4HW6A

Crystal structure of an auxiliary nutrient binding protein (bacova_00264) from bacteroides ovatus atcc 8483 at 1.70 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
424
Chain Sequence
SGTPFNPKEEIVVEKFLPTEGRKGTRVVVYGRNFGNDVSKVKVTIGGYPAKVINVKGESLLCICPSKAYEGDVKVSVVGDDEAELKSGVCEAKFDYQYNYVVTTFLGKLYENNTKWDVLAGPFDDCGAFDNIWRMMFDPNSNYDDLYWVGQRDAFRHVDFVNQYVDIKTTNIGQCADVNFTLNGDMVVVDDQSSDTNTGIYLFTRASGFTERLSLCNARGAKTCAVHPQNGKIYYTRYHHAMISSYDPATGTLTEEEVMMDTKGSNFHIVWHPTGDWAYIIYNGKHCIYRVDYNRETGKLAVPYIVCGQHSSPGWVDGMGTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCDRDSHTVRVLTPEGRVTTYAGRGNSREWGYVDGELRSQALFNHPTSIAYDMKRKCFYIGDCDNHRVRKIAPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords hypothetical protein, IPT/TIG domain protein
publication title Crystal structure of a hypothetical protein (BACOVA_00264) from Bacteroides ovatus ATCC 8483 at 1.70 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
total genus 112
structure length 424
sequence length 424
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hw6A01
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 4hw6A02
5GSRB 4NHUA 4UTAH 1DQMH 3H9HA 3MRKB 1J1XH 1PG7W 2YBRA 5IESL 4KZEH 3KG5A 5FO7A 1BP3B 2VDOH 1IGFL 3BO8A 5I18H 1LEKB 5A43C 4L8CA 4BFBD 3MRGB 2AW2A 3GDBA 3FAXA 4XVSL 1CFVL 2A1WH 3ZKXB 4NSKB 1MREH 2MOVA 3NABL 5JHDD 2IAPA 5I19H 1IM3B 4ZTOH 3SQOL 1IC5H 4RRPG 1A47A 4UNVA 2R29L 2PW1B 1JNJA 3U7WL 2VLME 4G9FE 3EOBB 1AI1H 1SJHA 1KCUL 4LOUC 1AGBA 1R0AL 2AQ3A 3PWJA 5ECJE 4OTXL 5T1DH 5DF0A 4P46A 5DQJA 4HFWB 5EBLB 3VXSE 3HG1B 4OM1L 5F7DB 5DMGC 5GGVY 1FORH 1KCVH 1KCKA 1RZKL 3ALXA 5D1ZA 4CVZA 3VG0L 1UXWB 4LIQH 2MWCA 3QQ4A 2BSSA 3WO4C 3HB3C 4LSQL 5CD5C 3L3JB 1XIWA 4JO2L 3OHXA 3WFBH 4YGAB 2O5ZL 4OF5A 4UTBH 2ZG3A 4OIIL 1KN4L 2DQDL 4OM0L 2OMBA 1ZLWK 4LP4A 1ZHNA 5FYJH 4Q9CA 3TA3A 2EE3A 4HUKB 2NCMA 1X7QB 1DL7H 1CLOL 3DYMA 5E08L 3PDDA 5C7XH 4YBQD 2I5YL 3NH7H 1KJ3H 3EDDA 5DLML 5CP3A 5F1IA 2B1HH 5CJQH 4ZG1A 2VLLB 3SBWC 3IFNL 25C8L 2ZWLT 3TVMB 4HEME 4PJXB 5F97E 5DTFA 1EO8H 3HZYA 5BVJB 2Z8RA 4K3DH 1G6RA 2DYPA 5FV2A 3KJ6H 1AO7E 5H8DA 3HMXA 3GBMH 3VXQA 5JR1H 2B7DT 1QLFA 3HUJF 4PTTB 4HHQA 4OIAA 3GI8H 4HWEL 5IB1B 3QDMA 4NUJB 5CJBA 4U1IB 4Z7NE 2BRRL 2NX5A 4BM7A 2V7NA 4GAYB 1AHWB 1YNLH 3OAYH 3VXUD 1OQXA 2F54D 4LCYB 5L8JB 4NBXB 3SDXB 4FNLH 5IVXB 3ARVA 4JQXA 2FEDD 3IYLW 1UJ3A 5IEHB 1U8JA 4R90L 4XCNB 3D3VA 5GRWA 3OB8A 2R0LL 3PQYB 4LAQH 2VKWA 5CGYC 1KPVA 4TOYL 5IQ9A 2WIIB 5JQ6H 1U8QB 4UAOC 2LE9A 4MJ2A 4MAYD 3S3PA 4FFVD 4O2EB 3AY4C 3C60A 5KSVA 3LQMA 2GVUA 4XPHH 2XWJB 32C2B 4OF7A 3TCLB 4ODHL 2WZPD 1HHIA 5HHOB 2IH3B 4I48B 3WN5C 3NTCH 1MEXL 5DHXB 4Q0XH 1A4JB 1KC5L 1JF1B 2C3WA 2LQRA 2QL1A 3OGCA 1Z9SA 4QNPF 3M17A 4YHKH 4Z7WF 4N0UB 3BRDA 4XMKL 1DE4B 5IOPA 1IJQA 4JFEB 5I1KH 1I7UB 5L2KD 3D6GA 1S7SA 3RWCA 3HI1B 5C0DA 1IGYA 4OGAD 4UT6H 2W9DL 5LJYH 2AI0H 43CAA 4XHJC 1V3JA 3K8KA 3VFOA 4NWTL 3D87B 1FL6A 2OTUB 3KPSB 4YX2L 3IJYB 1XR8B 1RJLB 4PRBA 4LCIH 3H9SE 4GH7B 1T7ZA 4LEXL 3Q6FB 2R2BB 1P7QB 2NY7L 4JM2D 3PGCB 4FMKA 4PTUB 3J8F7 4WO4D 5FB8B 4JHAL 4ZTPH 1ZE3C 3TN0B 4X6BB 1A1MA 2V7HA 1RZFL 2FP8A 4WVRA 3KVQA 2GFBA 2XYCA 1KG0A 1OP5K 1EGJL 4UDTB 2KQMA 1I7ZA 4MWFA 3I84A 4K3EH 5IFAL 3HE7C 5CBEB 5CAYB 2VO5A 4AIZB 1A7QL 5EZLA 1I4FB 3ZYOA 2UWEB 3ULVF 1UCBH 2A6IB 3AM8A 5E4IA 5L88L 3ETBF 4H5SA 5JA9A 2FBJH 5I1JH 4LHUB 3UYOD 1P4BL 2B20A 4IRJC 3IFOA 5J6GB 3L6FA 3D0VB 1E6OL 5J3HC 4PJGE 3MLRH 4P23B 3MQIA 3F7VA 2RFXB 4KK8D 3JWNC 2Y72A 5D2LB 4XVJL 1CG9B 2XA8L 1AR2A 2PYED 3FT3A 3U0TA 4HUUB 3ULUC 1TQBB 1YN7B 1FGNH 3MV9A 1IL1B 2JJSC 4X9GA 3HNSH 5BW7A 3BP7A 1HK6A 3D2UA 5ALCL 1T7YA 3LAFA 5DEFA 1A6WH 4W6XB 2FX8L 1HNGA 1FH5H 5CJ8A 3X13A 1OCWL 1JTTA 2E9IA 5FGBC 1PBYA 3CSYB 1A0QL 4IIQA 5CP3H 3Q6KA 1D5ZA 2RR3A 3TYGH 3DLQR 1J1PL 3E1F1 3DPBA 3KPMA 4GUPB 4CVWA 3LI3A 3QIWA 5IJKA 2IPKA 4GRWF 4TVPE 1G6RH 5FIEA 3VG9B 4HG4K 3VFWB 3O8XC 4P4RA 4ZMAT 2R2HA 1JK8B 3UP1A 3HMXH 3K46A 2IAOA 1F3DJ 1NCUA 5EOTA 4P3DB 3PGDB 3C9NA 1J86A 2XOTA 5EUOA 4I18C 3WDHA 1LK2B 1FO0A 4JANB 3QBTB 3RL2A 2B0SL 5TFSH 4CMMB 4G42A 1P69B 4NC2B 4JG1L 4PJFA 5C08E 3OKNA 3MPCA 5EBGA 5EUOE 4YEEA 4R2GD 2HJLB 4MNQA 1CTOA 3VH8G 1G1YA 1H0DB 4X9FA 2QE8A 1R5IA 3ARFB 1T21B 1VKXB 4NC1C 5EU4B 3BQUD 3MLYH 1TIUA 5T3XE 2R23A 4BQBA 2XZAH 4NNXA 4MNQE 3I9GH 4K7FB 1A7RH 4C56B 3RDTB 5CJ5A 3QDJE 3WN5B 3EOTH 3V6OE 4CW1B 3PWNB 3MA7A 4RNRA 3FJTA 1P7HL 4LRIC 3RPKA 1CCZA 1I9EA 2ZKHL 2WLZA 5IBLC 4U31A 1RULH 3TWCL 1CFTB 3HUJA 5CJXA 3OKLB 4WCYH 3S4SB 3P2TA 4WU7A 3IDGB 4N8VA 1R3KB 2NY1D 4P46D 5B4MC 1ZVSA 1SVCP 1JPGB 3MYJA 4WFED 3B9KC 3H42H 2BSTA 1DN0B 3HUJE 4Y16C 2VYRE 5F6IB 5HYJE 3VCLA 1X5IA 1BZ9B 2OS7A 5DJ6B 3K4ZA 4ODBD 2PTUA 1HHJB 3W0WB 1JGLL 3CFBA 5DD3H 3B3IB 5DRNA 5DR5L 5HDOA 7FABH 4AEEA 4D0BA 3N1PC 3O6FA 3MUGA 2ATKB 3C5JB 4D0CA 2IWGA 3SKJH 4Y7MA 2VLRB 4RAHA 1Q9LA 3DIFA 5IJVA 1RIHH 5C9JA 2ADIB 1UWGH 4ONHA 1T20A 2NY3D 3T2NL 2X1OA 4AEFA 1QBLL 1B6UA 3ARBD 5EU5A 9CGTA 3QIUC 5BCAA 3HE7B 3RI5F 1YYMH 5JORB 1MJUH 1V05A 4J1UA 3QA3B 3GSVB 4JDTH 3VXOB 3OX8B 3C8DA 2OR8A 5E8OA 2HTLD 3QFJB 4YE4L 4G6FD 3O4LD 3X3GH 5GSVA 5IW6B 2DYPD 2AV7B 2D3VA 3GSQA 1LO5B 5IB4A 2XQBH 3BW9B 3MRQA 3O6MH 4Z7WE 1B88A 4QNPE 4Z95L 4WI5A 1BQLL 2IAXA 1IFHH 5F7YC 3QDMD 1F02I 4H88L 4YHNA 4L4VB 1NCCH 1O7VA 5EBMB 2NX5D 4YBHA 4NQXB 3DASA 2V2XA 3I6GB 4HAFA 4ELKA 4XZUA 1HYSD 2I9TA 3QFDB 2EYSB 1FCCA 2JCCF 3LEYH 1BBJA 3GJFA 3D3VD 4JFXB 3LQAL 5F21B 3TBYB 4F7TA 1A3QA 3MRFA 3FO9B 2QHRH 3MUHL 4XWGL 2IAQA 5ILTH 4WFHE 1BECA 4XTRC 5HYQA 1ETZA 3T77B 4YO0A 1MJ7H 2FX7L 2VNCA 5IROC 1RUPH 2X09A 4RAUB 3KYOA 3WFCH 5IG7B 1MPAL 1AGFB 1GYAA 4CJ1A 5SWZB 5A2FA 1XH3A 4XBEL 4OGYH 1C1EH 3P9LA 2DJSA 1FFQA 1T66D 5GISL 2FZ3B 1VESA 3O8XB 3BOVA 5B8CC 2HVJB 3QUMB 3ZYZA 2XTJC 1EHXA 1VEMA 3ORJA 5E94A 4Q58C 4LQ1A 1G7QA 5J89A 3ULVE 2CIKA 4I18B 1NSNL 3VDCA 6FABH 4JAMA 3NCCB 1FO0H 1T4KA 1EUTA 2QJDA 2VSDA 8CGTA 2Z4QA 4HH9B 3SGKC 1T89A 5FYLE 4MS8C 1IAOB 1SBSH 5EZJA 1BFVH 5F7EH 3BZ4B 3JUZA 3CH1A 4PRIA 5TH2A 1QD0A 1J05B 4YDVA 3MRJA 2Q6WB 4EUPG 1XCQA 1U93B 3WXWH 1ZS8B 4KROD 1FLRL 2IFFL 1GGCL 2E6JA 4UBDD 1AC0A 1PEZA 2F5AH 1F58L 1FZMB 1DQJB 4GXUM 3QSKB 4LSPH 4Y1AE 4U1NB 1WK0A 1N7MH 4H8WL 1AP2A 3BVNA 1QFWL 3DO3A 1Q9WA 4ODWB 1AXSB 2NY4D 1Q9KB 2BNQB 1HQRA 4XP5H 2FJHA 2VZ3A 3VFMB 3T3ME 2XRAL 3QPQD 1IAIM 3BDYH 3B9KB 3S35X 4FP8L 4MA7H 4UV7L 1UVQB 2NY6D 4M61A 5GX4A 1FNFA 1ZT1A 5HHPB 1OTTC 3LS5H 3BDXA 3MXWL 5KZCB 4WFGE 4PJHB 4WGVB 1UKQA 1A14H 3V0VA 2ZG1A 5AZ2L 4Z0BH 4F33A 3MV9D 3G5YB 4X7EC 3A6CH 2ATPA 2XKSA 2IFGA 4ZUUB 1FGVL 3ARDA 3C8KB 4GN8A 3RWEA 1I8KB 4L3EB 5IGXL 5H37H 1DSFH 1F90L 2NTFB 1QYGL 2O5XH 4NHCH 4ELMA 2OZ4H 4L4JA 4YDJB 5GRYA 1SMOA 5IEKB 2XA3A 1S9YA 4RFEB 5FM5M 3LN4B 3TH4T 1S3KL 3QUYC 4LPYA 3GJEA 3V8CA 4LNRA 1CFNA 1WIPA 1RSFA 1CGTA 3QIWD 2W9EL 1S7XA 3L5WA 2H6PB 3VXNA 2EXWC 3CFCL 4JZJA 3Q2CA 1JYNA 4RRPA 1RY7B 4DWHA 3KGGA 1AIFB 2Y9RT 1GPOL 1G9NC 2GTZA 1J0HA 1E4XL 3BP4B 4N8CH 2AJXH 1T2JA 2FH8A 4NNYB 2X7LA 2AJ3B 1IGTA 4ONGH 2FPCA 3MNZA 4UIKL 4ENEC 4S11A 2MNUA 4KMTL 4A6YL 3GJFH 5DUML 4WHYH 5H35A 1KCSH 3SN6N 3K3QA 3SDAC 3ZTJG 5JOPE 1NC2B 2HTKD 2JELL 1INDH 1ZLUH 5IBTH 2CSPA 4WENB 3NIFF 3EO9L 1DVFD 3KPPA 2MFNA 1BX2A 3QG6B 4GOSA 4X5WA 2VAJA 4NJ9H 4BSJA 3MJGX 5E1AB 3MGOA 5B8CB 2DM7A 4EN3D 4TUKH 2XV6B 1E28A 4M1CC 2XTJB 3IJSB 2XACC 4Y5XA 5IHBA 3D25A 4NQEB 4KVNH 3MXVH 3TBVB 4EVNA 1MFCH 1TMCB 3VJ6A 2EIEA 5FYLH 5KW9H 3HI5L 2UUDH 4JFFE 4P2OC 1YMHB 5FDYA 5C86A 2BHUA 5D6DA 1HHKB 5E0QA 4LSTH 5T3ZD 4L8DB 4Q2ZA 3EYSH 3ESVF 1X4ZA 3JWOC 3UCRA 5F7NC 1Q94A 3AAZB 1YPZA 2Q7YB 4J3XA 5D71H 5I71C 2W8BB 4XX1G 1PG7L 4AEIL 5EPMB 3IU4L 2E7LC 5I16A 2Q8AH 4R4NC 1G7HB 3OJDB 4YFLF 1FVEB 5EC2B 4F7CB 3MFGB 4I2XB 4O4YH 1AE6H 3F7YA 5D70L 5DFVD 2JB6A 2BVOA 2QSTA 1F2XK 3QDAA 4GLRI 3T0EB 4KKNA 1TVHA 3BUTA 4XMPH 3P4OA 2MHAB 3U4AA 3JV0A 3L3DB 2VE6A 3EOAA 4ZUSB 1CE6A 1NQBA 4JRXA 5CBAA 4IOIA 4OF6A 1HKFA 2BHZA 1YDPA 1G1CA 1HHGB 2BVEA 4OCWL 3NCJL 1IM9B 3T0DA 1A3LL 4PLJC 1JGVL 1Z9MA 2R4RL 5L7XL 4X8JB 1KIRB 5EBWB 1KEGL 2PW2B 4J6RH 2ENSA 4M5YH 3TO4A 3LMJH 3I1CA 5CSZB 4JFYB 1D5IL 4IS6B 4O9HH 1YEHH 3MREA 4JFQA 3I75B 4JFDA 1OAKL 1UB5A 3TIDB 4JPIA 1CR9H 1QACA 1SQ2N 3HNTL 1NFIB 3BN3B 3KYMB 3STBA 2PF6A 4OKDA 4NQCB 3GSOB 3RU8L 3REWA 3KPLA 1DBML 3ZKMC 3WJJC 3HZMA 4OZHA 3QIBC 4R0LC 4RWYH 3TBTB 1S7WA 1CICB 3QH3A 2IPUK 2GJ6A 3EO1A 3QUYB 1UYWH 1Z0MA 2J3SA 5HGAA 2CLZA 4HT1L 1CVRA 1JN6A 1MCEA 4OZHE 4DKDC 3BEWA 4F2MB 5CINH 4OZGA 2VABB 3VD5A 1OAUL 1PGRB 5MP6L 1WVZA 3VFUB 1TFHA 5ITFB 2COQA 5DJ2A 2VXSL 2YOCA 3SDDA 1EXUB 4M5ZL 1CL7H 4X6EB 1V7NH 3I6KB 1NCTA 2XZCL 1YQVH 2IAMA 4C59B 2VQUA 5JW5A 4YHYC 3EYUH 5AWNH 5DVKA 1RURH 2HMID 3AS3A 3WFEL 4Y2DA 4M62H 2DMKA 3O3BA 3HAEB 4C83A 4XNQB 3JV5A 4ZFFB 4G9DA 1M4KA 4HEPG 4F57L 4K94L 1KJ2B 1URLA 2YC1A 3SDAB 3UJIL 4D9LL 4PRID 5TQ2H 4XNXH 1I7TA 1KLGB 3UPRA 2X4TA 3QWOB 5FM4A 5D5MB 5CEZE 5C07A 3PJSB 5FM8A 4OCMC 3MZTA 3MLWL 5FO9A 1ZANL 3I50L 3VE0B 4LPXA 1PVHA 3RL1A 1KBGL 3L3IB 3NIDF 4GG6B 2BCKA 3QI9C 4XT1C 4NO2B 1TXKA 2WWMD 4WUUE 4JZOB 2XWBB 3G6AB 3D39A 1FL3B 2QKIA 5DRWB 1KT2A 4TSBH 4OUUA 5I1EL 1AY1H 2BVYA 2Z35A 4M7LL 1OPGH 1PKQB 1DDHA 4DN4H 5ICYB 1ED3B 3DNKA 5IF0A 4G8GD 3SOBB 1O7SA 1PSKH 3KHQA 4POUB 4AH2B 1ULVA 3U7YH 1PQZB 1A5FH 5D96C 4RQQB 2GQHA 4NQSB 1G84A 5I71B 1AKJA 3FOLB 4RMTA 4WEMB 4KZEL 2GJZB 5ELIA 5J7CC 2APVA 3QDGB 1G7IA 1F4YH 4M1GH 3JBG7 2NXYD 4XMLH 4L3CB 1SBBA 1ND0A 3EJZD 2CK2A 3DXAE 3SO3C 2P5WB 3ARDD 1OW0A 1K8IB 4E42A 2R2EB 1W72A 2RCSH 4NOFA 4WW1B 5DUPL 1N8ZA 3VH8A 4M7KL 3G04A 3QO0B 1MREL 1S9WB 4FQHA 4K9EC 4NRXA 2XG5A 2LU3A 3ZL4L 1ZSDA 3D0LA 5LAXA 4ZTOL 5I1AB 1T22A 5JDSA 4FZ8H 1QSFB 5DSCA 4GKSA 2GY7B 3NIFE 5KOVC 5FUOH 1E27A 4IOSD 4PB9H 4CVXB 1I9RL 3BHBB 4N0FA 2DQGH 4MJIA 1S5IL 2B4CL 4Q7DA 4FQPA 1IGMH 1I1AC 4KJPD 4M6NL 1KTDA 1F6AA 4PBXA 3ZKND 1FORL 1FZOA 3P5BL 2C4FT 3X11A 1R3JB 3RVXD 5C0GB 4TNVK 1EMTH 4NUGH 4FFZH 3IETA 3SE4C 4DGYL 5DK3A 4FN0A 3CCHB 1MI5B 1NBYB 2YR3A 1QR1A 4HJJH 1ADQA 4F8QA 4P5KA 3MOBH 4ZFOB 3H3KA 3MRDB 4G6ML 2V2WA 3FT4A 3MRIB 3H0TA 1BVLA 5C7XL 3QIBB 4R0LB 3UYRL 1LEIA 1QVOA 5CHNB 2D31A 2CK0H 2P8MA 4HX1B 2Y4SA 1T3FA 4HIEA 5D7KD 2BY0A 5I0DA 1J8HE 4F8TA 2CR6A 2CJUH 2DQHL 2P43B 3KJ6L 4JFOB 1RUAH 3D85A 3B8YA 1JMZA 1T5WA 3MNWA 2W65B 2YD5A 3VFPB 5AD0A 4HCRA 2DWEB 1A6UL 3DVNA 2DQIH 4LLYB 4YHYB 1U8PA 4R96A 2YMXL 3CFEA 5HVHB 4LLDB 1OLLA 1ODAA 4MAYC 4FFVC 5DD0H 2YPLE 4EQ3A 1P84J 4PJ5B 1MHPH 5LBSH 3UTTB 1W0WB 2QEJA 1ROWA 5HHXL 1BD2A 3SDYH 5BRZA 1OGAD 3OKYA 5MERB 3JTSA 3ZE0F 4S0TD 3VDAA 2HRPL 2HLAB 1K2DA 1FVCA 4IEFB 1HOCA 5E9DD 5BRZE 1P9MA 2AJSL 4QY8B 5EX7A 1I3RB 3NA9H 3QNYA 2ERJC 4FXGA 3QZWA 2OSLB 4LLWB 1KNOB 4L1HA 1LO0L 1PDKA 4NPYA 3QI9B 5E2VH 3UAJD 4PG2A 4LGPB 4OLEA 4JRXD 1WZMA 4P0DA 5E4EC 3BN9D 2K1MA 3VGDA 1JBJA 1E0OB 3DECA 2OJHA 1MQKH 1YY8A 1ZTXL 2PCPA 1QSVA 4HK0A 3RNKB 3WWAA 1I1FB 5KVEL 2AI0L 5CIPB 3TO4D 3OZ9L 3MMEA 2GVVA 3QHFH 5IQ7H 4P99A 5LXGL 4WO4C 3WLWD 2FJFA 4LARL 5GS0D 4PV9A 2Q8BH 2X4SA 5CILH 1G7MA 1JWMA 4JFDD 2ZUWA 5EWIL 3SGEH 1KB5B 5FYKU 4XH2A 2DSOA 3B6SB 2W0FB 1NGPL 5J1TC 3DURA 3FN0L 1NJ9B 3WIIH 5I30H 1W72H 1A6ZB 3ZT5A 1LMKA 5GZOD 4AEHH 4JRYA 1EAPA 1MCQA 4BSVA 3BH8B 1GZQB 2BFVH 2GJ6D 3DSFH 3HFMH 4OFPA 4ETYA 5HXMA 5JW4N 5KTEH 3BEVB 4Z7VB 1HILB 2NZ9D 3PHOA 4KKBC 4JRYE 4OZFB 3WFDH 1EX0A 5KSAD 3WO3B 5TDNB 1I1AB 3LQZB 3ARGC 3SDDD 5DK2B 1WJ3A 4Q9BA 1NCDH 4RGNB 3UTSB 2YUZA 5HGDA 3MZGB 1UXSB 4WDIA 4XXDA 3S34L 4XPBH 4U7MA 1B4JH 5E7BA 3BIKB 4I13B 4U6VH 1JGDA 5I8CB 3FQRB 1SVZA 5T5NG 4BH7B 5KG9A 2G75A 1HINL 1J0JA 1ADQH 1QRNB 1FFPA 2QTEA 5DT1L 1T1YA 1II4E 3S3SA 1MFEH 4Y4KD 4IOFD 5HTSA 4L9LA 4YDIL 5SWSB 4JQIL 3O45B 5MEQA 3MRCB 1S5HA 5C07D 5DVMA 3AREA 1FE8L 4QRUB 5EC1B 3FB5A 1LP9B 5EO0A 5FCUH 3KGRA 5E2UL 2IAWA 2DKMA 4X6DA 1MLCB 3DX8A 1BJ1H 4Y8DC 2QR0A 5F9JA 2JE8A 1WTLA 3NCBB 4P2QE 4UB0L 5AAMA 1FIGH 1U92B 4J4PC 3Q48A 4PJ7F 3D39D 2ICWB 1N6VA 4YR6A 4M6AA 3EYVA 3C87A 2M8XA 2DTML 1HQ4B 2KUTA 4HCRH 4R2GC 3RGVB 3FB8A 5I74C 4MCZB 3QUKB 3OKKA 3QR2A 4MAYB 5C0BA 3U30C 3DGCR 4JPWH 1BQHB 1B9ZA 4XRCA 1DFBL 1RZ8A 1NANI 1FV1B 3GRWA 1N3NB 2QLVB 4L4TD 35C8L 4Y19B 3IKKA 1QQDA 4Z7UF 4NQDA 1IRAY 5C0BE 2ICES 1HXYA 3RAJH 2C3XA 1RZ7H 4LKXB 4F9PA 5EU6D 5FHAH 1ZHBB 2BERA 4WJ5B 4AL8L 1VFAB 4MB5A 5IK3B 3MRRA 4GKZA 4OV6F 5L2KB 4PGBA 4NQDE 3TFKD 1XF3B 1YEDB 2ILLA 1H3PL 3QNXB 4FFWD 1GGTA 2EO1A 4MHHG 3U2SA 3HTLX 2NY1C 4P46C 1T2QL 2FH6A 5I1IL 1Q1JH 2IH1A 3IJHB 4FFYH 4TTGA 2XKNA 5E4EB 5DJDA 5D1ZC 1JPFA 5E70A 4R97C 2FO1A 2JJTA 5HYEA 2HFFA 1F13A 1T1ZA 4G43B 3F5WB 3MO1B 4LCWB 5IFHH 1XIWC 2ZUQC 4WWID 4XC3H 5JPMB 1N0LA 4JM4H 1NAMA 4MJID 2VZTA 4EXPX 2G5RA 4H0HB 2BMKA 3H42L 5DO2D 5EB9A 5D7JD 5FDWA 4RBPK 3TA3C 1PYWA 3FHQA 4I8DA 5E8PA 1I8MB 4HGWA 4OBSA 4E41D 5K9OA 5DA4A 1UQSB 4ODSL 5CSBA 3ECBA 3D18B 4PRHB 1F11B 4X6FB 4UIMB 5HY9B 2YEZA 2DKSA 3SKJL 1WCBB 2ZUYA 1MHHA 3OGOE 1XF5A 3GSWA 2V6HA 1GIGH 2G60L 1F8TH 3HC3H 2AXGA 2BC4B 2ZSVA 4PJBB 4TSCH 1PW3A 4J8RB 4NP4H 4WTWA 3BZEB 1BJ8A 4U1HA 4FTVD 1QKZH 1YQ2A 4P9HH 4PG9B 4X6CA 3S4SG 4XX1E 1B0WA 4BZ1L 4QTIH 4XC1L 5F1NA 2ZOLB 4HKXA 4HQQH 2A9NH 3B5GA 1DLFL 1HYSC 1EUUA 3D85D 3R8BB 3ARGB 4JQXC 1UJ3C 2R69L 4OFYA 3QHZH 1J7VR 4AQOA 3UO1L 2WK2A 2F19H 1C08B 3HI6L 4HAGA 2DIBA 4QRSA 4O58H 4PJ9D 1A6TB 5ADOL 2FWOB 4P57A 4WIQA 2UZXB 5E8DL 2DQEH 3SE8L 5GJTH 2ADFH 3C60C 4HUWB 4OZIF 5I17A 4HGMA 3GMPB 3NCEB 3LHPH 5DWUH 4GRLB 4BZ2L 4DCQB 2NMSA 1TVBB 1S9VB 1EBAA 3AVEA 1BD2D 4F15C 3GI9L 4ORGA 5DGQA 3DO7B 5IMLA 3V52L 5GGSA 1T66C 3BAEL 4YHPB 3FFCA 5DJAB 1OT2A 3RA7H 4OKVA 3S5LB 3EZJB 4NN5B 2DQTL 3M1BB 4OGYL 2XKUA 2HKHL 1IT9H 1BFOB 2AK4A 5E5MB 3QNZA 3CD4A 3I3EA 4U0QB 4XCFH 1SY6A 1FZJA 4U6HA 3BGFC 4DAGH 3CMGA 3JWDL 3BUYA 4LFHG 3H9HB 4YWGL 4P5MA 2AERT 4R2GB 3EDKA 4OCXH 1BWMA 2R4SH 3CVIL 4Q1UA 3KLAB 3U30B 3V4UL 5HYSA 3GMLA 3K4DA 3BO8B 2VZ1A 1U6AL 4KROC 4MXQD 4TN9A 5HVWA 4L8CB 4PRNB 2GVXA 1CTNA 3GRWH 1JZ4A 4UBDC 5D7SH 1FFNA 3MC0A 3PE9A 3I02A 2XWTA 3LD8B 3WXWL 2CH8A 4LPCA 2RJMA 2A0LD 2D9QB 2C1OA 1SJHB 3WJLA 2NY4C 1FL5B 3HPJA 3O3AA 4L29A 3AM8C 4M3JA 3DETD 3PWJB 2F8VA 3DX7B 2EDJA 2FNBA 4W6YB 4XCEB 4ZPVA 4YDKL 5DQJB 2FIKA 2NXZD 3QPQC 3I2CL 3RIFK 5A2JH 5D6CB 3EYOB 1NBQA 1ZK9A 5HHMD 1LO3L 2NY6C 5IW1B 1KLFA 4ODUA 5B39B 4JFZH 4S1SH 5D1ZB 4BELD 2BSSB 1KGCE 2V5TA 1XIWB 2ZUQB 3STLB 1BIHA 1EEYA 1U8KA 4MX7A 5BO1L 3W39A 2X4UB 2AEPL 5CJOH 1NAMH 4UV4H 4JDZA 1B4RA 2BY2A 1PLGL 4PJ7E 2P46B 5BW7C 5T3ZL 1GXEA 1GSMA 4LDEB 4U1MB 4ZNCD 1ZHNB 4IRZH 1MFAH 5F72S 3TA3B 3FOMA 2X4PA 1INQA 2VC2H 5HI5C 1UC6A 2QQLL 4OCYL 1QA9A 1PY9A 5F1IB 4IIQC 4MJ5A 2VN4A 3HA0A 1AO7B 4ZOEA 3A6CL 2E7CA 5A3ID 3HLHA 1R3LA 3TCXA 3WL9A 2C1PB 1QBML 1U58A 1TITA 4WTXA 4I0PA 3QIWC 5CP7A 1AD9A 4Z7UE 5T5FL 1SEBB 4HPYH 4NGHH 5T5NF 2O5XL 5IJKC 3RGHA 1LO2H 1NCBH 5E2TL 4JR9H 3ARED 1M05B 1BAFL 1U3HA 3LRSA 4KUZL 3RY6A 3TYFA 4N0YH 2VL5B 3PHQA 3VD9A 3AROA 2DLFL 2V7NB 3RVVD 1T7XA 4KK6D 4DUXA 4NDMA 1VGEL 2W92A 4RMUA 5C2BH 5ABDE 5E8NB 5C0AA 1U8JB 5GRUL 3W2DL 1MCLA 5FGRA 5K9QG 4O5LH 1A9BA 1JNLH 2PNDA 3EO0A 4C58B 1KPVB 1QFOA 5IQ9B 4WNQB 3QUZD 1UWEL 2E8YA 1QSEA 3C60B 5D2LF 5KSVB 1D5MA 2VDML 4ONGL 2M26A 3P4MA 4OFVA 1T03L 4XVTH 3IAPA 1ZLVH 3WNNA 4GBXA 1EVTC 1HKLH 4TTDD 1ONQB 1J0IA 1RZGA 1J12A 3TT1H 2X1PA 5I75C 4U33A 5DJ0A 1MWAA 1L9NA 4R8WH 2P5ED 2VXVH 3OGCB 3PNWA 1INDL 3PWLA 5I8EA 1KN2L 1NCWH 5DI8A 3MLUH 4HHAA 5IOPB 1YEJL 3GIZH 3RWCB 3EFFA 3D1MC 5C0DB 3MROB 1CIDA 1IGYB 5CJXC 4YHIA 4FQCH 3IFLH 3H9SB 1U36A 4NJ9L 3DYOA 1FJ1A 5DUBA 4CVUA 2A73A 3TJEL 2XPGB 3NVQA 5L6YH 5MEOB 1Y18A 1P1ZA 3VFOB 3BGFB 1SY6H 4XHQA 1T0MA 3PXHA 5KVFH 2ADJA 4HJ0D 3QXUA 3ZKQD 4Y88A 4FABH 1MCSA 4OLVL 1M71A 5D9BA 3O6FC 3NFSH 1EJOL 3MRMA 4KROB 2DL9A 2KKQA 3KPRA 3LKRA 4KRPD 4QRTA 5E2WH 4GO6B 1CF8L 4NQUA 5E56A 2GW5A 5D71L 3S37H 1KG0B 2C3VA 3UTZA 3MNVA 4MWFB 3KPRE 5IMOA 3OL2A 1LE5A 4OZIE 3WFZA 4TYUA 2YKLL 3MLSL 3GHBL 4CNIA 1AE6L 1HHHB 5EZLB 2Z91A 3ARYA 1U42A 2HJKA 4DVRH 1VGKA 4K7PX 4HKJA 4WW2F 5E99H 1NBZA 3O9WB 2O26U 4V1DA 4X4MA 5KJRL 1VEPA 3KR3H 1GGIH 2X4QA 5L2JA 3RKPA 3IFOB 1B0RA 4JCMA 3L6FB 5TE4L 2D7TL 2YUVA 5TDOA 2AABH 4M6ML 4ZAKA 1RIUL 2ORBL 4PRPD 43C9B 3C6LD 1I85A 4J6RL 5ISZA 4M5YL 1UM6L 1U8MA 3RTQA 1YEKL 3MV9B 3LMJL 1M7DA 3H8NA 1U8LA 4OFYD 1V3MA 1YEHL 1DUZB 3D2UB 3NOIA 4PJAF 3VMOA 3X13B 3P73A 1V04A 2EDQA 1VERA 5LGJA 1DBKL 2AJZB 4IIQB 3MFFA 4JCLA 2GSIA 4C4KT 4MDJA 2HH0H 2DIJA 3G08A 1MAMH 2DQUL 1NCAH 2VUOA 4AIOA 3X3FL 2R56L 3VWJD 4WTZG 3PQYE 4KHTH 4P4RB 4HXBL 2R2HB 3FFCD 4UU9B 5F7UA 1GAFH 1Z3GH 3ZDYF 5C08B 4I3RL 5DD1H 3TO2A 1P4LA 3C9NB 4Z76A 5EUOB 1H3VA 4JN2A 4PYGA 1XGQB 1X5XA 1TZGL 3WE6B 2KPNA 3CUPA 4LKCA 2AK4D 1FO0B 2HMIC 1IQWL 1QG3A 1MFBL 2NW3A 2JJVA 2LVEA 3OKNB 4KQ3H 4UNTA 4Y8AA 1T89C 1XR9B 1R5WB 2VDLH 1FLTX 4MNQB 1N6QL 4HMDA 3INUH 3PWVA 5HJ3A 4QHUA 3L3GA 3MSPA 1S78D 1R5IB 2MSPA 2MPAH 1EIBA 1C5DB 2K3TA 2EDWA 3ULUF 3SOBL 1VFOA 4DK6A 2R23B 4NNXB 2GTWA 1BGXH 5CEYA 4F58H 2H8PA 1D9KD 4CADB 2IGFH 4JHWH 4OLUH 1G9MH 4RNRB 1N4XL 1QNZH 2WBJB 2WWMC 5ADPL 4YHML 5IIEA 2Y06L 2HT2D 3WIHA 4DUWA 5EA0L 3MV8D 3QQ3A 2XNAA 3HUJB 5HYJB 4Y4FD 1RUQH 3PUCA 4F3FA 4WU7B 4N8VB 4FQ2H 2X41A 2VZUA 1IZJA 1G0XA 4QRQA 3RWGA 3MYJB 1UZ6F 2Y5TA 5CSGA 2BSTB 3MRHA 2VQ1A 2FDBP 2J8UF 2WUCH 3RVWD 1MCPH 1T7WA 1RUKH 4YXLH 5GGVL 1RUMH 5ERWA 3VCLB 4I9WD 1NFDF 1H8OA 4MQ7A 1YNKL 3OJVC 3UDWA 2GHSA 4ERSH 4JY5H 1G7PA 3NCYS 4D0BB 2NXYC 3FRUA 3FZUD 3O6FB 3OPZH 2X9WA 3BSZL 3EJZC 1KIUA 3BKYH 4NO3B 4D0CB 3ARDC 3V64C 1Q9LB 1P7KA 5C9JB 1UGNA 2IPUG 3F7RA 5BS0A 1DQLH 1RK0B 3Q5OA 4JRWA 4Q9RH 4URTB 5D2LE 3O41A 3QDJD 5FA4A 1L7TL 1TQCC 2OL3A 4Z7WB 1S7QA 2IJ0C 2RCSL 3CLFL 1A2YA 5E8OB 4EQ2A 4I0PD 3MRPA 1NLDL 5BS0E 3HZKB 3B2UD 2OQJA 3ZDZF 3NZ8A 2BXZA 4JZJC 5BVPH 3GSQB 4P4KB 2EE2A 4KJPC 1CDCA 1VEOA 3ZKNC 5IB4B 2DAVA 1U3HD 3RVXC 4YHNB 5EU3A 2J88H 1ZT4B 4R26L 5EU7C 1OARH 2L7JA 5L9DL 1CGSL 2UUDK 4XVUC 2DQGL 4XZUB 5JXEA 1OF2A 1I9IH 4X9BA 1JJUA 2GCYB 5C0AD 4LSRL 3GJFB 2Y5EA 5GS0L 1F4XH 3LIZH 4JKMA 1YEGL 3MRFB 4NM4L 3M8OL 5BOPA 3HC4H 2C4XA 2A74A 5JDJA 2AXJA 3OXRB 4JJ5A 4LSUL 5HYQB 1OAQH 1EHNA 4K23H 2X4RA 1QSED 1MRFH 4PJHF 3WXVL 4XNUH 5I1LB 5GS1B 1ZLWH 1H5BB 4X4XA 2HQSA 2EDOA 2DM2A 2EE6A 1V3KA 1UG9A 1MHEA 4HKBA 4GBXD 2IEPA 1JZ5A 2ESVA 3JTTB 3GM8A 3MODL 1XH3B 4U0RB 1AGCA 5BZDA 3V5DA 1FYTA 1XGTA 3B9VA 3H7LA 4WW2A 1MCNA 2JB5L 4BKLA 2OX5A 2VR9A 5EIIA 1FRGL 3WUWA 4D3CH 4MVBD 4Y5XC 1A7OH 3PDGA 4K7PY 5K9KA 1G7QB 5I8KL 1KLUA 4JAMB 3O6KL 1JHKH 4PRDB 3VMNA 4ONFL 4C56E 4PJ8D 3K1DA 3RY5A 5E2JA 5D6DC 3LKPB 1UM4L 3UTPE 3QXVA 1JZ3A 2AJUH 3LSOA 2VXTL 4OIBA 3LS4H 5EZJB 2JJWA 2NY2D 5D7LA 2DQIL 4X5LA 5HYIA 3CH1B 1NGYB 4KHXH 2EYTB 4PFEA 5TH2B 4EBQL 5HBBA 4YDVB 5D1XA 1XCQB 1QLEH 3B9EA 4Y1AB 5FYJU 1X5GA 1KCRH 2JLLA 4JPVH 4U1GC 4PJAE 1YZZA 3E8UL 2Q20A 2EEAA 2IALA 3CFIC 1IC1A 1P4IL 1HWGB 1AP2B 4D9RD 3BVNB 5K93A 3BN9C 2YD4A 3WIHH 1Q9WB 5IMKB 3MLZH 2J5LB 3OJMB 4LVEA 1U8HA 5CS7A 1EEZA 4Y5VA 4RDQG 4XPTH 2AGJH 3V6FA 1U2CA 2FJHB 4PLKC 5LWYL 5ESQA 1KV3A 3UTOA 1W8OA 4V1DD 3HR6A 3A6OA 3TO4C 3O2WH 5HHNA 4P2RE 5GS0C 1ZT1B 2Z92A 4GAGH 5DDHB 5FKPA 2LV4A 1KTRL 4HGKC 3V0VB 5ISZD 3RTQD 4F33B 5IT2H 2F53A 2ATPB 2LABA 5TE7L 3MLXH 5HHQA 2Q8BL 4KVCL 3KS0J 4QOKD 3RWEB 2CUMA 2F15A 4GW4A 1CQKA 4YZFF 3MRBA 5GZOC 4MD0A 3D9AH 4S1DD 1S9YB 2EDEA 2ID5A 1HH9A 1TQCB 5CZVL 2HVKA 3ULUE 4LNRB 1OP5H 3VGBA 2OL3H 3HPLA 4W81A 4M1DL 3VXPB 1C5CH 1I9JL 2NZ9C 2UZIH 1RJCA 1S7XB 1OTSD 3QG7L 1EO7A 4N90D 4G6JL 2I27N 1CU4H 4ZSOE 4JZJB 2MCPH 4G6AD 1YY9D 3SDDC 1HSAA 1O0VA 1BBDL 2DF3A 4Q9QH 2GTZB 4CAGA 4G5ZH 1MJJA 2IAMC 2IPTH 4XAWH 5C09A 1LDPL 2FO4A 3DI3B 3KPNB 1OAXL 4J3VA 3ILQC 1UWXH 1XEDA 2XQYK 3ULSA 1IGTB 4Y2DC 3MNZB 1UZ6E 5EORL 3SJVE 5IESH 2J8UE 4LQFL 5EOCJ 1TDQA 1RFDL 5BOZG 5C0CA 3E6HA 4IOFC 1NFDE 2X70A 4X99A 3UTQA 1JV5A 2VJXA 1MCFA 4U6VL 5GJSL 2VOTA 2FJGA 5MEPB 4XVSH 5DJZA 1CFVH 5HDQL 5ENWA 3NABH 1FIEA 5C0CE 4X5WB 3SPVB 2R29H 1TJGL 2Y25A 5E03A 1KCUH 2VITA 3N1MC 3W9EA 1R0AH 4KU1A 2D0FA 3CC5B 4OTXH 1E28B 1FC1A 3C5ZB 4Y5XB 3GSNB 3Q5TA 3D25B 2R1WA 4E0RA 2JKXA 2HFEA 4OM1H 1EERB 1RZKH 3BZDA 3Q6PA 5DJYA 2X10A 3VG0H 3ZDZE 3WIFB 4LSQH 5IR1A 3G9VA 1L9MA 2WP3O 4Q2ZB 4JO2H 5ICXB 4DKAA 4X83A 1YPZB 1MCWW 1U2HA 4LGRB 1YMMA 3LN5A 3RP1A 1KN4H 2DQDH 5M95B 4OM0H 4U6XB 4GAFB 1WT5A 3IDUA 4WI3A 5I16B 3S8WA 1QP1A 1MIML 2FSEA 2WMPA 4ODXA 5F3HA 4YBLB 1CLOH 3F7YB 3O3EA 1OW0C 2I5YH 1QLGA 4NO0D 4U1GB 3KLSA 5DLMH 1U3YA 1ZA6A 4FFWC 2R9HD 1TVHB 2H2PC 5DMKA 3GSUB 3IFNH 4GS7C 1D5XA 3P4OB 2VE6B 3NPSC 3HNVH 5F89A 1L0XA 1CE6B 5CBAB 3OG6B 4IOIB 2Z31D 5GTQA 1KJVA 3F12A 4Y0GA 3ZYJA 1NDMA 1K3ZA 3RUGA 3U46B 4HWEH 1XF4A 3TO4B 3VA6A 4LVOC 4OSUL 5DO2C 3K74B 2BRRH 5D9SB 4GG6F 4M7LT 1N59B 3MREB 4JFQB 1WAAF 4PGCA 4YC2C 1UB5B 1BQHG 4R90H 5JXED 5C0FA 1SJEB 1NC4A 2ARJQ 2R0LH 4GXVL 1ZGLA 4TOYH 3VFVA 3FVZA 1J88A 3HE6A 3REWB 1M6OB 1SYSA 3LEXA 1CBVL 1JMXA 1DBJL 3HZMB 3WW9A 4WY7H 4OZHB 1NEZG 1UJTA 3KXFE 3SY0A 3BPCB 4ODHH 3WKML 4TSAL 2GJ6B 2I24N 1A21A 1MEXH 5BV7B 1KC5H 1HXMA 2ESVD 1YUHA 1JN6B 2DMBA 4W4NA 1G0YR 4XMKH 1T5XA 1FYTD 3V5KA 2QBWA 3C5SA 3PABA 2HN7A 3AS2A 5DJ2B 4K3HA 4LMQE 4P9HL 4AT6B 1BOGA 1IE5A 2W9DH 4H26A 4NZTL 5I8OL 3VMPA 1BVKB 2IAMB 1LNUA 4L8SA 3VXTA 4NWTH 3MLVH 5I9QC 5DZLA 4KKLC 2H32A 4HZLA 3QQ9C 5JIKA 2YN3A 1MOEA 4Y2DB 1H8NA 5FF6B 2EXYD 3CFJA 4LEXH 5I0ZA 4ALAL 3DTXB 4C83B 1VACA 3QYCA 2YZ8A 3OJ2C 3KWWA 4G9DB 4KV5F 5DQ9A 5D7LD 3ELAT 4X7TA 4JHAH 2XTJE 4RZCA 3LCYA 4JVUA 2E3VA 3CMOL 5D1XD 4NQEE 3U0PB 3V6ZB 4NZUL 3EFDL 4U6TA 5C07B 3CZFA 1RZFH 4MA1C 3RKDC 5EO9A 3TIEA 3QEQD 4WUUB 3BIBX 1JGUH 1EGJH 1P9MC 4P59L 5I73C 5D93C 5JUEL 3LV3A 1JWUA 3VD3A 5IFAH 3GZKA 4YZFE 3RL1B 2WWKO 5C1MB 3HLAA 1A7QH 4EI5D 4PV8B 2IC2A 4PG2C 5BMFL 4Y89A 4DFIA 2QKIB 1KT2B 3QRGL 5L88H 1OHQA 4OUUB 1W0YT 4YH6A 1JNHA 1DDHB 3OKMA 4I2XE 1P4BH 1E6OH 2I60L 5IVOA 1P53A 4HIHB 4WV1B 1OAYL 4HWNA 4XCFL 1FNEA 1MELA 4MGXA 3UPCA 4MXQC 1OWRM 4RDQF 4HF5H 4XVJH 2XA8H 2H26A 4JREB 3CVHA 1ZGLP 1CRUA 1AKJB 4QHNA 3RWIA 1IC7L 2BX5A 2DQFB 4TNVF 1FNSH 5ALCH 2FEEI 1K3IA 2F53D 2FX8H 3NFPB 1CFSB 2DBLL 4RSVA 1OCWH 4WWKB 4OZ4A 2XTLA 3KDMB 4LCCA 4QF1B 1W72B 5E1HB 1L7IL 1A0QH 1N8ZB 2NYYD 3VH8B 3DETC 3JV6B 3BH9A 3MLPA 3K4AA 3G04B 4O2FB 3HS0A 4FQHB 1J1PH 4GS7B 2NXZC 3GHEH 1ZSDB 2AK1L 5LAXB 1T22B 5JDSB 3NPSB 4P9HC 3VXRD 5DSCB 4P2CG 3MOAL 2EYRB 1CVSC 1E27B 1Q72L 3QEUB 4FQLL 5FK9B 5GZNC 3VI3F 5D7IF 2Q76A 4JGMA 5MHSE 4N0CD 3W5NA 1UCTA 2PYFA 5F44A 3OB0H 4WRLA 1Q8MA 3ARSA 1IC4L 4XP1L 5FO8A 1FN4B 5DD5L 4AZ8A 5T1MB 2B0SH 4YC2B 7CGTA 5C09D 4JG1H 1CDGA 3DROA 3L1OL 4XBGA 3CU1A 1NAML 2X4OB 1TENA 2GHWB 2V5MA 4P5KB 5DHVA 2CKBB 5JIIA 4L9LC 2ZCKL 5C71A 2X9YA 2LU4A 4KDWA 1INEL 2FHCA 1LEIB 1J8HB 1QVOB 4AY0A 3AREC 4GG8A 5GHWL 1F4HA 2D31B 2P8MB 2J6EL 4M4PA 1T3FB 3QJFA 4JFPB 4HIEB 2GUOA 4RMVA 2XFXB 3BFOA 2CUHA 2ZKHH 3RVVC 4YFLI 4D9QE 4HPYL 5IB3A 5EFIA 2A6JB 3TWCH 2EH7L 2HFGH 3CXHJ 2F74A 1U8PB 4R96B 4NT6A 5I9QB 1WAAA 3BD3A 2G2RA 2H32H 2HKFL 1PY4A 5D2NA 1Q7FA 2Y07H 3SCMB 4JN1L 3LKOA 1MUJA 1RZIB 1JGLH 4PP2B 4GG6E 4F9LA 4O5LL 5IW3A 5DR5H 2Z93A 1YMMD 1WAAE 5BRZB 1CLZL 2E7MA 3OKOB 12E8L 2CRYA 2EC9U 4R7DA 3WBDA 4K2UL 3VFNA 4F9PC 5KBNC 4KK5D 3VWKD 1RWIA 4MA1B 1JRHH 3QXWA 3DRTA 1HOCB 3T2NH 3IVKA 1K4CA 3G5VB 5I73B 2BNUA 1QBLH 1RQ5A 3QZWB 4PREB 4JKLA 1WFNA 5A2LH 5DS8B 4NPYB 4K3GA 4NKOB 2I25N 2AXFB 3TZVA 2SEBA 1OWWA 1W0VA 1YNTA 4YE4H 2J12B 4QRRE 2JJTC 4PGEB 4HJ0C 1LP9F 1YY8B 2PCPB 3KNBA 4FQCL 2P5WE 4G8EA 3VFTA 4QCIA 4Z95H 5C3TA 2AXHA 1HIML 3U6RB 2R15A 4E5XA 4H88H 2A2QT 5CD3A 2FJFB 4PV9B 3MV7A 5EUKB 2X4SB 4BFIB 4FG6C 4KRPC 2EIDA 1JWMB 3JZ7A 2Z0BA 1ZXQA 3CVHH 2VR5A 4F80A 2Q7NA 4A6YA 4NRZA 5CKGA 4APQA 5JHLH 3LQAH 2YK1H 3SKOA 1VFBB 3VFRB 5HHVL 1EJ6A 4XWGH 3DURB 1T2XA 3HE6D 2X4NA 4KV5E 5DHYA 3EDEA 4EUPB 3PF2A 4JRYB 2PXYB 3MGTB 1MPAH 4C57C 3CX2A 2R1YA 3CXDL 3JV4A 5HHMB 1LVEA 3SE3A 4MQXD 4LAJH 5A2KH 1N5YL 4XBEH 5GISH 2ZUXA 1S7TB 4XP6L 2YD7A 5INDB 5TGBB 3PHOB 3RWHB 5E99L 4F7EB 3RWJA 3WHE0 4TQEL 3QUXB 1NSNH 2WBWB 1B0GA 1H15A 1YEFL 2ISMA 3PWPA 4PY8J 4XXDB 3R1GL 3FFDB 4LVHC 1JGDB 1JPSL 3KLHD 3BP5A 4OB5L 2LAAA 5MENA 4JM2F 4X80L 3S35L 4LLQA 4DJMA 5KG9B 2G75B 3DUSB 3GM0A 2FD6L 4PWZA 1T1YB 5DHVH 1ORSB 1AFVH 3S96A 1R24B 2I9LB 4L9LB 1FNGA 4J3UA 4DVBA 2A77L 1FLRH 1ZT7A 1GGCH 4UUJB 4P2QB 2PETA 5MENE 5T3XL 5EO0B 3VXMA 4UT7L 1NBVL 1F58H 5JZ7D 1XT5A 1WBYB 3L3OA 4S0SD 5DXWA 5EULV 4H8WH 3DX8B 5F9JB 2QR0B 1NCAL 4QWWC 1MHCA 4XNZC 1QFWH 2BP3A 2FYYB 2WQRA 3UBXA 1DUYB 4WHCA 3RPIB 5KVMC 5MI0B 4YR6B 4Y4HD 2ZUVA 3S94A 4PJCA 3UYPA 2XRAH 2ZZUT 3FB8B 2O61A 2WP3T 4FP8H 1PKOA 4MNHA 4UV7H 4MCYB 3DUUA 3VI3E 5D7IE 3MXWH 5C0BB 3L95A 1JHTA 5JO5A 4PYHA 5CWSA 4HS8H 4LCUB 5AZ2H 4MXVF 4OGZA 4NQDB 4XBPA 3INUL 4X4ZA 4K8RL 1JI2A 1RJYA 1FGVH 2DI7A 4GKNA 3T8XB 1ITBB 5IGXH 3MRRB 4GKZB 1F90H 5JPNB 1QYGH 3WJLC 5JHDA 3BESR 4YGVA 5F70A 3PL6D 5B38A 3GO1H 1G9ML 1S3KH 5DD6B 1MWAL 1IEBB 1QNZL 1YJDL 4PP1D 4PJDA 2IH1B 5JHDE 2W9EH 2XKNB 5DJDB 3RVWC 1VDGA 1T0PB 2VL4A 1HWHB 3CFCH 4KZDL 1P6AB 4IJ3C 3WV0A 2X05A 3W81A 3TBSB 4YHZL 2B1AL 3FQWB 1MCIA 3BGAA 4O00A 4FQ2L 2DICA 1GPOH 3LVEA 4G7VL 2BMKB 3FZUC 1HDMA 4ZUTA 1QFUH 1QBIA 1RZJL 1N64L 5IHLB 1ACZA 2V5RA 1PYWB 4CU7A 3U4BL 4HGWB 4UIKH 1DBAL 4MJ4A 3VGHA 4M9PA 1KTLA 3TLRA 4KMTH 4A6YH 4I4WA 5DUMH 4UQ2B 4ZO9A 1XAUA 3DVFA 5GSRA 1ZLVK 1EAJA 1JF6A 1MHHB 2JELH 2PO6A 4I0PC 5D1QB 1C9UA 4GRMA 3UTSE 2AXGB 4IMKA 4U1HB 4GJTB 4MDIB 1CWVA 3NN8B 4X6CB 1U3HC 3CPLA 2X1WL 2IBZX 4JZNB 2YWZA 5ESVB 5F1NB 2APXA 3T1FB 4HKXB 5D8JL 4LP5A 2UZYB 3WMSA 3NPZB 1R3HA 3X12A 4WI7A 1VADA 5SWSE 4JGUA 2R8SH 3HI5H 1ITCA 2DD8L 3ULVL 3VXUA 1IGIL 4QRSB 1OD7A 1LP9E 1OARL 3K2UL 4KDVA 3W11C 2BDNL 2PTVA 4NRYB 3DX6A 5I17B 2HRLA 4QRPD 2ZUSA 5F7DA 1UB6A 3OWEA 4U1JA 3VXUE 2P45B 4AEIH 2F54E 3IU4H 4M43L 3T08A 4GBXC 2VXQL 3LRGA 2W07A 4UI2A 5IMLB 1G9MC 3E6FA 5D70H 1MRFL 4ZQKB 4I0KA 4RX4A 1OM3L 2WWKT 1IAKA 3EHBD 3MJ7B 5LCVL 4MVBC 4UT9L 2NNAA 2QSQA 4KKAC 4M93C 2BNRD 1X7QA 1IBGL 4DEPB 2AK4B 3ZZ1A 3QNZB 4OCWH 3NCJH 1FZJB 3IXTB 4U6HB 1A3LH 5CZKA 2P47B 1JGVH 5AEAA 2R4RH 4ZFGL 3BUYB 1AQKL 5L7XH 3IDIA 2FLBT 2IANA 2A6KA 5J4MA 4FQ1H 5JW4M 4KI1A 3GMMA 1KEGH 3NACL 3BGMA 3H7BA 4FQIL 3T0XA 1UA6L 2NY2C 4PJXA 3MCG1 2VDKL 5L2KE 4J3TA 4U2YA 1D5IH 5I6XC 2ZPKL 4HXAL 2XN9D 4WHYG 1JZ8A 4XP4H 4HS6A 3SGJA 1OAKH 1D5BA 3MV7D 2HA1A 3S8VA 1BF2A 1BIIA 4JM2A 5IB1A 1PG7X 5HI4D 2QV2A 4NUJA 5CCKL 3HNTH 4KRNA 3THML 4LIQE 1L0YA 1QFHA 3I02B 4APQD 2XWTB 3RU8H 3SDXA 5IVXA 3FQNB 1DBMH 1AGEB 2C1OB 2WNGA 4XCNA 3U83A 1NUDA 1A6VL 3O3AB 4L29B 5C2UB 1B6DA 5SX4H 4KGJA 3WS6A 4JO4H 4WEBL 4IHOA 4KAQL 4ZPVB 1S7RB 4ZO7A 3OXSB 3ZYIA 1BZQK 3L7FA 4HT1H 4YUEL 3PV6B 1IGCL 6CGTA 32C2A 4OI8A 4PJ7B 4PGDB 1KUMA 1OAUH 4ZFZB 3CU7A 4ZAKC 2RAMA 1EEYB 2EDXA 2VXSH 5HHOA 1AXTL 2MKWA 4M5ZH 2XT1B 4QYOA 1I85C 1JF1A 2GYSA 2XZCH 3RTQC 4PY7A 1CDIA 4N0UA 4N5ED 3KS0H 1DE4A 2PN5A 1LQSR 4G8IA 3PWPD 2LTQC 3WFEH 2VLJA 1KIPB 4TVSa 2X4PB 1G7JA 4PJEA 2EICA 2IVZA 3BWAB 4Z7UB 5E6ID 1QA9B 4MJ5B 3TF7C 4F57H 5I1GL 4K94H 4S1DC 4EEEA 3UJIH 2CO7B 2PYEE 4G80A 4D9LH 1XR8A 1R3LB 3WL9B 1EV2E 1RJLA 2KL6A 5CP7B 4MXVE 1AD9B 3O6LL 1OTSC 5GX5A 3MLWH 1ZANH 1L6XA 3PGCA 4DK3A 3I50H 3ROOB 3SKMA 1YY9C 3ZO0A 4HBCL 2B39A 5I15L 1K8DB 2WSKA 3VXMD 4Q97A 5FB8A 1Z6JT 1U3HB 3TYFB 1KBGH 3TN0A 3IDJA 4X6BA 2HT4D 1PX4A 4UOW0 4CDGC 3RVUD 3PHQB 2YZ1A 1WISA 4QXTA 1G7LB 2BVPA 5D9CA 2IMMA 1TTUA 1NFKA 3U9PL 4ETQA 4KTEL 5I1EH 4NDMB 4P5TB 2YRLA 3HKFA 4M7LH 5ESAA 5CBEA 1KXQE 1I4FA 4Z7OE 3EO0B 2IQ9L 4G5ZL 2UWEA 3TNMA 2A6IA 4X9IA 1MVFA 1CRZA 2M2DA 3RJQB 3GSNL 1D5MB 1TZHB 2DN7A 5J6GA 3D0VA 3C6SA 1C5BL 3UJJL 4P23A 1OGTB 2RFXA 3SDCB 1NMCC 1WZKA 3BQUA 3BP6B 5DJ0B 4C54A 4JY6A 3PWLB 5I8EB 3PNWB 5J0BA 1YA5A 5DUPH 4JQVA 4PRAB 4M7KH 1IL1A 1U8NA 4XPAL 3ZL4H 4XPGL 1CLCA 4FS0A 4M93B 1EDQA 4HH8A 1FJ1B 5DUBB 1FG2A 1DANT 1WZLA 1P1ZB 2OI9C 5DURB 2E9WA 1I9RH 1ZHKA 2IBZY 4O02H 4CRPA 1T0MB 3TC9A 2P8PB 1S5IH 2B4CH 4ISVA 3U48A 4KXZI 4M6NH 4IBLT 2QQKL 3UDWC 5I6XB 5EUOF 1CXFA 1M71B 3VFWA 2CPCA 3MRMB 4IRSB 3KPRB 5E24E 4OZIB 4UQ3B 4DGYH 4PJFF 4WFEE 2UY7A 3PGDA 4JO3L 2C3VB 3UTZB 1LK2A 1NGZB 3MRNB 3MNVB 2W60B 2QSVA 4G6MH 1LE5B 5TF1L 2G9HA 2V91A 3CDCA 2A9MH 3KJ4C 1I8LA 2AAVA 3G6JF 1XZ0A 4CNIB 3NFNB 3UYRH 2Z91B 2PO6D 1UACL 2HJLA 3ARBA 4PS4L 2IQAB 4HKJB 1MLBB 1H0DA 5GX1A 4NQTA 5A16B 2VAAA 3CX5K 3ARFA 1T21A 2DS4A 2X4QB 3HNVL 4HUNB 2Y7QA 3WUZA 3QAZC 1B0RB 3O4LA 5DA0B 1MAJA 2DQHH 4K7FA 2XQYG 3GMNB 5DRXA 4ZAKB 3RDTA 5JXEC 4CW1A 3G5ZA 3PWNA 1P84K 1U8MB 5BV7L 3RTQB 1A6UH 2QADB 5I1DA 2VDQL 3O4LE 1U8LB 5C3LD 2YMXH 4LLMA 1GRWA 4NKMB 3OKLA 3BX7C 3F7QA 3P73B 1S9KC 3AUVA 5LGJB 3QDME 3ZLQC 1R3KA 4G3YL 4ZPTA 3FRPA 4RBPH 5HHXH 1UZ8B 2NX5E 3HG1D 5F7KC 2GSIB 3LZFH 1MCKA 4MDJB 1DN0A 3DMMB 3WCYA 3G08B 3QRFM 2HRPH 3HHRB 2AEQL 2Y23A 1XCTB 3V8OA 3D3VE 1HHJA 1OB1A 4WY7L 3W0WA 1A1NB 5CEZL 1WV7T 3JXAA 2AJSH 4WW2C 4RX4D 1Q0YL 2VDRL 5JW3L 3OR7A 2NZIA 1TETL 1LO0H 2VLRA 4GMTL 4JN2B 1MFNA 1RZKC 2ADIA 3N1QC 3U0WL 3CUPB 4LKCB 5F7MC 2MCG1 1EHAA 1VSCA 1WZ1L 1ZTXH 1WLHA 2EXYC 2IAND 5KVEH 4OCLC 2BY3A 3TVMD 3GSVA 2BJML 3OZ9H 1W2KT 3PWVB 5HJ3B 5LXGH 1HYRC 3MLVL 4ODTL 5GRVK 4LARH 2H45A 2AV7A 2APTA 3DOSA 5D1XC 2FGWL 1S8DA 3O2DL 1A7NL 4MB3A 5EWIH 3U79A 2FEEL 1EBPA 3BW9A 1N0XL 1WF5A 5A1AA 2GTWB 3PP3H 5CEYB 5C0EA 1ORQA 5J9PA 5EBMA 1NGPH 2H8PB 5F7LB 2EECA 3MBEA 2CLRB 3FN0H 2J7LA 3WNMA 1F97A 3PIQA 2VAQA 3F7PC 3QFDA 5IIEB 2NPLX 1B3JA 4OFIA 1X5ZA 3QQ3B 3JSSA 2XNAB 3VFGL 2GK2A 3CDGA 1JGUL 1FSKC 4JFXA 4RAVB 4RISL 4S1RL 3TBYA 4Y5VC 1CE1L 3FO9A 4HLZH 1PEWA 3HCVA 4F3FB 4HDIA 2BY1A 3VW3L 3RWGB 2Y5TB 4DOHB 1NGXB 1RHHA 2OI9B 4KGLA 3KAAA 3FT2B 2VQ1B 4RAUA 1WEJL 5SWZA 5DFWH 4LPWA 4HPOL 5HHOD 1VHPA 1C12B 1UWXK 2J4WL 2KBGA 3Q3GB 4FQXC 4HUMB 1G7PB 2FBOJ 3FRUB 3WO4B 3KPTA 3S88L 3S34H 4JFED 4HF5L 3ROLA 3FCTB 1QFWM 3RVTC 2VLJD 3B5HA 5ICZB 1FC2D 2DM4A 2N56A 2GK0B 1FNSL 1HINH 5BS0B 2X89D 4NKIL 4HS3B 5B3JF 3F6IA 3WLBA 5DT1H 4FZEL 4MMZC 3KJ4B 3RWDA 5E00B 1EFXB 4YDIH 4JQIH 4X7FC 3KPSD 2OL3B 1S7QB 2ENYA 4K07A 3MV9E 2ICWJ 1A2YB 4U6YB 3MRPB 1FE8H 3BZ4A 1CYGA 1P7QD 3RRQA 3NZ8B 4MJ6A 4D0DA 3GHEL 3P0GB 2EEDA 5E2UH 3QULA 3TT3L 2CKBL 3QAZB 1IMHC 3MBXL 3ZHLA 2I26N 3TNNA 3WNPA 3TN0D 1U8OA 4UB0H 3T3MF 5HGGS 5EU3B 3B9DA 1FNHA 4YAQA 1OL0A 3V5HB 1DQJA 4BQ6A 1NMBL 2WIMA 4U1NA 2DTMH 2GKIA 2FHBA 2RGSA 3K0WA 1ZHLA 3QB7C 5JOEA 1AXSA 1Q9KA 3DRQA 4JJ5B 2VQTA 4QXWA 1DFBH 1RVFH 4KJWD 1AJ7L 3VFMA 4DZBA 5BQ7A 2HG5A 35C8H 5IVZB 4LHUD 2DL2A 1UVQA 3L5HA 5HHPA 1MHEB 2DOCA 4YIQB 1OSZB 4UAOB 3FQUA 3G6JA 4ZDHA 2ESVB 4PJFE 3HB3D 4P23D 2AJYH 4YDLC 4AL8H 2EKSB 4O5TA 2H41A 5BZDB 4GNAA 1U41A 4WW2B 2OP4L 5AZEL 4BKLB 1H3PH 1BM3L 1DVFA 4ELMF 5F7FA 5EIIB 4JKPL 1IAMA 3IXAA 5J8OA 1U3ZA 3G6JE 4OI7A 3SOQA 4ZUUA 1GOHA 4JY4A 3C8KA 1FFRA 1T2QH 3O4OC 2ZCHL 3BXNA 2H9GA 5GGUB 5I1IH 1I8KA 3E3QE 4L3EA 4EN3A 3VU2A 4MB4A 4YDJA 2HFGL 4X8XA 5EDXA 3LSOB 5EN2A 5D7LB 2O93L 5KVGH 4PJAB 2H6PA 2JIXB 5KSBA 1WT5C 4G6KL 4KK5C 2GAZA 2JF1A 2Y07L 4HIIB 2YPKA 4ODSH 1L4IA 5T3ZE 3BP4A 5KSBE 5I1HL 3QXAB 3FW0A 3P4NB 5E6YA 3ILPA 4OLWL 2AJ3A 1JHLL 1JRHL 2G60H 4WGWB 4P2RB 3X14B 1U8HB 1EEZB 1RIVL 2EIZA 5CGYD 3V6FB 4LEOB 4PLOB 3AMLA 3CK0L 5ESQB 1NUNB 3O3DA 3ARFD 4BZ1H 3GIVA 4XC1H 2B5IC 1NDGB 5HHNB 4D94A 2QQNL 2Z92B 3I85A 4KPHL 4MSWA 2EIBA 3L5IA 1DLFH 3G5XA 2PR4L 4C56D 4UNUA 3RDTD 2APWA 4IRJB 2R69H 5B22A 4LHJB 4FQXB 3UO1H 3TM6A 3ET9F 3HI6H 5E1AA 2LAGB 5ADOH 4QGYA 3T4YB 5E8DH 5KVDL 3SE8H 3HE6C 1QUNA 3TBVA 3CVHL 1DLHB 4WU5A 1NLBL 4BZ2H 1YPZF 3BI9X 5JHLL 2XICA 2YK1L 4NQVA 3QQNA 4ZSOB 3GI9H 1HHKA 4BJLA 4MQXC 3QZWG 1TZIA 3V52H 3AAZA 3HPLB 3BAEH 3FHAA 1JTOA 5A40E 1OQOA 3W0WD 5DMJB 1OP9A 1OP3H 1HI6A 5EC2A 1I3GH 3AMSA 2DQTH 3SJVB 5AYUL 2HKHH 1MJJB 2J8UB 2VLRD 4L8SC 5C09B 1B2WL 5BZWB 4KY1L 3T0EA 3JWDH 1CGWA 1NFDB 2MQ0A 5ALBL 4YWGH 3KLHC 1A4KA 3ULSB 2MHAA 4NBZB 5ID1A 1CIUA 3HE7D 5SX5K 1I75A 3CVIH 4FQJH 3H3PL 5C70A 5IM7A 2EZ0C 1ZWIB 1NGWB 3V4UH 5C0CB 3QFJD 4X99B 4MXWH 1U6AH 4X8JA 5GGTL 3G4EA 4B7IA 5E5RB 2EEBA 1I1CA 2PW2A 3QEGH 2FJGB 3EYFA 1S9XA 2RIKA 1ZA3B 5CSZA 5ENWB 4IS6A 3VDBA 5JZ7C 4L4VD 1AFVL 4OF8A 5ID0A 2CGRH 3TIDA 3MBED 3P9WB 1LGVA 3LKSA 2VITB 4F7MB 5B3JE 3FN3A 3W9EB 4OZHF 4GSDL 5FYKD 5F3BA 4PRIE 1NFIA 1CGVA 4YDKH 1QTYT 2R1WB 3I2CH 3GSOA 4CMHC 4E0RB 4QEGA 4CN1A 3MRLA 4OLYL 4UILL 1LO3H 3TBTA 1FZKA 4M7ZC 5AYQA 4OZGF 5FKAA 1CICA 2IBGA 3OB0K 4JDVB 5C9KA 3HMWL 4PY8I 2V9RA 4G8GA 5SWQA 5BO1H 4OCNC 1BFSA 2AEPH 4OGXL 1YMMB 3LN5B 5SWZD 3WYRA 2DLIA 5IHZB 4BYHA 4GN9A 1PLGH 1H3UA 4RA3A 3LQAC 4ZD3H 5T3ZH 3TPUB 3O4PA 3VD7A 4Y16B 3RHWK 2YD6A 4KI5D 4GW1A 4KRMB 3TGXA 3O8XD 3VFUA 2FSEB 4G8GE 4ODXB 5F3HB 4ACPA 4HS8L 4P3WA 4MA3A 3O3EB 3BIAX 1X9QA 3ARZA 4LCCC 3I6KA 1CD1A 1C7TA 3CFKB 2QQLH 4M8VA 4OCYH 4NWUL 4A0PA 2EH8L 3WSQL 4X7SL 2E6QA 5DMKB 1X5YA 1D5XB 2H1PL 2EDNA 2YD9A 2OCFD 1QBMH 5FOBA 5T5FH 3UROR 1KJVB 4MD5A 5DEGA 3F12B 5E2TH 3QIUB 2FX9L 2D7QA 4EDWL 4MD4B 3GO1L 5K9QI 1DN2A 1BAFH 4KUZH 4OFDA 1KLGA 5GRZA 4HUXB 2B5IB 5D5MA 2VRAA 3MLTB 4UINL 2BVTA 4ELME 2DLFH 1YYLL 1LO4H 1PJ9A 1VPOL 1VGEH 1WBZB 3VE0A 2C4FU 3N1GC 4NCC2 3W2DH 5GRUH 5I76A 5C0FB 1NC4B 1I1YB 3KXFB 2XWBA 3QWRA 3P3YA 2AEWA 1QFUL 4PR5B 1UWEH 2FL5B 3EYQD 4GT7A 2E9JA 3N1FC 4XNYH 2BNQD 1SYSB 3GSRA 1PKQA 2VDMH 3LEXB 5ICYA 1ED3A 4LBEB 1PZ5A 3IDYC 1T03H 1CFQB 3QCVL 1EFQA 5EU7E 3SY0B 3MJ9L 4WI2A 1N26A 1KYOK 3B9KD 3L7EA 1PQZA 4GLRH 3FMGL 4RQQA 5F1OB 5CUSH 1HXMB 3CAFA 4H8WC 5KZCD 4NQSA 1YUHB 3ZTNL 1KN2H 4Y2OA 3FOLA 5DK0A 5FGCB 5SV3A 3ZMRA 1YEJH 5L8LB 3FAWA 2GJZA 1T5XB 3V5KB 5HD8C 3C5SB 3PABB 2HN7B 2MJWA 1FP5A 4L3CA 1BOGB 1CT8A 4H26B 2P8LB 1K8IA 2CRIA 5DC4B 3TJEH 2H2SD 4WW1A 4S1QL 3VXTB 1S7UA 2FGZA 4L3ED 3QO0A 2H32B 1HN1A 4HZLB 3T65B 4IMBA 4I3GA 5D7KE 5D2NC 5I1AA 1QSFA 4L8BA 2R8SL 3U0SA 4F9LC 4OLVH 1OT1A 2F5BL 4X7TB 1K9TA 1EJOH 4RZCB 2PTTA 5IHUL 4OLXL 2O5YL 1CF8H 5EO9B 1OGAA 4OD3H 4GQ9L 5FUZL 1R3JA 3JUYA 1HCVA 4B53A 3VFSB 3MACL 3R0NA 1XGRA 2VDPL 2YKLH 4M02A 3W5MA 3MLSH 1YPZE 1IEAB 3GHBH 5E9DA 4X7CC 4HMEA 1OGAE 3TZVC 3AC0A 2RB8A 1D6EA 5F88A 2DWDB 1QOKA 2GSGB 3PDOA 2VISA 5KJRH 4CMHB 4XTRD 5E9DE 4U7SA 1NC2D 5TE4H 3RNQA 2D7TH 4M7ZB 3P0VL 1E6JL 5EZIL 4M6MH 1BZ7A 5TDPB 5E8EA 1QBBA 1RIUH 2E7HA 2ORBH 2H26B 4HX1A 4FQ1L 4DGIL 2OK0L 1V3LA 5HI4C 1UM6H 4JRXE 1LWRA 1YEKH 4NCDA 5FA3A 5EH1A 1JPTL 1A7PL 1J1OL 5IB2B 4APQC 1OAZL 3B5TA 2WBKA 4JFOA 3DR2A 2WANA 4XP4L 5IKCB 5DC0A 2CRZA 4PBWD 4OZ4B 5I1CH 4XB8A 3O11A 3NCFB 1AD0A 3VFPA 5ETUA 1FBIH 3RZCC 1DBKH 3VRJA 4YFDB 3BH9B 5LVEA 3UZQA 3HS0B 3V1SA 4ZNEA 2AKRA 2YD8A 4N1HB 4JFDE 4IDLA 1AGDB 1KEML 3LKQA 2DQUH 5ANMA 3SE3C 3S2KA 5IV2B 2GI7A 3X3FH 3FONA 1HNFA 3UTTA 2R56H 2OJZL 4HXBH 4EXKA 2ED9A 2Q76B 2BRQA 4JO4L 5MERA 3FQXA 1GC1L 4I3RH 5ANME 2CUIA 2PYFB 5I66A 2HLAA 3E5ZA 1TZGH 1LHZA 4ZO6A 3TBWA 5FO8B 2EDTA 4XB7A 3BMVA 4XNMA 5KSAA 1IQWH 3VI4F 2GJ6E 3VGFA 5HYSG 1MFBH 1YC7A 3DROB 3T0ED 2OSLA 1T1XA 4XBGB 4XGZB 1VA9A 2ICCA 4OZGE 3V4VL 1N6QH 3GBLA 2KZ1B 5L0QC 1A1OA 2GEEA 2A6DB 4YXHL 2YRPA 4NFDA 4IMLA 4LPTA 4K71C 1IM9D 3GMRA 5F1SA 3SGDI 1EHLL 1UADC 3AU1A 1TJIL 4XAKD 3SOBH 3T0BA 3UX9B 5GIRA 5CIPA 5HGHA 3CFDA 4GG8B 4Y4KA 1DTUA 1GZPA 1OTTD 3WD5L 2HT4C 3QJFB 1UH2A 3ESUF 3RVUC 1T6WA 5C6PB 1N4XH 2GUOB 5GXBB 1A9EA 4YHMH 4AK1A 5ADPH 1CK0L 2Y06H 3QXDA 5EA0H 3OSKA 4ZUWA 3WHXB 5IB3B 1KB5A 5EFIB 1M1SA 3SREA 2OMNA 1U8IA 2W0FA 2YWYA 4XPFL 1IQDA 8FABA 4NQCD 5C07E 1IEHA 4NZRL 1V5JA 3EGSA 2F74B 5T1LA 4YHOH 5AAWA 1A6ZA 1JNNL 1VB9A 5IBUG 2DQJL 2G2RB 3DHMA 1Q9OB 5GGVH 2IF7A 1CICD 5D9DA 4BQCA 5EOCL 1QLRA 4LASL 1MUJB 1YNKH 4I3SL 3QUYD 3U4EB 2Z93B 2OM5A 4P2OB 3D39E 2UYLA 2Z9TA 4QXUL 4HMCA 3BSZH 5LGHL 4OZFA 3QCUL 2EXWD 3C09C 4O2CA 3VFNB 4L4TA 1GJIA 2R39A 3GNML 2WUBL 3O3UN 4OJFL 3DRTB 3IVKB 1K4CB 1F4WL 1WWBX 5EZOH 4QRRB 5DYOA 2BZDA 4K3JL 5EU6A 1Q0XL 1R3IL 3IFPB 4C55A 2D03H 1MCJA 3BIKA 4L4TE 1L7TH 3GMOB 4X7DC 1B90A 4KFZC 3TZVB 3CLFH 5M7QA 1KACB 5J13C 1YNTB 1NLDH 2ARWA 1QEWA 5EU6E 2OXHA 1LK3L 1CD8A 3LN9A 1WICA 4G8EB 4X6DF 3VFTB 4PB0L 4QCIB 4Z77A 2AJVL 4M48L 4R26H 2AVGA 4QRUA 2X1QA 5EC1A 5K9JL 2VLKA 5L9DH 2W0PA 4O02L 4OV5A 1CGSH 1MAKA 3L5XL 3P9MA 3MCKA 5E6ZA 1MLCA 4M6OL 2DQCL 4HUVB 4LSRH 4KK9D 2Q3AA 5D7JA 3WEXB 4NRZB 4A6YB 4APQB 5GS0H 3SKOB 1YEGH 4K94C 1U92A 4NM4H 4X98A 3M8OH 5C6TL 3QWRD 4LSUH 4NYLB 3UMTA 4MJIE 4E41A 3DBXA 4M1CD 2E9BA 4YBQC 3RZCB 1E4XI 2PO6C 5DHYB 1HQ4A 3WXVH 5IMMB 5EG6C 3RGVA 2NY0D 3FO0L 4MCZA 5F6HJ 1T83A 1UKSA 4IMKC 1JYWA 4JHBA 4CU6A 3WHE1 4MMXC 3MODH 4E41E 3JV4B 4OBRA 2A9ML 2QSCL 1QO3B 3NBNA 1N3NA 4HV8A 2NW2A 2JB5H 4FTVA 1K5NA 1FRGH 3QDGD 3G4HA 4R4ND 2B8OT 4U4BA 4WJ5A 1X6NA 5C92A 5I8KH 1TCRA 3Q6GL 5IK3A 1B0GB 1H15B 3O6KH 4ZYKB 3BZFA 2R0ZL 2DLEA 4FTVE 4ONFH 1YEDA 5CZXD 1DBBL 3RY4A 2CDEB 4KKCD 1UM4H 2FEDC 4X0KB 2EDRA 3HZVB 2VXTH 5MENB 4PJ9A 1CD9B 5L0QB 1QSFD 4TNWK 4EBQH 2W91A 5DC9B 2BSED 3DUHA 5C8JA 4G43A 3F5WA 3MO1A 4LCWA 3S96B 1RK1A 4JJHA 4U1KA 5JPMA 2N1KA 5CMAA 4DVBB 4H0GA 1ZT7B 3IS1X 3SQBA 1I7RB 3E8UH 2EE9A 2XY2A 3LZFL 5CIPH 2KDGA 3KLDA 1P4IH 5IB5A 3UEZA 4HWZA 3NCMA 1I8MA 1MHCB 3UBXB 1BD2E 4JPKL 1UQSA 3TEUA 1KB5H 2L0DA 5D7IB 1MI5D 1F11A 4OGAC 4BH8B 5HY9A 3BT2L 4AM0A 5LWYH 2B4CC 1WCBA 4X6CF 2O61B 3P11L 3S36L 3ZKMD 5D72L 3QIBD 4RA0C 4PJBA 3BZEA 3L95B 4P3CL 5CWSB 3SGJC 3MV11 3OKDA 3V79C 2FECI 5TJWK 4JM2C 2GITB 4XBPB 3VI4E 1YECL 4KJQD 5TE7H 3IRPX 4KVCH 5D96B 1RJYB 4OZFH 4GKNB 4RGMC 3HC0A 1FNAA 1OD9A 2UY6A 1KJMA 2DI9A 4NJAL 4P9ML 5JHDB 4I5BA 1C08A 1A6TA 3WS6C 1TTFA 4CL7A 5CZVH 3SO3B 1OY3B 1U91A 2FB4L 4EOWL 4M1DH 2WINB 4GAJL 3GMPA 1I9JH 3AS0A 5J13B 1X6LA 4Z5RB 4GRLA 4PJ5D 3QG7H 1TVBA 1S9VA 1X4XA 2YPVL 4G6JH 3UTTD 4ZOAA 5DVNA 3DGGA 3N9GL 3DO7A 1BBDH 3QO1A 2EDLA 4HJGA 4Z78A 3ZHKA 4KK8C 1LDPH 4HIXL 5H94A 1OAXH 4JVWA 3FQTB 1P5UA 3S5LA 2IG2L 5HHME 1CGYA 2N4IA 3QEHA 5EORH 3BKCL 1F3JA 1MH5A 2OTPA 4LQFH 1BFOA 2YSSA 1NANH 2VUYA 1XFPA 4OT1L 5B3NA 1RFDH 2E27L 4O5SA 3U1SH 4HK3J 2PO6B 5GJSH 4M8QA 4WUKL 4Y5YA 3PV7A 4GRMB 5HDQH 3KLAA 3UXFA 5TPWL 1V7ML 1P2CA 3CPLB 3TN0C 2Q3ZA 1TJGH 3L9RA 4PRNA 1C8PA 4G9FA 3OF6D 2P42B 1WC7A 4DGVL 1F3DH 4WFFD 1XGPB 1R3HB 3X12B 1VADB 1IAII 1EA9C 3VXSA 2EDYA 3VXUB 3B8SA 3IDXH 4JFHD 3BJLA 2F54B 1FL5A 2ZJSL 4M7JL 5T1LD 3DX9B 3DX7A 3IGAA 5KN5A 4X6DE 1I8IB 4KJWC 4XCEA 5GGRA 2DDQL 3DX6B 4D8PB 1UB6B 3EYOA 4NM8L 5D6CA 4U1JB 5B39A 2ITDB 5IW1A 3WS3A 3IU3A 3QUZA 2CIIA 1T04A 3MV01 4KUCD 3SKNA 4P23C 1NMAL 3HR5A 1MIMH 3STLA 5HI3D 2Y36L 3E6FB 4R4BB 1RVFL 1UENA 3BQUC 2X4UA 5JTWA 4XAWL 1TQBC 1I1AD 3EIFA 4JQVC 2C3HA 2ICWI 1IAKB 4HKZB 4U1MA 4RGND 1KF9B 3UTSD 3EOYG 2NNAB 1DEDA 1AQDA 2P5EA 2AJYL 3PP4L 5TQ0H 3GMQA 5L8KB 5CKAA 1NEZB 4KRLB 4AQ1B 5INCB 4YPGB 2P44B 2ERJB 1AO7A 1LEGA 1KPRA 3IDIB 2IANB 2A6KB 1F42A 5JNYA 2P5EE 1QRND 3GMMB 3BGMB 3H7BB 1C16B 2C1PA 4OSUH 5T33L 3L3KA 5SWSD 1SEBA 3VG9C 4JEGB 3QISA 4OCRL 4HS6B 1D5BB 1M05A 2VLKD 1X5KA 4H1LA 1BIIB 4JM2B 1KCLA 5DJXA 2VL5A 5KVGL 4WO4B 4GXVH 1Y6NR 4M9OA 5LQBL 1XMWA 1CDUA 5F96L 5JXAL 5ITBL 2YD1A 4YJZL 4RGMB 4N9OB 3NZHL 3WFHA 1I8LC 1CBVH 3V0WL 1DBJH 1YN6B 4JVPA 5E8NA 2NY3C 3T4AB 2OXGA 3ARBC 3RGVD 1DEEB 4TUOB 3K2MC 3W82A 4WNQA 3WKMH 2J6EA 4TSAH 5M94B 4IHOB 4E9LA 4OF0A 3ARFC 3WUWG 2GT9A 3EW3B 5JOFB 1H3WM 3L7FB 1N2RB 3ULUL 1BEYL 2HTLC 1NUGA 5FYKL 2F58L 2DG1A 4Y19D 3HRZA 3RDTC 4YXKL 1ONQA 4PIRF 5F1KC 1H6LA 3ARRA 1FVDB 4QYOB 3D5OF 4NZTH 1X5AA 5I8OH 3DARA 4PY7B 2E7BA 4G8IB 2PYEB 4PRPA 3C6LA 2FATL 3FB7A 3MROA 4QLRA 5KSUB 2VLJB 4X6CE 2C7UA 1G7JB 3H9SA 4HWUA 4PJEB 4ALAH 3DV6B 1TJHL 4KC3B 2ARJA 4N9GB 2XPGA 2D7NA 3IDMB 5MEOA 3RFZC 4YHLL 4RMQA 4G80B 2LVCA 1IGJA 4PRPE 4UOW1 3QUML 3PP3K 4ODVL 3CMOH 5DEZA 1CS6A 5F6IC 4NZUH 3EFDH 4LCWD 1T6VN 2ZCLL 1RJZA 1QR4A 4P59H 1QRKA 1JE6A 5JUEH 4HBQA 3SKMB 3G6DL 3GKWL 5ACZB 3ZSSA 2HWZL 3IDJB 3CIQA 2ZOKA 5FYJD 3VWJA 5BMFH 1GGUA 4QXTB 2ZP0T 2BVPB 5CEXB 2J1KA 4ZUVA 5JIHA 3QRGH 4ETQB 4NKDA 1ZEAL 2VXUL 3SKUD 5ESAB 3VRIA 4PRHD 1I3GL 5C0ND 2CDFB 1KELL 2W38A 3V9FA 1HHHA 1XF2B 4IDJL 2I60H 1P6FA 3FFCE 3TNMB 2IADA 1OAYH 3KYKL 4PJGA 4Z6AT 5BJTA 1CD0A 4NHUB 2DKUA 3O9WA 4LSSH 2P4OA 2YBRB 5I74B 1IC7H 2AK4E 4FQJL 3C6SB 5FO7B 4DFHA 1TNMA 1JFQL 4KKBD 3MBEC 4MXWL 2DBLH 1MQ8A 3BQUB 4JY6B 43C9A 1MRCH 3QEGL 4LU5L 1L7IH 3ARGD 3I6LE 1KSRA 1U8NB 1D9KA 2BSRA 5F9OH 1DUZA 2AK1H 3GK8L 3LEVL 4M00A 4LGSB 2CGRL 2R0KL 3MV8A 1FG2B 5GGQL 4H25A 1AGBB 3MOAH 3BKJH 2AJZA 1Q72H 2UVFA 4FQLH 1UM5L 1ZHKB 4GRLD 4Y4FA 4OD1H 2NY1B 4P46B 4ISVB 1A02N 4OI9A 1MCCA 3I3DA 3MV8E 1CDJA 1IC4H 4XP1H 3F62A 5C0RL 5C0JA 4CVZB 4R97B 4KI5C 3QQ4B 5DD5H 2NY5H 2X6MA 4MNGA 4UU9A 3OHXB 1EPFA 3L1OH 5DGRA 4H1LH 5C08A 4LF3A 2Y6SD 1XGQA 1S7VA 4LLVA 4ZD3L 3WE6A 1BJ1J 4S2SA 4I9WE 4MNGE 2G9HB 4J4PD 4FXKA 2P24A 1XZ0B 2ZCKH 2ICEA 2NY3B 1XR9A 1INEH 2X9XA 2L7UA 1R5WA 1H3GA 3ARBB 1F3RB 3D69A 5GHWH 2BOCA 2V2TA 4UOJA 3QDJA 2A83A 2J6EH 2VAAB 5DZOA 4RFNC 3CXHK 3V6OA 4B0MM 2Y7QB 4X5XA 5DTFB 1TNNA 3HZYB 2ZSWA 1C5DA 4G6FB 3O4LB 1K85A 1G6RB 2DYPB 2VLMD 4G9FD 5DRXB 3UJTL 2EH7H 3JWDC 3VXQB 1QLFB 2CRMA 4PUBL 1CXHA 4CADA 3G5ZB 3P77A 3QDMB 5I1DB 1CN4A 2WBJA 3VXSD 2NX5B 4LLMB 3EYQC 1LO4L 1WCQA 2XZQL 2HKFH 5HYJA 4JN1H 1UJ3B 4XP9L 2YUXA 4ZPTB 3D3VB 2OTWA 4I0CC 1D6VL 1LDSA 1CLZH 1VFUA 3LRHA 12E8H 3MUY1 3BE1L 5D1ZD 4ZXBA 1MJ8H 4K2UH 2HTKC 4XNYL 1F6FB 5C0AE 1XIWD 2AQ1A 2VIRA 1RMFL 4WI9A 2ZG2A 1OB1B 1FAIL 3E3QC 3F65A 1Y0LA 3M45A 5LKNA 1KB9J 3S7GA 4F15B 1DVFC 1HHIB 4CGTA 1QSEE 4BK4A 3NAAL 4NO3A 3OR7B 5CUSL 1X5JA 3TA3D 5FCSH 2H2SC 4JKWA 3M17B 4OAWA 1KENL 2OZ4A 4EN3C 2Q86A 1S7SB 1RK0A 1RD6A 2K7QA 3EJYD 1AO7D 2CD0A 1LE9A 3KYNA 4Z7WA 1HIMH 43CAB 4PJ8A 1FL6B 2D0GA 3HZKA 2D2OA 3LH2L 4NO5A 2V9TA 4DW2H 3UZEA 4MQTB 1S8DB 4PRBB 4P4KA 3WDJA 4P2YA 4MA8L 5IVNA 5HVFB 3H6JA 1WWWX 4OD2A 5C0EB 1ORQB 5J9PB 1ZT4A 2NR6D 5HHVH 1E4WL 3MBEB 5J56B 3PIQB 5DFVC 1SMAA 1A1MB 3RX5A 2V7HB 2GCYA 2GFBB 1YEEL 4OD3L 2DRUA 3CDGB 2BK8A 2WV3A 3O0RH 4QHMA 1I7ZB 1KTKE