4JMLA

Crystal structure of the tolb(p201c)-colicine9 tbe peptide(a33c) complex.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
398
structure length
394
Chain Sequence
SGRPIGVVPFQWAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQCLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TolB
publication title Intrinsically disordered protein threads through the bacterial outer-membrane porin OmpF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/toxin
total genus 109
structure length 394
sequence length 398
ec nomenclature
pdb deposition date 2013-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 4jmlA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 4jmlA01
4HHQA 5D9DA 3IAXA 3SRGA 3HLHA 3S8VA 5GTQA 2OJHA 2W8BA 1RWLA 3SREA 1E1AA 3WW9A 3BYCA 4A0PA 4O5SA 5GX3A 4GN9A 1QLGA 5D9BA 2IAWA 2G8SA 2IAUA 3A9HA 2FP8A 2VAQA 4GN8A 3S2KA 3LI3A 1CRUA 3V1SA 4DG6A 2FPCA 2DSOA 2IASA 2QE8A 5GX5A 3TC9A 2GVVA 2DG1A 1C9UA 5GX2A 1IJQA 3I1CA 5GX4A 3SOVA 4O5TA 4Q1UA 1CQ1A 1V04A 2HQSA 3Q6KA 4HW6A 3SOQA 4ZLRA 3E5ZA 3G4EA 3WWAA 3LI4A 3KYAA 2GVWA 2IAOA 2IAQA 1C5KA 3Q6TA 3G4HA 5D9CA 3HRPA 2IAPA 2W8BB 5FWWA 3SOBB 4GNAA 3DASA 4GNCA 4GNBA 2GVUA 2IAVA 1Q7FA 3AMSA 1PJXA 2IATA 2V91A 2GHSA 3O4PA 3V64C 3S8ZA 3A9GA 4IYGA 4PWZA 3Q6PA 3LI5A 2GVXA 3U0SA 4HHOA 1H6LA 4GN7A 2IVZA 1NPEA 2P4OA 2IARA 3P5BL 5GX1A 1POOA 4IMBA 2FP9A 1RWIA 4JMLA 3V65B 1QBIA 5EX7A 3AMRA 3S94A 3FW0A 3HLIA 3DR2A 3KGGA 2POOA 2ISMA 2IAXA 1CRZA 4R40A 1N7DA 2DG0A 3FVZA 1CVMA 2FPBA
chains in the Genus database with same CATH superfamily
1FUYB 2BJWA 5EJ9A 1YR3A 1ZH8A 2C78A 2WYVA 4OIFA 2VZ8A 1G4UR 3X1JA 4C21A 2B1RA 5F2OA 5D51S 1XZHA 2VDQB 4F86A 3EULA 1CR0A 2YXDA 3PV0A 4MXDA 3MB8A 4L7DA 1CHDA 4LEIA 3CLSD 1FYEA 1UH5A 5MN4A 3D8HA 3TI4A 4AKTA 3PJRA 1V43A 2CHEA 3QVKA 4NCBA 1HUQA 3ACDA 1CJVC 1SCUB 1UANA 2M98A 5A9SA 4EELA 3A6DA 1FTNA 2FWNA 2I54A 2OV2A 1TU3A 4EI7A 1L7OA 2VWDA 1VIYA 1ZY2A 3M6FA 2O8BB 2VPYA 3LW7A 1C7FA 5IRCD 3EHDA 1KVSA 4JH0A 1DAHA 2K6GA 3SIRA 2KM1A 1B2RA 4FEAA 4C1NA 3IMEA 2SKEA 3TIBA 1JA0A 2E85A 4KIFA 1Y6QA 3BD6A 2R96A 2YV3A 1RE0A 2PJZA 2VPIA 1J20A 3RJTA 4MGHA 4B0OA 4MWUA 4ZVOA 4JT9A 5L3RA 3DT6A 4D8WA 4AJOA 4HWRA 3AERB 4MV6A 4Q7KA 4ARSA 3S2IA 4MWEA 4OBWA 1ZHOA 4MS4A 4C4AA 4JBIA 4QSMA 2FP4B 3BL6A 4KWIA 1RD4A 1M10A 2B0CA 5AJHA 1EFUA 4IKPA 3KV3O 1XALA 3MCUA 4MQBA 4BFWA 4BBZA 1YQQA 2RGYA 2GN9A 1HDYA 2R86A 1EFTA 3MRTA 1EFRA 1YGYA 2Q1YA 4KVZA 4IJQA 3PXGA 2JGMA 4BNWA 2ZATA 4X24A 4BLOA 1V2GA 5JRZA 5FH9A 4KRYA 1L7RA 5KKAA 2O5CA 1A72A 2WFZA 3P97A 1A1VA 1Z12A 1EVQA 1JHAA 1F2VA 1JJBA 4KNVA 4A2PA 4HXFB 3CEJA 5LOVF 4Q3AA 3I62A 2IOQA 4XD2A 1AS3A 4IMJB 2WVAA 2JHFA 1D8TA 2DBVO 2UYOA 4DS3A 1IN1A 2JA1A 4P5DA 3UHJA 1NIJA 1PZXA 2IYRA 1LZKA 1OKKD 4L7VA 1KJ9A 3I2YX 1TF7A 2XZTA 3NT2A 1Z38A 1T24A 2AW5A 3FYUB 5ECGC 5ESRA 2FDCA 2PBRA 5HUKA 5K5EA 3ZGCA 2PFSA 4GEKA 1QKIA 4XUDA 1SQ5A 5LXTF 2IV2X 2HMYB 4FMCB 1WCIA 1ODKA 3GPBA 1KHTA 3CJQA 4MV9A 5FTNA 3TGWA 5GIOE 3KXIA 1FP7A 3O0TA 3GMIA 4C5BA 2V7PA 2MWMA 5AFSA 1F60A 1MX5A 2PH1A 1JPUA 3BIXA 2P4OA 2IHKA 2VHVA 4L7BA 3A1VA 3HB9A 1J97A 4KE7A 5FI5A 3ZK7A 3MRVA 4WKCA 5EFZA 7MHTA 5LA6F 1JAHA 2P4HX 3IVMA 4IDOA 3B3GA 1HYHA 5LOVA 9MHTA 1KPIA 1J2TA 2NG1A 4XM2A 3NXSA 1EE1A 1H65A 5DU2A 4MGEA 3UB4A 3H2IA 4LVNA 4I5DA 1K6MA 2QR5A 2DQZA 4Q3OA 2JIZD 3ENZA 3RHSA 5BV0A 4L50A 1VPLA 5FBKA 1XYVA 1DG3A 1JSZA 5CJ2A 3HLKA 4QPCA 5I45A 2A4KA 1DO0A 2EWWA 3M4NA 8GPBA 5LXTA 4DV0B 1QHXA 3KXPA 1RFLA 2RGCA 3JWHA 3PTAA 5AW9A 5JADA 3PX7A 3G5MA 4W1PA 1K7FB 3FGZA 5ANRB 2J7KA 4OTZA 1Z2EA 4IF4A 2O1WA 2BLLA 2HBYA 4U7FA 1WSWA 3EEYA 3HU2A 1K4YA 1MNAA 3E3NA 2AEMA 2L17A 1IK6A 6YASA 2QWGA 1G3QA 2ZUCA 3QWAA 4ZAWA 1A4QA 1U7PA 1TT7A 1FFWA 2OV8A 5LA6A 3V9PA 2Q0HA 2Z9CA 5IP5A 4OX9Y 3DAGA 1KJNA 2HCJB 2CHQA 16PKA 5FBQB 3OFND 4WCDA 1MG5A 2H2WA 2HX1A 2OO3A 5DTRA 1QZXA 3TMYA 4AP5A 5KC9A 1G19A 4U2EA 4EHNA 4MUBA 3BMOB 1R8QA 4G41A 4ZEVA 2JI7A 5ALLA 4LNHA 3HZHA 1BFDA 4M0CA 3AF4A 1DKRA 2YA6A 3BCSA 3PP8A 1IG3A 3R7NA 3S70A 3AEKB 1UJBA 5E6SB 1C0KA 2GJ9A 2FQXA 2FPCA 5CCEA 2ADOA 3T41A 5KU7A 4N3BA 4M9XA 2WHQA 1J25A 1K92A 4FDMA 5ISMA 3P71T 4RW0A 4AY5A 5HHTA 1RLOA 1JLLA 2BGJA 3LVRE 9LDTA 3HNOA 1RQRA 5GX2A 1IXZA 3INNA 4WESB 5C8VA 3VM6A 2XUZA 5J63A 1GR0A 2IHVA 2XZIA 2IK8A 4CU5A 2E48A 4X6YA 2VW0A 1Z74A 3Q3VA 3VR6D 3WA7A 3DO8A 2M6RA 5ALUA 5FA5A 3C3EA 1U8YA 3Q3IA 5BWLA 2ACVA 1XSEA 5JMTA 3EG9A 2DFKB 1NNEA 4I1YA 1FNDA 2EFCB 3HVJA 4NXMB 4WL0A 1JKFA 1RHMA 3DF7A 3ZWCA 3H5OA 1E2DA 1JZSA 2X0KA 1M8PA 3IE2A 4QJIA 3SFVA 3JW8A 2A9PA 2IAPA 1GGKA 5EXEA 5CP8A 1Z5PA 2BC9A 3T95A 4PYKA 1HZZA 3UJ3X 1UDXA 2JGNA 2NADA 3Q9LA 1IVSA 3PGA1 4QUGA 4G9EA 1W59A 3K9NA 3IAM6 1D09A 4G23A 2A67A 1DDGA 2YXEA 1P0QA 3JCZA 4OLAA 4QX6A 3BWVA 5CB0A 3AMSA 3FXAA 1L5ZA 1FVXA 4F0JA 2FUKA 1RBMA 2FWMX 3F8TA 3NGMA 4WRRA 1ACJA 4TV9F 1XZQA 5JALA 4E1VA 1RZ3A 1NJ5A 2ONJA 3LQFA 2Q2QA 1NBIA 2AJCA 4QTXA 4Q9LA 1JHOA 2XUAA 2J5XA 2FFBA 1JEAA 2YBEA 2G6BA 4H0CA 4TYNA 4C4TA 1D6SA 5SY6A 2AC4A 3F5FA 2VNIA 3MA0A 1E58A 1CUSA 1DUIA 4BWVA 4R1MA 1IHUA 3OOHA 3GUVA 4F56A 3NETA 2NOAA 1M5RA 2C3PA 2G06A 2X4GA 4JMLA 1X0VA 2DWPA 2JFFA 3D3WA 3FF4A 4BRSA 5IJ9A 4PWYA 4GNRA 2RHWA 5LR6A 4HZYA 5IBRA 3WGYA 2BCEA 5GAJA 1YFKA 4E88A 2AGSA 4EPTA 2QNBA 2MMCA 2A3RA 2Q9UA 2GPYA 3GVPA 4TS1A 3HEMA 5L9AA 1WXQA 3V34A 4P3KA 4EQZA 4TV9A 1A9SA 5F3DA 3QWHA 4MMYB 1W1IA 2Q8QA 2XNHA 1XZPA 3GPIA 3MMSA 1RRVA 5A6SA 1SVUA 2AJDA 5KNCH 1GCOA 3BZBA 3RBVA 2VRCA 3H0EA 1P9RA 4NE2A 2N46A 2HKIA 4KRGA 4RVGA 1S2GA 3K35A 3VSDA 2CSXA 5T67A 2D54A 2ZSKA 3ZXYA 4A8HA 2NGRA 2Z8ZA 3NGXA 2HD4A 1M1XB 4GVPA 1ZOOA 5B3AA 5CFZA 1IY9A 1VZ2A 1DRJA 1K5HA 4LV8B 3ESRA 3A1UA 2VN8A 4GKBA 3EXIA 4E46A 2PCJA 4GR5A 5JCJA 5IPFA 3KB2A 4MWSA 4LAFA 4PSUA 4MYHA 4TTAA 4ZVMA 4MO9A 1ZW1A 2JGFA 4Z1MA 1QH9A 4CZ2A 3ZR4B 3GQVA 3VHRA 1M2WA 3QF4B 3IBSA 3R0VA 2DECA 1MKYA 3MAGA 4JUCA 3ZLVA 2IYTA 7MDHA 2BFMA 3DG9A 2UZ4A 1F2DA 1R4NA 4PFQA 1JPNA 2HSJA 3EA5A 4IUBS 3EUFA 1BDJA 1Q7TA 2WHEA 1U7UA 2JJ8A 2JIDA 4NDAA 2BSAA 4Y2HA 5K6AC 5JDCA 4KR2A 1JSLA 5ENDA 4NEGA 3O84A 1DC8A 4D81A 1W46A 1QH8A 3GF4A 5GV7A 3MD0A 3RYFB 2OFXA 1O95A 2VHXA 2X0JA 2QTRA 3AVOA 3FSEA 3S68A 1AMNA 1EMDA 1KXZA 1W5AA 2NACA 1Y6RA 3E8SA 2ZRCA 3R77A 5TPWA 1O9HA 2RK4A 1TZCA 4C4OA 4EPRA 1FP4A 1M2JA 3EXG1 3S8EA 1FDIA 4AY2A 2D4AA 4PZCA 3R3HA 3K32A 5AWFC 1NJGA 5FBRB 1E32A 3DMPA 4JKYA 3A70A 4DV2B 1QIKA 4XASA 4RTOA 3QOXA 1QGZA 2BW0A 2UXDB 1ZC4A 1FCJA 3PDHA 4Z0PA 1FSGA 3ZS9A 1SJ9A 1M0SA 3NLLA 1N9ZA 2BE9A 1JEQB 2NQ8A 4JFRA 3TG8A 1YZYA 2H1HA 3GG9A 4QXAA 4AS2A 4ACBA 4X1YB 4YMWA 4BO7A 3GL9A 4XOUA 4EUNA 3U61B 1SXIA 4DJ5X 3AC0A 4ND3A 5GM2A 1REQB 3VR6H 4BEBA 3QLUA 4RIHA 3CG0A 4TXHA 5BXYA 2OFFA 2NUAA 2WMYA 4BC1A 1XVLA 4BWYA 4C88A 4W1RA 2UUBB 4IO0A 2ASVA 4JGGA 3ED1A 2CDNA 1WXIA 3GUYA 4N6NA 2VQDA 3WV5A 1PTJA 2WJWA 1DMRA 2IUFA 2Z56A 3ZVMA 3C6ZA 4DUYB 3AV3A 4GPZA 4HNQA 2OYSA 1O4WA 4IS3A 1DWQA 1RWWA 3OAAA 4JQZA 5DXJA 2XXAB 5FI3A 1N7GA 4FFVA 1U5AA 3QFSA 3UWMA 4HSGA 2C4NA 1JEEA 2KHZA 2GHTA 2WB4A 2OLKA 3BX1A 5A6VA 1QYRA 1SUDA 2W0SA 4H1TA 3I2IA 2EP7A 4X61A 4OA5A 3VZPA 2VZLA 3V65B 3EOBI 4GXNA 1TAQA 2ES4A 4P7JA 5H82A 3FETA 2G17A 3MHPA 3GB9A 4NU0A 4LF6B 4CPNA 3D8UA 1RMTA 2FZKA 2H0RA 3HY3A 3R0QA 5SZIA 2ZBFA 3C7TA 5LZ8A 3RTGA 4NBNA 2CLCX 3Q2IA 3OX3A 1MV5A 2WWHA 3OJCA 2X1MA 4B4DA 1YNOA 1C29B 2GNPA 4HDSB 1VJ0A 2HBRA 4TXLA 1HNXB 1U8UA 1MRZA 2DE0X 4PEVA 2FUG6 4BNLA 4LF7B 3ADPA 2WQZA 4K26A 4OOEA 1EGVB 5GZ6A 3U1VA 2G8NA 4CIVA 4DEYA 1RXVA 3QU7A 4NG5A 2PS9A 4HNAA 1Y3FE 4M1YA 5ALHA 4PCLA 3VU8A 2CMGA 4EPXA 2EYUA 1HDEA 3UT5B 1W5SA 2Q8NA 1E4EA 1ZA2A 4Q05A 4YIKA 1M1UA 3B1JA 4INOA 4FVKA 4TX1A 3ILHA 4MV3A 4TL8A 4X7RA 1CRPA 2D59A 2KS6A 1KNXA 3IRUA 1B16A 1QQ6A 5E3JA 2QENA 4FINA 1TW2A 1Y8QA 5E9QA 4CF5A 2JGRA 3IO5A 3TVDA 4HZWA 3KTDA 3KZCA 4NE9A 3VVBA 4RELA 4KXUA 5AK3A 4CFSA 2PNJA 2GK6A 3RF6A 3F0TA 1K08A 2DM6A 1O6GA 5IAGA 4AL4A 2QYSA 2YCLA 1SCDA 3BA1A 3GUZA 2R00A 4UTXA 3VC1A 2VCHA 3FSGD 1ZA1A 3HKBB 3PR2B 5LLTA 5CEJA 1XV5A 4H7KA 1ZJZA 1DAFA 1QS0A 3IDOA 3CE9A 4W4TA 3G6WA 2CFTA 4OY3A 5FZJA 1WAMA 1HSZA 5H3LA 3PVCA 4WJZA 2O8DB 1MC4A 4N40A 1KVQA 4OI1A 3RHFA 3QKUA 1HWYA 4YCAA 1SCBA 5BSFA 1DNPA 2FPIA 3EXFB 1YK0A 5ARCA 1C9EA 2O7VA 1N3YA 2FPRA 3H17A 4FQ7A 4FS3A 2AC7A 5THXA 5C5EA 4HW6A 2BMAA 1CJUC 4PC1A 4YRFA 1JKXA 4EHAA 1VLQA 3BXHA 4GDIA 4W7IA 3AEXA 1XJ0A 5EN4A 2VUIB 1GT91 3AUAA 3Q7RA 2OXTA 4Y6PA 4YQFA 1XRSB 4MHSA 1CFJA 1UBUS 2LD4A 1M6NA 2RJNA 5T6MA 3GJ4A 3OIVA 3KHUA 4XJWA 2MCFA 3FFTA 2ZUFA 1Q57A 2H52A 2ZYAA 5AW4A 3FYTA 1C2TA 4KFSA 4AG3A 4H7HA 5JEDA 3H99A 3H6GA 1U0EA 2D5IA 3JASA 4YJDA 3KDPA 4L0DA 2QXUA 3KSUA 3PT9A 3OLCX 4J6FA 1N3LA 1KS9A 4EFLA 4RPLA 5H16A 5KJCA 2DVMA 1GRQA 3CRW1 5IVIA 5EEGA 3D4BA 1Z4MA 5A3SA 1PT8A 1RC1A 2QRLA 4R2WA 1U1FA 4J3NA 1F8EA 3KSAC 1SCNE 1SVOA 3BF8A 4AQDA 2W2XA 3VV2A 1T8YA 4DIOA 1T36A 5J4KA 2W6OA 5G1NA 3T3EA 2JGDB 3TQSA 2V7UA 4LTMA 4CYMA 4L0QA 1XWWA 3ECAA 3EVTA 3JSXA 4R98A 3AJ8A 5TT0A 1GTVA 1PYDA 4U6NA 4Y1GA 2HO4A 3I9OA 3P9IA 1P61B 3PHHA 1A4UA 5EQTA 3PJDA 1ZI9A 4KHZA 4C78A 1E1QD 4MLDA 2BFFB 3E0XA 3HYSA 3B38A 2QTHA 3CHYA 5C5IA 5JY1A 4NBWA 4MJVA 1BAPA 3CF4G 3E7PA 3QEJA 5DCWA 4BZZA 2F67A 2V6JA 5IFKA 5C4GB 3OCJA 4LFBB 5TY0A 3HP7A 2R6DA 5GVSA 2EDAA 3I2GA 2KSQA 4HEJA 3SR0A 5HUJA 5C53B 5J40A 2YZ7A 1RYEA 1OJ7A 4E33A 3QPAA 2OGTA 1GU0A 5DLDA 2A75A 2JGEA 3CN7A 4FFBA 4G85A 1M76A 4RPHA 5T5QA 1DX6A 1YRBA 3CF6R 3DDCA 4GZ3A 1NFFA 3Q87B 6Q21A 2DKFA 1U2RA 4YCJA 1UIRA 1FNMA 1UC5B 2V55B 1ORHA 2VZEA 3IR7A 1E3WA 4J9UE 4DZRA 4PTYA 3EIFA 4ITVA 1NYTA 5TQ0A 3WK8A 4RULA 1F2UA 4LQ4A 3EEBA 4D0RA 1RE1A 2RGWA 2FFJA 4M0KA 2V7QD 3UZUA 3VDMA 3UK7A 4WE3A 2DT5A 1T1JA 2XT6A 2QI9F 4I1OA 1K4MA 4MMZB 4WN9A 1M75A 5ALXA 2B9EA 1ZBDA 3DXZA 2B83A 2QMQA 2W93A 2BDTA 4UAVA 1YASA 2H5EA 1GFSA 1UJ2A 3N58A 2AUNA 1K7YA 4OL0A 4IV0A 4K86A 3AZQA 2PFGA 3HL4A 5J2TB 3W3AA 3JQGA 2DSOA 1SA0A 2FVXA 1M6WA 2C0PA 4GG1A 1JVNA 2YNMD 2G07A 4DR7B 3OHMA 4DPMA 3O7MA 2BT4A 4RD0A 1Z0ZA 4TVOA 1HV8A 3HA5A 3L1VA 2H06A 1HFJA 2Q5LA 4MYCA 4NESA 4F5EA 2MR5A 3QMPA 2VQSA 3T7EA 2Q2NA 4L73A 3U16A 2OSVA 4YWHA 3DOIA 3HO6A 5TLSA 3DD1A 2YBDA 4YMSA 3RU2A 4FQ4A 3N28A 1M2KA 3H5VA 3DL2A 1VPTA 1M2NA 2QROA 1R15A 4QUDA 1FSFA 2HH9A 3WWAA 2CYAA 2OB2A 4PG7A 4XCQA 3KYAA 1I6KA 1P44A 3DA8A 1U1EA 1VKOA 4HY3A 5DK4A 2GFHA 4JFAA 4LSZA 2LV8A 4QARA 3TECE 1WEHA 2WOZA 1G8GA 1RI2A 1OI2A 2PWAA 2DQ4A 3L6CA 3IT0A 2YX1A 4X20B 1ML3A 1M2VB 2YFKA 3KUUA 1WTAA 4J9TA 2II6A 3NAQA 4MUIA 3AF2A 1E3IA 4OXQA 4MUHA 2PGDA 2I0FA 1C7QA 1YVUA 3EPRA 3PPIA 1I7LA 4R8SA 1I6LA 2ZQZA 4AQYB 4AF7A 4OXKA 1WR8A 1EHCA 2EG5A 2QA5A 4P38A 2SLIA 1L5YA 2IAVA 1OR8A 3NJ4A 3ZXXA 4N18A 5JPIA 3P27A 2B3TA 1ZUNA 3V7NA 1C9MA 3EPKA 3DMNA 5HPYB 1G7RA 1RPNA 1RABA 3GJ5A 4D9EA 1LW7A 1DO8A 3UJ7A 3OM1A 1W8NA 2ZE6A 1DQNA 1Y9JA 1ISFA 1ZJ4A 2HB6A 1QE0A 1QHSA 3FWHA 3IMGA 3INYA 5BY2A 5JECA 2CXOA 1B26A 3NOVA 1FW6A 3OEEA 1O8CA 3G8AA 3KWLA 4YAUA 3B13B 2FN9A 1JTFA 3BJRA 4BEWA 3W2FA 3P20A 4KFTA 1WQ1R 4QXPA 4IZ6A 1O6BA 2I34A 5DYWA 4EUFA 1P9WA 3WIBA 1KETA 5DWDA 2AGVA 1UEJA 3PI6A 2X7JA 1AS2A 4B85A 2F62A 4V1CB 3H84A 4FYKA 4EP1A 5B55A 3A9VA 1CUAA 1EX7A 5I3CA 3UAZA 4W5JA 2WU0A 2WYOA 1S89A 2IZOA 3GRAA 4PZPA 5E4JA 3I8OA 3U5TA 3CKLA 3KJGA 4A9AA 1IYZA 1IJBA 2OG2A 5T57A 3KAPA 1C4OA 3LX8A 4J03A 4NAHA 4OQNA 3AP2A 4WLUA 3CNBA 4FGLA 4OKIA 1TM5E 2PEZA 4HTAA 4JUBA 3U9SA 1JI3A 1NJ6A 5IAJA 2HA5A 1IPEA 4RKRA 4LBYA 4PX9A 1UINA 2AEFA 4XDHA 3QLVC 3OZUA 4AJIA 2XT9A 2CNDA 4HGNA 5DNAA 4G2TA 3SZ3A 4FOQA 1XRQA 2Q1XA 4KXWA 2JIMA 4N49A 2NQTA 1WZEA 4UEQA 3LX5A 4AVYA 2ZI5A 4B7ZA 2HPHA 4XOGA 4D4JA 4FPLA 3IO3A 2Q27A 3PQDA 1B93A 1WS6A 2PXCA 1RW4A 1PL7A 3KQMA 4FDTA 4DLXA 5ARBA 1CETA 4EW1A 4HJXA 3PNKA 2PT7A 3O8QA 4ALJA 2QL6A 1QBKC 4XPIA 4CT5A 1OX4B 3BMQA 3WLSA 3EGDA 4RPIA 2GEUA 2I66A 4LZNA 4GI3A 4LNUA 4NV0A 1VIAA 3UB2A 4EF4A 1NCBN 2DPGA 3AW9A 5HZMA 4QU5A 4I3FA 4URUR 2MIIA 1LTQA 2A14A 2FW0A 3AKEA 4K3UA 5CA0F 1H9AA 2Z8YM 3TEMA 3VKWA 2SIMA 1JFFA 1KDPA 5K3EA 4ENTA 3PLAE 3U3JA 3LCMA 3KUCA 4C7OB 2NSYA 3A71A 4Y0VA 3OT1A 4M8SA 4N7MA 1OV4A 3FCUB 3JRWA 3I1CA 1Z4YA 3MYRA 4ZY3A 2TMDA 3KOMA 2OQVA 4KFCA 4JGIA 3SFTA 2EU8A 2H1FA 2IW3A 3A1EA 3Q15C 3OY7A 4KR9A 4ALIA 1SULA 4CV3A 1Y89A 3IEKA 1EVLA 1KHHA 2QTLA 3ESBA 3IT1A 2A7QA 4J7UA 2POCA 2ZJ3A 2RG1A 1IRIA 2FI1A 2XE6A 2YRFA 2ONZA 1C50A 3TDMA 2MYNA 5K0TA 3EPHA 5AM1A 3CH7A 2P2GA 1IQPA 3I01A 5B2FA 5E4YA 3UWSA 2XQGA 3GBVA 4Y0AA 1MHPA 2ZRKA 3GCXA 1WV0A 2OVBA 3CLRD 3D3KA 3R0JA 3FCXA 2WSYB 2ZCVA 3L8HA 3HB7A 5CRIA 3IQIX 3TL3A 4BLPA 1Z2AA 3NMUF 3K30A 1NQTA 4KGZA 1YI8A 3ZC3A 1YRHA 2JHPA 2ZI3A 2QXYA 1IY1A 4PG4A 4DV4B 1H2EA 2QLBA 1LPAB 1U0RA 1RNLA 2CDAA 2DCUA 2RGDA 2XLBA 2YYYA 3FUWA 4JWKA 1PDVA 4GZ5A 4Q9IA 3ZCXA 5B7QA 1CVRA 4ZV4A 4QNPA 1QIHA 3QI2A 1Y0BA 4Q4JB 3TIGA 2AMLA 3KQHA 4KXQA 1D0IA 3H1BA 5FORA 2HBZA 1OWMA 1IVDA 2CKMA 4JJEA 4V0QA 2C3YA 3LT0A 4R2XA 2DUNA 5CBPB 1JWLA 1YIAA 3IC5A 2HYIC 5LQKA 3WDKA 3DZGA 3HQ4O 2NO6A 3RVBA 1U3DA 3G8DA 2O0KA 4G5GA 4M46A 1NBOA 2I4MA 3ITKA 3NWPA 1KFJB 1P7CA 2Y0PA 4YAEA 5JYBA 2F8LA 4BAGA 1I7QB 5I8ZA 1XL1A 3R74A 2I7XA 3PE3A 3JAWB 1MR3F 4FNGA 4OHCA 3THWB 2WUEA 1XEXA 3JATA 5IC4A 1HTBA 4A15A 1G8MA 3C3MA 3S7TA 2OA0A 1YZQA 4CM3A 2CT8A 1DBRA 1H6BA 1R16A 1RKQA 1VHLA 2LVBA 2ZWIA 2B5OA 3JWGA 3OQHA 4NH0A 5D1NA 1BCRB 3QUBA 4Q15A 4DQVA 5CK5A 4IW3B 4IYRA 2G9QA 4PXYA 2FR0A 4CCAA 5BSUA 1DX9A 3L92A 4R3NA 4DMGA 4LFAB 3G5UA 3OG9A 2XY4A 4KO3S 5JS6A 1V45E 3D4PA 1JU4A 3G23A 3SLIA 1CJKC 1FMTA 5HIAA 2Q3CA 3KXKA 4G4JA 2H11A 2PUJA 3PL1A 1KSGA 3RO7A 4R5MA 1GRVA 1AGNA 1COZA 1Z18A 4OBEA 4ZGBA 4MW6A 3O26A 2WHXA 3OZGA 4OJQA 2HA0A 4TWIA 1WCYA 3UXEA 1D07A 3K6KA 3Q12A 4S24A 4AB1A 3FX2A 1B1AA 2G8LA 4XX1A 1XXHB 4HRVA 1VPVA 1ZXBA 4J8PA 3RSLA 3SMVA 3UEOA 2CMDA 2NN3C 4BE9A 5BXQC 1S8OA 1UOQA 1M6YA 1EJ2A 1U0SY 1Z08A 2C3OA 4ZU3A 2P5YA 3K53A 4ND1A 1NVKA 4J91A 3L4EA 5EKTA 3VA7A 3W1WA 1T9CA 3TSAA 1RMQA 3SYNA 1GQFA 4GT1A 2QZJA 3KZMA 3DV0A 2B61A 1YDWA 3O8DA 3TQOA 3N2KB 1C9NA 1RXUA 4XDGA 5TGTA 1QPZA 1GA6A 1MXFA 4BMXA 4B83A 3F46A 3K0FB 3LC7O 3FJOA 3LUHA 3DMYA 3NAGA 3TR6A 1AIPA 2O3TA 2ZTSA 4IY1A 3G68A 3FTPA 1M6VB 3SR3A 1H94A 3F3SA 4P84A 3WLMA 3VBCA 5JJLA 3K0AB 3A26A 2VUTA 1FNCA 4N3GA 5GX5A 3WDZA 2WICA 3JWEA 1NN5A 3U0VA 4C0XA 4PCUA 4LIPD 3KSBC 1KSJA 3NHKA 3PPVA 3TJMA 3ANXA 3PFCA 4XIKA 1RHRA 4O4IF 1P74A 1PGJA 1E94E 3SOVA 1W25A 2BDEA 2IOHA 2Y4OA 2VK5A 4YV7A 4EATA 4LE0A 1NNUA 1JHPA 3CT6A 2PKRA 4YT8A 1V1MB 4M0EA 5J58A 1JIJA 2GMWA 2HFJA 2MT9A 4FDVA 2CZGA 4RY2A 1GXSB 1T25A 4NJEA 3IPCA 1VSTA 2RBKA 5HUGA 3CUKA 3ESDA 4EIWA 1H85A 2D62A 2YASA 4ZICA 4CMEC 1NSCA 5DFAA 2Q28A 1J7JA 4MR9B 5D9CA 1JDTA 1UAAA 2HPVA 2BFOA 2SCUA 5FNRA 2YZ2A 4JP2A 5T64A 2GJAA 2QZ4A 3FB1A 3UJPA 1VIVA 1UBFA 3K09C 2JJ2A 1BC5A 1P4RA 1G1AA 2X6TA 4O4IA 3FDZA 2JAXA 1BVYF 1LBEA 4NMLA 4YUZA 4IMRA 3E7FA 1XMQB 5JSYA 3K1ZA 1FW8A 2AR9A 2FHSA 4ENUA 5JSUA 1XIVA 1QHEA 1EQAA 2GO1A 3L79A 1QZZA 1X8KA 3DP9A 3NHYA 4P3XA 3WKDA 4C7VA 4NOLA 4E4RA 1F06A 1CUJA 2XADA 4F5ZA 4MWZA 2H7VA 2ZRLA 3KZVA 3IAUA 4L4XA 4R7TA 4WLFA 4HFMA 5GOTA 1YD7A 3WA6A 4BVLA 4X65B 3CKKA 3A31A 3C16C 3WWEA 2AVNA 5FCDA 1E1KA 3HJRA 3S1SA 5EHQA 1QIDA 3P5BL 1GDDA 2C2HA 2EP5A 1KTIA 1POOA 3WYGA 4B6OA 4BHTA 2C92A 4A6XA 1QV9A 5CNMA 4RQTA 1YQXA 1Q0RA 2C94A 3ZHQA 2F25A 2XWBF 1BOOA 2R48A 2ZVPX 2RH5A 2GESA 2D7DA 2ZYTX 3LT2A 1I51A 3AR2A 4DBZA 5JYCA 4YAKA 3KQTA 4I8IA 5FDFA 3BCRA 3ZH9B 1HEIA 4NPCA 1DUSA 1L4EA 3D0QA 3A06A 4IQ4A 4V0KA 2FX2A 3AHIA 1CVMA 1SUCA 1SU4A 4N3AA 4JUAA 1AQLA 1JF8A 1EVIA 1K8QA 1W30A 2ZVQX 3JQQA 5AR1A 2XA2A 5EIWA 1PFYA 3GGDA 2W2LD 1D4AA 1TF2A 1SCUA 4KWCA 4XIJA 5TT1A 3R5FA 5BMOA 1IN6A 1O89A 2AZTA 1LEHA 1UKAA 2BGUA 1SR8A 4WLOA 3KTOA 2O8BA 4TN1A 1DT5A 4NZOA 2YZKA 1Q22A 4KVFA 2F28A 1CX9B 2EL7A 3CSDA 1YR2A 5IW8A 3S7ZA 1T8WA 1YDFA 5IH3A 2PXXA 4LN1A 5BR7A 1E2FA 4F1KA 3WZLA 2HIGA 1KZ7B 4FCVA 3BVPA 4ZPXA 1XMOB 4FTWA 5CNJA 3AERA 2VAQA 3EBPA 3KAJA 4LHVA 1F7UA 4IIEA 4EITA 2GCNA 2FP4A 3DOFA 1IMOA 1FFHA 4YLEA 1TUEA 2QTWB 4QLOA 1EWTA 5EP2A 1IHOA 4ZXPA 5TQJA 1XGKA 1M83A 4RJIA 3WX0A 4AECA 1ONPA 2W6ZA 4DG9A 1PV2A 3WYFA 2QP3A 4K9LA 1I4DD 1FNNA 1V3EA 1GA4A 2VSKA 1OA1A 1UUFA 2FSVC 3WOVA 4IOLA 3THRA 5LLDA 3JQRA 1HO3A 3FWKA 4JUIA 4AMYA 5C3MA 5JH7B 4KUHA 4LYFA 2GBLA 3BSWA 1NTRA 1ZW6A 3OKFA 5E7IA 2JLQA 1JMYA 2BISA 2WE7A 2WWRA 3B7EA 2YUTA 3R3VA 1M2HA 1DJNA 1GPJA 2MYUA 3BN3A 4YYZA 1CEQA 5LZ2A 2OR3A 3T5AA 2R84A 1JDVA 1NOIA 3F6EX 1KZYC 2R4QA 3DP7A 3G6KA 2QS9A 2PVPA 3FYUA 1XZEA 4MVJD 2OP0A 2A33A 4Q16A 5ILGA 1SIBE 5L7YA 4BL5A 2J45A 2H5LA 1PD0A 5EL0A 4DNXA 3N2NA 3CF0A 5CPBA 4HDKB 1BJTA 3K9HA 1TEVA 4OKNA 4YZ2A 2AG1A 2G5CA 3G49A 1PWZA 1X3LA 5DN9A 1RU3A 4DMMA 2ZTHA 1NPTO 4OHKA 2WPDD 4PS1A 3WTBA 5M3BA 4MW9A 3U3MA 1DJOA 2Q3BA 2ORVA 3DTVB 2F9LA 3R20A 1O54A 4KN5A 1HG0A 2EYQA 4N12A 4AGTA 4XQGA 1EESA 5DULA 1TKRA 1MGPA 3PLNA 1TTPB 4KJXA 2CW5A 1XF1A 3TJRA 1Z0AA 3LD9A 4Z9AA 5L6LB 3BH0A 3QVJA 5ADUS 1H6LA 1O96B 2G83A 2I76A 4DR6B 5EIBC 1FFYA 4CKYA 3TH5A 3C8ZA 4II7A 1PL0A 3T9AA 1L5QA 5BQOA 2WUDA 3O38A 4FFLA 3MTBA 4H3HB 3FH0A 5F2KA 5SYAA 2LCQA 5A9SB 2HDHA 5HX7A 1D9XA 1ZI0A 1UDCA 1WLSA 4P3YA 2D13A 1SVMA 3FROA 1YKSA 3DZKA 4MAAA 2ZZMA 3ALXA 3OCWA 2W20A 4I00A 1GQRA 3TNJA 4C08A 1OZAA 4TRRA 2XB6A 1U7TA 3VTAA 2JF0A 2ARKA 4FIZA 1L8QA 1T2UA 2FRDC 4MJXA 3V7WA 5L6MB 1JE0A 2G9RA 3DOUA 3NM6B 3L46A 2VF5X 4JP5A 1JNXX 1KJ8A 3GQBA 4Q4LA 4CIBA 4IGIA 2BM0A 5HGJA 1VM6A 3SCZA 1YNSA 1ZCAA 5LP1A 1FBTA 2LBPA 4UFNA 3BMOA 1CUDA 2R11A 1MAUA 1M1YA 3A4MA 1M2OB 4NQRA 4PYMA 2PU7A 2WJ3A 2CNOA 1QV7A 3OCXA 3ETCA 3O8CA 1P17A 2H9IA 4HG2A 3AEKA 4Z3DA 1JA1A 3PHIA 1VI6A 4YT2A 4F96A 1QUFA 4ARZA 3G2QA 1XNHA 1YAHA 4YAOA 3PDIB 2GJ8A 1PQUA 3A9TA 2ZGVA 5BN4B 2QBYB 1WUIS 3N7AA 2FF5A 4CKZA 1V8DA 1JHMA 3OPNA 4WESA 4CGYA 1KJZA 4DLZA 3HO8A 1QHGA 4U7DA 3OZFA 3J7AC 1ZH0A 2BBOA 2FEKA 3FNEA 3KKEA 3JR3A 3B2NA 4DANA 3FVVA 4TLLB 1H05A 1ZJJA 5EZSA 4Q03A 4P2GA 5EXDA 2Z2XA 1J42A 5E9WA 1QF6A 1IM2A 2GJSA 4EKNB 1U3VA 2FZEA 3CW9A 1FUUA 1TECE 2JZOA 3BYZA 3KZ1E 3T7AA 2CLIB 4EY8A 3D0KA 2WF8A 3DWGA 3QPUA 3MT8A 1LC3A 1PS8A 2DPYA 1JI0A 2CFCA 3RANA 5AVQA 4LWOA 1N2OA 5FXMA 3Q6KA 5IKPA 3DO6A 1BZYA 3EN0A 3EZ6A 3SOZA 2JHGA 1OGYA 3EA0A 1TVKA 2WSMA 4XWKA 3ND6A 3RFFA 3K36A 4FFDA 1W29A 2CNLA 1P1RA 4L27A 4RAQA 4G5FA 4AIIA 3N8IA 1RHKA 3MBOA 1F8DA 1W88B 2GK7A 3IUBA 3UCFA 1NASA 4JHLA 4CLHA 3RRXA 4I9HA 1CRWG 3CR8A 4XUEA 3COYA 4QULA 2ENUA 3ZCUA 4F5DA 1TKBA 5HOEA 4JMPA 1E3QA 3T35A 3URKA 4PC3A 2C88A 1B74A 3HDVA 3MMXA 2P1ZA 1EUUA 3RU9A 1N1MA 2QWAA 2CJWB 2QMEA 2ZDHA 3CRQA 4FLMA 4R1NA 4E7OA 3GEDA 3IPAA 4NRDA 5EPUA 3VDXA 2WJ4A 1H42A 4EECA 4RKFA 3R9KA 2VYFA 1BROA 4GOND 2R8ZA 4YW3A 2E87A 2UVPA 2J3EA 3LAWA 4XCXA 2C7PA 2DF8A 3LCJA 2YY5A 1V2IA 1HNNA 5FWYA 2JBAB 1DARA 1L4LA 1YKGA 3L40A 5ALSA 4MVJH 5F2NA 4FP2A 4KQJA 4P6VF 4CMBA 1S2IA 2B36A 1XNRB 1AM4D 4NI5A 2RHRA 4TSFA 3A1WA 3N5KA 4RA9B 1ZAYA 4CL0A 3AUYA 2EF0A 2FSFA 1UMCB 1NLUA 3CURA 4JLOA 1O4VA 3TI5A 3GH3A 4P33A 4OXIA 4WCFA 4M1QA 4BXOB 4PQFA 1CY2A 3RSSA 1F5NA 3EAFA 1Z4WA 4TL9A 2YC2C 3GA5A 3ZW9A 1C9YA 2YFQA 5GY7A 2EBUA 4GXQA 1W6RA 2BGLA 4UVEA 1QG0A 5DNDA 3WMEA 2PGAA 4YRPA 2PUGA 1XTSA 3MWDA 5JHHB 2XRMA 3O94A 4ZYYA 3DBHB 1FPQA 4TVBA 3V8MA 1W0JA 3IL2A 3QA9A 4H6WA 5A0TA 4YRDA 4ZT2A 1FNSA 2H1RA 5HCUA 1GSHA 4B3RB 2PAAA 1FU7A 2AK3A 4E31A 1BN6A 4QN4A 1GL9B 2IF0A 4ODIA 4Z4QA 2R6ZA 3ZV3A 1SUEA 1Q0ZA 1BOFA 1XZAA 2RAPA 3W8EA 2PUFA 2P79A 3PUZA 1D2EA 2DG2A 3P0IA 4OQFA 5K45A 3V8RA 1IZYA 5A3VA 4BLQA 4FPHA 3COPA 5CGZA 4LJSA 2FZ4A 2XTMA 2J0UB 3HM2A 3ETJA 1UR5A 4D4MA 2Z6UA 3JQ7B 2HADA 2VHJA 3CGGA 3K0EA 2J3QA 1Y6GA 3DE0X 3LL4A 4EX6A 3NPAA 2HWYA 3UC1A 1T2FA 2OECA 3E81A 4LNAA 5LU8A 4B4WA 1YDMA 1JHZA 4WXPA 1GSOA 4KR6A 2YMQA 5FOWA 3ZD8A 4PYIA 1VHWA 4CQMD 5KNBD 2CCGA 5ELLA 4K3VA 1L8OA 4IVNA 1W8OA 5AM0A 1QNFA 2G80A 3LUGA 3MWKA 4Q1AA 4WFKA 4AJ1A 1M1YE 3QE4A 2C7RA 3T15A 1YZFA 1QWOA 2WYWA 3NIBA 4LXYA 2C9MA 4NABA 3U4AA 5HZKA 3AVWA 2QB5A 3TLYA 1OB2A 3ONEA 4YRMA 3LUPA 4PIVA 1CQ1A 2IZ6A 4QEKA 2O0HA 1NVXQ 4TTTS 3LL7A 4UW9A 4B87A 4X1YA 5DHAA 3T1YB 3ZZUA 1FYWA 4DLYA 3GIWA 3N59A 1P7ZA 2A9KA 1YFZA 4M3NA 5KJEA 1REQA 3K6RA 3E27A 4X44A 1J8MF 3RS2A 1KXJA 1RAGA 3TPZA 4HNSA 4CG3A 1CYEA 3JPYA 1SOWA 3PKJA 3UJBA 2NT4A 4GZTA 1TLLA 1VCNA 5J23A 1E5VA 4IHKA 3LTNC 2GM9A 2MSNA 3DC2A 3ZBUA 1Z5GA 2PO5A 3IJ5A 1Y9AA 2GAFA 4QDZA 3HL0A 1U98A 1ID8A 4YACA 3TCKA 1H93A 1OW3B 4W6ZA 3FKJA 2KLBA 4D4GA 3R7FA 3RKSA 2GLTA 3TQHA 3X1ZA 3R1IA 3LBIA 4DXDA 5B1IA 5K6TA 4JB3A 3REGA 5FQNA 1NPDA 4M4UA 1FQWA 3ABIA 2GZ3A 4R01A 4S0ZA 5TE9A 2VTVA 2R87A 1EG7A 1WDLA 5AM4A 3T61A 3A9GA 4Q9AA 1ZD9A 3C8UA 4IIVA 5B1HA 1K7EB 3IPRA 1X9IA 5GV8A 1X86B 1QNLA 3QPCA 3CLTD 3VZDA 1MORA 2OXCA 2YIVX 1CQPA 3DVAA 2A0KA 3L49A 4H08A 4UHFA 4WI1A 3HCDA 4Y6RA 3UMSA 1L4BA 3QW2A 4PX3A 3ICWA 2VC2B 4C89A 2ZJ6A 2YVUA 1JZTA 1T3TA 2VXCA 2IARA 3AHJA 3Q41A 4G8CA 1M7GA 4HDSA 4XQ0A 5A5EA 5K01A 3RKUA 2O23A 2HR1A 3F3YA 4FPKA 1EINA 1XF9A 4M89A 4GKJB 3TLGB 1DP4A 4OBXA 2QSYA 2HCTA 1GOTA 4IEIA 2AWNA 1GLVA 3BB1A 1NN0A 4R41A 2A9QA 4D4KA 1KZGB 2PGJA 4GE0A 5CITA 1WY5A 4P81A 3VSAA 2ZYDA 2IAXA 4P58A 3C48A 2JLWA 3RBZA 2HWUA 3JQ9A 3UT5A 4MIEA 4YROA 2ZI9A 2QY9A 3VPBA 2RIRA 3HVHA 2DERA 2AH2A 3PXDA 4G5RA 2GN0A 2J85A 2GRAA 3QEMB 4KBYA 4LYHA 1EHYA 2F26A 1HEYA 2Z6VA 1IBCA 2BF7A 4K2HA 2PL9A 2RH8A 2VEOA 4ZQHA 3T5TA 4D6XA 4Y2UA 5I7FA 2JD1A 3GMSA 3ZQ6A 4D9MA 5IT5A 2O59A 2I7CA 3PQ2A 1CUVA 2D5LA 1IOVA 2ECQA 4ZANA 3HM9A 2HQ1A 1UEXC 3IP8A 2P6NA 4D97A 1KA9H 2EVWX 4D56A 4M3MA 2GVNA 4WEQA 2FWPA 4KC0A 3WAKA 3ORRA 1H6AA 1OJLA 1Z4IA 2H51A 1DTWB 4HIZA 2QLJA 2WT9A 3HWSA 4BB5A 3GLRA 3TYXA 3ZKWA 2XZPA 4YP5A 1Z8DA 3S2FA 5L3QB 2FZVA 3WB0A 4P5EA 1YOVA 3ZIAA 4J0GA 2O8DA 1NXPA 1X1TA 1X80B 4QGHA 5CLFA 1NR7A 1UPFA 4LRWA 2FHRA 2QN2A 3P9SA 1P60A 2BFBB 1PWYE 2XECA 1GLNA 1HL3A 1HETA 3D2AA 1X1DA 3JZAA 2EARA 2IODA 4J49A 3ZWOA 2W42A 4DCCA 2UZ3A 4LZAA 3UV7A 3RIGA 4FYIA 3OF2A 3H3JA 4G1UC 3UJAA 3OEYA 1FLDA 3LG2A 2GB4A 2IU3A 3O82A 2X9VA 3WJAA 1NW5A 5EJGA 2Q4TA 4ZVRA 1V8OA 2C29D 1FK8A 4LF9B 4L5CA 1EBFA 1N8NA 1XP8A 2WUFA 2DHDA 1JT9A 3GDFA 5COQA 1WUJS 5AKKA 4IFEA 1OILA 2AD1A 3Q0EA 5HJEA 4BN0A 3VYTB 5KSWB 3TM4A 4X64B 2ZUSA 2PL5A 1LDYA 2B8TA 3K5IA 5AYVA 4DM3A 1A14N 2BF4A 3AL2A 2F00A 2VK6A 1SC6A 4UTOA 1TZKA 5TJHA 1JBQA 1CDEA 1XZFA 5KNBH 1CJSA 4HPWA 1V35A 2OMKA 4EJMA 1FDOA 2VATA 4LVCA 5HR5A 2QVCA 2X9QA 4UU8A 1YS2X 3C4VA 1FMJA 1Y9ZA 3SOBB 3WK5A 2L2QA 1Y4SA 5C35A 1FTYA 1GFZA 1UDWA 1A97A 2EHJA 1E79D 4OGFA 5DP2A 4JZKA 2XCLA 2QKYA 3KLMX 1Y1KE 1T1IA 4QUIA 2YVLA 5BQ3A 3H0KA 3AVXA 3DYVA 2JGDA 1U7DA 3A7DA 2GPTA 3GROA 4LY3A 1AS0A 5DHFA 4UUPA 4BJ1A 2ZM5A 2IZZA 3OZBA 1HE8B 3INTA 4U8GA 4ZYVA 2X4IA 2IUSA 1EFHA 1PYOA 3CB2A 2W6JA 2E6UX 1P19A 1N0IA 4QDXA 3ZHZA 2YMMA 4A73A 1FVHA 4AS3A 4B76A 4D26A 1ZKDA 2HF9A 2BFFA 4XMBA 3W4IA 4ATNA 4QBIA 1M66A 1H22A 3LDGA 3TQTA 3A58B 1NCDN 1QMPA 1XO1A 1BWPA 1LI7A 2CF6A 1A9PA 3PF9A 4FP9A 4UNQA 1H3EA 3ZQUA 3KD3A 4ZCSA 5I4CA 1T9AA 5ERGB 4DREA 2WUVA 2JLCA 2VW1A 1YVDA 4X4AA 4FJ2A 4O2AB 3WQSB 4BLWA 2XMPA 4ROSA 4L02A 4HI0E 3A6KA 1O95C 4M22A 4AD8A 1QP4A 1BHJA 2C7BA 2XHZA 1E4OA 1L5MA 4M98A 1DQPA 5K8UA 4IVPA 1M6EX 2QUKA 2I33A 3OTGA 3Q9UA 3NC0C 1YJ8A 2OHOA 4KS5A 2HHLA 1IOLA 1M0TA 4B80A 1WX1A 1KH3A 3DYBA 2NV0A 2GHRA 1YIDA 1Q1QA 1X9HA 4N5HX 2BFAA 1HG1A 4LOLA 1S1DA 4RORA 5B4VA 3IV9A 5NN9A 2IYNA 1OTYA 2P67A 2PKWA 4BUJA 1RM5A 2O2CA 5D01A 3TG2A 3L9WA 5JFOA 1EFVB 1ZJ6A 4UQLA 1EK0A 5HKKD 1UJ6A 3FPAA 4LRUA 4EUSA 2JJYA 3R23A 3PD0A 3QLUC 2G5GX 2GTIA 3FCAA 2X0IA 4FEGA 5LWHA 2OFPA 3JVDA 5C51B 3EGIA 2PXAA 2GCGA 5CMLA 1XDSA 4I6JA 3VOAA 4KQHA 5KYTA 1UXJA 4K9QA 4WUTA 4Z53A 3D3QA 3RSGA 4DMFA 4DR5B 1D5CA 1UMDB 2PX8A 4I46A 2R5WA 3AQ4A 1E0AA 4KS4A 1PTJC 1YS1X 5CCBA 4G0WA 5H4HA 3TOCA 4FYPA 2VR1A 2AOTB 2ZB5A 3AP3A 2JGLA 3K4HA 2JLXA 1N6FA 2IY7A 3GH1A 2WJVA 3M6VA 4FILA 1NY5A 4FN5A 1KQNA 5ADVA 1VCHA 5DISB 4I1SA 3FLMA 3V1MA 5GONB 4BJHB 3G2OA 4RVOA 4ZGGA 1TC1A 4BMDA 2AN1A 3KAQA 1GG8A 1RYHA 2B25A 4XGNA 4B0PA 4OKSA 4F2WA 1Z2NX 2GXUA 4J0DA 2XGJA 2KMLA 4M2LA 1RTKA 4X20A 2G0AA 4ETNA 3N8GA 5BQFA 1M2VA 1ZM7A 2A9FA 4LZZA 1OH8A 4GL4A 2D7JA 3M0EA 5THKA 1D03A 1Z5WA 2GI4A 2ZI4A 1FDTA 2ZRFA 3IODA 2ABWA 1JQDA 4J3FA 3TGLA 2H31A 3DHYA 4JROA 2V7XA 5C3UA 4FZ5A 4K9SA 5LIPA 5KQRA 3IAFA 2XCOA 3SZGA 4CEHB 2PYZA 1CDOA 3Q6NA 1E1RA 4WNCA 5LQRA 1M34E 3C43A 1TM3E 3DZCA 3FCOA 4CKWB 4F9EA 2NTNA 1XWIA 3KT6A 2Y1GA 3S3TA 2XQVA 1U0HC 3EQZA 5JTUA 3VH4A 1OT3A 4MJLA 4ASUA 3AHDA 5DTMA 3RC1A 3RUAA 2HU5A 1ADYA 2CLLB 1B8OA 1DCKA 1CUGA 2Q29A 3DOEA 3DSRA 1G41A 2VSYA 3HUFA 3AHEA 1KITA 1A8IA 5HQ3B 1P3Y1 2BR3A 1ZS9A 2ZJ1A 3FDIA 2PPVA 3G1WA 1SQGA 3SQOA 4MZXA 4LK2A 3RODA 2AOWA 4HAZA 4V1CA 4NCAA 2PSFA 4XIFA 2VCEA 4KMOA 2R00C 4JVMA 4TXNA 4YJGB 1XTZA 1I6WA 4M9CA 2IPMA 3SHQA 1CYDA 4UOQA 1MX1A 1SD1A 1TO1E 3L18A 4D0NA 1EUDA 1G8JA 3GC6A 1XTKA 4LRQA 4ZCIA 4JL8A 5BT9A 1E3DA 2OCPA 3MJSA 5BVGA 2LCIA 3AVQA 3OEWA 2YY6A 1NFRA 1N34B 1XDZA 3CKYA 1DEOA 5BWBA 1SO7A 2NO9A 1DBSA 1QO7A 2PBZA 1WB6A 4FGWA 4Q3BA 3QBEA 1GTJ1 2ATXA 3OQJA 4NIMA 1XHEA 1BD4A 2IPXA 2O7NA 3KKZA 3U31A 3VHLB 5C8ZA 2GEDA 4HKTA 4PR3A 5D5PA 4MARA 4V39A 2OV1A 2FRXA 1MAAA 3B6ZA 2H54A 3MF4A 3ZE0B 4EHIA 2F11A 1N2HA 1ZIOA 3SX0A 2IYFA 2WJ6A 1H2RS 3ZGXA 1QE3A 1Y37A 5JATA 3GD7A 1GKKA 2JW5A 5CD1A 1BDIA 1I80A 5CVDA 1T5HX 4CTMA 2VDJA 3AR7A 1PX0A 3H97A 3MCAA 2DTXA 3ESQA 2Z5LA 3RTBA 4YMLA 1OX4A 3O2QB 3D4LA 3OWHA 1L1RA 1G8FA 3MIIA 3TW8B 4ND5A 2YKGA 1ESCA 3PZBA 4J7CA 2YH2A 3UAXA 3WL4A 2NYRA 4K7JA 3WHLA 2BTOA 4AJNA 3EMVA 3M5PA 4EB3A 2K5UA 3CPJB 1E5XA 3O1HB 3TZHA 1N2CB 3IKMB 3K3AA 3Q6MA 4JAVC 4PYQA 2NZWA 5CB8A 1QP7A 3RYCA 5IF3A 1I1QB 1J9EA 3R7AA 2C4UA 3V1UA 3GWZA 2HC9A 2HJVA 4CLOB 1PEDA 1OMOA 4LOKA 5AHRA 3TZQA 4Z3KA 1L8XA 2FVYA 1FDWA 1ODFA 1UPXA 3WJ2A 1SUBA 1YA8A 4J7AA 2YQZA 5EJ2A 4EF6A 3FVTA 4ZFNA 2B4RO 5EHGA 1TJNA 3VTKA 4BEJA 3GP3A 1IQUA 4RSHA 1AF4A 5BYKA 1J8VA 3U60B 1HGXA 1GAJA 3QSYA 1FUIA 1V8ZA 1X7ZB 3EFHA 2A9RA 5FA6A 4TM8A 4HZXA 1O2DA 3U4HA 2VBFA 1F6BA 3UWOA 1GITA 1KBQA 1KZ9A 2BDUA 2ZBGA 4Q1UA 1Z8HA 3DYIA 3I9NA 1W4LA 4YECA 3U3RA 3H9BA 3VC2A 2WWYA 2ZRJA 3OA0A 2V1UA 1W2HA 2PKCA 4ZLRA 4DEVA 1NN3A 3OKAA 4QFBA 5C37A 3LI4A 3BXEA 2O1SA 4P98A 2X0FA 4C76A 5L45A 2XXJA 2NPIA 4LRXA 4HQFA 5TPZD 1ZCFA 1U94A 3DMTA 1BRMA 5DVZA 1KI2A 1U1CA 4HVCA 3T34A 4Q4JA 3C5EA 3JAMA 4RETA 4KPUB 3CWCA 3L0IB 2BFPA 3ITNA 3W2GA 4GVLA 4QWWA 1OU4A 2GF0A 4GLJA 4R9UC 3UC9A 2J5BA 2QAIA 3I2FA 3L01A 4BO0A 5CBPA 4ED9A 1QP8A 2GCPA 2YA5A 2Z4SA 3AOGA 3IQHX 1Y63A 4BQSA 2H1IA 4AZ3B 2CEAA 4LHEA 3KLPX 4RIFA 3H2YA 2WDPA 2FW6A 3C24A 4TROA 1ZQ9A 5FNTA 1G8YA 1R5OA 1NUHA 2Z08A 3ANLA 3FN4A 3KJIA 5H80A 3W06A 2I6UA 3JAWA 4YK7A 4ARBA 4CTNA 3G2LA 4BV9A 3GJSA 1T5DX 4F4HA 4KQWA 4V0NA 1FEZA 3WQRA 3A25A 3X1MA 2QWJA 3UPTA 3U0SA 1HLPA 2H4FA 4RTPA 4ABTA 1BCRA 3QNMA 2DWOA 4NZ9A 4P32A 4AJ9A 2YJ5A 4QDTA 1Q74A 3MZ0A 2B2CA 1LQUA 4JQCA 3U09A 3D6NB 1EQUA 1VDZA 2J31A 3E2IA 4Q7LA 4YUYA 1L7PA 1KRWA 5DM1A 1H4VB 5KTPA 3O8NA 4D4IA 1EFDN 2HEIA 2MSEB 1MS1A 1XK6A 3BJMA 4TL6A 5I9TA 3K16A 2HXGA 4IOKA 3CW2A 3OCUA 4O33A 3V1LA 5J4LA 3QU4A 4M0DA 1E2KA 1ZSYA 2RGNA 2BAGA 3OCCA 1XXHA 5LQNA 2JIPA 3QBJA 4D3FA 2I1VB 2OO7A 3BK7A 3KB8A 4JI2B 5ALEA 3WYNA 2V58A 4U1RA 4M88A 3RC2A 1Y34E 1NLMA 2CZQA 4NPHA 5FOSA 3EWSA 1YC5A 2PRKA 2C77A 4JKIA 4CKEB 5HSGA 3LF1A 4FPJA 3A1DA 1NVDA 4KQ6A 1BE1A 3DZFA 4P31A 5HIJA 5KQLA 5BRAA 3N2KA 2PWBA 2JIQA 2ZANA 3FVQA 1ZN2A 3G88A 4GPEA 1VOTA 4Z4GA 5AP9A 3K0FA 3EGEA 1DELA 5I51A 1M6VA 2ZUVA 3KQOA 3Q0IA 3PXCX 3C8HA 3K0AA 2ORIA 3OQBA 3AUKA 4J7XA 3FHCB 1AA6A 1KERA 1MJGA 3GCDA 2JS7A 2CUKA 1KK0A 1QAQA 5AI4A 1ISRA 2B78A 3AFIA 2OZKA 2PBFA 3BEOA 4ZAFA 1BMDA 1GY8A 2QQGA 4DJJA 3BH7A 2G8SA 3UM9A 4MV8A 5TF0A 2B8WA 1P4SA 4M0FA 3ESAA 5F77A 3BHMA 4G0XA 5E2AA 3L05A 1G66A 1YMVA 4IP0A 4J0JA 4K2AA 1ISHA 3SC4A 4E2YA 1GXSA 1XJ5A 3DUWA 3FZEA 2C8JA 5C1IA 4PBTA 5A4MS 3JZIA 5GX4A 2QDXA 1WEKA 4G8DA 4MR9A 5DB4A 4X1IB 2FSUA 1GZ6A 3HCWA 1X1QA 4A2WA 3ASVA 3UUEA 2J9FB 2IXGA 3RUPA 1U2SA 2PG3A 4K0RA 1B8UA 2AXQA 4U63A 1JA9A 4H77A 1Z0SA 5TARA 3VR3A 4B47A 4J75A 4BMZA 4F4CA 1P75A 1JR3A 5A0FA 4QLBA 3ZE9A 2UXCB 3DVQX 3ZWQA 2E5WA 3IRVA 4IJUA 1NV8A 3DPSA 4CG2A 2FW9A 1TVCA 1FMLA 4QN6A 2XSZA 2GGSA 1DWOA 4KGVA 1C7IA 5M5BA 3EVCA 1BGXT 1AE1A 1K0FA 5KTOA 1EK2A 2G1AA 1SZPA 5K4AA 2NZVG 1HF3A 4G36A 5FUXA 1EWRA 1G64A 4HV4A 3Q98A 2QN8A 1VYVA 4ZVKA 3PVZA 2WTEA 3PIIA 1C3LA 2OK8A 4QATA 2A0FA 2N9UA 3DHVA 4HWOA 1FTWA 1JJ7A 1VMIA 3NT4A 1JN0A 4XSVA 5GZ1A 4KE6A 1OCEA 3E7DA 2A35A 1Z6ZA 3H3FA 3SU8A 3U0BA 1RLMA 4JHXA 4WBNB 3ZDCA 2ZSIA 1RKBA 3PXBA 1QO0D 3L0ZA 3O4PA 3PC7A 2CYCA 2JKVA 3FFXA 1CUZA 3MTQA 4KV7A 4X91A 1ZYUA 5AESA 3ZGZA 2VJNA 1EEXB 3EBLA 1P18A 1XB2A 2CXRA 1LW6E 2VP4A 3O4GA 3QUCA 4I4LA 3OUUA 4WMLA 5HRCA 4AKIA 3PFFA 2YTZA 4KDCA 1DFGA 4UCQA 2VBGA 1OF1A 2D1SA 3CBGA 2ILTA 2LCFA 3Q4GA 4LHYA 3LUKA 4IDFA 1BCSB 1W8IA 2BIFA 5GX1A 4B5KA 4F6RB 3E22B 2BFEB 2O52A 3TW0A 1YZTA 3U48A 4P4UA 4PPFA 4IV8A 2NSHA 4FOWA 4RE6A 4IGKA 4HMQA 2I6QA 5DI3B 2HSEA 1C30B 1QYCA 4CLEA 1BVUA 4PXAA 2FHPA 4U3JB 4CVNA 4URWR 1TCCA 1XTRA 4J0CA 3DULA 3TPFA 1F12A 3QELB 1KIFA 3JTEA 1GADO 1I3LA 4S2UA 3RTAA 5K8IA 3KUKA 3PBKA 5YASA 3HBJA 2QUIA 3KETA 1DT3A 1GPH1 1HPLA 2CY0A 2EXXA 3HRKA 4QVGA 1HTTA 1TD1A 2YINC 4HZUA 1QAMA 4K46A 4YZ3A 1E8TA 5JH7F 3RVJA 5I6DA 3HKEB 1PT5A 1N5OX 3HY6A 1OZ0A 1H66A 3A28A 4FLEA 5EUBA 3QUAA 4IF6A 1J24A 3SRGA 2CVZA 3BSYA 2XEXA 3H1AA 1MC8A 4RMJA 3PWSA 5FNSA 2P91A 2XOKA 1U31A 4ITRC 3ZCVA 1UM9B 2A9JA 3HCOA 4DDTA 3NCHA 3L0BA 3RGGA 4FDUA 3WYDA 4QEZA 3UBTA 3A32A 1D5WA 1CNFA 4JC0A 1VXRA 5IT0A 1M8KA 1P7PA 1CVIA 2Z2KA 3R7BA 3SBOA 4QT0A 2EZ4A 2NXNA 1XXHE 1EP9A 4CEIB 3BRWD 3SD7A 3TLAA 3VJMA 2XUPA 4QL3A 5U1PA 4BKPA 4YO8A 1EU1A 5JH7A 1SXGA 2I67A 2ZIEA 1BSVA 3QTTA 1KQGA 3X1DA 1DWUA 3ZGLA 2DHQA 3V4FA 2Q49A 4G56A 3VPSA 1ATIA 4PY2A 2V65A 1CR2A 1KK2A 1FYVA 4FGSA 4XVCA 2WF6A 1AVTA 2NZXA 2EV9A 2PZKA 3IIMA 4JT8A 2HA4A 3RVRA 3FA2A 1CUIA 1M2EA 2YQ5A 3GVHA 1XZDA 4K6GA 1C80A 2JLBA 1W36C 5LPNA 2B0JA 1V0JA 5CCXA 2VSFA 4ECAA 3NKFA 2PT6A 4XUGB 1UFOA 4L72A 1ZD4A 2ZTLA 3AI1A 2J41A 3JSAA 4PF1A 1WE2A 4HDKA 1J99A 1I4OA 1T0JB 5DE3A 5AOCA 4WK0B 2VKTA 3RFVA 1MJ5A 3PGLA 4BN5A 1I9GA 3KX2A 5K0LA 4HUTA 1XRLA 3G5TA 3ZU5A 2CD7A 4YZ4A 3G4HA 3AEYA 1P2GA 1D6JA 2TRSB 3IIJA 3Q10A 4MVJG 4X95A 4H35A 2CCJA 2E18A 3EHEA 1O57A 3GGOA 2VPQA 3A6GA 3PHJA 1TLTA 1GYPA 3SBXA 1QFMA 4EW3A 5AW3A 1IDN1 4KR0A 3JQBA 5F7OA 3R76A 2NMVA 4GJTA 1BQ3A 4WNYA 1DQSA 1BKSB 3OT4A 4MNTA 3KCQA 1F8YA 2GETA 5ENVA 4IJWA 1O96A 1ZRHA 2EDCA 4R68A 3WIVA 2ZT7A 2EIXA 5JBQA 4QOGA 5AQ1A 4MB6A 4KH0A 3W79A 4GPTA 1B9VA 1X7YB 5FNUA 1QYIA 4ZGWA 4GZ6A 4NNPA 1E1DA 1ZVJA 5FBZA 1P9LA 1U04A 1EPUA 2HWKA 3B6IA 4L8LA 4W1QA 5C31A 3I5MA 5EXSA 4FONA 5ALQA 1G5FA 2XOXA 5F7ZA 1ZNWA 2Q46A 1FYFA 2ZJBA 1CUCA 3DL0A 2XMBA 2EFJA 2IZ7A 5EUCA 2VZ9A 2ZR9A 4LOAA 3CVXA 3VKVA 4RK7A 1E5LA 1L7FA 1K5GA 1UZUA 2C31A 2P2DA 3TRIA 2GF2A 2P90A 2M32A 2VK2A 3TNYA 3S94A 4E5VA 3GU3A 1QPGA 1P80A 4DLRA 2GKGA 2XXBA 2OCXA 4OYYA 5F7XA 1UQTA 2P75A 1M2OA 5CT8A 4P0PB 1L4KA 2JIRA 4HDRB 5EJIA 3OZIA 4REMA 2G09A 1IZZA 1IUBA 5DGHA 5F3RA 3AR4A 5AXCA 3D12A 1IQ0A 4X3OA 1JE1A 3EFOB 1TA4A 3PQ6A 3DNFA 1GZVA 3ICVA 3AHHA 4HZIA 3DFZA 3PDIA 5CLIA 3IUYA 1RWNA 1PR9A 1RVV1 3HNPA 3LSYA 3QRWA 1A4IA 4X1KB 3ZJ5A 5BN4A 5BSKA 2QBYA 1Z4VA 5BW6B 1YZLA 3ANMA 3ROQA 3TDKA 2X9GA 4ALKA 4ISCA 5JXIA 4MPPA 3AXTA 4PN3A 4AKEA 4XQCA 4ES6A 1MVNA 3ACCA 4U2FA 4K81B 2RGAA 3BM5A 5CXQA 1HOXA 3GOHA 2VOEA 1GQQA 5C9ZA 3KVRA 4AZWA 3R7SA 2D0PB 2AFIB 4K1XA 1SKYE 1X2EA 2VF8A 1NNSA 2WTUA 1C41A 3C1AA 2AG8A 3HXKA 1EQ2A 1HDOA 1Y6ZA 3U3ZA 4PQGA 4A0QA 1N2XA 1FJGB 1A9QA 2ORED 3Q7IA 2BE7A 3HYRA 4ZCPA 2C82A 5AIBA 4CIDA 5JWOA 3PD7A 2ESRA 1NDHA 1TXGA 1Y81A 4RUKA 1AG9A 4A3SA 4DDUA 2C9DA 2VK1A 2RARA 4LGVA 1Y7PA 3VNSA 4F4IA 5KB3A 1NR1A 1A4GA 3P9PA 4IX1A 5TR9A 1GUDA 1G20B 1FLAA 2IEDA 3LVQE 3OPVA 3Q3JB 4M1EA 5FAXA 1EEHA 3LLSA 5CJPA 4CDNA 5CYGA 3AY3A 1K8RA 4CTKA 2J5KA 3TTWA 3D54D 2UYGA 5FYQA 5AW0A 4KO1S 2OAP1 5C7OO 3NOXA 4BP9A 1SU7A 1V04A 3MVEA 2ZRPA 3JYHA 2JAWA 4KK4A 4OAPA 3USCS 4ZJUA 1YB4A 4C4ZA 3RNOA 1ND5A 1NM5A 4MS1A 5BR4A 4O4JB 4GB1A 1M7BA 4QAJA 3WBFA 1EXVA 3GFQA 1H2FA 1KVRA 2CJWA 3OFJA 2G72A 1RCUA 3K9WA 2FSIA 4M99A 3K5WA 4X92A 4FN4A 1K32A 1UKYA 2PWYA 4XJRA 3PQ4A 5B4UA 1X87A 1KEPA 1RWBA 3BFJA 1JHDA 3ZW7A 1T0PA 2XUGA 1CZKA 4LDAA 3CLKA 5CT6A 3WHKA 1W0KA 2WKRA 2BJHA 2VHUA 4CEJB 4HLNA 5ULLA 1QRSA 2JBAA 1AD2A 2GCEA 4L4UA 4XJUA 4CIXA 1Y1SA 3IEVA 1JECA 1FU8A 5KJ6A 1Q0HA 3AEQB 4RK4A 3F4BA 2R6AA 4TYPA 5JAMA 1QK5A 1JMKC 1CZLA 2PKYX 4RA9A 4B35A 2HT1A 5HJ2A 3WBBA 1UMCA 2RI1A 1KH2A 4FDLA 4ZVNA 3ZDQA 4F3NA 3ADBA 3EX7C 3SI7A 1KMCA 4QSHA 1GM5A 1C9KA 4ZTBA 1SELA 2FR1A 3U44B 4QUHA 3NBXX 3GZNA 2PRYA 5FI0B 4C0KA 4QYTA 4DPLA 2XOEA 3CZPA 1NZJA 5D7NA 2R8BA 3TNDA 4EUEA 4R8VA 5B5SA 3BUSA 4UAJA 1DTSA 4EPVA 4GQAA 4NJOA 4X0EA 1QZTA 2BKEA 5KJFA 4GF5A 1AQNA 3DBHA 4N39A 1JAIA 4U39A 1RS0A 5K8JB 4WPGA 3D59A 3I6ZA 2CMKA 2GOYA 3UENA 2D0DA 2ZWVA 4EF5A 1S1MA 1SHKA 4UMEA 3SF8B 2ZAMA 3KL2A 5EIFA 2GBLC 4FOLA 1QQAA 1E0SA 3A6PC 4GGOA 4BV8A 2P3SA 3GFGA 4NFLA 4UC0A 2VTDA 3EXEA 2GPAA 1H5NA 1OVGA 2EFHB 1G38A 1U6DX 3DW1X 3H11A 3Q7EA 4AHAA 3D43A 2ZYHA 3TLMA 2POQX 1BXRB 3TI3A 3D2CA 3NX4A 3FYUC 3PC4A 4C2AA 4D9JA 3JQ7A 4E5NA 5AKZA 4WTOA 1IWPB 4MA0A 3OE7A 1KEEB 1SQ0A 3ZWVA 3K0KA 3VX3A 3RVLA 3HBNA 1SM4A 1A9OA 2TS1A 4JI8B 1H8ED 3CT4A 2PX5A 4CMIA 4XJVA 4M36A 5TEVA 3R7LA 1KJWA 3OH8A 5M2QA 3PEEA 5FPSA 5EIAA 3SOPA 4YCLA 2IYOA 2OYCA 2YXBA 1MT3A 3NB0A 4K6KA 3COWA 3X43A 5FTMA 1KP3A 3JY6A 4XM0A 1ECLA 2XCUA 1Z4OA 4UM5A 4DLSA 3WXMA 1XTPA 4P53A 5FL7A 3NORA 1CQIB 2F1RA 1SC1A 3FJ1A 3PGMA 2WA1A 1JHUA 1ZISA 4I4TF 4MWRA 2ZCUA 4G1FA 1AURA 2IYSA 4YGYA 1N7IA 1QFJA 1Z35A 2H7YA 3H0CA 1IZ7A 4LKRA 4TV8B 3IYLW 2CV2A 4N7JA 4DR4B 1KE2A 4FPCA 3FFBA 4Y98A 3DMFA 5JRDS 3OLYA 2VCYA 3H5TA 1SIWA 1ORVA 5PGMA 3OJ0A 5IXYA 1PDOA 3E61A 4EHKA 3WGMA 5K2MA 3ZTYA 1ULHA 1LX6A 5ARDA 4JP8A 1V0ZA 3MWFA 3ZNQA 2BERA 3H6KA 1U11A 5JAZA 4M4NA 1T5OA 1ZI6A 1FRFS 4GAEA 1L4YA 1T9KA 2FG5A 2PN1A 2XQIA 3JQAD 4RESA 3TLJA 4QJ3A 2HW8A 3P0EA 2O0LA 2P6OA 1RRKA 3IJEB 4QUJA 4RKWA 5A2QA 3DZDA 2W22A 2YMLA 3M34A 3RTCA 1E62A 1QB7A 3WVNA 4Q0MA 3EVAA 1UQRA 1MFZA 5CB4F 2AG0A 4QTYA 5CFMA 4MVXA 2VP9A 3B70A 5JVDB 1Z33A 2GBIA 4YWJA 2B1JA 3EVGA 3L5KA 4XTRA 4MQ4A 3WBJA 3WK4A 4DABA 5C32A 3RYIB 5FX2A 3N75A 3QTBA 4TS3A 1WOMA 2AEJA 1IHDA 1IK4A 5DHTA 2EATA 2HIMA 2UZ0A 2HMWA 1TK2A 5AHXA 3S8MA 3AI7A 2I4RA 4CQJA 2PGXA 3O7WA 3VR4D 1NVVQ 5L3SA 3VI4B 2VDMB 5DBOA 4ZXFA 2QVZX 3L43A 3PB3A 1A9TA 4PANA 1I13A 3TLGA 5WRFA 3GVCA 3V8BA 4DF3A 2OBMA 1Z2CA 3UW1A 2QP4A 2RIPA 4BRWA 4ZCTA 6CHYA 1YHYA 3PXUA 1OAKA 4RGVA 5SYMA 3O4VA 3WLQA 2NXJA 4B84A 2EQAA 2Q7OE 1PBNA 3QY9A 4RNDB 3ZTWA 3T5DA 1JKMA 3GFOA 3KR9A 4HGOA 4IQKA 1QRAA 1SXJE 1RZVA 2X7HA 3A4VA 4YONB 1BYIA 4QFDA 2OP1A 1FP6A 2HIHA 4XYMA 3W8RA 1YXMA 1IAVA 1TTQB 1VIDA 2R7KA 3SMQA 3WGHA 3I5YA 1P2FA 3QEMA 1JEDA 3B9QA 1UZMA 2C4HA 2Y0CA 3QXGA 2IIVA 2MINB 5HIIA 5JXGA 2R0QC 2CC2A 3V9AA 3GAZA 6NULA 2PL1A 4FPFA 4M9QA 5JVDF 4GC9A 2AZDA 4G0YA 2NXCA 1XD8A 2ZUBA 1T35A 4CCSA 4F60A 3GCGA 3IA7A 4PVCA 5HQJA 4MHTA 1U3WA 3OEHD 2ADMA 4AURA 1XRNA 2ZR8A 1GQSA 1ZM3A 3WHPA 1JLRA 2YN4A 3FUUA 1DTWA 1XYGA 2CHGA 1RSZA 1KEVA 3JVEA 2OQRA 3FCCA 1SVSA 4FJ6A 4NCKA 1OI3A 5L3QA 4IJ6A 3KOXA 1V6AA 2TMKA 5JNTA 2A5FA 3W6PA 1X80A 4KWHA 4Q3CA 3PUVA 2DSNA 4GX2A 4CV2A 5LJIA 4C04A 5B58T 4TLAA 2BFBA 1MWEA 1PS0A 4Y6GB 3UJHA 5B58C 1TMYA 5CVUA 1A50B 3WG9A 2UUPA 4B44A 1Z4QA 4EDFA 3JD1A 3VKUA 4POOA 4E12A 4C0WA 4D3DA 1NDUA 3TLEA 5I3ZA 3IP3A 1N32B 3AY6A 2OPHA 2NO0A 4FX5A 3WLRA 6GPBA 1NSTA 2C57A 1A5SB 1DXOA 4RBNA 3JU3A 1TIBA 1LCIA 3AFMA 3NGLA 3NWEA 3SS9X 2FETA 3CEAA 4BVKA 2CMLA 4INAA 1XTQA 3L0PA 4I0WB 4G24A 1MJHA 1YVEI 1MZVA 1Z6AA 3L6VA 3E8XA 3QKIA 4OFBA 3VYUB 2BGNA 1J4AA 2VHYA 3WDLA 3ZOZA 3TOZA 1NVMB 2QK4A 1OHHA 5B53A 1OXVA 3CVVA 1AK9A 4QM6A 1H23A 3VSEA 2C7OA 1UWLA 3P2YA 1PK8A 2GBFA 3D5TA 5AKGA 1VHTA 2VDOB 2B99A 2CXXA 3ELYA 5G2OA 1ZGHA 4B79A 1U99A 1XZIA 2GXSA 3OWOA 4LI0A 3RJ5A 3SDZA 5BNTA 4O2AF 2PLWA 4HP8A 5COBA 3O6VA 2I91A 3AEUB 1U7ZA 2OCDA 2O3SA 2BZGA 1SNTA 3C39A 1SPXA 1UPAA 4DJDC 1YCDA 3I64A 3T52A 1JR2A 2IS2A 4CPLA 1V4VA 4LISA 2O19A 4AJPA 2HJWA 2WIJA 2V4UA 1W94A 5LC1A 2ISSD 1PYGA 3BEQA 3CX6A 3RC9A 2CGEA 4IEEA 1TJ3A 3D6HA 3MJTA 4EG4A 2XBUA 1Y7IA 2IITA 5CNKA 3ZCPA 3P9CA 1DXHA 2DKNA 3MRSA 3VNRA 2NSJA 1Z6XA 2QL7A 4R81A 4OA8A 4KMMA 3IP5A 1TKCA 4FKZA 5DT9A 1VJRA 1CJMA 2OD9A 1IFXA 3GBSA 2A5DA 3TTSA 3BIJA 4O2AA 2J33A 1U8AA 5FZNA 3ETEA 2C42A 5I9MA 1Z8FA 2B30A 3I72A 5TX7A 2B8NA 3Q7PA 4XEHA 3ZE1B 1PQ4A 5FOVA 3TLKA 4MRMB 1UFRA 1ODIA 1Z47A 4WHMA 1EGQA 4FCCA 4FI3F 2XF8A 3BGIA 3Q6IA 4WKNA 4Q00A 2REOA 3P4YA 1Q12A 1Z7EA 1OC4A 3GT4A 4GMKA 4TQAA 1P31A 3RUFA 2WIGA 3DXFA 4YP6A 4AXBA 4BOYA 2O54A 1RWIA 2JJ1A 2IZ1A 4B7CA 1QYWA 1SOAA 2GX6A 2Z83A 3VR4H 5K0ZA 1L5OA 3VPGA 5GONF 2XTAA 1DKPA 1BDMA 3S2YA 3EY4A 1EFVA 1ZDMA 4II2A 3THSA 1RWQA 1X13A 2G70A 1EIWA 2BP7A 3PTZA 4TMFA 4RKYA 2R751 3GAMA 1NI4B 1C4WA 3UHFA 2ANCA 2C2ZA 5ITZB 4OHYA 2FGKA 4Z9FA 3CUSA 1D4ZA 4K6CA 4PAQA 1VTKA 1E59A 4LW8A 1JT2A 4OJNA 5AJTA 1J8YF 2MYTA 2QRUA 1UMDA 4WA5A 4UCWA 3JQPA 3AIOA 1LVHA 3DBIA 4Z7JA 4AMUA 1J9ZA 2QTTA 5GJBA 2F1HA 4LZOA 3VSBA 3IP7A 3KLBA 3W34A 4E5UA 4MDEA 3M5WA 3GAAA 1JEJA 2AOTA 4LS3A 4NECA 1E7MA 4HFNA 3T3IA 1EJ6A 1QIJA 1R5JA 5T8KA 1C3XA 1CTQA 3PI7A 1GARA 1STOA 5K0GA 2G5TA 2VTBB 5DN6A 4EFNA 4YR9A 3VNUA 1QC5B 2YIMA 2D2IA 3EQ8A 4HQ0A 3C7DB 3LHFA 2XNCA 5GONA 5DLYA 3SKYA 3X2EA 2JFUA 3THXB 4PE5B 5JWHA 3L2OB 1PKEA 3VZSA 1GNRA 1GV0A 1JXAA 1Z6GA 2IELA 1GQ2A 3PFKA 1EDZA 2C5EA 1VL8A 2XYVA 2I29A 2IUEA 4HMPA 3SE7A 3TL6A 2NYUA 2FQ1A 3EY9A 1LRJA 4P8RA 4XD7A 4Y7DA 4C3ZA 3OCZA 4IUDS 2ZQYA 2IASA 1CU1A 3T1VA 3PS9A 1ZWLA 5LQUA 4HGZA 1A88A 4ISBA 2A1UB 2C96A 4HQLA 4MA5A 1PR3A 3OQNA 1MRNA 1U9YA 2OSBA 4W1SA 4NBRA 3JVUA 4LMPA 2GT1A 1DC4A 5LNK6 3CCCA 1L5GB 2DWCA 1WZIA 1VKHA 1Y3DE 2HGSA 2P2CA 4WINA 4TWZA 1SUPA 4JYCA 3O8OA 4IIXA 1K5PA 1PDWA 1X92A 4LOJA 4OQMA 4CKWA 3JQ9C 4XLTA 1TI7A 2QYTA 5HCNA 5ICMA 3B3FA 5K0EA 4AO7A 1E9RA 2WM3A 3GYBA 3E8MA 2OBBA 1WXXA 3LSTA 1K5DA 2A5LA 2J87A 3EDCA 4GPD1 4M8KA 5C0OE 1LBTA 4JJZA 3QYJA 2JH3A 2ZAIA 4YRQA 2Z57A 3TLBA 4RHYA 1A5TA 4H4EA 4C30A 1G5PA 4PRZA 4WZ6A 1W6UA 3A0UA 1WRBA 4GIBA 1A96A 1ILWA 5HQ3A 3BXOA 4QICA 5JNVA 3UBMA 2W8ZA 1QIFA 3WHIA 1GNTA 4YHHB 1RZRD 3HB0A 3FD8A 4QA9A 3G8YA 4G1BA 3HCAA 5FPHA 3H2SA 4PHTA 2W4QA 4GNAA 3M3DA 4MGKR 2XRZA 1N1EA 3L7KA 3F7OA 1I4TD 1H0RA 2IYLD 2QUBA 3DCIA 3EIXA 3DGFC 3IE0A 2IFTA 4M1MA 4Y7CA 1GAWA 1KJIA 2J3MA 1UOEA 2Q45A 2OESA 4HEQA 2V97A 3JVIA 3OJXA 2YOGA 2V91A 2YA7A 1GU7A 4K40A 3O1JC 4MQ6A 4Q3NA 5ERYA 1A8HA 1JIIA 2BEUB 4RZQA 2X2FA 2J7PA 2Z8YA 4K28A 4UXJA 1R6BX 4ZVVA 2AEPA 1E64A 4O08A 3GRCA 2CWWA 2FOXA 1ZNQO 3ZX5A 3VISA 5EPEA 1YS9A 4I50F 1BEEA 2AW3A 4IXTA 5BVHA 2C8VA 4XI9A 2JCVA 2J0EA 2K7ZA 2OBFA 2OENG 3GDHA 5IJWA 1RMYA 4GKVA 4NYMQ 3WLNA 4PG8A 4D82A 2H18A 1D2HA 4BECA 4QN3A 3F7TA 1BEZA 3MS4A 5FT9A 3QH4A 4IM7A 3H18A 1ZLXA 5J3JA 2WF9A 2YRXA 4FD2A 3NDIA 5LB2A 1C8VB 3DEFA 5D00A 2Z04A 2ZRAA 3LECA 1QG6A 5IJ0B 5J5VA 1NMAN 2X8AA 2ZW9A 1Y9EA 2W6MA 2JPDA 4I99A 3SYTA 4MVCA 4YI3A 3K2BA 1S8FA 3C70A 5KAMA 4EL0A 1SNYA 1V26A 1N2CA 1U63A 4X9XA 2PUWA 1CFZA 2VP5A 3D7MA 3B7GA 4I50A 5GGXA 4YW5A 1SOVA 4GR9A 4HH4A 1UJ4A 2WQ6A 2A8YA 1U8TA 3E3AA 3O4IA 3WMFA 4CLOA 3WB9A 1DB3A 1B15A 2IOFA 1KC1A 1DRKA 1MS3A 3CRVA 1EFRD 3FZNA 1KFEB 2ZBUA 4H6VA 3TSWA 4EVSA 5CDYA 4F2HA 3HDTA 3KSMA 5SY9A 4YUWA 1E1AA 1NC3A 2IBTA 3TMKA 2O3UA 2Q4EA 3DFKA 2E3JA 2B7CA 3MS2A 1E2UA 1W76A 3PNMA 4V2UA 5AI8A 2PVSA 4Z9XA 5FB3A 4DQDA 4V1CI 1X7ZA 3R0IA 4N76A 2PX3A 3DWIA 3FZQA 2VZ0A 4EBBA 2GXAA 2HYDA 3DWEX 3VNVA 1L1QA 1NYQA 4K05A 1NYLA 4ND7A 3NG1A 1XTUA 5CTAA 4NVRA 4EAQA 4KODA 4MRRA 1NKSA 1DKLA 2XJ4A 4ZOBA 3S1LA 4YMHA 5HS6A 3TFOA 7ABPA 4HXEB 1TCBA 4Q47A 4BGDA 5KTYA 4KMRA 9LDBA 2ZWAA 2X8WA 3KQLA 4HGPA 4HGQA 4KPUA 4LX8A 3G17A 1JWAB 2D00A 3T8YA 4BC0A 4PTLA 1CS0B 1TK3A 3B5IA 4BBWA 3DNPA 3MWEB 1Q11A 3RHTA 2F29A 2DBZA 4AZ3A 2L82A 1K3TA 5EHIA 2QZZA 5EJAA 4F7WA 2JIZA 2CN1A 3A9CA 1JU3A 3VPDA 5KKCA 4BV2A 2ID8A 1RQ7A 3LQRA 4D9KA 3R9XB 1C0PA 2QQ0A 4X8HA 4QBHA 5ALGA 2Z98A 1R0BA 1ZK4A 1YCHA 4LDNA 1N7JA 1SVNA 3H2BA 3ZD9A 4B17A 2NSLA 2FN3A 1RAHA 5IKXA 4G5HA 1XCGB 5FUMA 4PLGA 5F9HA 2NU7B 4LQDA 3ULKA 3VR5A 1PGQA 2FA9A 5B7GA 3BREA 1KI3A 2NQ2C 2KB0A 3H83A 2DQYA 2Q3FA 4EQ6B 4OSPA 4D9IA 1BKDR 4XX0A 3NHWA 5ITSA 1GZHB 3EDOA 3A3YA 1Q1ZA 2P35A 1T5LA 3EF1A 4M0LA 5BUQA 2C7QA 5DBFA 4O1HA 2CLKB 2W5UA 5ALDA 1VBMA 5T4FA 3OFNA 4BE7B 1NQVA 3TI9A 3VZQA 2KJQA 4GRDA 5IXJA 3DBLB 2A58A 2XRFA 1UXGA 4L22A 3MWYW 2BZDA 5EMMA 1ZKMA 1G3RA 3DV2A 3TEFA 5KS2A 4F7DA 1KC3A 5CH5A 3CNOA 3L4BC 1SUUA 4CKEA 1G8KA 3O73A 3TTXA 1G5TA 4R6WA 3AZOA 3LCCA 4NICA 3EW7A 4NATA 2PH5A 3IEIA 6PFKA 4R8KA 2JBWA 4RE5A 3D2LA 2XVMA 3HUUA 2EHDA 2OXRA 5LZ5A 3VVLA 1OBFO 3MERA 4TKMA 3ZZ1A 3NDBB 2ZP1A 3WWDA 1ODLA 3PQFA 4PYOA 2Z3ZA 4IZHA 2Q6TA 1QHHB 1CZUA 5J5CA 3DOCA 4AN1A 1Z15A 1LK7A 4MUXA 3VR6A 1Q3TA 1YV9A 1V7QA 5LIRA 1PJQA 3O83A 1PZEA 5JFGA 2IP1A 4WWHA 3DLHA 4BQOA 3AFHA 1PTKA 2BKUA 4PNPA 2CXTA 5KYWB 4MRSA 2ONYA 3DR5A 1JEYB 1OX5A 2LP4Y 4GM0A 1QM5A 2IXDA 3GJQA 2P2NA 3SREA 3AKYA 1RC8A 1SUFA 1U2DA 4WERA 4XEUA 4IVRA 4NK4A 4KWTA 1ZOIA 4LQCA 3JZDA 4E6PA 1QR2A 1MR5A 4HAVA 4A03A 2I87A 4WSOA 1RXWA 3ND7A 4G4IA 1E6EA 4X1IA 3CYEA 4TQ9A 1ONSA 1SPBS