 5KBYA 3U1BA 1V5IA 2O07A 4PVCA 2CVHA 4J1SA 4A6DA 3PEVA 3VSAA 4BEWA 5A7FA 3BB3A 4MCIA 2IEZA 3LT2A 3KHUA 4HGQA 4P7BA 1EP9A 4RXUA 4UEJA 1LV7A 4YGXB 5F3RA 4IOKA 4BLWA 1AH2A 2Z8XA 1C81A 3L7AA 2IPNA 4MV5A 4N12A 3DMPA 2V3CC 4W1QA 5SV2A 3U60B 3F97A 3ROPA 1N5DA 3FI9A 1EVEA 1J42A 3QXJA 1UQRA 4MOWA 4X61A 3IL2A 1KF0A 1XZMA 3P19A 1RAIA 1H2ZA 1AZTA 3FVQA 4PAWA 1M1ZA 5AXCA 3HBAA