4JMLA

Crystal structure of the tolb(p201c)-colicine9 tbe peptide(a33c) complex.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
398
structure length
394
Chain Sequence
SGRPIGVVPFQWAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQCLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/toxin
molecule keywords Protein TolB
publication title Intrinsically disordered protein threads through the bacterial outer-membrane porin OmpF.
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 394
sequence length 398
ec nomenclature
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 4jmlA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 4jmlA01
4O5SA 3TC9A 3V64C 4A0PA 1C9UA 2FPCA 2IAOA 4GNCA 5GX1A 2POOA 2IAPA 5GX5A 3V1SA 1IJQA 3LI3A 1NPEA 1Q7FA 4DG6A 3DR2A 3BYCA 5GX4A 2HQSA 1QLGA 1V04A 5D9BA 5D9CA 2IASA 5EX7A 3FVZA 4O5TA 3SOVA 3KYAA 2G8SA 2P4OA 3G4EA 4R40A 1H6LA 2OJHA 4GN9A 4IMBA 1PJXA 4Q1UA 1E1AA 2IAWA 3HLIA 3S94A 2VAQA 3HLHA 3SOBB 4HW6A 4HHOA 1CQ1A 2GVVA 2QE8A 2IARA 2GVUA 2IATA 3IAXA 4JMLA 3LI5A 3FW0A 5GX2A 2V91A 4PWZA 2W8BA 1CVMA 2FPBA 1RWIA 3E5ZA 3SREA 1RWLA 3SOQA 2GVWA 3A9GA 3P5BL 1N7DA 3WW9A 1C5KA 3S2KA 2IAVA 4GN7A 2ISMA 2IVZA 1CRUA 2IAQA 5D9DA 4GNAA 5FWWA 3Q6PA 1QBIA 3HRPA 3A9HA 3Q6KA 4GN8A 2DG0A 3AMSA 3G4HA 2GHSA 4ZLRA 3Q6TA 2IAUA 3V65B 2FP8A 2W8BB 4IYGA 2DG1A 5GX3A 3WWAA 3S8VA 3U0SA 2DSOA 3O4PA 2FP9A 5GTQA 3SRGA 3LI4A 3KGGA 3AMRA 2GVXA 3I1CA 1POOA 2IAXA 4GNBA 3DASA 3S8ZA 1CRZA 4HHQA
chains in the Genus database with same CATH superfamily
1BW9A 1WU8A 1WM1A 4B9AA 3A06A 4HQRA 1KGDA 4BQEA 3CT4A 5BQ5A 2Y9MB 5HUKA 1IDN1 4W4TA 4LMPA 3TZKA 4BS9A 1SO7A 5AVSA 2WZQA 4KFRA 2ZR0A 2GRJA 3AIOA 1I4LD 3PXEA 4K9MA 4WXYB 4XI9A 4ASUA 5DBFA 2VJKA 3O83A 3UFXA 3QRWA 3KZNA 2G6TA 1KFCB 4YJFB 5TJHA 3S7TA 4E4RA 1KAOA 5ECDA 1E96A 2CHFA 2HXSA 4FNOA 4MVXA 1PCXA 1WV1A 3UENA 1J0EA 1XELA 1R74A 3NGLA 5DF1A 1EDZA 4B2PA 1NFFA 1QH8A 2HADA 1YBFA 3DAOA 1IONA 1Q3TA 3N05A 4N54A 3PC4A 4Z4GA 3DFFA 4OI4A 3U39A 1NOKA 2IL1A 1Y3DE 4J7AA 4QRIA 1Q7GA 4Q47A 4FOOA 4R68A 1K2VN 1DEHA 3JQ7A 3PKZA 4ZRDA 1L5WA 3QKIA 2ENWA 1IRIA 2XRYA 4TS1A 3UKDA 2GD1O 2OCDA 3V6LA 2PYIA 4E1BA 1V4NA 2D5CA 3BWBA 2DUNA 1FLNA 1FFAA 1L7PA 4L1KA 4NCBA 2YRFA 1FS5A 5DHPA 4L4ZA 4UHEA 5BSMA 3WK5A 3A1NA 4C0BA 2RGUA 3I01A 4EVSA 5IYZF 3PEWA 1H5UA 1U6DX 1X86B 1S0UA 3ZHOA 3KZKA 5HOEA 1E1AA 2OAGA 4N9WA 3F78A 5KTSA 2QY6A 4H7KA 3B85A 5CXSA 3E2MA 3HB1A 3PHIA 1JV2B 5AW3A 2B37A 2H7YA 2XCQA 2XNHA 2GM9A 4X1KB 3P96A 2Y4NA 4BNXA 1FTNA 1L5MA 1D2NA 3TBHA 4B31A 3PXBA 2F8MA 1WB4A 2IPLA 2WSIA 1UKEA 1UMDB 2W6IA 2YRWA 3GJTA 2CD7A 2RDMA 3KRTA 2YJTD 2X8JA 4U0KA 4YAUA 3PVCA 1Z22A 4YP1A 2GEVA 4NZMA 3E9RA 1HO3A 2O20A 4HAIA 3ZJUA 1UQUA 1XZIA 4QDUA 5HFAA 1G5FA 1VJ1A 2H1SA 1EZZA 1N6RA 2GZ2A 4F8YA 3QKWA 5E7QA 1UP7A 3ZWXA 3W2IA 1CUXA 3JVEA 2ZT7A 2JAQA 1FFXB 1QS0B 3UH1A 2RIRA 3LM8A 4XYMA 3PDUA 4LOIA 2ZS8A 3KQSA 1N7DA 1IOWA 2ID7A 4ZPXA 2DHRA 4OMCA 1CB0A 3AT1A 1OTYA 4PRYA 2ZBGA 1JSRA 2W11A 4PLPA 3V1MA 1J4AA 1WSBA 2FSSA 2WF5A 4UFOA 4YRNA 5JARA 1VG1A 5KWSA 4QYXA 2VZ8A 4LRSB 3STWA 4ESEA 1S3SA 1G38A 1ZSYA 4LRWA 4JROA 3W6NA 1WHTB 1Y5MA 1LV8A 2QTZA 3B9RA 4DRYA 5I9MA 5BPHA 1ZRNA 2YXBA 3V65B 3LRPA 4FFLA 3HCPA 1O97C 3D4IA 4KQ1A 4IYGA 3ZV4A 2WWYA 1DKUA 3H5NA 3IX7A 3JX9A 4ND2A 2JASA 3TLGB 1ZPDA 3LMKA 2ZZKA 1OXBB 4NQZA 3IQIX 1Z50A 1BSVA 3KEMA 5G40A 5A3VA 1DXYA 1XVAA 5BW5A 4A6DA 3GFRA 5L3VA 1OCEA 1NZDA 3RB8A 1UPXA 2WT9A 1JXAA 1P2DA 3W79A 3G2KA 1G21A 4MWYA 1QZZA 1YFLA 2WWIA 4B3BA 3F7MA 1EIZA 2FPMA 4RKFA 4P38A 1GRVA 1MT0A 2YFQA 3SXJA 2ZXUA 4WLFA 3QX3A 2M98A 3HRKA 1IFXA 1JVNA 1IAQA 1O4WA 3A58B 1RRGA 2PTGA 3K53A 3QPBA 4LQCA 1NRIA 3AY3A 4B5LA 3ZVKA 1Z08A 2HF8A 5TPZA 2QUJA 4UAVA 1XVLA 4DB2A 2PPVA 4F9GA 3FWZA 2HI0A 1FDWA 3OPQA 4ZQHA 4A8JB 1V5WA 2DGDA 1ZRMA 2E0IA 1YDFA 5BORA 1XP5A 3DTVA 4NENA 1YACA 1GARA 1SHUX 1T5OA 2XQJA 4MAMA 3K35A 4ZO4A 3FMVA 1V2IA 3X1WA 3ZDEA 2GZDA 1R0RE 4GNKA 3OFJA 4GC9A 3C1OA 3E27A 4IICA 3WGJA 1KP3A 5AKGA 5DYIA 2IZ1A 4A82A 5LB2A 4BNYA 5CDFA 1EM6A 4OA8A 4XKJA 3DBHB 2AMYA 5IJZA 3NN9A 1DXHA 5A7GA 2PUEA 1RHQA 3FNBA 3AVXA 1DU4A 2ZI4A 1UMCB 2JKBA 1JT9A 2NZWA 3E6AA 4JJFA 3UIEA 1W0CA 2M32A 3W2FA 1J9ZA 2BKLA 3I34X 4TTPA 3ROZA 4C0WA 1ORTA 1R0ZA 4OGLA 4V0NA 3TTTA 4MB6A 1JJAA 2YOGA 3C3DA 4OQMA 2GWRA 2PZ8A 1ECPA 4QFDA 3AG5A 3WLTA 3N7UA 1SC6A 2OUKA 4GJTA 1X7XB 3MELA 5ELLA 5HA5A 4BNMA 2GT1A 1YB5A 1CVIA 2AJTA 5E38A 3EVAA 1G19A 1XN4A 3F2VA 4HQLA 5ALWA 3WYDA 5LFAA 1A1SA 1J0CA 2FUNB 3Q10A 1M75A 3UK1A 4U2CA 4FYMA 1AY0A 1ZD3A 2E2WA 2YMPA 3RUPA 4XLTA 2HT8A 1Y8RB 1Q95A 2WK1A 3G2OA 3HG7A 4TOIA 5LDDC 4B7RA 1A7AA 1Z45A 2V74B 1Y9DA 1Z2AA 1A82A 1YOBA 2NX2A 4FGJA 1ZMTA 4RPIA 4F2PA 1J0BA 1LJUA 2RG7A 3EX7C 2B8WA 5TEWA 2P2NA 3ZDAA 5IC6A 1TZKA 2BGTA 1V2GA 2VBFA 3F98A 4BMDA 2X5OA 2WTUA 1NXQA 4DSNA 4QFBA 2YMLA 1E3IA 1F20A 2ZI6A 3CONA 3L04A 2PZJA 3GHHA 1IVCA 4M8IA 5EC8A 4GX5A 3R8CA 4W1QA 1RC1A 3WWEA 4L5CA 1EWVA 3N2GA 3IAUA 5B55A 4ZT5A 3ROPA 2EZ9A 1GAEO 3N5CA 1IN6A 2P9TA 4L95C 3NSSA 2OOSA 4CN8A 2FV8A 3CPHA 2A0XA 2CEAA 3EIEA 2RK6A 4RBNA 1MENA 1MX1A 5A9TA 3DP7A 3FBTA 3UWDA 1YGPA 2C4HA 1NHWA 1Y1LA 2B5OA 4HVTA 4EDFA 2XR1A 3RRYA 4YAGA 3N0XA 4ZALA 1RXUA 2DJ5A 5KTRA 4DXDA 3CLRC 2DTDA 3O2JA 3D5QA 2SECE 3VO8A 3W3ZB 3A2LA 3KDSE 2ZTVA 4P3YA 3NQ41 2VYND 4HDQB 1NVEA 1ODLA 1R66A 1Z5WA 1NZJA 3OZ7A 2V7XA 5DYGA 3V00A 2XE7A 4WDQA 3SX4A 3KTAB 4GQAA 4XJWA 2JCBA 1RBYA 2D3TA 3K0CA 1U1IA 3HC7A 1F0PA 2F17A 3LW7A 2TRSB 1NYQA 4OU5A 5JI2E 3DQQA 4ARCA 4X20B 4YCMA 2OKGA 3CL0A 4EGAA 2GTPA 4YT4A 1DG3A 3OIWA 2P0YA 3KJZA 3N0WA 4GOKA 4RV4A 3VFDA 5K0EA 3HBNA 1ISMA 1XZEA 5JS6A 1BFKA 2GBGA 2UVPB 1RBZA 3HB0A 4I00A 3MQ2A 3SEZA 2VK4A 5AO9A 4G24A 3RBXA 3TSAA 3WL7A 5I7HA 1XZJA 2NZXA 2AN5A 1Z6QA 4PRLA 3N8KA 4TMVA 4JYAB 2P7IA 3GRUA 5AESA 1XTJA 1QHEA 2NZ8A 4PHCA 4KSCA 4R7TA 3WRXA 2E6UX 3M5CA 2WWHA 4ZREA 4YP0A 4U3JA 5DJ5A 1E94E 1JG1A 3DB1A 3PT9A 1G20B 1PW5A 1X3SA 5BNTA 2VQSA 2NNLD 2R4UA 4Q7LA 2CFTA 2FZ5A 1B23P 3R7LA 4OJNA 2AMLA 5BR1A 3NX4A 1UKBA 4IDGA 1LKZA 3V3KA 4BCDA 3WL6A 1MLDA 2W83A 4PICA 4B3GA 2ATVA 3GN2A 1NNLA 1VZ2A 2ZB7A 3HP4A 3MWKA 1R0KA 3QY9A 1NF8A 4URFA 4Y30A 1T1SA 2ZRIA 5D6NA 3W5VA 1P19A 3OQBA 1GNTA 3WDMA 4DY6A 4MRRA 1WVMA 2RKOA 1EBUA 4NZ9A 5BN4B 1OB5A 1KP9A 1KJNA 1ODJA 3EZNA 3LYAA 2EAUA 2QTAA 1KK2A 1YZLA 2ERXA 1KI3A 1QTIA 3FROA 4AJKA 1AHIA 2GBPA 5KC8A 2C2ZA 2BY4A 3W5AA 3ZGOA 1JSXA 1M2JA 4GLLA 4M0KA 1XZDA 1Z82A 4XPIB 4FPKA 3OCWA 1IY2A 1UODA 4O29A 1B7GO 2ETXA 3VHQA 3U7QA 4E3ZA 4RK0A 1IVFA 1NN2A 2PUWA 3RLFA 4BX0A 5FX2A 4YTEA 2GEUA 5GIPE 3VDNB 3W1WA 1QE0A 2MMGA 2VW1A 4DTIA 4EFLA 5HTOA 3PWKA 3D6AA 1TU0A 4H52A 1J20A 4ZMSA 4IIGA 4BE4A 1PLLA 1E6UA 4NCKA 3W1EA 1W36B 4RVNA 4X91A 4Z0TA 3O1JC 3UXYA 1OBHA 1GFWA 2OCKA 5G02A 1D2MA 3ZD9A 3E58A 5F7JA 1X3LA 5LJLA 4KQJA 3DBOB 1PYOA 4TL7A 1PU2A 4M7WA 4RMHA 5KO2A 3VSAA 3CN7A 3RE1A 1AQYA 1W59A 3WLIA 2YDPA 2LUOA 1OYYA 2WWGA 4H59A 5THKA 3Q3VA 3V8RA 2H51A 3EVTA 5LR6A 4GH5A 3LOPA 2BM9A 1Y8QB 3SK0A 3DM5A 1WSDA 2GCIA 3NBQA 3CR7A 1L1RA 1TYBE 3DM9B 3KUCA 1NYRA 1T6XA 1JFFA 3Q3IA 4BMZA 1JILA 2JFWA 5I01A 2G28A 4L16A 3GZNB 1ZM7A 2QN6A 5AOVA 3B5EA 3ORSA 1PFYA 1IWBB 2WR8A 4IF4A 4M1OA 2X0NA 3LL4A 421PA 4G0QA 2A5FA 3HN2A 1A5AB 1G8SA 1IEXA 1OC4A 2N1MA 3KJIA 3M1YA 1RWWA 3CRW1 4P53A 1Y42X 4J0IA 3TQOA 4HT3B 4R3WA 2R68A 5I7WA 3PQEA 2QRVB 3OT4A 5FIUA 1P4JA 2XBMA 3ZE7A 5EKSA 3BJRA 1TKBA 1CUYA 5JSZA 1VPLA 1SCUB 2W4MA 2DM6A 2IXGA 5MFPA 1KKMA 1N6EA 1TT5B 1G8AA 3G0HA 3K5WA 4IDHA 5HK9A 3GGGA 1DT3A 1HDXA 1YE3A 5DBIA 5GOZA 2Z8ZA 3RODA 1ZG3A 1ETHA 1QJ4A 1V3UA 2GCGA 3NBZC 3TFOA 5DO9A 2GJ8A 1T3HA 2EYUA 3PQ6A 1X14A 3SD7A 3ZJYA 1YC5A 1OLUB 1KC1A 2BGUA 1G0OA 1G5IA 1WDTA 3I9V1 3LZCA 4G56A 4PTZA 3GRRA 4CM1A 4DMGA 1SEPA 1T9GS 1JSZA 2BAGA 4XLZA 1L9KA 5IDYA 1SQGA 2V65A 3FZNA 1RWKA 1VM6A 2DUUA 1MPTA 2FFHA 1QB7A 1BS1A 1T5TA 2WILA 2ZRPA 3A0UA 4LXIA 4RJKA 4JI8B 4YASA 4Y2PA 2CL7X 2O06A 3A6DA 4KYTA 3VKHA 3DLBA 4PF1A 3WTBA 3ZIAA 3L1VA 4C9BA 1EA7A 4DDWA 1NMQA 5BV2P 1P60A 1G20E 1THZA 3MXTA 3VJMA 3BFJA 3V33A 1I1NA 1PG2A 4K86A 3LPMA 2J0UA 1W88B 1S3FA 1GUFA 1AMUA 4ZCSA 1KHTA 4BBWA 2CJWB 3PA6A 2FWBA 4UHBA 3ZVNA 2X9MA 2HQSA 1P4AA 4MTLA 3ESQA 1M73E 5JALA 3CXUA 5HMLA 5CNMA 2Q7OE 1QHYA 3V8QA 1KH2A 3OJCA 5KTKA 4HGYA 4CIBA 2BHTA 2Y1OA 4G6ZA 4YI5A 3VX4A 5AVXA 4CHBA 1E62A 3CVWA 4JXXA 4G5QA 5BMVA 3L0CA 1ZGAA 3H42B 3JALB 4RJJA 1ODTC 4V0OA 3H86A 2FCAA 5DIZA 1A95A 1CHNA 3FVTA 1BG6A 3SKXA 4MB0A 4WSOA 1Q1NA 3I9MA 4P7FA 3NATA 3NEPX 2V4UA 2FZGA 1WV0A 2D0OB 1ABBA 1G63A 5G1NA 1HK7A 3L0OA 4Q1EA 3BF7A 3BUSA 1ZH2A 2RJOA 3EXEA 3QXSA 4PO1A 4MQEB 4YRJA 3QVXA 4FYKA 5C80A 5JOQA 5G0WA 2ZWIA 3MCAA 3L8EA 2QSJA 1CQ1A 2MWMA 3SJ7A 1BVYF 2WSMA 2XB4A 4Q6BA 2QL5A 4PU0A 1JBQA 2FPOA 3RV4A 1DTWA 1P1IA 1NU6A 3UUWA 2Z95A 2QZSA 3L2OB 3P9XA 1CIPA 4FWIB 4D3FA 4IFBA 2NP7A 2Y1XA 4B83A 4BX3A 3PRYA 2QDKA 3B6MA 4NLLA 3SKYA 1Z13A 1T91A 2JBWA 1QIMA 2YICA 1YI0A 2J3DA 2PKQO 5LC1A 2X0FA 1JJVA 2CNNA 3RSZA 4ES6A 3ESDA 5A2GA 1WBBA 1B8PA 1QF9A 1WSWA 2P91A 1H9BA 3MIZA 3R5KA 4ZC8A 2BHSA 1GT91 1SUSA 2V3WA 3A7EA 3I58A 3LNCA 3MMXA 4GI2A 4U4AA 3W6OA 4L4SA 1G5RA 4D3ZA 2ICAA 1LLFA 1P73A 2GPTA 1RPJA 3FFWA 5DGDA 2KYRA 5FOXA 3OICA 1Z25A 2AI1A 1B8NA 2IAVA 1V1MA 2X8BA 1XWWA 1N33B 3RVLA 2Z98A 4HS4A 3GLTA 3CZPA 4QOGA 1HSOA 4A8TA 4TROA 5JZVA 3GVIA 4LOAA 4LXGA 1Y1RA 2YJ3A 3S1AA 1TTTA 1Z36A 2P9ZA 2X0DA 1WF6A 2QSUA 4D56A 1FSPA 3N8GA 1A98A 2DEUA 4K0RA 4TKVB 3LT4A 4NCNA 2R6AA 2A78A 5LP6F 3ESRA 4HAWA 4AMBA 3QPWA 3I8XA 3O7WA 4CQLA 2WQ7A 2PJZA 5A1TA 1C3VA 1R6UA 3S8ZA 1E6EA 2HX1A 2YVQA 1HORA 3IDZA 2BM1A 4C0LA 2WJGA 3BHMA 1NBMD 1C9JA 4HQFA 2P90A 4I4CA 5BNFA 2CNWA 5B30A 3WFIA 4ACBA 1HE1C 2FF7A 2H9YA 5BT9A 2ZRKA 4L5BA 1V16B 3TW6A 2D0PB 2EZ4A 2H2DA 4RABA 3PC2A 4GI7A 4ZXFA 1DMSA 1RXVA 4YJKA 5H4GA 1XLUA 1TYDE 4RORA 5DYWA 2QGFA 1E7SA 1QHGA 1M5RA 1NUUA 1LLUA 5LLSA 5DRTA 3LI3A 2FLWA 1RM0A 2J6CA 3RF6A 3IXMA 1OI3A 1LJLA 1WRBA 3DFKA 4RDCA 3QUQA 3C24A 1BXRA 3BILA 2XUGA 1PL6A 2HU5A 4N5LA 4N12A 4XYBA 4XILA 2GN6A 4DJJA 4LX8A 3MINB 3T9DA 4DQLA 1FQKA 5B3AA 3WLRA 1C3JA 3GAZA 2J33A 2O0JA 5JC1A 1GSOA 4OYYA 5K0JA 1SXJE 2GVZC 4U6QA 5U4QA 3FSEA 1GN8A 3MA0A 4D92A 5IANA 3NKFA 4M8LA 5TF4A 2D4AA 4PO9A 4QBHA 2B0CA 1KDOA 2HUNA 5T4FA 2OZVA 3LLVA 4CT5A 5JMWA 5K8JB 1TEHA 2NO5A 1G6HA 4MWGA 2JIZD 2Q9BA 1AHPA 2NVOA 1YULA 3JR3A 1ZU5A 4TKUA 1R0CA 3RJ9A 1U4NA 2VXOA 5AVUA 4QOFA 5ARBA 3TKYA 2G5GX 2YNMC 1RYFA 3SOPA 5HUJA 2OFFA 3EPKA 1MAHA 1SOAA 3EVZA 3QWBA 1ECLA 2CFCA 3CO0S 1FMTA 4M99A 4OA5A 2EGHA 4QOJA 3QXJA 1FTQA 3WL3A 4EQ6B 2W2XA 2JPDA 4MROA 3AEYA 2WTNA 1RXYA 3QF4B 5AP9A 5KS2A 1P2BA 3I2HA 3OLYA 3F4LA 2JGIA 4EL5A 2JFVA 3GD5A 3GJSA 4DBLE 1GPDG 1NCBN 2ZOSA 2IW1A 4NCJA 1W1XA 1UJBA 1KSJA 2A0WA 3HJTA 4KQGA 9LDTA 1IUNA 3DZBA 4XIYA 3SYNA 4YMTA 5BNIA 2AC7A 1RPTA 2GN8A 2WD7A 3PNVA 4N7MA 1ZI0A 5T3YA 4PNPA 3OEHA 4YW5A 2YWGA 4MW6A 1WD7A 3CNHA 1IIRA 3G7SA 4QUJA 3G9QA 3O4IA 5AIAA 3PQ3A 4EY6A 1RHUA 3GRZA 2X58A 3DWIA 4MB2A 4CM8A 2N0SA 3CUYA 3A9RA 2B8EA 2R8RA 3H7IA 2GUWA 3BREA 4MS4A 5EMNA 4XXHA 4H0NA 4D8TA 5IHXA 3PRKE 2VQEB 2VK6A 1BFDA 1V48A 2IOYA 2OHJA 1Z5GA 3ISTA 3R0ZA 1BGXT 1Q3HA 2DPGA 2YYYA 3D9QX 3ESAA 4H6WA 4ZCMA 2IH2A 3OMWA 2ZIWB 3KEQA 4QU5A 1IZ7A 1FJXA 1EP1B 3NXKA 1SUAA 4P36A 4J9VA 2IH5A 3JQCA 2A9VA 1WUYA 2PXCA 4O4LA 1XRLA 4PM4A 2CDCA 4NL4H 4Q39A 4LEIA 5DTEA 5LBIA 1YQEA 3MNFA 4NE7A 4WV3A 2J85A 4ZO6A 2AMFA 4RULA 1Z0ZA 2GX6A 1I01A 5CTAA 1NOIA 1JNXX 2NAPA 1SXGA 4B80A 3RRFA 5GWXA 3JVVA 1W34A 3TOSA 1VRWA 2IPMA 4I3GA 4A2WA 1P0MA 4NMHA 4DEYA 3B36A 1XEAA 2OZKA 4DA0A 1L5KA 1TJ5A 1YCHA 3HDVA 5L9AA 1J0AA 5EIFA 1KP2A 3IAS6 1VLVA 1ZNQO 3AZPA 2YXDA 3GGSA 3EN0A 2HMYB 4JBYA 4GZTA 4GRIA 4MW5A 3F6CA 5TC4A 1JA1A 1YFKA 2CVPA 4C4PA 5K6AA 2CFOA 2QMEA 1NXVA 3RJZA 1INGA 4C3ZA 1UEIA 1ZHHA 1MB3A 2R1VB 3ESYA 1A72A 1UAAA 2P9BA 3DCYA 4IW3B 1MTOA 4FGSA 4TN1A 7REQA 1REQB 2NTJA 5LA6F 3AFGA 4Q4JA 3KQPA 3HZHA 4KWIA 2OC4A 2QM3A 3KVNA 3W0LB 2QWIA 1KKLA 2WNIA 3IQEA 5JSHA 4OUDA 1UBCA 2EFEB 1SIBE 2VBIA 2FEXA 5DB4A 1HXHA 1Q77A 3OQ6A 4MR7A 1EUZA 1CHDA 4BUJA 5JNRA 1L6RA 1TK3A 1H4SA 4WOJA 1PJ8A 2VRWA 3GH1A 4IIFA 1FUEA 3L6UA 3TI5A 2WAYA 2PBZA 1KMQA 3C7DB 5HGXA 1T13A 3RRJA 3GGPA 1M6WA 3FUVA 1DRJA 5KTYA 1G8KA 2Z57A 4B4WA 1O5TA 2IF2A 3N58A 5DBGA 4HQKA 4MJXA 1DDOA 2OAQ1 3WIBA 3L41A 3IYLW 2B3DA 4BHTA 1E1RD 1DBIA 2IX9A 1RWMA 1UBGA 3VTZA 4QPNA 2GKGA 2N46A 5GVSA 3U62A 3JY6A 6YASA 3O1HB 4CKCB 2ZM6B 1DZIA 5JVDF 4MI6A 5BWMA 4WNYA 1JALA 5LOVF 1PI3A 4I8IA 4RK6A 4BNLA 1PQ4A 3CNQS 3F96A 4BYMA 3LA6A 5DTRA 1XZBA 4WJKB 3PDIB 5KPDA 5TT1A 4LXHA 3F8SA 1Z2EA 3FSGA 3T99A 2AV6A 4DNFA 4F9TA 2RJNA 2WJYA 3M6LA 1ARZA 2F43A 2OORC 1SBTA 5KOHA 4HDNB 1GLGA 4TV9A 3LO8A 4G41A 4YQEA 5CHYA 3G8CA 1SUWA 1L8OA 3ZH9B 2R8OA 2EJWA 2FPSA 3L8CA 3IKLA 3N8HA 3NHBA 2GBFA 4FW8A 4DVGA 2XX3A 4HAYA 5CXUA 5HP4A 4LV8B 2EKZA 1NI4B 2ZYHA 1A4RA 5B3KA 1A9PA 2GPWA 1I3CA 2JCSA 3F7OA 1DBQA 3HL4A 4J90A 4RYDA 3JQBA 5LU8A 3Q8MA 1WDLA 4DCVA 3ZJVA 2P9HA 2Q3MA 1CJTC 3VO2A 5DN6A 5FPQA 1Y8ZA 2PUDA 4E5MA 2Z08A 4OI2A 3NFRA 2AGVA 2FEWB 3EZFA 3IVRA 4YBZA 4A9AA 5IM4A 1YV9A 4PC7A 2ATEA 4CMAA 1GL7A 2YINC 3G9ZA 3GJXC 5FBQB 2BGKA 4I2NA 3A6PC 1G4HA 5F78A 2CMDA 4RTSA 1PNRA 1I2AA 1ZBDA 3B5IA 1EDDA 3ZDQA 4NWIA 2SHKA 1MC8A 4P34A 3W8EA 5JO0A 4ZYYA 3IFSA 2FUCA 3GRAA 4JNCA 4QPJC 1MEEA 4CPYA 3IHTA 3RTCA 2X3YA 4ZQIA 4F21A 1J2EA 5DXJA 2DFVA 2GERA 2ASEA 2I6UA 3BE6A 1YR7A 1MGPA 1T3LA 3PHBE 5CM2Z 1VI2A 1IN5A 1GPYA 2H7XA 3BZUA 4KAXA 3RRMA 1NQOA 3E84A 3LF1A 3QLVC 5CNIA 3VR2D 4W6QA 1PK7A 3IEVA 5T6BA 4KR6A 3NEJA 4U1RA 2Y2UA 2E3JA 2FGKA 1T9GR 2HHCA 3ABRB 3FPAA 5EXXA 1WLSA 1N3IA 1VCNA 2DC1A 3FY4A 4R4JA 3HYTA 3SXPA 4V38A 3TIXB 5A6SA 2Z2IA 2ZYDA 2ZUCA 3JS5A 4N5IX 4ISCA 3TPZA 1KJQA 2TS1A 1KRHA 1HE8B 1LH0A 2AHOA 1F3OA 3N2ZB 4BTEA 1NWHA 4M9XA 3KM0A 4RHXA 1W21A 5KYXA 1OASA 3PD1A 4N1BA 1FLAA 3L8GA 4NBRA 4GPEA 3VM6A 4AECA 5D5QA 3KXLA 3WC4A 3EEQA 3BXXA 4AYWA 3LDGA 4ZOQI 3KYCA 5JAHA 1NSBA 1JKJA 3GVCA 1T3ZA 2VHZA 2EGGA 4IIUA 4I3HA 1C7ZA 2VKTA 2OCYC 3E81A 4UULA 4RKEA 5EP1A 3MBIA 1QRUA 3WISA 4OXIA 3W9UA 2ZDHA 3KJNA 4MCHA 3IQXA 4A5SA 2WIBA 4Z54A 3HJNA 3VQTA 4DM4A 2W43A 3DTTA 1VL8A 1XMJA 2PKYX 3OTQA 3PPWA 4K1JA 3H1EA 4HO1X 5EWLB 2LDBA 3OWOA 4PAQA 1N1DA 1M10A 2I67A 3BK7A 1EUQA 4UM8B 1XDDA 2X1VA 3ZHCA 5KKNB 1NXPA 3C5HA 1MS8A 3AU9A 3BWXA 4EBFA 4E2ZA 3EFHA 5H0IA 5BWOA 3H65A 5ILQA 2IOFA 4FGLA 4UPDA 3T7SA 1OLXB 1XVIA 1NYTA 2XCLA 2FX2A 5L3QA 4KYVA 3OO1A 5FV7A 2BVNA 1O1YA 4ASUD 2A84A 2HV9A 2JAPA 3DTNA 4OGKA 4YFVA 5JJLA 5AW2A 2QL7A 2C5EA 1GL9B 3PBKA 3FTEA 1Q7TA 3OOSA 4QNMA 5JBIA 2IXEA 1U81A 5E9JA 5HX0A 2OZPA 4CL2A 3TF5A 1NIJA 2XZIA 4OAQA 5ICFA 1ONPA 1ZGGA 4BGUA 3K20A 3MF4A 2WOZA 1MRNA 2EJBA 3NCHA 3R1IA 2ZCUA 1QX3A 3MWEA 3O93A 5EZYF 3RS5A 4IYJA 2OP1A 4ZEXA 1CVMA 3KZOA 5HCNA 4JK3A 4LZWA 5IJWA 3RS4A 3ZY6A 2O14A 2OB1A 3DEHA 4ZV9A 3VDXA 3I5XA 2VVTA 2OAP1 2NU6A 1NFRA 5KNDH 3KQLA 3AEKA 3MS2A 2VHCA 1W6RA 2C8KA 4MVYA 5F4ZA 4OCZA 4TS9A 2HT5A 2CFSA 4UD2A 3EA5A 4GNAA 2X1LA 3CTMA 4JY7A 4IV5A 4WLNA 5HQTA 5JRZA 2F12A 1M1NB 3A2KA 4YZ2A 4LSZA 1K89A 1FYFA 4UHFA 3KD2A 2VNKA 1YU6A 1QE3A 3GCWA 4RIGA 5DXAA 4BX2A 2JIOA 3TBFA 4D52B 2IYPA 3C3AA 3ICCA 3LC1O 3QA3E 3DHNA 2F1IA 1XQVA 3CA8A 3HA2A 3NBFA 3QKRA 1E1NA 3CBGA 2GN4A 2CE7A 3CKMA 1MX3A 2XEXA 1ZZEA 2G8LA 5HUQA 1EU1A 1FYVA 2R4QA 3QE3A 3NRCA 3HUTA 4KRGA 4X1IA 3SJAA 4C7BA 4PG6A 4S3MA 1YBAA 3NASA 3RAPR 1I2BA 5JNTA 1YCFA 1OJLA 4PXSA 1JTFA 3EISA 5K99A 1DUSA 4ND8B 2ANBA 3OZTA 2KHZA 1V3QE 1W19A 3ASUA 3K09C 4ESOA 5D3MA 5C7OO 3BQMB 3TJRA 2VQ3A 3GBSA 3RSCA 2EDCA 2HXYA 4FYXA 1EG7A 3NTXA 1JPNA 3R3SA 4ONEA 1NZFA 2ORVA 4OH7A 5LYJB 1V0JA 4ND4A 3Q9UA 3T3OA 4I6GA 1UJMA 1DELA 2E4UA 2HA4A 5DNEA 4BNTA 3A7DA 2EC5A 3BE4A 5F1OA 3RK0A 1JHDA 2G5TA 5M5BA 1GFSA 5KVCA 2OXTA 3RIMA 3E8MA 2QV7A 2GZAA 3UBMA 5BUQA 1B00A 5J2TA 2GA9A 2WF7A 3VNHA 4P3XA 1G4UR 1Z8HA 4DC1A 2G1UA 5EPUA 3STHA 1JR2A 2X3FA 3VPSA 1VBFA 2QWKA 1PWHA 2FN9A 2WHPA 5EIWA 1DS6A 4Q9NA 3O74A 4OBXA 3MAJA 2Z9BA 3A2MA 2WSSA 1CB7A 1WPRA 2IYWA 2JCGA 1NMCA 3V32A 2OXCA 2JBAA 3P0EA 4JP2A 3TTXA 2JLZA 1AKMA 3EIQA 3HYLA 4RA6A 1E9SA 1YQXA 3FZGA 4MR8B 4CHGA 3U44B 3GEPA 1QYCA 5KVSA 3WIEA 1VXRA 1ZXBA 4K7JA 3ZNPA 3PF9A 3IE1A 2VW2A 1YBMA 1GUAA 1XKTA 1Z2NX 2D74A 4IKEA 1Q91A 3G2JA 3RDPA 1UF9A 2RK4A 2P68A 2E89A 1A5SB 4MRNA 4U9IS 3V9AA 1IHOA 5J40A 3D02A 5B57C 3TS1A 4Z2YA 2IAWA 4RFLA 1H2HA 5JQGB 4RH1A 1ZY2A 4Y8VA 1ZESA 3FBGA 1XU7A 3IUBA 5TPZD 3ZU3A 4EG0A 1KWKA 3H1AA 4Z7JA 1CP2A 4N6OA 1GV1A 4WRRA 5BSRA 2WMYA 4OSEA 1GR1A 1P1BA 3F90A 2XWBF 4IVPA 1X7YB 2ZJFA 1NUTA 3A9VA 1NN3A 1L5RA 3NBKA 1LA2A 4EX6A 1N57A 3WTCA 1Z5VA 3AF4A 3LRTA 5I9SA 1RJFA 1GA6A 1QGDA 4JR2A 4Y9TA 5F1PA 3UT0A 4ASCA 1B16A 2GK6A 1GJRA 1PT9A 4YMGA 2W8BA 3QLEA 1FZQA 1GGHA 3N2NA 3LVFO 3PEEA 3IR6A 4LI3X 2P8JA 1VMIA 4DLPA 1MF7A 5EVJA 4CR6A 4KAAA 2QVCA 3C6MA 1U3TA 4KXNA 3T7JA 2WUGA 2FTKE 3CKLA 3H71A 1N9GA 3OZCA 3THXA 1TTQB 3H2HA 4DABA 4IJQA 1E92A 2A0UA 3QG1A 3SR3A 3I2JA 4HG2A 4L85A 4L15A 4XIFA 3LPCA 2EFCB 3TW0A 1PEDA 3VR4A 1XRRA 3CVOA 2IOHA 4PN7A 4F3TA 2X42A 1IQ0A 2QX4A 3OSUA 3NDIA 5G0VA 2IDZA 3WK6A 1ICEA 3V8EA 3KWMA 3Q9NA 5AJUA 5SYMA 4HD8A 5IDWA 1NKVA 1PFVA 2ZSFA 3L49A 1T1RA 2H1WA 2NO7A 1L7VC 3UG7A 4HCJA 3P94A 1M2HA 4S2UA 3IUYA 5C4IA 2WM3A 4BEJA 4DFDA 3K39A 1UBJS 4Y6PA 2CLEB 4Z4FA 4YEDA 2UV8A 1XU9A 5AXAA 2NQ2C 3D7MA 1V26A 1SKAA 2UYGA 2ZB8A 1LX6A 3ER6A 4GMFA 3J81A 4NQRA 2DY0A 4IJMA 4AJ1A 1U94A 2AOUB 1WW2A 2SKCA 3PC7A 4HSGA 1J70A 3MEQA 4WKOA 3S2ZA 3T5BA 5GIOE 4WK0B 2EW8A 4M54A 1JLMA 2CVHA 3F2IA 2XMBA 2IIQA 5KSPA 2B2XA 4ZI2A 1P29A 4XGIA 2JARA 3ZCRA 5GONF 3BT7A 1T8TA 1NW9B 5AK3A 1Q7RA 4K9PA 1LBHA 1L5ZA 3WDLA 4CIXA 1OV6A 3IO3A 3QU2A 2J0SA 1KMMA 2X40A 4OXNA 3IIKA 4PYOA 5IWAB 5DNVA 1RC0A 1ZJ5A 1D1PA 1TW3A 1FXUA 4U8HA 4RA9B 3R0XA 3SQWA 3RTAA 3VKUA 2QUIA 4BNFA 2X9QA 2HEGA 3KKZA 4LV6A 2OXIA 4YRLA 1FL9A 3DV0A 2AZTA 4U2FA 2VXBA 4CDRA 2QWBA 2BJWA 5EHZA 1Y34E 1E8UA 1A9RA 3H5OA 2X9VA 3HBAA 1Z28A 4OHPA 3AEUB 3RG8A 4R31A 1RE0A 4L75A 1QM5A 4N8DA 4ZRMA 3ZWKA 5FL3A 2EEPA 4OUKX 4HLUA 4YCDA 3TIAA 3VOBA 4HBGA 1HV8A 1U2TA 2FW0A 1LPSA 3E53A 4DANA 4B5KA 1EGHA 1KDYA 5JNUA 1NW4A 3EDRA 3BSWA 4KK3A 1CUFA 1I5OA 1WXQA 2D1TA 2NGRA 4MGKR 4OHOA 3GPBA 3V4PB 5KYXB 4KHPB 3KU1A 2QI9C 1C0IA 3U49A 1QLHA 5BN5A 1T15A 5HE8A 3V1UA 4BQQA 2FP4A 5FKJA 5B3JA 2VEDA 3GCXA 4RMJA 3HBFA 3OM9A 2I2WA 1VLQA 4DNPA 3O47A 2X4GA 1NG9A 4RGQA 3KQHA 5TMBA 4LF5B 4I66A 1NMAN 1YMQA 3DCJA 4NHEA 3E4DA 1GZUA 5FLKA 3CGWA 4O0LA 2JLBA 3LQFA 2D6FA 1L7FA 1G60A 1OQAA 1SQ0A 3T3EA 4F6CA 1HQYE 4LSMA 4WBNB 5B1SA 1NNEA 2ZANA 1HNXB 1OH7A 3QFCA 2ZKIA 5LZ5A 5HGJA 4B6OA 4RU1A 4I14A 2P2SA 1HYQA 1RFLA 4P0TA 4BUZA 3E8SA 3SG0A 5LQKA 1FJGB 4M37A 4K0KB 3SXUB 3EXFA 3MOIA 4M36A 3H9CA 4IQGA 4PAGA 5DX0A 1PJLA 3EGVA 4TLAA 1RYYA 1H2BA 1YUNA 2B4QA 4Y2XA 1JLLB 1KWGA 1XFAA 3QBJA 3ID6C 1M34A 3L43A 3N1UA 4QVIA 1CULC 2FW8A 4IY1A 1TD9A 5BUZA 2G1KA 4CT0A 2PH3A 1T36A 3N7AA 5EZQA 4RPKA 3KEGA 2XNDA 4TMXA 5A4IS 4MK4A 2R6CA 4GIBA 1Y3AA 3KKKA 2ZJ3A 3EDOA 2OO5A 1GY8A 1R8XA 4KGZA 3AONB 1KRXA 5CBPB 3WMXA 2PPLA 4ZAWA 1BD4A 3FOWA 4WVFA 4XOGA 2BMFA 3QBDA 4Q1DA 3AWDA 4TN5A 2RHMA 3F3SA 4WK4B 1WETA 1O96B 4LGVA 2VZEA 4LOHA 3QKSB 4HFRA 4B4VA 3VA7A 1DIHA 4D25A 1TF2A 1JSLA 3D2CA 3FYTA 1RAIA 3N6RA 5JSKA 3JATB 4KVGA 3AHCA 2OCAA 5BVGA 2ODQA 3AUJB 3W3AH 1ORHA 4JJZA 4UBKA 3R6DA 1IPEA 5C8XA 1N78A 4WECA 4NJMB 3AF6A 1SKBA 2ZETA 2I8LA 3GU3A 3O82A 3OPNA 2BM8A 2DY1A 4Y6RA 4IIXA 3L6OO 4BP1A 4PLGA 4Q1BA 2QORA 1JAZA 4A0PA 1TC2A 2V7QD 4X60A 4LCJA 5CH8A 5AVQA 4XSVA 1JJ7A 3QV2A 2BIFA 3COVA 6NULA 2JVKA 1W0JA 3WIOA 4UUBA 4PZUA 1JEYB 3EQ2A 4AF8A 1P2UA 1E18A 3M6AA 5IXJA 4B43A 1HSZA 4L8YA 3FVWA 4EMTA 1P7VA 5IJ0B 2ZT8A 1N2HA 3DEFA 1NF2A 3C1AA 3ZWOA 3U4GA 3MJVA 4AROA 4E5VA 3VMMA 3ZUGA 1GG5A 2AFIE 5H83A 2NU8A 2NU9A 3BXFA 1NDUA 2RI1A 4O59O 4ZQEA 3TW8B 1U1GA 2IASA 4HZVA 4AHAA 3I1IA 4ANFA 5CB6A 1V0EA 4CM5A 3W7AA 2ZYSA 2A9FA 3TJZA 4GC5A 2C4UA 3W7VA 2W20A 2F1HA 4KEAA 4LY6A 2QM0A 2VSNA 4P7BA 3I52A 1NVVQ 2C7RA 4MWLA 2HO4A 5C4MA 2PNFA 2I4TA 2O3RA 3FCAA 1RQ7A 1E3SA 3RRXA 3T4EA 1LU9A 1UZNA 1MC1A 1TQ8A 3AESA 3MRVA 2ZI3A 4IHKA 3VPCA 1TKCA 4TS4A 4QVKA 1Y1TA 3U7JA 1DFGA 1BS2A 1GAJA 3AH8A 4GP7A 5TSDA 1SAYA 1B14A 2FVYA 1TYEB 2VF4X 3I2FA 4MLDA 4NK5A 1DAHA 4QXQA 4X85A 5FJIA 3ZCXA 3ZIAD 3TLJA 3E18A 4DUZB 1VCMA 1P91A 2B8NA 4RKRA 4DLLA 4WCFC 2QL6A 4WD3A 2FB9A 1XXHB 3AL2A 1G9SA 3BERA 3ROTA 3ZU6A 4MV0A 2QBYB 2XT0A 5JAUA 1KDTA 4MRSA 5LMCA 1X7ZA 2R87A 1OUMA 3D6HA 4KLCA 1BX0A 4L7QA 2VUUA 4RHTA 3GLSA 3MSXA 5FOWA 5A3QA 1ITZA 4LMBA 2ID9A 2VP4A 2ZQ5A 1WHSB 4BJ6A 3E3AA 3U4QA 1O4VA 3M1AA 1OWOA 1TGYA 5M1ZA 2VC2B 1N34B 1VPVA 4ZYUA 3CUEF 1JAIA 4RGBA 3AUUA 4Z51A 2VUTA 4C2AA 3HWX1 4BV2A 2LV8A 4FNGA 2Q7DA 1EVZA 2G67A 3L40A 5C35A 4GHWA 4BB6A 4GBED 5CYGA 1Y1PA 2ZQZA 4XMBA 3H4IA 4FUQA 4RXTA 3CVXA 3L4JA 2QWJA 1HL3A 3JQFC 4MA0A 3BN3A 2GJ9A 2CXOA 2VUSA 2BV3A 2AFHB 2F55A 3O38A 1RM3A 3HACA 3ELBA 2IAUA 3O3MB 3ZV5A 3RQIA 1SKMA 3K72B 1SHZA 5GX3A 2AR9A 2C94A 4P32A 1F7UA 4PFKA 1DX4A 1L7MA 1YHYA 4JU8A 3DBLA 3IOYA 4Q1FA 4X7PA 1MS1A 1QGED 4QGHA 4GVLA 3TRJA 4BMNA 4KQFA 3DGFC 3WKCA 1IN4A 4OGWA 3SILA 4OHCA 2DKFA 1CQJA 4QLBA 1D4AA 3WKAA 4R1MA 1GZ4A 1A04A 2P2YA 2RH9B 4K3UA 4V3CA 3RS7A 3VV3A 3QEJA 3JQ8A 3WX0A 2AT1A 3GNLA 4P58A 3LHIA 3K30A 3LCRA 2HC9A 4MLZA 5D1HA 3OG9A 2UUBB 4WZBA 5IVHA 3KQMA 1K6MA 1OZFA 4JLSA 4EG4A 2VLIA 4IIJB 1K0FA 4UREA 4GX2A 3SZLA 2QW1A 2BFEA 1AQ6A 2AK2A 4U2EA 4IRUB 4XJTA 3OUTA 2ACKA 4I50A 3RWMB 2W5OA 3FNGA 4LTNA 4V0MA 1SK8A 3L1JA 1JJFA 3BIXA 4X9XA 5D84A 1QCYA 2QU7A 5DGIA 1WP5A 1K6JA 3A4MA 4MA4A 5AI4A 3QWFA 5KZMB 1LNQA 1U2GC 1XJ5A 1LPNA 4MZDA 3HM2A 2AEQA 4FZ5A 5EJ8A 2FJUA 3SANA 2VWGA 5IYZA 2ZSHA 4MCJA 3URKA 4V1CB 1WB9A 4PQFA 5E2BA 1X0VA 2H65A 5BN3B 3T5GA 1NY6A 2IDKA 3ISJA 3OOEA 3IP5A 3RS0A 1AH2A 1MAAA 1E3WB 1TZBA 4QYSA 2EX4A 4A7PA 3IUPA 1D2EA 4XD2A 4BNIA 4EWLA 4IWNA 3I73A 5K5EA 3RFUA 1A4IA 4AUEA 4UVEA 3EUFA 1U3WA 2YUTA 1UJCA 1PNVA 5JXIA 1G3IA 5K3AA 1P0IA 5AJWA 1ADCA 5JEDA 3EEYA 5JDIA 5LZ2A 2II6A 4FCCA 1MOPA 2RBEA 2H1FA 2PWBA 4YUAA 2MTBA 3KWJA 3EMBA 4MARA 1AQLA 3NH9A 5AUQA 1UC8A 3DUFA 1GZDA 1T8RA 3IT1A 2B4KA 4EPRA 2H11A 4N0QA 4Y18A 4JEIA 1BKDR 1I0LA 1OBOA 1Y3FE 5TQVA 3A0RB 1AZWA 5E6UA 4PZZA 2GO1A 1KSGA 2PEZA 1C3LA 2J32A 3O8CA 2I62A 3UN1A 2JDIA 3IJPA 3NNSA 3D11A 3NANA 5I8ZA 5K8VA 1QMGA 2ATCA 2Q5OA 4XQ0A 3R7FA 3FOFC 3K0SA 2G07A 3GQVA 1B0PA 2Q6OA 3ZEIA 3VYWA 3Q7TA 4RJIA 5AI9A 3RSHA 2QD2A 1T3SA 1P9RA 1UM9B 4FQ7A 4ENRA 4DARA 1G64A 3PPXA 5LQNA 2DQKA 4EHHA 5FQOA 2J9YB 4BO8A 1HDZA 3DV9A 4D2IA 4DUPA 5BSTA 1QIIA 1HFKA 4A1OA 3WW9A 3HVIA 1E2NA 4JJAA 2JKYA 4HQ0A 1XNHA 3SBEA 1VQ1A 9ATCA 5FOUA 3H99A 7GPBA 3WGIA 2AFHE 4NAVA 1RMYA 4FNMA 3IP6A 2V3CC 4WESB 4R2LA 1ZMXA 5JANA 5A9SA 3IMCA 3U0VA 3E4CA 3HFGA 3WGOA 3D4OA 5AW5A 1IIBA 3SJZA 2QWHA 1U02A 2J67A 2NO0A 4KUGA 2EXXA 2K7ZA 2QM8A 4J94A 2WF6A 2F00A 1DAMA 4FHEA 1USWA 2A4MA 3IOBA 3EQ6A 5BWLA 4GUAA 1S4MA 4EJSC 1AUVA 2R8BA 1ZGZA 4WOCA 4EFMA 3V1TC 5HS6A 3USES 1QHHB 5E95A 2I99A 5ENZA 1CUHA 2GETA 2QJFA 3KTDA 3V1KA 4JXJA 2HU2A 4I55F 4PQYA 3TO5A 2WNSA 2VNHA 4I36A 2PKQP 5HJ2A 2F27A 1NI3A 2M9MA 4HHQA 1KTVA 4BZZA 1G9TA 2C03A 4IEIA 3T5AA 2O19A 1Z12A 3OEHD 3KV1A 5ADWA 4OOEA 4XGRA 2WOJA 4B87A 4J6FA 3ZJ4A 3QHPA 1U2PA 4FE4A 3OIUA 3T0FA 2J9FB 3MFYA 1D4OA 1JT2A 4W5OA 4UBMA 3W8RA 1PV2A 2B69A 4PWYA 2VPZA 4E5UA 1QGUA 4G0YA 4ZDKA 5F5LA 4P0PB 1J7JA 1KIFA 3RVKA 1NMZA 1FCJA 2C9OA 3RUEA 1HTTA 1QK3A 3DTVB 2F3UA 4NENB 3DBRA 3K2QA 3SYKA 2FG7C 5BP7A 3COPA 1OBVA 4UM9D 2VP9A 2ACVA 3DVQX 4NYMQ 3ZBPA 3W1VA 1X7HA 3PNOA 1KXJA 2P2LA 1UT5A 2C92A 3MB8A 3PFIA 3WADA 4DPKA 5LQAA 1Y9AA 1S3IA 3F6YA 1ZEMA 1O6GA 1S1CA 3GI1A 1F0KA 3LPLA 3JR7A 4FHGA 4FB5A 2HW8A 4WN9A 3SU8A 1E79A 4C0QC 4YRBA 3KDPA 1YZKA 1GTG1 3LGXA 3P2YA 3TNLA 2ZPTX 4WWHA 2AJ8A 1WEHA 3I1FA 2PWPA 4D8WA 3AGQA 5KB3A 2P6OA 1TA0A 4ND1A 5A62A 4MQ4A 3GPLA 2AWNA 1OFIA 3CVJA 3M9LA 4C6RA 2O7NA 1DXQA 3LT5A 3PLNA 2C4LA 2PL1A 4HW6A 5K3CA 5BURA 4KQ6A 4N3CA 3TLBA 2FZCA 3O4HA 2I7TA 3AI1A 3D8BA 3JQGB 3ZHSA 3K3PA 5KMGB 3TG8A 5HF8A 2WE8A 3N53A 4QNRA 2DLDA 2B35A 4K87A 4O4HB 5SZIA 5L6LB 3PEYA 1Y5IA 4URWR 4PXYA 4WLVA 1XN1A 1R5NA 1HMYA 1MO6A 2WICA 3VHLB 2OCBA 3NU1A 3TSCA 4WOPA 3I2YX 1I7NA 3E5ZA 1B42A 3DF7A 3M1IA 3FNRA 4ZT2A 1FRFS 1RRPA 5KQSA 3D5TA 1SBHA 3HN7A 3VKFA 2FHPA 5CT5A 2OV4A 3AUAA 4J16C 4N39A 1SIOA 2PS0A 1O95C 1ZD4A 2JLAA 2XA9A 3F9RA 1UXIA 2J3LA 3C85A 2HSDA 2FMKA 1U7XA 4OXRA 2XB9A 4BGEA 1POXA 1M0EA 1Z5UA 4KQMA 3KPWA 3GA0A 1ZDMA 2P11A 2ZYWX 4EB0A 3HWWA 3DL4A 4YI3A 5ECYA 4AKIA 1KQPA 4MGYR 2GYVA 1QQBA 4DIKA 4HAVA 2PWAA 3QE2A 3WB1A 3WAGA 5A5EA 3V7WA 1W0OA 1TCVA 1MR3F 3WRYC 1I1QB 2IYOA 1RLIA 1TTHA 1XLWA 4FCVA 4KPEC 4UDOA 4MUYA 4ZEWA 3GDGA 1HDGO 1QYDA 4Q0MA 1SPXA 4GXNA 4YUVA 3LCUA 1O03A 3OZUA 1PFQA 2GJ4A 3AYZB 5HF5A 2ZIGA 4OQPA 2QUAA 4KN9S 1QZXA 1XA4A 5K20A 1FS6A 3OZWA 3LK7A 4AO7A 3B1XA 4KBGA 4ZOLB 4TL8A 2NP6A 3NO4A 3COWA 3WHKA 3K71B 4QOSA 1QJCA 2GFQA 2DXIA 4MS3B 3P19A 1WUTA 4RZXA 4S35A 4MW2A 5DN6D 3TI7A 4MQ6A 4BLVA 1VSVA 2ZCVA 1I5RA 1QOZA 1SU7A 1G5TA 2OGSA 4XR4A 2XGJA 1Z63A 2F3QA 4EMUA 5AI8A 3OHSX 1HRDA 3COJA 3VZRA 1SQ5A 2I22A 3VJKA 4CV2A 5GVRA 3N8IA 1GA1A 3ME5A 3ZWBA 3BPSA 4U3JB 2DWUA 3FIUA 5DCWA 1U11A 1MZPA 3OT5A 4AGIA 3V48A 1T6ZA 3CYEA 1DWPA 4D98A 2DTEA 4E11A 1SN7A 4YRKA 4EVQA 3KQKA 3L8MA 4YCCA 1KNXA 3ADEA 3I5YA 1CJCA 2I6FA 4M1TA 1MOSA 4P22A 4DEXA 3KT8A 3SOVA 3FIJA 4YW4A 3DT9A 2ZGVA 2PGDA 4Q24A 3QXCA 3TWOA 4AMUA 3NT5A 4K5QA 4NARA 1IN8A 1ZFNA 2QX8A 1S01A 3E35A 2WT4A 4EYGA 1AQNA 2WJAA 2C5HA 4WBXC 3C8MA 3ST7A 4LJ8A 2C3UA 2DFPA 1RJDA 3VNVA 1DJOA 3FW1A 2CHGA 3FZQA 3KUKA 4ZAXA 3ETJA 3ABIA 3IOMA 3UK2A 2RGNA 5JXWA 2Q1UA 4PINA 1XTZA 1O6ZA 1CZLA 2F24A 1J8FA 1BN6A 1TQHA 3LKZA 4IGKA 1CD5A 4HNRA 5I6DA 4NECA 1UT6A 4RKYA 5DK6A 3E2PA 2JD2A 3ONNA 3C98A 4KXFB 4WCFB 1X8JA 2AF3C 4U2GA 3LI5A 1BEZA 1N2JA 3PTZA 3WG9A 4CLDA 3J80A 2R7LA 1KI2A 4LF7B 4H7DA 3T12A 4C87A 2WG1A 3UAYA 5E6RA 3VSEA 2D13A 1ZEJA 2JIBA 2QTGA 2VP0A 3KOOA 2PUTA 3ND9A 4IQ4A 4Q3OA 1WOMA 1SKYB 3I45A 4MI3A 2Z2ZA 4PEVA 4REMA 1XCPA 3CS3A 3PXGA 1T1JA 3OPYB 2B1GA 4Q01A 2PWZA 3GAAA 2KLBA 2GCOB 4NYJQ 1N8SA 4OLBA 3SOQA 1GR0A 2CNKA 2P67A 3ZWWA 3UWSA 1KSHA 1P6XA 1C3OB 5D8DA 1CUGA 1HLGA 2NG1A 2AN9A 4P1ZA 1C3XA 1COZA 2PQ2A 4J7UA 3HHPA 3KFVA 3F1KA 3O9JA 5I51A 4B6FA 2P6RA 1I36A 1XYGA 2JCXA 1GKIA 2V03A 2ZBUA 4HGNA 4WIAA 4EJFA 2IHTA 2VDLB 1SHJA 1CK4A 1ZSNA 4TZKA 4GN8A 2D0IA 5EXSA 1BCSB 1GQYA 3T7AA 2TSYB 4I4LA 3X1ZA 4BIMA 1XZGA 2V0NA 2YJ4A 3H11B 5LU9A 4CPOA 4K6KA 1NVUQ 1QHIA 2HA5A 2P8SA 3QVMA 3OA2A 4RFSB 4I3FA 1GTRA 3SQMA 1AN0A 3GVKA 2BZGA 3V8VA 1ZQ9A 1SZPA 3BEQA 2IF0A 1XEFA 4K6CA 3OOYA 4BXOB 2H2UA 2HCJB 2IYZA 3AW8A 1EFUA 1OPRA 3BB1A 1P0QA 3DHYA 3K94A 4C14A 1AC5A 4CEHB 3EG9B 5IKPA 1OXSC 5FWAA 1LBEA 2HWWA 4OTZA 1Q6YA 1H8HA 5FWXA 9LDBA 3CVYA 1W87A 3WFJA 2DT5A 3D54D 1HNNA 1UBHS 3H72A 121PA 1XWIA 4X94A 5SYNA 4Z5XA 3Q0EA 1UDAA 1PQUA 2GPBA 1VJ0A 1D8TA 4F46A 2GK7A 2X86A 3E05A 4K81B 2JLSA 5EQDA 1L4GA 4AD8A 3IVXA 1MIHA 3DR3A 4E33A 2VTBB 5F12A 2ZTUA 5DT2A 4AX8A 3Q98A 4S2EA 3O9VA 3H4VA 1WXIA 2I87A 2QN1A 2O1WA 4FYIA 5GM2A 2BGWA 1EM8A 1YS1X 3BMOB 1YZQA 5FUWA 4K6OA 3CF4G 3S40A 3AY7A 1C0PA 3UWPA 1OSNA 2B7BA 3AZQA 3LCCA 5H3HA 3W5IA 1HLDA 1EQUA 1E60A 1PVDA 2XMRA 5JSYA 4AWAA 1NASA 2B94A 1FYEA 2QLTA 5DM70 1S2IA 3LKDA 3RGWS 5CFNA 2OBLA 2J9ZB 1UC9A 2QQ0A 3L8HA 4J2TA 3TQIA 3WA6A 2JC3A 1H1LA 1Z5OA 2NYAA 1PR9A 2PA0A 2Z9DA 4YPOA 5JADA 4FFVA 1J8YF 2VSMA 4G67A 1HX7A 4IFIA 2ZITA 1VPDA 5DNAA 2FFBA 5FI3A 3GLGA 3BGOS 2D3WA 5CVEA 1A4UA 4WACA 5BMVB 1KJWA 4GP9A 4M0EA 2POCA 4YPVA 5FAKA 4TLLB 1CNMA 1E1QD 1UXGA 1B3BA 2AUTA 3VR0A 4XIKA 1FTYA 3JRNA 5EJFA 2WJWA 2G5PA 1X1SA 2Q9UA 3DJYA 2Q3CA 4W1PA 2NSLA 1DJNA 4DMKA 1K92A 3DKKA 4FBLA 3ZKWB 3W9SA 1GGFA 3V4LA 1C1DA 3OX1A 1COWD 5T64A 5F7OA 1G6KA 2A2ZA 4R8MA 5FWNA 3GELA 4GZLA 3S28A 3ZK8A 3PR2B 5T57A 4HHOA 3IJ5A 1Z37A 4ZCQA 3KL2A 4CV3A 2BTQA 1JU3A 2D1SA 3JWHA 4YHBA 4BO7A 2W48A 3MLAA 4BN5A 3KD3A 3BJIC 4NEHB 1HYBA 4HX5A 5KTNA 4ZYTA 3H73A 3L7AA 2PMDA 1JVBA 1SKYE 1Q92A 2WYUA 4J4HA 4DDVA 1R0BA 1MZ5A 3A1FA 1OX4B 2JLCA 3OJFA 3N70A 3TH5A 4M1EA 4NOKA 1LTQA 3V9PA 1QP0A 2XOKA 1S9DA 5KHLB 4GLBA 5I9BA 2EP8A 2Q27A 4FHDA 2WSSD 4GEKA 4I1VA 4DNQA 2I2CA 3FJYA 1XRNA 4HQNA 3LLCA 4N1AA 1BOFA 2XUFA 1H0KA 3WLMA 4AKGA 1RIFA 3A9GA 1U0RA 2ZYAA 3FDZA 1PJ3A 3EF1A 4JOCA 4DLSA 4DEVA 1QWSA 1B8UA 1BWQA 3PUYA 2O8EB 1E4VA 3P26A 1MZ6A 1L3BA 1ZRSA 1EFVA 1OJ7A 2WJ4A 4C06A 3QXGA 1RP1A 4LX0A 2QK4A 3KB1A 4EHLA 4GL2A 3EZ7A 3ZGZA 2I65A 5E7JA 1LLQA 1MXHA 2AR0A 3QEKA 4WL0A 3ZY3A 4F84A 1WR8A 4CF6A 4PO8A 3O7MA 3MTJA 2F26A 3CLHA 3C1UA 3GLVA 2MYUA 4JELA 4UVDA 3RS9A 1ZI8A 4HPXB 4JJ6A 3TTYA 3EVCA 4QC2A 2VDKB 4FT2A 2XZPA 3NJ4A 5B2FA 1N25A 1K9SA 2PH7A 3A27A 2F29A 3QPUA 3UANA 2FF5A 1E59A 1OTHA 4M0UA 4TQUS 1E77A 4BQRA 4DLAA 1F2DA 4KFUA 3UAWA 3EWSA 4POOA 1VL0A 3R24A 5KOYA 1DKRA 4ZARA 1TRKA 1LPOA 4YV0A 3PUVA 3AOEC 3MBOA 2P65A 2PQ6A 5CGQB 4LRXA 5K3OA 2B3TA 5IARA 3R6LA 4GR5A 1CQIA 4FE7A 3CW8X 3UJ6A 4KUHA 4LXXA 3VR4D 2OAEA 3LFHA 3IBFA 3T9CA 3GGOA 1X94A 2VG8A 1YB4A 1ZUWA 5F35A 1ZVKA 4G5XA 1VL1A 1Z3CA 4CM7A 4TWZA 1CY0A 1U6KA 3RYCA 3P0IA 3RV3A 4QTYA 2HCRA 3EIOA 3K8ZA 2ZIZA 2YVUA 4QTXA 3LU1A 1NUQA 2JFPA 5EUCA 3KR0A 3LY5A 4QXRA 1Y0BA 1NHGA 5TE9A 4E5SA 4C07A 3K9BA 4S1NA 1QH0A 2GPJA 2XPCA 2X8LA 3PFCA 5AW0A 2MDTA 4ZPJA 1B76A 3HCOA 1XTVA 1ENYA 1KOFA 4YJHA 5JQGF 1IZZA 1HE5A 1YL5A 2FEOA 2WSLA 3EGDB 1YI1A 1R64A 1YS6A 3OM1A 4RM3A 4V0QA 2POQX 4AZSA 1NVGA 2CWWA 3BX1A 5D2CA 3P8ZA 3DE3X 1THMA 1R5JA 3N74A 1H23A 3BK2A 4B40A 2AJDA 4LQ4A 1QDEA 5IVDA 1FUKA 3SFZA 3TVDA 2QVGA 4MJUA 1YT5A 4BKMA 4ZI7F 5BSGA 5FNRA 1D07A 1BEEA 4CTKA 2HU0A 3QFRA 2AOTB 5GPBA 9MHTA 4MWXA 1SKUA 5B5SA 4R1TA 4ZVNA 4GSKA 1E1CA 4G8DA 3CX3A 4IHJB 1QBKC 4XYLA 1A9XA 2V5AA 5I8PA 1GFZA 1FDIA 4TV8A 1Y7HA 4KIWA 4IIDA 4B4OA 3PX7A 2OZLB 4JF7A 5SY4A 1TPZA 3EC1A 1L2TA 4J75A 4NE9A 4QPDA 3ZNOA 2HMUA 5BWCA 2VPJA 2J3HA 1JLKA 4TSKA 4EA8A 3KT6A 4NYJR 2GSDA 1CJVC 1T6NA 1OF1A 2O8CB 1R6VA 4F1KA 1USVA 2JCYA 1BXGB 1KYVA 4K9QA 1XZ8A 3ZHTA 1LXCA 5KIAA 1IH8A 3HSYA 1K66A 1SVKA 3CF4A 3KYDB 4LF8B 4YGYA 4MV7A 3K0AB 2ISMA 3PK0A 2PTHA 2BFDB 3LCVB 3TCXB 1X1CA 4F4DA 4M8KA 2I78A 1K8QA 2HSWA 4D4UA 4EI2A 2PT5A 3QELB 4MMYB 5DIFA 1XL0A 4NV3A 1XIVA 5U1PA 3IMKA 4BNWA 1CWUA 4L22A 1E6CA 1PGNA 3ZE6A 3JQRA 4R1UA 4PX2A 1HI9A 1BCRB 1U7WA 1VL2A 3KXDA 2FR8C 1HFWA 3H8VA 2MIIA 3W5JA 2ZJZA 4DYHA 4UFPA 5C1PA 3V42A 2VHVA 4PLWA 4UDXX 1GL6A 1CW2B 4MVJH 4MUFA 1PT8A 1RZUA 4BAGA 4KQKA 1PUXA 2R6JA 1B73A 1WU7A 3DSRA 1ZNWA 3DZGA 2HMWA 2VRCD 4LW8A 4PAWA 4RVFA 2NYRA 1A9SA 3L1IA 1BRTA 2VTEA 3DVAA 4J1QA 3SBDA 2WV9A 5SYAA 1Y7TA 4I4IA 5B7QA 3PJGA 4CIWA 2R65A 1USKA 3AUYA 3U61B 1XRPA 4FCWA 3E23A 4Y2SA 2Z5FA 2JFOA 5CLGA 1L4FA 1RYNA 1NJ8A 4HDSA 1YUMA 1M6NA 5PGMA 1XF9A 1XP8A 5KI6A 4JITA 2O8DB 3X43A 4CETA 2OC9A 2AG8A 1YWGO 4F8JA 2F28A 1U7ZA 1DC4A 1RLTA 2XCOA 4IFTA 4JT2A 5EHQA 4OHBA 3FUXA 1E9BA 4MNTA 4FI3C 4B6RA 2PUAA 3WGQA 1H2EA 2IRWA 3DMHA 4YXWA 4C5AA 1R6XA 5H4HA 1QRAA 1U5BB 3TXYA 3BQ9A 3FOZA 2GM4A 2Q1TA 2XYQA 1ZH0A 4WUVA 1SB8A 2I54A 4Q4AB 3S2YA 3CZMA 4R7ZA 3SC2A 3ZI7A 4LWPA 1T4CA 4HJRA 4HZYA 3UWKA 2IEAA 2AJCA 3B1WA 3W8NA 3GVHA 4F04A 4FDMA 4FKZA 4KLRA 3G9TA 2QN3A 1KZYC 5JASA 2PBRA 3GCZA 1ZXLA 2VF5X 3ZOZA 4N49A 3R5XA 2Q8NA 1A3CA 1BYUA 4OQLA 5HZGA 3F3MA 5ED4A 3KR9A 3P2MA 1AB5A 1AUOA 3EEBA 2ZKLA 3Q88A 4ND6A 5ALVA 1AZSC 4WBNF 3BWDD 4MRVA 2P6PA 5BVHA 3E5HA 4QYTA 2IBMA 2VWDA 1WUJS 3LXMA 4JLKA 3I42A 4B9EA 1C8VB 3B1FA 3QMMA 4JMPA 3K1ZA 5D51S 3SJCA 1NUHA 2EW1A 1L4UA 1PP4A 1ONBA 2XMZA 2G8NA 2YIDA 1CBUA 4NS4A 5JV5A 1Q57A 4KI0A 2PX8A 5LQUA 1UPFA 1Q1AA 3ETEA 2CMLA 4AKHA 1ORRA 1Z38A 2Z0MA 4JJ4A 1L7QA 3FYSA 3L8ZA 4WADA 4TYPA 5EE9A 4Q6WA 5JUWA 1W85A 1KC3A 2BFFB 3L82B 4JBGA 3WNDA 4AG5A 4DLZA 4JR1A 1A76A 2F62A 5F3WB 2HA6A 1YB2A 2HMVA 1HQKA 2WKSA 4YAWA 1IXKA 2OLJA 3H2GA 2JJ2A 2WJPA 5LKRA 3D2AA 3UMRA 3JWGA 3OJOA 3PJEA 3PEVA 3GX1A 3D3EA 3ZDRA 2HF7A 5I7VA 2QXYA 3LDUA 3DO8A 4PNHA 3HA3A 3LWNA 4P93A 4MV4A 4NBKA 4UBOA 3GVLA 5F73A 3V7YA 2D8MA 4HZZA 4DYDA 4UU0A 2JHGA 2ADOA 2JGAA 2GHQA 3NDPA 3HJGA 3QEMA 4YRAA 5K7SA 1YZGA 2PV0A 2PUFA 2BFAA 4K26A 3HUEA 3AERA 2WDPA 5CYOA 2GHSA 4JVLA 3FLAA 3S2GA 4G2NA 4DIFA 1QDLB 1RXCA 2NO9A 3GW8A 4X93A 3MCUA 3OLQA 2FPPA 3KSMA 4ARSA 4B35A 3THOA 4K9KA 5AMXA 4ZP1A 3VPDA 4LECA 3V4FA 5B4TA 3JAWA 3KQWA 2DSOA 1K86A 2DT8A 5ALSA 3U3MA 2G76A 2CXPA 2BMAA 1PSZA 1D5WA 4MVWA 4XFKA 2HJVA 3P27A 3E1SA 4UU8A 1FK8A 3SMQA 3CNOA 3T06B 3LX4A 2UUPA 1RYZA 2SKDA 4GS5A 5DVZA 3DMTC 1J8QA 3AW9A 3RYTC 3SDBA 1RAEA 3DJFA 4ZOCA 5AW7A 4EA9A 3WJ2A 2C9MA 4EH1A 2OM2A 2QVLA 1Q0SA 4GI1A 4NP6A 2GN9A 1PL0A 3EAQA 1FYDA 2AF4C 3RAFC 4FBMA 1NW7A 1V3TA 4JL5A 3HWRA 1MTZA 4MV1A 2JZCA 5HQ3A 3WZ2A 1N6NA 3BMQB 4G4SO 3NBAA 5A7HA 2NXEA 4R8RA 2XT9A 5KKAA 1VP9A 2WFAA 2H2NA 4QWWA 1DX9A 2EDAA 1UADA 4HH4A 3LLUA 3CF0A 3L6DA 1II8A 4K1HA 3F5QA 1NXXA 3UV3A 3K96A 4LBZA 1DBRA 3VRHA 1ZN9A 4I1PA 1E4EA 4Z8YA 1SB9A 4DPMA 3TTUA 3F47A 3PYLA 3GR6A 3ZDFA 4CPLA 2F1KA 2W6ZA 1GNSA 4FILA 1BE1A 1RCFA 2HRQA 3PQ2A 2NWQA 5KYNA 4I19A 5KU1A 4YJ3B 4PQEA 1WMFA 5T3UA 1KA9H 3IIIA 3HBMA 1T5IA 1YJ5A 1JDTA 2O50A 5BYBA 2P1DA 2VP3A 3T3NA 3QYJA 4QEKA 2RK3A 1MB9A 1OTXA 2FSGA 2V96A 2F0ZA 1FDOA 2JFFA 4YGXB 6REQA 4L4UA 5AICA 2X76A 1EFCA 3FDIA 3I6IA 3IO5A 1U4OA 3X2FA 1KI6A 4YFYA 3ZVRA 4DMFA 2JAHA 5AM0A 1IBCA 3K9LA 3NLLA 4CI0B 4EIWA 3I2GA 2I7XA 1XRQA 1WCXA 2NADA 4JL6A 4WT7A 3TIGA 3TG2A 5HRUA 4XUGB 2N42A 5EZYA 1QP7A 3QPVA 3OTIA 2YWDA 4MGIR 4R84A 3VR3A 2WTBA 3E7DA 2AN1A 2VP2A 1ODCA 5HVNA 1K8XB 4UHHA 4TRNA 1P33A 2L17A 1JHYA 1Z0AA 4RSRA 4PNZA 1L4KA 2J0EA 2PBFA 1UJ4A 3WY9A 3EGCA 1AHNA 1X2RA 3HCNA 1U9CA 3UMSA 4KHZA 3K36A 3K4QA 5KVQA 1GWNA 4WLUA 2Q0HA 5CEJA 3OQMA 4LNAA 3A4VA 3CEPB 3J81k 3JD0A 2OENG 5CNKA 4IVNA 4C0SA 1F9EA 1Z6AA 1PN3A 3IBTA 3DTYA 4EZBA 2OD2A 1F6BA 5KSOA 3LT1A 4OV6B 3JQ9C 5HJ7A 1NMXA 1W2GA 2OMEA 3KDAA 3O31A 2LKCA 3OX3A 5AM5A 4YJ2A 1A71A 2FWIA 3WYCA 4QNPA 1PZHA 2CNLA 3AEKB 1DDGA 4QTZA 3UKJA 1RQ2A 4GN7A 1VIMA 4Q3DA 1GNPA 1GYPA 4G0PA 5J59A 3IB6A 1KI9A 5DGXA 1JXMA 3FJOA 1FOEB 1E7RA 3T9FA 2R8EA 3G0GA 3NHMA 5CA0B 4MWVA 3P0JA 1EUDB 3D6UA 3UMBA 1UBNA 2CSXA 5C9ZA 2ACEA 4M9QA 4FYHA 4MYHA 4ZGCA 4YJFA 4C3OB 2IE0A 5LNK6 3Q7EA 4Z4QA 4X3CA 2WKRA 3EXHC 3K9FC 1XHEA 4GECA 1S2DA 2X0JA 4LE2A 3W34A 3ZVMA 2IEGA 3F4KA 3M3HA 1XQ6A 4QYMA 3RSQA 3W4IA 2PZEA 3G8DA 1K6IA 1WCWA 1YQUA 2IY9A 2QL9A 3EBLA 4H3SA 4X90A 4CMHA 5DW0A 5EYPB 3DAYA 3BE5A 3P0HA 4RY8A 4E12A 5BY2A 2DPHA 2D1RA 4XX1A 2AX3A 1MAWA 1YO6A 1PDOA 2REXB 1ORVA 4IIEA 1XMXA 4R83A 4TT3A 3RAGA 3E22B 3FGOA 3HNPA 3PFGA 4IDBA 4FPCA 4P5EA 3UAVA 2PLRA 4G0NA 3DDHA 2D06A 4Y6SA 2I34A 3UMFA 3KKNA 1FBTA 3FAZA 1LBQA 4HAUA 2IYRA 2CMHA 2FGJA 3EGEA 4ZZ2A 4BFVA 2H63A 1LSUA 1ZK2A 5DI3B 4E31A 4UXHA 1XCOA 3L77A 2QQGA 4YWHA 3VU1A 3OQVA 5CLHA 3VYSB 4F2WA 4U7GA 3UBTA 1F0YA 4BASA 4C4TA 1QPGA 3FYHA 3FZEA 3MJSA 5EE1A 4P0QB 1UP4A 2OB2A 1M2NA 3JZMA 2X6QA 1EBBA 2HBQA 2XWSA 3DBIA 3H5RA 3R3UA 4FOPA 4HGZA 2KBEA 4DXAA 1WZNA 1A14N 3LGAA 4OP1A 1BHQ1 4X1KA 1DARA 4HMPA 1J42A 2XTAA 3DR5A 4BNJA 1YA6A 1UMDA 3UGTA 4PGHA 4F9EA 1F2TB 1RI1A 3TEFA 4RSMA 3U2QA 4AJNA 1WWKA 3NZEA 2Q4OA 3AFHA 2ZR7A 3KPVA 1ADFA 2W2LA 1KMCA 4QBFA 4C7MA 1UBEA 2LW7A 4NOJA 4KS3A 4KMSA 1SVMA 3U4IA 4MUEA 4ALNA 4F5EA 3GAMA 3LUAA 1W52X 2H6EA 4GZXA 1KVUA 2REQB 1FFXA 1QS0A 2R4TA 2YQ4A 1NU8A 2FSIA 2QJTA 2X19A 1QRRA 1RCUA 3GEMA 3WWDA 3ZHYA 4P3KA 5K6TA 1NVAA 3SIPA 4BPBA 3UQZA 3DOUA 5LQDA 5JJIA 2ADMA 3ZGXA 5LUAA 4A26A 4G4GA 2FMTA 1BE6A 2IYVA 3CSDA 1K4YA 1ZUIA 4FVTA 3WWCA 3RFFA 1ECJA 3KJFA 4Y67A 2WPDA 3FFTA 3ROEA 1L7AA 4XIIA 1FFYA 4CJXA 4EO9A 2C5LA 1WHTA 3OY2A 3D0RA 3FCEA 4Q7JB 2ODNA 1V6CA 2F9FA 1R6TA 2HWUA 1VFNA 2JA1A 1PTKA 4B7NA 3OQ1A 2HDNB 4RIIA 1H22A 1M6VB 5AWFC 5JJKA 3TLGA 2J4FA 2EFDB 4GXRA 1QAQA 2KS6A 3EA4A 3NOXA 4H17A 4NDZA 1QIDA 2YZMA 3TQFA 1PZXA 2VAMA 2NQTA 2I6QA 5HWSA 2AI2A 4M86A 4ZZIA 3VNQA 1CUZA 2IEIA 3SHWA 2OFPA 1PZFA 1E79D 4IMIB 2WTEA 5F77A 1YJQA 2PX4A 1XLVA 3P2IA 4N3AA 2IYFA 1UCFA 4FS3A 4RAQA 4GGPA 1I7PA 3C3KA 4YP6A 3SX2A 5E2AA 4CEJB 1JSCA 2OOKA 3R6GA 1VYHA 1LS6A 3KLNA 4ERNA 2R751 4ND3A 3V8BA 2AEMA 4Q9DA 5IJXA 1T25A 2YZGA 5DM4A 1BJKA 3Q6TA 4OVKA 3QVKA 3GRPA 4A8JA 2E49A 3A11A 2YOFA 3FNQA 3KQQA 3O3CA 4Q4DA 3L7DA 4FOVA 1PO7A 2ECKA 3BAZA 3FCYA 3FVVA 3KO8A 3L8DA 3PDCA 3UGQA 4BO4A 2ILVA 4DCUA 3IQDB 2YYAA 4WX2B 5SICE 3P0RA 3R3WA 1M2VB 1Y7IA 1ZQ1A 3ZI0A 4PTLA 1L7OA 1HDIA 1Q21A 3JQ6A 2FXVA 4MHOA 4URUR 3ZN2A 1S02A 1IUCA 1PWYE 2FLKA 5C8YB 3ACDA 1MQ8B 3U17A 2QROA 3F46A 4BBAA 2P9JA 1FNMA 1NKTA 3DBHA 3LUCA 5CFLA 1Z4JA 2VZLA 3FCXA 2H92A 3B13B 3AGPA 1G55A 3D0KA 3IDFA 2OBNA 1NP7A 1UMCA 3SLRA 4AJJA 3L92A 1KQOA 1RXEA 3RT1A 3O0DA 2C2GA 4DDKA 2BEVB 4X49A 3MRSA 2C0PA 9ABPA 3HCBA 4N40A 3JZFA 3PV0A 1MN6A 2I03A 4YQZA 1V37A 1X7XA 5SY9A 2J09A 4UU1A 2G9RA 1P4SA 2H4HA 4FNAA 2KE5A 5ALIA 3OTOB 1SPBS 2G82A 3L3BA 4U39A 5TIIA 2W2KB 2VNIA 4I4TB 1DIOB 2O1EA 4CMEC 5FNVB 4IS3A 4UTVA 1ANKA 4OHWA 3G0BA 1Y8RA 5K4AA 3E9ZA 3EVNA 1VCOA 4ACAA 1XJWA 4NU6A 1D2CA 5FNZA 4R8KA 3Q7RA 5JS8A 4JP1A 3AM4A 1GVHA 3V4RA 1GEGA 2I8AA 4R2XA 5H80A 4XA8A 2I7CA 1P45A 4BIIA 4NZNA 5P8WA 1L3IA 4D9KA 5TS2A 4FHCA 4OL9A 1JLRA 1XXLA 3BXPA 4CKBB 5T4BA 3DYVA 4LG1A 2QS9A 5TNXA 4BVJA 3O8QB 5TMDA 2VCEA 4YRSA 1M9NA 2E4XA 4XWKA 2VHEA 4WA8A 5AHRA 4EW6A 5IBPA 2WKWA 4G25A 4MWRA 1OAOA 1HOXA 1HY3A 3UXEA 1PTJA 1JHXA 3HKEB 4EI7A 1E2DA 4HNUA 2RHOA 2F10A 2CWDA 4FT4A 4GWKA 1QV6A 1XMVA 4FONA 3UAGA 2HRZA 4A2QA 1UXKA 1ZITA 4N3GA 4OFBA 3DAGA 3C16C 4QKQA 1BDHA 3NDJA 3ZGLA 2WZBA 2CXQA 4MKZA 4HC4A 1LNZA 4C4SA 4LJAA 1YJ8A 5CA1B 3K38A 3M70A 3NOOA 3U3ZA 3L02A 3QOXA 5GX2A 2YA6A 3CQ9A 2X23A 1CUUA 4LYDA 4O33A 1O94A 1Z4MA 2XH8A 5ULLA 3ERCA 1TB4A 2FSHA 4CF4A 3RKSA 3KTAA 4HPJB 4AJHA 5CFPA 1XDBA 5BR7A 3OQIB 1SHLA 4RZIA 1IB6A 2WLTA 3L1KA 1T9AA 3PGA1 1CIVA 4II7A 4TWIA 4L9AA 4U63A 2IZOA 2IYXA 3PQ8A 2HMAA 3BMNB 3EPPA 4MEAA 1IK6A 2YFHA 2AYXA 2NACA 2DR0A 3HR8A 4JT9A 4X20A 3O4RA 5AM1A 4HX2A 1G1AA 5EXEA 5D9DA 4K9DA 3AZOA 1PJTA 1E9EA 3N0RA 3CLUD 5I7UA 3ZWQA 5D01A 2UVPA 3ZD6A 4PCAA 4FFPA 5BQOA 2QIPA 3W9YA 3K9CA 4OHXA 2KM1A 5BR8B 1DQPA 2ZDQA 1PVOA 3RNLA 2QXUA 4GKVA 5HM6A 4HDMB 1T8YA 4RJTA 2O52A 2AMJA 4PC1A 1ML4A 1TE2A 1GNLA 5B7NA 4JKOA 4C6SA 1G20A 2XECA 1E7MA 2NN3C 1H2ZA 1XZKA 5BVGB 1Y5RA 4QLOA 1JTEA 1TJ3A 5GGYA 4ETWA 3K70B 3M33A 3WQSB 4MO9A 2GM3A 2BGNA 2X4LA 1UWVA 2HSZA 3BK1A 3K5PA 2FMXA 3QTTA 4GOOD 3M82A 4M1KA 3Q8WA 4H6PA 5DBEX 2E1RA 5JQWA 1Q0TA 1KEPA 2OA0A 1RYMA 4ZGBA 5H8WA 2RGBA 4GXQA 4BN0A 2VN8A 5BN4A 3W4JA 5AI5A 3CF6R 3UMMA 4B7CA 5GX1A 4M9ZA 5BQXA 3VJRA 1ZIDA 5EMJA 1KJ9A 2Q41A 4D3DA 5AUPB 1J2TA 3EDQA 3FUUA 2JD0A 2JVJA 4JB8A 4RX1A 2AC4A 5JWRA 2PDAA 5DXFA 5F23A 3H9EO 4XPIA 4Q02A 3PC8C 1W4CA 4D80A 4QZVA 2CN1A 2IHJA 3RHFA 4A6EA 2BE9A 1NMSA 1JU4A 1JFRA 3DNMA 3WOHA 1EP2B 1CR0A 2GS9A 1PFKA 1XMSA 1YRWA 2MSKA 3C45A 3HVJA 3ZX4A 1DV1A 4CM9D 4QUKA 4DWJA 4F3CA 4F71A 1ONOA 2XF8A 2NU9B 3IMGA 1TAUA 1P31A 1XJ0A 4XM1A 4RD4A 5J5AA 5CVDA 3CGGA 1OFGA 4CIVA 5EO8A 1QFZA 2FWRA 4R40A 2ON6A 1C8KA 1N5LA 2HK6A 1V8DA 1V25A 4HSEA 4WTOA 2X8AA 3LCJA 4I9NA 3O91A 4ER3A 2F13A 3WWPA 2PSDA 2ONCA 1G1MA 3K9WA 3IAS1 4AC9A 3B9QA 5ICCA 1J9EA 1RJGA 1Y8QA 4QGBA 1VE3A 1XAJA 3SNHA 3UJ9A 3EBOA 3AESB 4JA0A 5MHTA 2OVFA 3FD8A 4LZJA 1M6EX 1VP3A 3LX5A 5BSUA 2B5WA 1LPBB 2GVNA 4O6VA 1D4ZA 2IYYA 1SOMA 1G7RA 2FEMA 2PD3A 3GZNA 5DW3A 1GRRA 2KWIA 3UA4A 5B36A 3TNYA 3Q12A 2YXNA 1XCMA 4WH0A 3NP9A 2IATA 1Y8CA 2F9LA 2OSVA 1J23A 1E5TA 1OX5A 1Q5PA 3ABSB 2DG2A 3JQAB 1VKNA 1D1SA 3NYQA 2Y27A 2QRLA 4LXYA 4TX1A 2QRVA 1BAPA 3S8MA 4W5NA 3SIRA 1A8SA 1DG9A 1QHSA 3GT4A 4LVOA 4URVR 1BMQA 1NV9A 1ETUA 2BRUC 3NRJA 2HZBA 2X15A 4YMHA 4G8JA 3IP7A 5IVIA 4KPFC 3IE2A 4AVYA 3UEOA 2C8JA 1TT5A 2MMCA 2C2XA 1NBEA 3OESA 1CP3A 4O5OA 5ALLA 5F1YA 4EHIA 4YX9A 5MGBA 2XUHA 4R51A 2QLJA 1K7EB 3MYYA 2KX7A 4WK2B 2ENUA 1N2CB 5ECWA 2QKYA 1SUPA 4F0JA 5K0FA 5AUOB 1E1YA 1PJ2A 2Z6UA 1QNFA 2XWJI 2YFKA 4FHFA 3TECE 2EKLA 4B7UA 1J24A 5EJMA 1OLUA 1RLOA 5TGDA 2I76A 2XCRB 4B32A 4OMDA 1J1UA 1RRCA 2HL6A 2C5SA 2VH5R 4WLEA 5ESWA 4LWOA 1RCTE 3DNPA 4B3IA 1QKIA 2EQ5A 1EXWA 1VE6A 1VGRA 4KE6A 5J1TB 5FOTA 4LQLA 2IPXA 1XL1A 2RB4A 4WKGA 1NXTA 5TJ9A 5EL0A 1MBZA 1Y1SA 2PZKA 4EJ6A 4ENUA 4D41A 1P4HA 4PCUA 1TK2A 1UH5A 3WGYA 1X74A 2X2EA 3NNNA 3IUQA 4AJPA 4KR2A 1W88A 3EXHB 2CJWA 3NC4A 4DRXB 2FP9A 3FZYA 3U44A 3KZXA 2Y68A 4I9UA 2PL9A 4Y7DA 3W8FA 2A88A 4V1CI 3HVHA 1PK8A 3UB4A 3A14A 3NB0A 4EBBA 5IAGA 4JT8A 3BCSA 2Y99A 4GBGA 2XOKD 3NGXA 5CIQA 3FA2A 1IY0A 1CR1A 1EFLA 2KLHA 3A70A 5EINA 3I8OA 3FWPA 3GIDA 5T4EA 4B3JA 2CDAA 1RFGE 3JALA 4PC2A 2YJNA 2EOAA 2Z2KA 2BJVA 4O2BB 4UAUA 5F64A 4Q12A 4W99A 3S81A 1V11B 2GJAA 2QMOA 3E8XA 2OHGA 3L93A 5E4JA 3LRXA 2QE6A 3O75A 2QZJA 4ID9A 4N47A 4OB7A 5EJGA 3TL3A 3KZ1E 4KNVA 2C2MA 4RF3A 5C0OE 1KERA 3SSAA 3SZMA 5AIBA 3ANSA 2KI5A 3IPAA 4OSPA 2VCYA 4MQEA 1L9XA 3CJTA 4KQCA 3EJWA 2D2IA 1EZ1A 3KQTA 4JB2A 3I76A 3SSNA 5KJ6A 4MMZB 5BMVF 2VPIA 3DDSA 4X7RA 3WK4A 5ALDA 1DBSA 2IBSA 1RYHA 3LUDA 4NU8X 3IUJA 4GRAA 1OLSB 4CLRB 3GRKA 4INOA 4DHWA 3S70A 4H9GA 5BMOA 1CZHA 1EK0A 1CY7A 4LDRA 1QBGA 1UK8A 2AXQA 1ZA1A 4L7VA 5I9LA 1O89A 3B8EA 3D31A 1P7PA 4PR0A 4RHEA 1H93A 5DM2A 3QBVA 2V8OA 2Y4OA 3NWEA 1ACJA 3M9XA 4GI3A 3LJKA 4OBBA 2XCSB 1BYIA 2NZVG 1DAFA 4QYIB 4EUNA 5K3EA 4X1YB 1E3EA 1DAKA