4HW6A

Crystal structure of an auxiliary nutrient binding protein (bacova_00264) from bacteroides ovatus atcc 8483 at 1.70 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
424
Chain Sequence
SGTPFNPKEEIVVEKFLPTEGRKGTRVVVYGRNFGNDVSKVKVTIGGYPAKVINVKGESLLCICPSKAYEGDVKVSVVGDDEAELKSGVCEAKFDYQYNYVVTTFLGKLYENNTKWDVLAGPFDDCGAFDNIWRMMFDPNSNYDDLYWVGQRDAFRHVDFVNQYVDIKTTNIGQCADVNFTLNGDMVVVDDQSSDTNTGIYLFTRASGFTERLSLCNARGAKTCAVHPQNGKIYYTRYHHAMISSYDPATGTLTEEEVMMDTKGSNFHIVWHPTGDWAYIIYNGKHCIYRVDYNRETGKLAVPYIVCGQHSSPGWVDGMGTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCDRDSHTVRVLTPEGRVTTYAGRGNSREWGYVDGELRSQALFNHPTSIAYDMKRKCFYIGDCDNHRVRKIAPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords hypothetical protein, IPT/TIG domain protein
publication title Crystal structure of a hypothetical protein (BACOVA_00264) from Bacteroides ovatus ATCC 8483 at 1.70 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
total genus 112
structure length 424
sequence length 424
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hw6A01
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 4hw6A02
3PIQA 4GSDL 3R06A 3PDDA 3MRKB 5TE6L 3P77B 4WFEE 1F02I 1GGBH 3NCFB 5DMKB 5EZOL 4F15B 2BVEA 3LHPL 3NGBC 4RRPG 5LKNA 2W59A 1GGYA 1P9MC 5AZEL 4KU1A 4R7NA 1A9BB 4JJ5B 1LEGB 3GGWA 4NDMA 4P49A 5E2TH 43C9B 3DI2B 4Y4HB 1KIQA 3S5LG 4HUXB 5I1GL 3LI4A 2RJMA 5EPMB 1IT9L 4F9PC 4P4KB 1T03L 4OQTH 1ES0A 1EFXA 4JM4L 4GW1B 4PJ7B 2YN3A 1BZ7B 4GUPA 3MRPB 3GKZA 1MHEA 1OCWL 4MZ2A 1DJSA 1I85A 1L9MA 1MFDL 5B39A 4YHML 1DEDA 1RFDL 3NFSL 5DJCB 2LVCA 4JRXD 1A3RL 4QEGA 3VFSA 2XKNB 3M45A 4U0RC 3MUY1 3TA3B 4TSCL 5GISL 1PKOA 3RA7H 2BHUA 3MOBH 3GJEA 3L3JA 2DLHA 5GX5A 2NXZC 4LSVH 4PJCE 3QI9A 4X0KA 3T3PE 5E8EA 5ETUA 5KZCD 3ZT7A 3UYOD 3S8WA 2J12B 3IDJB 4PJFA 1MAMH 4NRXA 4DQOH 4EZMA 4KKCC 1RZIA 1RZKL 4AIZA 2IAVA 1JGEB 1VESA 3OG4B 4OUUB 3B3IA 4DGVH 3O0RH 1LO2H 1G7PA 4JFQB 3QUKB 5KS9B 1J05A 4WV1B 3WL9A 1C08B 5EBMB 5J6GB 3ZLQC 4I5BA 3H9ZA 4EUPG 1MHPH 3QA3A 3F7YA 3U0WH 3Q48A 5E6IA 4HUUA 3B2VL 4XP5L 2VDNL 1I1AC 2NZ9D 3O3EB 4U6VH 4OV5B 2HTLC 4LSRL 3G6DH 3SGKC 4CU8A 4RGOH 4NC2B 1VFMA 4J3UA 4NBZB 2PO6D 2F5AL 4GRWB 4EN3C 5EFIA 4QCIA 3O2DH 3OGCB 4WEMB 5CGMA 1UH4A 2VZ1A 3VXQB 2XXMB 1QYGH 1QR1B 1MF2H 1JYNA 4R8WL 2JLLA 3H9HA 3SKOB 2XA8H 3Q2CA 3DROB 5A2FA 2IATA 3KPNB 3RVUC 2A6KA 3NFPA 3RFZC 2E6JA 4M7JH 4HWEH 1MEXL 4JLRB 3QIUC 4XVSH 2H3NA 1D5MB 1CE1L 4G8GD 1MIMH 2WUCL 1UZ8A 2NY2B 5EBWA 1JPGB 1KXTB 1CICB 2UWEE 5DHVA 1XH3B 1DBMH 2VZOA 4HQQL 4ZXBA 1A1OB 3KPMB 1BECA 5GGSY 3OF6D 1C5KA 1VENA 3VXPA 4YO0A 1ZHLB 4RAHA 2FJFA 4JFXA 4X6DA 4C58B 1U58A 1YYMH 2L0DA 3ARBD 3MZGB 1W72L 1Q38A 2GSIA 4P2OA 5HDQH 5INCB 5C0EA 3Q6KA 3WJJA 5J1SC 1B0RB 3DSFH 4E0RB 2JELL 1H3UA 2P5WB 4MNQD 2H26B 4LPWA 2Q8AH 5MHSE 3RWEB 2JCCA 1MJ8H 1G7MB 4HXAL 4CKVX 5D70H 4CMMB 5EU3B 2WP3O 2HJLB 3V6OE 2QTEA 1S5IL 5DGQA 4V1DD 5JNYA 4UTBH 4KMQA 2DDQH 32C2B 3GSOB 1K8IA 2IGFH 3WJLC 4LIQL 3MRRB 1YPZB 1KXVC 2ZCLH 2Q8BH 4JREC 2ZUQB 2UZXB 3KAAA 3LKNA 4PTUA 1EEYB 5IF0A 2GYSA 3U4BL 3CVIH 5MEOB 3P9WB 4LSTH 3T1FA 2GVUA 4H88H 4Q7DA 1KNOA 1IAIL 4Q9RH 6CGTA 5JW4N 3BPLB 3VGDA 4ZUUB 1X7QB 3U0TA 2RGSA 3OAUL 5H2BA 4G9FE 4ZFFA 1UM5H 3VGBA 3QCTH 4P46A 4E9LA 5ICZB 3KYNB 1KTLB 1R24B 2Y4SA 4XVJH 1UYWL 2UYLA 5ESQB 3TJHC 5M7QA 3CDFA 5DJXA 3V1SA 4C56B 5E1AA 1YUHA 4KI5C 1U8LA 4MCYB 1QP1A 12E8H 4J7RA 4DZBB 1YMHA 2JIXA 4GRLD 5ACMA 5IVNA 2BVQA 1NCBH 2Y7QA 2YD4A 3QDMA 3EDDA 1LO5B 2B1HL 3SE4A 4N90E 4P2RE 4WCYH 3VW3H 2CIKB 5I9QC 2XWBB 3RGVC 5JHDB 4HS3B 4UDUB 1OPGH 3RI5K 5D1ZD 2XXCB 3C5ZD 4ZPTB 5CLWA 1U36A 2LAAA 3V65B 1EX0A 3X3GL 2ZG3A 3WHE1 2XPGB 4OCSH 4JGUA 3T0ED 3C2SA 4WHTA 3BZFA 5DUPL 4MD4A 5T1LB 1R6VA 3T2OA 1NC2B 4LSQH 1HINH 4DKDC 3QNZB 4G9DB 3BP6A 3SPVA 1LEKA 5IVXF 3GMLA 2GTWA 2HFGL 3QPQC 3GM8A 1TETL 1VB9A 4PGEA 4WTZG 4OM1L 1KC5L 5TDNA 3VD4A 4I0PC 4QXUH 4UB0L 4JAMA 4JO2H 1JVKA 4FA8A 1HIMH 4GG6E 3HNVH 4XH2B 4EDXA 2KH2B 5IMMA 3W9DA 5ANMB 1FGNH 5L6YL 3B5TA 1VGEH 3FO2B 5L8KB 3IFNH 5F3HA 4EOWH 3JSSA 4I3GA 3IAGC 4N8VB 1HH6A 4ZS6D 3KPPB 2HRPL 2ED8A 3FT3A 1XGRB 5DR5H 4HCRH 2OP4H 1YEFL 5H35A 1AXTL 3DECA 3GI9L 2I60H 3B6SA 4YNYA 3QUZC 5JPMA 2X1OA 4M7ZC 1RK1A 3ZTJH 1H5BB 3GBNL 1Q9OB 3JUZA 5E7FA 4D3CH 2O61A 5B8CC 3PDOB 2E27L 4J23A 2F53B 3QRFM 2MCPL 1N4XH 4X5XB 4LLDB 2IADA 1HQ4A 3D39E 3ALWA 4GKZA 1X5ZA 3WHXA 3EOBA 4ZUSB 2ICWB 3AU1B 4PRHB 2DQCH 1R3HB 4HXBL 5L2KB 3FOMA 3L5XH 3OXSB 2ADIA 4FXKB 4BSVA 3NZ8A 2HLAA 1L0XA 3SKMA 3FB7A 3EO0A 4LLWB 2DBLL 4PJ8A 3IF1B 4AQ1B 3ORJA 4X8JA 2V17L 4FP8H 2NYYC 4KMTH 4JR9L 1FP5A 1FYTB 3FRUA 5FUZH 3WNNA 5KTEL 5KW9H 4BH8B 1FQ9C 1T7XA 2UY7A 4G3YH 4YHYB 4JG1L 1J1OL 1JHKL 1UB5A 2W0PA 1DBKL 1FNSL 4NQXB 4R7DB 5C2BL 1GRWA 5A2KH 3BGFB 4ZDHB 3HR5B 5E24E 2GCYA 5GS0L 3U7WH 3VGAB 5J7CC 2HH0H 3K1DA 2ITCA 2X4OA 4WFGD 1UADC 5FYLE 2VWEE 4NO0B 3NFNA 3UTTE 1FGVH 1AP2A 1F58L 3UZQA 4ZD3H 3HLIA 3ARED 1K4DB 2F54D 2FP9A 3B8YA 1L0QA 3P9MA 2C4FU 3BT2H 3MRMB 2XTJC 4PRBB 4WI9A 5DO2D 4F33B 3TGXA 1FAIL 4FQIL 5FCSH 5T5FL 4K8RH 1A6VL 2BOCB 4LCYA 1QFWM 3RDTA 4LRNH 1HHIA 5F7WC 3F12B 3UTOA 4XAWH 1DQLL 4U1MA 2JTDA 3KPTA 5JTWA 4WWKB 4ELME 4EXPX 5K33A 1YECL 3ARDA 3ZKND 1INDL 4N1HB 4ZODA 5KSBF 5DQJB 5C07A 2R0KH 5DJAB 5I6XB 1EEUA 1S7RB 2IG2H 5GHWL 3QEHA 3WDIA 2R4SL 2R23A 1K6QL 5SWZA 3CVHB 3OTTA 4KRNA 3OR6B 5FECB 2J5LC 2JJTA 3BKMH 1HILA 5DK0B 3OXRB 5KANI 4LDLB 4G42B 4J3TA 4OQTA 2N7BA 4HJJL 4JPKH 4NIKB 3H9SE 2C3VA 1GPOH 5DFWH 3BYTA 3BKJH 4E41B 4BH7B 5GZND 4K71B 4DN4L 1U95B 5J12C 2AQ3A 5F3BB 5ELIA 1AHWC 3VFPA 1NFIA 5I1AB 1HCFX 3VFUA 3HA0A 3DURB 3MV11 4RA0C 2MQ0A 3S9DB 4H5SB 3EO9H 3VI3F 3QP3A 5F6IB 2DLFL 2XQYG 3PP3K 1LO3L 4NZUL 1X5GA 3MQIA 1A7PH 1JI2A 4F7EB 4HWUA 1NGWB 3U7YH 3IS0X 3WSQH 1YY9C 3HFML 2VDPL 1J11A 4RX4A 5D1QD 5E9DA 1NCUA 4YHLH 5BV7B 1AR1C 1PLGL 1DP0A 3V6BR 1CR9H 3C6LB 4Y8AA 3BHBA 4MWFA 5ACLA 3K4AA 5D2LE 4MA7L 3MRGA 1R3IH 3MJ7B 25C8H 1WAAE 4OCNC 4KK6C 2A73A 4OZIE 2XN9E 4NSKA 1B88A 5D7IE 5GGTL 4JFZL 3KR3L 5IJVA 1CFBA 4DWHA 2AKRB 3VWJC 3SE8H 2YZ8A 3BXNB 3C9NA 1V7NL 3GJFB 2YD9A 4JQXA 2DJSA 3SKJL 3TBTB 3O2DA 1KCUL 3KPLA 4DK3A 1WEJL 2BVPA 4U1SB 1UENA 4ZO6A 5GPRA 15C8L 3P9LA 4GN8A 3T08A 5DF0A 3QG7L 4M8QB 3SOQA 3O41B 4CVZB 4PJBE 5IESL 1EERB 4X8XA 1HE7A 2HLFD 5SWSD 4FQXA 5JQ6H 3DMMD 4YFDB 2IMMA 5L88L 4JM2A 3V4PH 5ID0A 1JIBA 4I2XA 1OTTD 4Y4FA 4NC1C 2WIIB 2YWYA 4QNPF 3GMRB 4X6CF 3EOYG 1TZHB 4Y88A 3FB8A 5CAYB 3P40A 3I6KB 4QXTA 3B5HA 2AJXH 3VXRB 5JXEC 1SEQL 3OHXB 1WZ1L 3VXNB 3Q3GA 1V3KA 4M6ML 4X6BA 5GRYA 3VCLA 4Z77A 3RZCD 2NX5B 5JLZA 2YPKB 3ARTA 5AWNL 2LAGB 5E5UB 4O4YH 3X14A 4BQ9A 4NRYA 4LAQH 4Z0BL 3MRJA 2HFFA 2B1AH 3SDCB 3SGEH 2DM4A 4LPUA 1GH7A 3S8ZA 1GIGL 4QKXB 3IKCB 3VE0A 4XPAL 1S9KC 4NUGL 3KGGA 3KYMA 5F70A 1KPRA 1N3NB 5IFHL 2BMKB 4NNPL 4HDIA 4XCFH 1IBGL 3K1KC 4GMTL 3DXAA 3VXMA 4F2MA 5J13C 3LKOA 2CQVA 2EDYA 1XIWA 2QKIB 5KVEL 3D85A 3NA9H 1G7HA 4BZYA 4M9PA 1MFAH 1NCWH 5BRZB 3QT2A 5FHBL 2FD6H 2W0KA 4Y89A 2VXTH 1OT1A 4PLKC 4HKZB 3E0GA 1UVQB 1AQDB 1RJYA 1NBQA 1P69B 1IGIH 3BPCB 4U3XA 3VA2C 2YRZA 5DRZA 4F9LC 1MPAL 3DGGB 3GI8L 4QHUB 5D6CA 4MNHB 3V0WL 3EFDH 4PJFE 4PG2C 4U1HA 2DM3A 1MCPL 4LLUA 4K3DH 4BZ2H 3B9EA 1U91B 3MBXH 4IHOA 1NMBH 2M1KA 4NFCA 5GGUB 3CLEL 1T1ZB 5JDSA 4Q58C 2CIIB 4XZUB 4JHAL 5EUOF 4JZNB 3G5XB 3WMSA 4R4NC 3ESUF 2CLZA 3LQAC 2H8PA 1X9QA 2YD6A 4ZS7H 5B3JE 2AEQH 4W81A 5JR1H 4KAQL 4QRRB 3L3HA 4BK4A 3F7QA 2VXSL 3C5JA 4J6RH 1MAKA 2QV2A 2FEEI 4X98A 1OY3B 3LKPA 4JPWL 3O45A 4GNAA 1EGJL 1XCTA 2GJ6E 1C8PA 2FGWH 3CX2A 4U2ZA 4O9HL 2NR6C 3AY4A 1T89A 5IMLA 4PJGA 1QBLH 5GGRA 4P3DB 5FYKE 4PJHF 1D6EA 2YPVL 4NCC2 4NQEB 4FXGB 4NO3B 3N1GC 1Q1JL 2R2BA 4WFED 5I76A 2XKSA 3HNTH 4HSQA 4GBXC 4XCCL 1JPFB 3RX8A 3RNQA 3VG0H 4H1LH 4LFHG 1NAKH 3S88L 3OAZH 4PGCB 4N9GA 4BSWB 4QOKE 2GAZA 3WIIL 3JWOL 1RVFL 3TC9A 2PR4L 4ZUVB 5HHQA 3LN5B 1DVFA 3LSOB 2J4WL 1HHKB 3UJJL 2CLRB 1KLUA 2B7DT 3V5HA 2EEDA 3S94A 4LKCB 4GXVL 3HC4L 1DSFL 3HE6D 1RZJL 1OVZA 1Z9OA 4Z7UB 3VMOA 4HBQA 2SEBB 5IB5B 4MX7B 4KRPB 2A6IA 3UZEA 4PGJA 3JWDH 2XZQL 4HCRA 4CVUA 3PG2A 5IHZB 3CFCL 4LPVA 1HSAB 4FQQA 1FZKA 2JCCE 3D1MC 5C7XH 1ZTXH 2Z93A 4Y16D 1NLBH 3P4MA 2MJWA 5FKPB 2HTKD 4EQ3A 1FO0H 1RZKC 2GITA 4L4VE 4NYLA 5FM5M 1MVUA 1U8KA 5MENB 3LAFA 4MQXC 2D9CA 1YEKH 5ISZA 1U2HA 3MJ9A 4ONFL 3B9KA 3OJVC 3GMPB 3ARWA 1FVCA 4WO4C 1F2QA 1VGKA 5BZDB 5IROA 4WJ5A 3H42H 1YNKL 2AEIT 5I19H 1JRHH 3KHQA 1AGEB 2XZCL 1QO3B 1YEGL 3MNZB 5EU6E 2DKSA 4R0LC 3IU4H 2D7QA 4H20H 2K7QA 4X4XB 1IM9B 3RVVD 2OR9H 3IDYB 4OGZA 2YEZA 1WJ3A 4PRIA 3JTSB 3VRLE 4LU5L 1CXKA 1PG7H 3HE7D 3PNWB 1WCBB 1CFTA 2AK4B 4GRLC 3SO5A 2J8UA 1QRNE 2UV3A 4MCZB 3MOAL 4P48A 5FKAB 3UX9B 4AIOA 3AM8A 3DBXB 5ACZA 5CP7A 4DN3H 3U6RA 4UV4H 4MQTB 4XNYH 3MA7A 1ZT4B 3BEWB 1D9KA 4XI5D 3BMWA 1VFAB 3ZL4H 1T2QL 1P4IH 5I1LA 1ONQA 5IB4B 1XEDA 4JDTH 4YX2H 2OMNA 1IILE 2ADJB 3CCHB 1AI1L 1FZOA 4RMQA 4MJ6B 2V7HA 5E8PA 5JUEL 4YXLL 3ARGD 4B7IA 3GNML 4OI9A 1IE5A 4NP4H 3TPUB 2W65A 2VERN 2PUQT 3L3IB 3O11B 1QVOA 1N6UA 3O6ML 2HJKA 4PLJC 2VL5B 4R26L 5SX4H 1F4AA 2GFBA 2VR9A 5KSAA 3WDHA 2EXYD 3D48R 5HHNB 4XNZB 1BZ9A 4IS6B 4IRZH 2P8PB 3U4AA 4NUJA 1J12A 1FRGL 4RDQG 1QUNA 3EOAA 4JVWA 1IGTA 5IVOA 1LK2B 2HG5A 2LTQB 1CE6B 4H0HB 5HXMA 4HIHB 3VXOB 3U79A 1UKQA 3W11C 4TNVK 1I7UB 1ZMYA 3D25A 5EOCH 3VD7A 1MIEL 1O5DT 4PV9B 1IQWH 3TN0D 1E4WL 1HHGB 5K9OB 1ZAGA 4G6KH 1U8OB 1C5BH 1KTDA 1EO5A 1UH2A 5IM7A 3LZFH 5LGJB 3H6JA 3RNKB 3GEWB 3U30C 1NMAL 3TFKC 2FWOA 2VH5L 1PY9A 1T3FA 4KGJA 4DFIA 3VWKA 3MLSH 4PR5B 3T0DA 4HGWB 1YJDH 4G9FD 4XPGL 2WBWB 4FG6C 4S10A 1W0VA 3M07A 3MACL 1IC4L 2DQTL 2Q86B 2R69L 3PF2A 4BFBD 4KXZH 2I9TB 2IWGA 1I1AB 2BNRB 3BH9B 5KJRH 4JHWL 3PQYE 3QO1A 3B9AA 3SQOH 3G5ZB 4HH9B 2COQA 2Q6WB 3GUTA 4LLVB 2H41A 4WHDA 5D7JB 3OKNA 2FYYB 4PLNC 3INUH 1X5IA 5I17B 2H1PL 3HRZB 4PJ5A 4U4BA 1JFQL 4N90D 4P2RD 4YXHH 3BESR 1OF2B 4R96B 5IW6B 1AFVH 4CRPA 2EO1A 3X17A 3RPIA 1MY7A 2VLKB 1BQHB 2PXYB 2DQIH 2E7HA 4N1EA 5BW7A 2O5ZH 3DIFA 3MUGB 4YHOH 1NJ9B 4MNGA 1DLHB 4J3SA 4YAQB 2NXYD 3KS0H 5BVPH 2VZTA 3VFNA 4JN2B 1KXQE 1XCQB 5DJ2B 4Y19D 2P5EE 4NWUL 3QEUA 5ITFB 5IT2H 3O6FB 1FORL 5HGAB 1A0QH 3W0WB 4NKMA 3HI1A 3WIHH 3MRLA 4PREB 4ORGA 4IMKA 3TBVA 4L8SB 5JO5A 3A9HA 4OFYA 1T0PB 4M1CC 5C0GA 3UJIH 3FOLB 3F5WB 3IFOB 4RFEA 1W8NA 1WQVT 2DWDB 5B22A 1FCCA 5AZ2L 3O8XD 4M1GL 4MD5B 3MLZL 3UAJD 2AJVL 5ADPL 5SWZE 3PWUB 1JGDA 1DL7H 5F72S 4P5TA 4F7MA 4YBLC 2Y72A 4GAGH 1E0OB 2UY6A 1GC1L 3RJQB 1KJMA 4PBWD 4PS4H 3FAWA 4S1QL 1N59B 1YC8A 2AXGA 2MQCA 4K23L 4MJ5A 1DQDH 3DVNB 1JK8A 3D39D 1M7DA 1XFPA 4MSWB 1QSEB 3VFOA 1FFRA 5LVEA 1WBYB 5I66A 1FN4A 2OTWB 1C16A 1PW3A 5I2IA 2A77L 4GRMB 5SWQA 5IKCA 5E5MB 5HGDA 5JMOC 2XWJB 5DMYA 4X7TB 3RIFK 1NDMA 2A6JB 3MBEA 3ULVL 4E5XA 3BQUB 1LEIB 5TJWK 2L4OA 5EA0H 5E9DE 4DVRL 3N9GH 3WS3A 1AO7A 1I7TB 4G6ML 1UWXH 2X70B 3RRQA 3QUXD 3TIEA 3IDXL 2X4PA 3HPLB 1FJ1B 1JCKA 1IGCH 3OR7A 5T3ZE 5EIVA 3HZYA 2G2RA 4MVBD 2DF3A 1FIGH 5GS0C 3MRFB 5EWIH 3KPOB 5DS8B 5I73B 1N5YL 1KENL 1BVLB 2YD1A 4KJYB 5FCUL 3CDYA 4HIXL 4XXCA 5FYLD 3ZYZA 3RVXC 4GRWH 3UTTD 2Z0BA 5D5ME 3NPSB 4R6UA 3C60B 4XPHL 3ZE2E 3ARFB 1J5OH 2WBJA 5HGHA 3QEQA 1G7JA 3MFGB 3T4AB 4NQDB 3D2UA 4KHTL 1QBAA 4M6OH 1QLEH 3RTQB 3FT4B 4EI5C 4HHAB 3SRGA 4H1LA 2A9NH 5F7DA 5EX7A 3VXSA 2I25N 1RIHH 1RZFH 3EYSL 3HI5L 1GZQB 4KJPD 4WW1B 3UTQA 4HPYL 2YKLL 3V4VH 4NJAH 5HYSB 2BNQE 2IBZY 3WUWA 3FO0H 3GBLA 1TENA 3HMXL 3MGTA 5FM4A 4ODUB 1IKNC 4GXUM 5CEZH 3PHQA 3MV9E 4I9WE 4RMRA 4ZTOH 5ICXA 3TLRA 1DE4B 4IDLA 3QXDA 4GW4B 4JFPB 4TSAH 3H9SD 3LEVH 4UV7L 5EU7C 1NGXB 1QLGA 4Y4KB 1D6VL 1FPTL 5EO9A 5DWUH 3NZHH 1LE9A 1HOCA 4L8BA 3MR9A 1F00I 3SDXA 3JV0A 4JFHE 2Z31C 3JTTB 1FVDB 1JF1A 3F7VB 4ZUWB 3S36L 1T7WA 4XB7A 5JHLH 4C54A 1E6JL 2JJUA 4ZFZB 1PKQB 5DRNA 3FFCA 4JANA 4X5WB 1KIRB 1U8NA 4Z7OF 2AEPH 3GK8H 1MJ7L 4L3CB 4OLUL 1OAKH 4QRPA 4MJIA 1MJUH 3VXME 1A1MB 2ZCHH 6FABL 3TYGL 2UUDH 3L3KB 5CHNB 2EZ0C 5DD6A 4D9LH 1JRHI 1MLBA 5FK9A 3GHBL 3WV0A 3RWFA 5ADOL 1JZ5A 2Z8WC 2XN9D 1JMZA 5EU5B 4KI1A 4P23C 2DKUA 1CXLA 1I3GH 2VTFA 4TUKH 1MCEA 3BIKA 3ZYJA 2FZ3B 4Y5XA 3MLWL 1EPFA 2CJUL 2Y5TA 5GSRA 4UNUA 2GIYA 5FYJE 3BP4B 2BSRA 1HQRA 4OCLC 3DYOA 5CEYB 3FONA 1CLOL 4KV5F 4OFPA 4O51B 3T65A 5C0CA 2DQEL 1CXIA 1WWBX 2FJGA 4HJ0D 1WSST 1KN4L 2G5RA 4OZGB 3GSNL 3JZ7A 1MWAB 2QADC 5MEQA 2IANB 2G9HA 3QHZH 4TUOA 3ULVF 4XPFH 4TPRL 4NHCH 5E99L 1CDCA 3OJDB 4N8VG 1YMME 3SDAD 5IB2B 2V9RA 3KWWA 5HY9A 1URLA 4PJGE 2WWMC 3CFKB 4UBDD 5DLML 3RL1A 2EDWA 2R39A 3BVNB 5E8DL 1S7TB 4EIZC 4ACPA 5FOBA 5AUMA 1YEHH 3V5DA 4GS7B 4M93C 4BFGA 2UVEA 1UJ3C 4Z7WF 1WBXA 3JV5A 5IMOB 3UZVB 4LMQI 3O2VH 1T4KB 3E3QC 4MHHI 3TNMB 4LFHD 1E4XH 2YK1L 1A2YA 1EDQA 3NVQA 1JGVL 1TZGH 4KJQD 5D2NC 5I16B 3FT2A 2NCMA 4I1NB 1A7NL 4M6NH 3PGFH 4LCUB 4XNMA 3RKDD 2XY1A 5F9JA 5DK2B 3QXWA 3EYFA 3RWDB 5GS1B 2C3GA 4Y16C 2XWTA 1ZLSL 3DX7A 2A1WL 3BH8B 1MRFL 3LRSA 4YQXH 1MI5E 2QR0A 3OL2A 1OD7A 2H6PB 1ZHNB 3L3DB 5IR1B 2R8SL 1PFCA 5EOCJ 2MHAA 3UYPA 2D31B 1TQBB 5I1IH 1SQ2N 4RFOL 1H0DA 4HS8H 3WFEH 2J8HA 3H9YA 3SJVA 4O5SA 3I50L 2XRAH 1YA5A 2BJML 3VD5A 2H2PC 4NNXA 1WZKA 2CGRH 4N0YL 5CUSH 2IVZA 1KB9K 4GQPH 1S78D 3CMOL 2YUWA 3D0LB 5CJ8A 1RK0A 2HMID 1NL0L 3VFRB 4LSSH 3S4SA 1PEZA 3UTZA 5IWLC 5ID1B 1YEEL 4U0QB 2IEPA 5E6ID 1RZ7H 2XNAB 3I02A 5AD0B 5HVHB 4YLQT 4KDTA 4YPGA 1MCBA 4MA1B 3ARPA 3BSZH 3OAYH 1F3DH 2GJ6D 1I1YB 1L7IH 1U3HD 2ZUXA 2ESVB 1Q0YH 2J1KA 3WYRA 3QQ3B 5FYKD 2N4IA 3MLRL 2J8UE 4I0PA 2H9GA 1AGDA 1T03H 2KQMA 5K59E 4PB9L 4RFNC 2ZOKA 3OKDB 1GZPA 1OCWH 4EI6A 3TWCL 5I8CB 3UO1L 2NW2A 3DUSA 4OCMC 4QOKD 1A3RH 2BY1A 3MODL 2CK0H 1DBJL 3KS0J 3IFPA 3RUGA 3T2NL 3WIHA 3SDDD 4I3RL 1RZJC 2YUXA 3QUZA 1M1SA 3P77A 5LAXB 3B5GA 3V52L 4S1RL 2XACC 1WTGT 1JF6A 5DMKA 2V2XA 1HXMB 4ZXBD 3MLUH 1ZS8B 1C1EL 4ETQB 4MLSA 3BEVB 3N85H 4K2UH 2ZSWB 4JJ5A 1CD1A 3TT1H 1DBAL 1NCDH 5L7XL 4P2OD 1VDGA 3A0OA 43C9A 4Y4HA 3OKOB 3CVHH 2RB8A 4IIQB 2A6DB 2YPLE 4D0DB 4HUXA 4P4KA 4G8FB 4JRXB 4KKAC 1P4BH 4E42A 3MFFB 4GW1A 4PJ7A 4CNIA 3B2VH 4AL8H 1F8TH 3MRPA 4L4VD 1OHQA 4M48L 3R0MA 4FQ2L 5DJCA 3WEXB 4OGYH 4GJTB 5D9SB 5KZCB 4JFED 1IFHL 5LQBL 3LPFA 3MPCA 3QH3B 2XKNA 4HIJB 5INDB 3TA3A 4O00A 3KLDA 3OSKA 3S37H 1FAKT 2OX5A 1IZJA 1RI8A 4Y2DC 4YZFF 3EYVB 5DC0A 5DQDH 3BDYL 1KCLA 2DOCA 4A0PA 4G6AC 3OB8A 4WIQA 4LCCB 1JZ7A 3IDJA 3N0PB 4X7SL 3RVTC 4TQEH 1JGLL 4PUBL 5EU6D 1F4WH 4X6DF 5I74B 4OUUA 3TNNB 4LARH 4JFQA 1X6LA 3ZTNH 4Q9QL 5KS9A 3MLTA 1UKSA 4WV1A 4AT6B 1T83C 5J6GA 3QNYB 5CIPA 2Y25A 1A6TB 1MOEA 3RWJA 1MAJA 1EEZA 2PO6B 1VA9A 3QQNA 1CVMA 1IC7L 4LVEA 4ESKA 1Z5LA 2Z91B 1QRND 2EYSB 1HSBA 1P7QA 4DW2H 3QWQB 3WD5L 3QHFH 1DANU 1OGAA 3O3EA 4OV5A 2W8BB 1K9TA 2APWA 2FX7H 4LVHC 4PJ9C 1TJHH 3I2CH 2GJJA 2JIXD 2BOBB 1RUQL 1NQBA 2KKQA 3UTSE 2OR7A 4PJXF 3GJFH 2JELH 5EU4B 4LLQB 4KZEL 3VXQA 1RUMH 2FX8L 3HNSL 1J1PL 4RMTA 4G8GB 5GX3A 1MH5A 4Z7NF 1FH5H 1S5IH 3HG1E 1BQLL 1Q8MA 3ULUH 3T0WA 4MNGE 5LXGH 4JLRA 4RMSA 1D5MA 5C0AE 4TTGA 2Q76B 3QDHA 4TSBH 1EHLH 4ODTH 1PEWA 2OZ4H 3ARBB 3RWHB 5F9DC 4ENEC 1A6AA 5BZWA 1ZLVH 1LO0H 4MNQB 3QCVH 2CMRH 4RGMB 1R3JA 1ZHLA 3QSKB 1FNGA 3J8F7 4POZC 5DJ8A 1A3QA 2WWKO 4AEFA 3OAUH 5ERWA 1GGBL 1ORSB 4F7PB 4DUWA 4V1DB 3RWEA 1UYWH 1G7MA 3QZWA 4GAFB 1IEBA 5EU3A 4LDOB 5C09A 3MXVH 3T2QA 2DLGA 2VZSA 2HJLA 5E2TL 5CD5C 1PZUB 3HZMB 5HHOE 1XZ0B 3GSOA 3B83A 4JFOA 4HBCH 3X13B 2AERT 2WINB 3I9GH 2AXFB 1CGUA 4GOSA 1SJVA 4NWTL 3MRRA 4OCXH 2G5BB 2DQHH 3MC0A 5EH1A 4S0SD 4NRZB 2P43B 5EUKA 4X83A 3VWJA 5DJYA 4PJEF 2EC9T 3OKEB 1CD0A 2N56A 4K3EH 4AMKH 2YMXH 3PQYD 3SGDI 1G1CA 4V2CB 3RA7L 3ETBF 4FOMA 3MOBL 4KROC 1HCVA 4ZUUA 3IRPX 4LSVL 3IU3B 4HF5H 4IMLB 4UT6L 1GVIA 4OZFG 1ORQB 4EQ2A 5CJXC 1KTLA 1R24A 1PVHA 3SE3A 3V79C 5ESQA 4AH2B 4WI8A 1MAML 5J6HB 2F15A 4NN6B 4DQOL 4CMHB 4P57B 2XKUA 4PJ8D 4FFYL 2NY0D 1ZEAH 4C56A 3IJHB 5IB3B 4DGVL 4MCYA 3O0RL 1FNEB 5IG7B 1CDHA 2Z8RA 4WFHE 4DZBA 4Y5YC 2E7CA 1AO7E 4OM1H 1KC5H 1EAPB 1JNNH 5D1ZB 1MHPL 3U0WL 3C5ZB 1JUFA 5J11C 1LO5A 5JXEA 3T0EB 5J57B 1KT2B 4MAYC 4N0UB 5JHDA 1ZGLB 3G6DL 2P5ED 4UDUA 4RGOL 2GY7B 4PV8B 4ZPTA 1D5XA 2Q7NA 1AXTH 1RMFL 2AJUH 3K8MA 4MA3B 2XPGA 1QYGL 4Q6IC 1MF2L 4QT5B 1PYWB 3WFBH 2XA8L 1NC2A 4PGDA 3RDTD 5F96L 1ZE3C 3ZKSD 3QNZA 1XF3B 3L3GB 4G9DA 4M7JL 1V7MH 1WBZB 4HWEL 4QTHB 5L2JB 4PB0H 4NKOB 3SBWA 3CDCA 1UCTA 1RIUH 3SOBB 1G7QB 4XVSL 2W9DH 1BBJB 1MIML 2NY7H 3RHWF 4WY7H 5ICYB 1RJLB 5DHXB 3TZVA 5DEGB 5SWZD 4Q74A 5ANMA 1DBML 1Q9WA 4N8PA 5IW1B 1GC1C 1SYVA 1EEQA 5GS3A 2IQAB 4L8CA 1QLFB 3WN5C 3DRQB 4OBRA 5IIEB 4M00A 3LD8C 3LN4B 3KPPA 1YYML 4FFZH 3PJSB 1XGRA 4ZYKA 5DD1H 5HDQL 4NHUA 3P3YA 3DSFL 5HI5D 2IAMD 1N5AB 2YWZA 4L4TA 2Q8AL 4U3HA 1Y6MR 1H5BA 1Q9OA 1MJ8L 3ZDXE 1J0YA 1DBKH 1FNSH 5D70L 5D1XC 1ZWIB 1NFKA 1KLFA 2MCG1 1NAMB 5DD0L 4HW6A 2P24B 4Z7QF 3FFCE 2DDQL 4MXWH 1T5WB 3ULVC 1IEAA 3KPRD 5LBSH 1L0YA 1I9RH 2AAVA 4L29B 2IGFL 4QRPE 4ZUSA 2ICWA 5TF1L 4RX4D 3L7EA 4PRHA 5E9DD 1R3HA 3HCVB 5L2KA 1FAIH 2V5SA 2ZCLL 3OXSA 5T5FH 1A6VH 1KPUB 5T3ZD 3LY6A 3PV6B 3G5YB 4LLWA 3CVIL 4IOIA 4N0CC 3IF1A 1DQLH 3QNXA 1UWGH 3CU1A 4Q9RL 1WGOA 4KY1H 4FTVE 2ICWJ 5D4QA 2VKWA 3R8QA 1FYTA 4BH8A 1ZLUK 2YC1B 1UM5L 2V6HA 3QCTL 4G43B 4AJ0A 3KNBB 1QPPA 4XVJL 3V2AR 2P8MB 2W9LA 4NQXA 5DZLA 3AREB 4MQ7A 3ARUA 1P7KB 2F54B 5CSZB 3HR5A 4J3WA 4WDIB 3ES6B 3EYQC 12E8L 3KHOA 3U48A 1T1XB 5C0CE 1B4RA 3CJJA 1NCBL 3W9EB 4UZGA 1F3DJ 4HV8B 3NMEA 1K4DA 1CDJA 2PNDA 3TT3H 3BP5A 5IBLC 4WCYL 3QFJE 4WU5B 3VW3L 2OCFD 4JY6B 4JRWA 3MNWB 3BOVA 4PFEA 2EKJA 1OPGL 1QD0A 3F12A 4Y4FD 2BNQD 5IMKB 4LHJB 1QA9B 4NZUH 4WWKA 5LGHH 4OCSL 3BX7C 1S7QB 3RU8H 3LB6C 3MV9D 1CXEA 5DQJA 3AB0C 3REWB 1ZT7A 3HFMH 5DJAA 1A4KB 4ODHH 1S7RA 3D5OF 4KQ4H 4LSQL 4P99A 1HINL 5DT1L 5FO8B 3CVHA 3OR6A 1N6VA 3WFHB 5FECA 1X5AA 4WNQB 1KELH 2JJSA 4NBYB 1J8HE 4HZAA 4WO4A 3LS4H 3OXRA 5DK0A 3UTPE 1OM3H 3NIGF 4G42A 4R97C 4LMQE 4JGJA 1MHCB 2JB6B 3VG9C 3I75B 4QXUL 1QQDB 4JO2L 3VMNA 5FGCE 3RKDC 3HNVL 4E41A 1KCSH 3UPRA 4BH7A 1FGNL 2ZSVB 5GGTH 4JFZH 3LDBC 1VGEL 1KIPB 2XV6B 3IFNL 1I85C 5C8JB 3DURA 4JM2F 2VZ3A 5IVXA 5D1QB 2X4NB 5DR5L 4HCRL 5BXFB 2OP4L 1K85A 4HJGA 2FO4B 2I60L 4DAGH 1UA6H 4WENB 5I1KH 3QI9C 1NGWA 4D3CL 4KI5E 4YHNB 5IESH 3B43A 3WXVH 2E6PA 5FM8A 1J88A 4K7PY 4PP1D 1FLTX 5HI4D 2FNBA 3C6LA 1N4XL 4QXWA 4H8WH 2GEEA 4NQTA 1KTKE 1DFBH 4HPOH 4FFVD 3SJVE 2Y36H 5FYJD 1FFPB 4FQJL 4OZHF 2O93L 2DQCL 4H0GA 5JPNB 5E6IC 3L5XL 3V7AE 4FRWA 2V5YA 1AIFB 5T3XE 1UG9A 1QSFE 2VDOL 4MYWB 2FEDD 4M6MH 1BD2E 3TO4D 2PYEE 3OQ3B 2AKRA 4TVPE 3BXNA 3ECBA 1AGCB 3GJFA 5SWSB 1CD9B 4FP8L 3DMMB 3HKFA 4KMTL 5FUZL 2I9LB 5KW9L 2YRPA 4G3YL 1TPXC 1BBDL 2HT3D 4Z7VF 5FB8B 3ROLB 3IDIB 3O41A 3DO3A 4CVZA 3HAEB 1YMMD 4FZEH 4WUUE 3AS3A 1BREA 4NN5B 5F9AC 4C55A 5IK3B 3U7WL 4RZCA 2YA1A 4PJCF 3V0VB 4MAUH 3V0AC 5DK3A 4LCWA 5KVEH 3RZCB 4WFFE 3LKQB 1FGVL 3BO8B 5DD5H 3GMRA 4ZD3L 1VFBA 4MHHG 3BT2L 2DLEA 1QSVA 4YE4H 1IAOB 4UQ3B 3VXRA 1IAII 5GJSH 4K8RL 1SY6H 3G6JE 3RUGE 2ADGB 4LRNL 1XGTB 4KQ3H 3C6SB 4PRNB 2YPKA 1OSPH 4XAWL 2MQ3A 1MPAH 3AXLB 1SVZA 2P8LB 3WJJC 4ODWB 3H2WA 5E08H 5IFJB 1IGYA 2E7BA 3RWIB 2R0KL 3S5LB 3SDCA 4PY8J 4DOHE 2DQJH 2VQTA 2IG2L 3IKCA 4AENA 4IRJD 1HKLH 1O7SA 2MNUA 5HVGB 4JHAH 1G7IB 2BMKA 4TYUA 4EBQH 5J1AB 2DQDH 1IEHA 1MI5D 5L8LB 3BKML 3MV01 3BWUC 1R5VB 3G08B 4IRSC 3VFTB 4LOUD 2VXSH 2ATPB 3BDXA 3T4YA 2E3VA 1TCMA 3DARA 4LKXA 3STZA 3GMMB 1GPOL 1KG0B 3MRHA 3BKJL 4N0FB 1VPOL 3SN6N 3O9WC 2ZOLB 4WW2F 4CUCA 2R4RH 3S35X 4OLWH 1UVQA 1AQDA 5HDOA 4ISVB 2D0FA 2YPVH 4KTDH 3EO9L 4N9OB 4PJAB 3AMSA 3DGGA 5KSVB 1JYWA 1TJIH 4QHUA 1Q1JH 2VAAB 4MNHA 1G9MH 4S1DC 4U7KA 4ZAKA 2NY3C 1YY8B 4P46C 4B50A 4NN7C 3U7YL 3WSQL 3RIAK 2WLZA 4WI3A 3S88H 1U91A 4YHLL 4EUPB 2CIIA 4YPJA 2CLVB 3WIIH 2C4FT 2LVEA 4NZRH 2XY2A 2PR4H 4JZNA 1A9EB 4IYGA 5HD8D 4QGTA 4LSDA 1R3IL 2BZDA 25C8L 2XTJE 4GXVH 1NUFA 3HC4H 5F89A 2X7LB 4QRRA 3CH1A 3T3ME 1NMCC 2HT2D 1OGAE 5F88B 1KV3A 1RURL 3SE4C 2NMSA 1MFCH 3CFJB 4HZLB 5J8OA 4JCLA 3GM0A 3SE8L 1KULA 2V7NB 4GRWE 4OB5H 5J9PA 2I24N 3O3DB 4P3DA 5K93A 4TULH 1KYOJ 2HJFA 3DGCR 1BEYH 4NQEA 4FXGA 3MJ8A 2VSCA 4YDJA 3E8UL 5C08A 5I1CH 3KLAA 1U93B 4PP2B 3GBML 2ZZUT 5C0ND 3HPJB 5KN5B 2WZPD 2Z92B 3HE6B 5IQ9B 4JZJB 3EJZD 1E28B 2IAQA 4RSVA 3L7FB 3V4PL 3LIZH 2APFA 1MSPA 4QHKJ 4ZUVA 1AH1A 5EOQH 4MDJB 2YPLD 1HHKA 1DQJA 3DLQR 2FH8A 4LKCA 4Z7VB 3WBDA 1ETZB 5KSAD 1WICA 3PHOB 5DFTA 1FHGA 3EO1B 5HTSA 2CPCA 3Q1SH 4MX7A 5DFVC 2ICCA 2AJXL 1PX4A 4Y16B 2NLJB 1D5IH 1I3UA 3G6AA 4PJCB 4MXVF 1QZ1A 5IHZA 3DX6B 4O4YL 4PY7B 2CDEB 4LU5H 3KXFE 3S3JA 3V7MA 4LAQL 3IETA 3MGAA 1V3JA 4XNXH 4HK3N 2B1AL 3PWPE 5C09E 3ZHDA 1E1AA 1JWSB 1TZIA 1MCIA 4XCFL 1L4IA 3B8SA 4G6FD 5J89A 2YD2A 3JV4B 3LMJH 3GMPA 1AC0A 4O2EB 1NDGB 4KKBC 3NA9L 5A16B 5BZDA 3CFDA 1MFAL 1NCWL 3OZ9H 1XGPB 5D93B 2LU4A 5E0QA 4FZ8L 5I1EL 4ZUTB 1AGEA 3HE7B 2FD6L 5D7LA 2J6EH 3FZUC 4X9IA 2FX9H 3MNZA 2VXTL 1D7FA 1S7XB 2EIEA 2X9YA 3ZKXB 2NY1D 2VO5A 1IGIL 4X4XA 5D6DA 4Y2OA 5HHXH 3GDBA 3QIBD 4EVNB 4BJLA 4ALAH 2V9TA 1V3MA 4EI5A 3UTSD 5C1MB 1JNLL 1XF4B 1DCLA 1CCZA 3EFDL 3O6MH 3PNWA 1J0IA 4XVTH 5GXBB 2V5RA 2AK4A 2DMBA 4MCZA 4K3DL 4BZ2L 1A6WH 3MBXL 4NM8L 5FKAA 3VA6A 1NMBL 2ZUTA 2OXHA 3DVFA 4LNVA 4NC1E 3N06B 1U92B 2UWEB 4ZS7L 2AEQL 1OAYH 3HG1D 3QQ4B 1ZT4A 3BEWA 1TQCB 5F1NB 1MWAH 5JR1L 5B4MC 1S9VB 3ARGB 5C0AD 4J6RL 3RIAF 2R29H 4XPTH 1ROWA 3RWCB 1CQ1A 1JHTA 1JPSL 3CSYA 4BK5A 2FGWL 4UQ2A 1PD6A 2Z31A 4MJ6A 5JZ7D 3U9UB 1QBLL 3CXHJ 3MLXH 1F6FB 3MLYH 4R2GD 3TPUA 3ARDC 5CJQL 2CDGB 2W9EH 3HNTL 2VL5A 3VG0L 4JVUA 1IM3A 4JRYE 4EDWH 2DSOA 4DJMA 5HHNA 1NAKL 3VGGA 1W2KT 4IS6A 4HWBH 5TQ2H 3OGOE 2GQHA 3FB6B 4YC2B 3TN0B 4PJHA 1JTTA 3UBXG 3X3FH 2DQFB 2JJTC 1M71B 4ONGH 1JL8A 5DURD 5HHOD 1ULVA 2BSED 2RCSH 4HIHA 3NIDF 2EDBA 5GGTA 3CNKA 1NC4D 3NCJH 2FBJH 1TVHA 1HHGA 4P23A 5K9OA 1FSKB 4M3KB 1U8OA 5DMGC 5H94A 5T1KA 3JWDL 4DUVA 1SBSH 3KJ4C 4G9FB 1AR2A 1YYLH 2YXMA 5LGJA 1BHGA 1OTSD 3RNKA 3OKLB 4L4TE 4QY8B 1WT5A 4GAYA 4YFEA 4BKLB 4WVRA 4U1GB 1ZTXL 4OGAC 4V2BA 2VN4A 4JPVH 4X80H 1NLBL 4HGWA 5FO9A 5TH2B 2GT9B 1FO0L 1RWIA 4XGZA 2Q86A 2Y07H 4ELMF 3W39B 2I9TA 1JNJA 2E9IA 2FHFA 3BH9A 2UZIH 5DTFB 5FV1L 1YEKL 1RUPH 5E94B 1FZJA 3VXUE 3MBED 4P2RB 3G5ZA 4HH9A 2Q6WA 3E6FB 4WFHD 1INQB 1AGFB 1AO7D 4M7LH 2OK0H 5D7JA 5L2KE 1YDPB 3MCKB 1C12B 5I17A 3H42L 1I3RB 4FQPA 5I19L 3TM6A 4LRIA 3HRZA 3HC3H 1RUKL 3QULA 5E4EB 2W0LA 5CEXA 1OF2A 4R96A 1JYVA 3IU4L 5IW6A 2NXYB 2VLLB 1JWUB 4H20L 3Q5TA 3QUYC 2OR9L 5MERB 2HWZL 2DQGH 4JQXC 3LI3A 1BQHA 2PXYA 4Y19B 3D69A 1UJ3A 5TE7L 3LRHA 1BX2B 5TGBB 1PG7L 1DLHA 3U0PB 4P4RB 4YAQA 1C5CL 4JN2A 4W70A 1G6RB 1LQSR 4FQXC 4IOFC 4S1SL 5TFSL 4DN3L 1D5ZB 4JM2C 5D2NA 4UV4L 4GG6B 4YHPA 3D2UD 2FRGP 1LP9F 5HGAA 5CBAA 3W0WA 4RQQA 3ZL4L 1I8MB 1P4IL 4PREA 4JDTL 4YX2L 4QRQB 3D3VE 2A9MH 1ND0B 5C0DB 2DRUA 2W60B 3ME0A 3O8XB 1H8NA 4NC0B 2X4SA 5D2LF 4KJWC 4KMLB 1E27B 3IFOA 3TCLA 2P7TA 4TN9A 1IGFL 2FSEB 4OZIF 2DWDA 2NXZD 5DVOA 5DEFB 1I8IA 2WM0A 3P4LA 4MD5A 1L7TH 2X89A 4DVRH 3HLAB 4G6MH 1K2DA 1R5IB 2NQCA 4XAKE 4KKCD 3PWUA 3D39B 5F1IB 4IRZL 1RUAL 1UM4L 1JHLL 3EOTH 1JGUL 4L1DA 2OL3B 3PGCA 3EUUA 4YH6A 5DHYB 3FFCD 1XIWC 5D9DA 1QSEA 1BVKB 1EGJA 1WBYA 2NPLX 4ZFGH 2C9AA 4NGHL 1IQWL 2OTWA 2GSGB 1NCCH 5IVXE 2HTLD 4G6KL 2BY0A 4HUVB 1L6ZA 4L8DB 4UTAH 1C5BL 1ZVSB 2XYCA 3NH7H 3GMQB 5E5MA 3QUXB 1CU4L 2DMKA 3NCYP 4EN3D 3LZFL 3Q5OA 4X7TA 4QHLB 3V6ZB 3NOIA 3O3AB 4NQCA 4JDVB 2A6JA 1AY1H 5JOFB 4UIKH 2MWCA 4FTVD 4FFVC 4L9LB 3BQUA 1M4KA 4JB9L 3MLSL 1H15B 1I7TA 3LEXB 2X70A 1YJDL 3AROA 1KJVB 4DZ8B 5DI8A 3HZVB 1QBIA 3RVUD 3QDJE 3Q6FB 4XRCB 3UTTB 3DV6B 1ACYH 3QIUD 4Y5VC 3ZE0F 3FHAA 5C0IB 1WK0A 3SQOL 1HI6A 1TVBB 4M62H 2PTTA 2D03H 1BVLA 2ARJB 5C0CD 2CUMA 3INUL 3ZDZF 4MMXC 4HT1H 1U2CA 2ZPKL 5E56A 3C60A 1D6VH 1LD9B 5CWSA 3ARFA 1Y18A 4ELMB 3S3SA 3QFJD 1MCJA 1AFVL 1MFBL 4BZ1L 3N1PC 2FDBP 2C1PB 4PGBB 2YBRA 4NZTH 4NQDA 5HYIA 2EE9A 2O5ZL 5TQ0H 3RTQA 3FT4A 4YHOL 5E2WL 4HHAA 2OYPA 2AW2A 5BVPL 1ZGLP 5GSVA 1I8LA 3BZ4B 4R4BB 2JK5A 5HYSA 3BWAB 4LIQE 3H9SB 4LCWE 4OD2B 2B20A 4O58H 5IT2L 4ODUA 1J8HD 1A0QL 1DVFC 1TVDA 4YBQC 1JTPA 3UTPD 5C0RH 4EJ1C 3WIHL 1F3RB 4PG9B 5M94B 4CVXB 3VXRE 4GW4A 4JFPA 4X6EA 1S9YB 3QWOA 5KG9B 3F58H 1NGXA 3C8DA 4Y4KA 5B3JF 1MRCH 3DO7B 3UJIL 1WWWX 4IBLT 1CS6A 3ZT5A 3Q6TA 1T1YB 2K3TA 2VIRA 3MUJA 2FJHB 3TPKA 3F7VA 4ZUWA 1J86A 1NGQL 1T83A 3AUVA 2JB5H 2PETA 5DJDB 3L3OB 3A67H 5CBEB 2D4DA 5FM5O 1PKQA 1OWWA 3HR6A 3TJHD 1CLOH 4I18B 4X5WA 3S8VA 3OKYA 1KIRA 2IAWA 3ELAT 4L3CA 1DL7L 5D2LB 4KI5D 3H0TA 5I15H 5I8OH 4HKJB 1A1MA 4GAGL 2BNUB 2OI9B 4OZIB 1Q9LB 2XN9B 5KSBE 5DJ0B 4PS4L 3QR2A 4ODSH 5D72H 3B9KC 3C09C 1J0JA 1DQDL 5D7IB 8FABA 3BPOC 3SJVD 5F97E 5IROC 3MA9H 3RGVD 4BM7A 2VQ1B 3ZSTA 3U2SB 1W8OA 3UROR 4K7FA 1SMOA 3ZHLA 3EIFA 5T3XD 4ZTPH 1QSFD 2X4RB 1XF5B 5C0BE 1BD2D 4DUXA 1GGTA 2FZ3A 2PYED 4TVPD 2BC4A 4OD1L 4PJBB 4PJIF 2VLJA 3VJ6B 3BP4A 1KCRL 5DUBA 4YBHA 3GSWB 5EA0L 3N9GL 2VQUA 2WV3A 1A4JA 3WE6B 2R2EB 2XG5A 5F71A 1IGCL 2Z9TA 3VI3E 2X4UA 5FA3A 3EYOA 4WUUD 3AM8C 1F6AB 3QPQD 2AQ2A 4KUCF 4OZGA 1JI1A 1MJJB 3SDAB 5EWIL 1U8QB 1MWAA 4U1LB 2IANA 4I0PD 1CLYH 5C9KA 2ERJB 1D9KC 3O6LH 3WS6A 1CLZH 2PW1B 3BP7B 5IEKA 3PIQB 4WFFD 3OJDA 4M4PA 4RDQF 5IB2A 4K8RC 4ELKA 1EA9C 1A64A 1J5OL 3RJDA 4DGIH 3BVNA 1S7TA 1OP5H 3QUZD 3GGWB 4NDMB 5C08E 4M6OL 1QLEL 1CT8B 4NJ9H 4NCDA 3SOBH 5IMOA 1T4KA 5KSAC 4HWBA 1CQYA 5FFLA 1RIHL 1RZFL 1TJGH 2DS4A 2XT1B 3TNMA 3V4VL 4NJAL 1NL0H 4GW5B 1MHEB 5I16A 5EC2B 5CEZL 3O2WH 3VFSB 4I3SH 1U6AH 4JO4H 3V5KA 4D9RE 4JVPA 5GZOC 5DK2A 4TSAL 4G8IB 5AYUH 1LDPH 3RWDA 1B4JH 2R1WB 4G5ZH 3HUJE 3LV3B 1SHMA 3BH8A 5DWUL 3NZHL 5E8EB 5ETUB 4F7TB 1DUYB 2R9HC 1GYAA 4L3ED 4PJFB 2NYYD 4NRXB 1X5XA 5DXWA 1ZHBB 4QNPE 1YQVL 2POOA 4X6CE 1GAFH 1ZHNA 3L3DA 3TA3D 5IR1A 1NAMH 1UEMA 3BUYB 3MLRH 3T04D 3UEZA 5JHLL 2QQLH 5DVKA 5EIQA 1G7PB 4UINL 5B3NA 5C9JB 1J05B 1AKJA 3VWKC 2AEPL 1M7IA 3GK8L 2NY6D 4XNUH 1OAKL 4MAYA 3J7HA 4LBEA 1MJUL 4QTIH 5E6IB 4HS6A 2ZCHL 4OIIH 3D0LA 1ZOXA 3CK0H 2BHYA 2MKLC 5HHVH 3VFRA 2E9WA 3VH8G 1EV2E 1K8DB 1I7RB 1C7TA 2GJ6B 2C1OB 5ID1A 4D9LL 3V52H 1U3HB 2IARA 4OQ1A 3MRDA 2XTJD 5D7LE 4OZ4B 2XNAA 2GUOA 5AD0A 2IPUG 1P7QD 4WGWB 3SHSA 1OGAD 5FO7B 1I3GL 4TUKL 3PV7A 5D8JL 1I1YA 1ZA3B 1BQUA 5I75C 2V2WB 2A6KB 3C5SA 3QQ3A 2DN7A 4QOKB 1IAIM 3CGTA 4KGLA 5BW7C 4BQCA 4NM4H 1BAFH 3I6GA 3SDDB 1JN6B 3C8HA 3OKDA 1M7XA 1DEEB 1RD6A 1UZ8B 5EBWB 3F7PC 1T7ZA 2NTFA 5DHVB 5I8CA 2NY5H 4FQ2H 4ZXBB 3DUHA 1Z3GH 1IFHH 4JCMA 4Y7MA 3QHZL 4XPFL 5EU7E 3PWLB 4NHCL 4P2OB 4R2GC 2OS7A 4IMKC 1HXMA 3BDYH 5EUOE 5D1XA 4HKBA 1ZS8A 2ARWA 4ETQA 2JCCB 3BEVA 4PUBH 1KFAL 2CXKA 2GJZB 4ZO9A 1I9EA 4QF1A 4D8PB 4IIQA 2A6DA 4D0DA 5JNYB 4L4VB 4GQ9H 4YK4C 4OFKA 1YY9D 4JRXA 5DD3H 5F9WB 4JFEB 3KXFD 5BJTB 3F65A 1EZVX 3MFFA 2BXZA 3O2VL 1AR1D 4FQLH 4LHUG 2X4QB 4GMSH 3PWPD 5C09D 1CFQB 4PJHE 3WD5H 3EJJX 4P5TC 1E4XL 5E6YA 2DQUH 2R0LH 5FDYA 1NBYA 4KWUA 1EBPA 4XNQA 3WEXA 5D9SA 1TZGL 3LKNB 4KK6D 4PTUB 3CPLA 4HIJA 1P6AB 2FBOJ 4Z7WA 4M6NL 3T1FB 1S5HA 3OV6A 2X1PA 1SMAA 5EU6B 1KNOB 5B38G 3DWTA 1HKFA 2VISB 3QJFA 4K3GA 2P45B 4P2QE 2RFXA 5H2BB 3VWJD 1FG9C 4ZFFB 3GSXA 4KC3B 1F13A 4LCCA 1S8DA 2UYLB 4YQXL 2ED7A 1PQZA 1QRNB 5DJXB 3T0AA 5DUMH 3U1SL 2B4CH 1NEZA 3FQWA 1YUHB 4XP6H 4XWOC 5I1IL 3MLVH 4YWGH 3VFMA 1IAMA 3P30L 2JIXB 4M9OA 3WFEL 4Q0XL 4JJHA 2PO6A 2XRAL 2Y7QB 2Z91A 3GSRA 1QHPA 3F62A 2EYSA 5CUSL 4RA3A 3HRPA 4XMPH 2X1XR 2W8BA 1ZK9A 5DJ6B 1H8OA 4LSSL 4M61B 5EORL 1CBVH 3ARVA 4U7MA 4GNBA 2K9UA 2ADFH 3QIWC 3DYMA 4OSUH 5EU4A 4XXCC 1RZ7L 4LLQA 5JXED 1MQKH 1YPZF 1ZANH 3OBAA 3GSQA 1Q0XH 4R40A 3U0SA 1X44A 4G8GA 3BSZL 3HAEH 1IVLA 1A14H 2DYPD 2WBJC 4FFWC 1L7IL 3PL6C 1IKFL 3K7UA 1CTOA 1CRUA 4HLZG 2NNAA 4O2CA 1Q0YL 5E1HB 5DMIH 3HTLX 5ALCH 3OF6A 3E3QE 2BK8A 2EH8H 3T0VA 4NWTH 1V5JA 1TDQA 2MMXA 3ARBA 3RWHA 4C57C 3BYCA 2QE8A 4JRYD 2X41A 5D2NE 4MNQA 4EDXB 4N5EC 5I71B 1SJXA 2F74B 4ZOBA 5CS7A 1U8PB 2CK0L 3DYPA 2GHWB 2MPAH 3FT3B 1JZ2A 1I4FA 1ORSA 4F7PA 4V1DA 4UT6H 5H35B 3PP3H 3WLBB 5ILTH 3TZVD 1S3KH 1YN6B 4YNYB 1Y0LA 1N2RA 4PLKD 5JPMB 4WEBL 3MLUL 3JWDC 1RK1B 3N85L 4JY4B 4HLZH 1XGYL 3O4LA 4FFYH 4K2UL 1Q9KB 1FG2A 3TT1L 1UZ6F 4KK5C 1NCDL 2M26A 1UACH 5GIRB 4K3JH 3CVHL 1KEGH 3HZMA 1CFSB 2XFXB 5DMJB 3ZE2F 4L4TD 2IADB 1X4XA 4HIEB 5TDPA 1P4BL 2RQ8A 4F3FA 2AXFA 1INEH 5IOPB 4GKZB 3PQYB 3EOBB 2G5BA 4AL8L 3FFDA 3GSNA 3SCMA 1F8TL 4GFTB 1II4E 4NRZA 4R4ND 3THMH 4BSVB 1S7WA 1OAUH 3QBTB 2WSKA 4OGYL 1UQSB 1ZV5A 3MROA 3WCYA 3BW9B 3VU2A 3EO0B 1A7QH 1RMFH 4PJ8B 2DB8A 3VXUD 2NY0B 3MRQA 1ZT1B 3UYRH 4XVUC 2ITDB 3S37L 2OTUB 4TTDC 4AEHH 4YDLB 3IU3A 4IMLA 1J0HA 4RNRB 2XI9A 4JN1H 1Q7FA 1KPVA 1ORQA 5DQDL 2H32A 3BGMA 2NR6D 2AQ1A 3QPXL 4AH2A 5F96H 4NKDA 1FCGA 4TQEL 4NQCE 3I1CA 1IL1B 1F4WL 4Q1UA 4WTWA 3IJHA 5BV7L 4Y5XC 4EUPH 1FNEA 3P0GB 4LARL 2GCYB 5IG7A 5IV2B 3ZTNL 1G7LB 3CZFB 4GBXD 1EAPA 2P5EB 2ITCB 5E00A 5D1ZA 3C5ZA 3EZJB 1TTGA 3NFNB 4XCNB 1AP2B 3KDMB 4LDEB 43CAA 3KPSA 4OF5A 3OPZH 2Z8SA 3ARQA 4DW2L 3QHFL 4P2CG 3GO1H 4N0UA 2FX7L 3ILPA 2EYTB 1ZGLA 1TJHL 4XP1H 3I2CL 3GIVB 4PV8A 5KSUB 5FAAA 3FKUS 3RDTB 3GJFK 1HHIB 3LOWA 1BP3B 1YNLH 3FO1B 4M5YL 3NTCH 1RUML 2WBKA 2ZWLT 1PYWA 3D3VD 4NOBA 5CMAB 1FH5L 5DD0H 3SO3C 1CF8H 2GHSA 4NQDE 3L3GA 2R23B 4O2FB 5SWZB 5KVDH 5L2JA 1A6ZA 4IRSA 3ULUL 1P6FA 4PJXA 5LXGL 2D4FA 4D0CB 1G7QA 1HILB 4M5ZH 1OARH 5C86A 1FNLA 4TSBL 1EHLL 4ODTL 5TF1H 2OZ4L 5EDXA 1FFOB 3GHEH 1NGZA 3O9WA 1UJTA 1UT9A 3BD3A 1ZLVK 4XAKD 2NY4C 2IAMB 3FAXA 1LO0L 5HDBF 2AABH 4MQXD 1UGNA 5IW1A 3QCVL 2CMRL 2IQAA 5HDLA 1QLFA 1UEYA 4ODBD 3DRQA 5IIEA 4WO4D 3VFPB 3TVMC 3WIFB 2FO1A 4MA8H 1B0GB 3WW9A 3KJ4B 4PYHA 3PJSA 5CKAA 1KCKA 1NSNH 1LNUB 3MV8A 1N5AA 1U3YA 3CSPA 2FECL 1F4XH 3SQBA 1GHFH 2BVYA 1J9CT 3QXTA 4APQC 4I48A 5GQBA 3KPRB 3T0BA 2AV7B 1I7ZB 2E5EA 3DR2A 3MXVL 1NAMA 5E9DB 4UAOC 2P24A 4XHJC 4LQ1A 1PKQE 2H2SC 3O4OC 1ZSDB 3BHBB 2IBBA 1T5WA 4ODXA 4HBCL 3ARSA 4L29A 1YJDC 3TIDA 3I9GL 5LGKA 4OCXL 1HWGB 2FPBA 2DQHL 3HB3C 3HCVA 2A73B 1KPUA 3QDJD 5IHLB 4QRUB 4F8TA 4K3EL 4AMKL 2YMXL 5D5MB 5JQHC 5EO1B 1DLFL 3ZE1F 3C9NB 4HFWB 1VEMA 2W0FB 1ZHKA 1QBBA 4FN0A 1HDMB 5HYJD 3E2HC 4HF5L 1AD9B 4YHKH 4G43A 4KDTC 3P9LB 4X7CC 2EDOA 4C4KT 4WI2A 4MZ3A 1OAZH 4PJEA 5DT1H 5EBLB 4KKLC 4OLZH 3AREA 1ZEAL 2F54A 1JP5A 5CSZA 2VLJE 2DG1A 4WDIA 3ES6A 4DVBB 4X7FC 4MB5A 3DJ9A 5ID0B 3BPNB 1NFDE 4PLJD 1T1XA 3K0WA 1JNNL 3W9EA 4Y4FB 4IJ3C 2BNQB 4HV8A 2HVJB 1KYOK 4WU5A 1RZGA 1CVSC 1T80A 3MV9B 1SJHB 4JY6A 2C3WA 3OKMB 3MNWA 2IPUK 4QXTB 5I1JH 4MGXA 4LCWD 3Q3GB 3VCLB 1X5YA 5JLZB 3W11D 1QA9A 1A5FH 2AJUL 1A1NA 4JKPH 4POUB 3BKCH 3DVGB 4FMFA 3X14B 3MSPA 1T7VA 4XP9H 1WZLA 4NRYB 4F37F 4F15C 3REWA 3WFBL 1A4KA 3OKKB 5DRWA 3MRJB 1U8HA 5DA0B 1FFNA 4OUOA 2A0LC 5MP6H 5GGQH 3GKWH 3VE0B 5FO8A 1NUGA 1X6NA 2E9BA 1D5BB 3TFKD 1QLRB 3WFHA 3LS5H 4WNQA 4U6XB 1V7ML 2BRRH 1E6OH 1QOKA 4PB0L 4Y4HC 4HDIB 3U4EB 5DGRA 1RIUL 1CN4A 2IF7A 3WNPA 2JB6A 1OQXA 2W9DL 2NY7L 4FQJH 4P4KC 3IDMA 4FG6D 3I75A 4R90H 1QQDA 4WY7L 2IH1A 3HZKB 2IH3A 2ZSVA 4C83B 2O5XL 5L9DL 2DTML 2VDOH 2OSLB 1KIPA 1HEZA 3EHBC 1N7ML 3ULUF 3L5JA 5SV3A 4LK4A 5K59F 1M6OB 4FFZL 1B6DA 5D1QA 2X4NA 5DD1L 4D0BA 5BXFA 3IDGB 3TA3C 1QFHA 2FO4A 5JIPA 1FVEB 1I9JH 1BBDH 2B5IB 1FL3B 4OJFH 1NGYB 2FLRT 5D6CB 3GMOB 4KRMB 4LLUB 2NY6C 4P9HH 1WITA 2OXGA 4HWZA 2DM2A 1N26A 3KJ6L 5C0BD 1N8ZB 4MXWL 2BSTA 4K9EL 3TO4B 4WV1C 5LBSL 2CLZB 1I9RL 2H8PB 4ZAKD 3ZKQD 3IXTA 1FFPA 4DKFH 2X10A 5C2UB 4Z95H 4B53A 3I3BA 4Z8FH 2PW2B 1AIFA 2QSQA 4NNYA 1LVEA 1FC2D 2FHCA 4ZNEA 5FGRA 3O45B 1WZMA 1YMMB 5GGVY 3PWVA 1UWGL 1MCQA 4KY1L 3LQZB 1OP3H 5EIIA 2I9LA 4OBSA 1NANH 3BE1L 4QXGH 4Z5RA 5B21A 4M1CD 5FB8A 3ROLA 3IDIA 2WNGA 3MV7D 3HAEA 1R3KA 1UWEH 5I76B 4AQOA 4AK1A 4U1IB 2CH8A 2OLDA 1G6RH 2CO6B 5IK3A 4CDHA 3V0VA 1DDHB 2YA0A 4CGTA 2VNCA 5C08D 3RZCA 4DKEH 1T7YA 5DC4B 3V5HB 3BO8A 1JV5B 3CXHK 3CD4A 2NY2C 3LRGA 1VPOH 3TT3L 4KK8C 1CICC 1AC6A 4X4YB 1DTUA 1A7BA 1JNHB 1YN7A 4LVOB 1IJ9A 1CGSH 4ZG1A 4RRPA 1HYSC 4PRNA 4CL7A 2OJHA 4IRJB 1RHFA 4KV5E 2VLME 1QFOA 4UUJA 5LGHL 3HS0B 3VRIA 4UOW0 3RU8L 4ODWA 1MI5B 2P47B 4FQQB 1FZKB 4D9RD 5IFJA 3S5LA 4ODHL 3DRTA 1KJ2B 4OCWH 4KQ4L 1K3IA 5CJBA 3ULVE 5DYOB 1G7IA 3GSUA 5J1AA 2GITB 1KELL 2EE2A 3LS4L 5AG9A 5F7HA 1MVUB 4OKVA 1OM3L 1R5VA 2OL3H 3G08A 2EDQA 3VFTA 3B2UC 4JG0H 2ATPA 4HFUH 1CLCA 3OB0K 3T77B 2BX5A 3QWRD 5HHME 1KG0A 1RURH 5GS0D 1BGXH 1KCSL 5A43C 1T66C 4LHUD 2VDLH 2AV1A 4NO5B 2ZUQC 3MYJB 4Z7WE 3PXHA 1FZMB 2NTSP 3QUYA 4AEEA 3GRWH 3FQXB 4NT6B 3RVXD 1IC5H 3NPZB 3E8UH 2DTSA 4DAGL 5BOPA 1UA6L 5KSVA 3BPLC 4Z7UF 5I1KL 3GBMH 4LSUL 2EH7L 2K7PA 1YY8A 5D7LD 2ZUVA 3SE3C 1CFTB 4OIBA 3WXVL 1CGXA 1UC6A 4EUPA 3DX8B 2CLVA 1BWMA 5FYLH 4H8WL 1VKXB 1DFBL 4HPOL 4J1UA 1A9EA 4EI5D 3U6RB 4O5LH 3D6GA 2Y36L 4LGRB 1I3VA 2X7LA 4KTEH 1XR9A 4OT1L 5F88A 1QG3A 3CFJA 2ENYA 4HZLA 4JFFA 5GS2D 2YOCA 4RAVA 2V7NA 2JF1A 1MCRA 3O3DA 4MXQC 1FZOB 1ZVHA 1YEJH 3SDYH 2V7HB 4NQSB 1Z2KA 1MRDH 4OZHA 1RHHB 1OQOA 5HPMB 3T2PA 4K55A 2YPLB 3FRPG 1SJEB 4FZEL 4J3VA 4NQVB 5IQ9A 2GFBB 5KSAB 2Z31D 4JZJA 4RBPH 5E8NB 1EO8H 2HA1A 3L7FA 2IASA 1A22B 1BZ9B 4MAUL 2JKXA 5C6PB 3BKYH 1R0AH 4MDJA 3SBWC 4JKKA 2B2XH 2IAPA 5KOMC 1IGTB 4Z7VA 5DD5L 5L0QB 4FZ8H 3FW0A 5I1EH 3LEYL 4YE4L 3TZVC 4OLYH 3FCTB 3GSVA 5GJSL 1SY6L 2F5BH 3E6HA 2NLJA 2EZ0D 4PJCA 4YDKH 4KQ3L 5IHBA 4XBGB 1OSPL 4KZDH 3MJGX 5IM7B 3DX6A 4PY7A 4LNRB 4QGYA 1K4CB 1FNHA 3KLHC 1JNLH 4G6FB 5E08L 4JE4B 3O4LE 4P23D 1OB1A 5FGBA 2A2QT 1H5BC 3EKCA 2DQJL 4NM8H 5T1KD 1T1WB 4P2QD 1CXHA 4ONHA 1HKLL 1JWSA 4JDZB 3WLWC 4JKMA 1W0VB 4EBQL 4Y5VA 2DQDL 2Y9RT 3UMTA 5GGSA 4LHQB 3QAZB 4FNLH 2VLRA 4UI2A 2KBGA 4MDIA 3M8OH 2NY1B 4O2EA 1NDGA 1KLGB 3GUTB 1XGPA 3QIBB 2R0WL 3L6FB 1BJ8A 1JPSH 3LKRA 3OKNB 4ZFOB 2F8XC 3UTSB 1WLHA 1HZHH 4WEUD 3HE7A 3O3UN 2QADD 3P11H 4OF8A 1SYSA 1S7XA 2R4RL 4I0CC 4OLWL 4OZFB 1BOYA 1Y6KR 1S7SA 3WKMH 2GW5A 4KTDL 1NBZB 4M3JA 4OF3A 3VFWB 4EVNA 2HAZA 3RPIB 5CJQH 2AK1L 1TJIL 5EB9A 1G9ML 1HHJB 1CDBA 3HG1B 1EK3A 2WWMD 2GTZB 4MNGB 4WW2A 4YHYC 3ESVF 2FIRT 5IB1B 5C0AB 3VFNB 5JW3H 3BGFC 4NZRL 1GGIH 3VGAC 3QEGH 3DASA 4YZFE 1LK3H 3SE9H 3QQ4A 3ZKMD 4H26A 4LVNB 2V9QA 3ZSSA 4U33A 1BFTA 1MCCA 1NCTA 1S9VA 3KPSE 3ARGA 5T33H 3CFEA 1A02N 4NKMB 5CJ5A 4R2GB 3HI1B 4FQCL 4X6DE 5B39G 4TVPL 2HQSA 3RL2B 3TBVB 1MFCL 4NKIH 5ECJE 2X05A 4OB5L 5BVJB 3U9UA 1H3TA 4TULL 3IYLW 1UCBL 4P5MB 2X44D 1BEYL 4WWKC 5F1OB 1AD0A 2VABA 1BIHA 3V6OA 5I1CL 2CDGA 1KB5B 4QHNA 5DURB 5HHOB 5I6XC 3MXWH 1YEIH 5CGYC 2WW8A 4WTZA 3DSNA 1JGDB 3RVWC 2FATH 4PJXE 1NC4B 3R1GH 1F4YH 1AQKH 2CR3A 3LIZL 4F7MB 3TEUA 2JJSC 2DQFA 2BVOB 5EOQL 1KJMB 1M71A 4DEPB 2X89D 4EIGB 4LAJH 1AE6H 4ZO7A 1KEMH 4U6HA 1BVZA 3DX9B 2AXGB 4WI4A 2H2PD 1JK8B 1FBIH 1X5FA 2Y06H 2Y5EA 1ITCA 1RUKH 2IPTH 3EJYC 3VD9A 3W5NA 3Q1SL 1FN4B 4K71C 1IRAY 1C16B 1D5IL 4OF0A 4IEFB 5SWQB 2QQQA 4G9FA 4LLYA 1E4KA 2HWZH 5HGDB 3MV8E 3OKLA 5TE7H 4LQFL 4QY8A 5F6IC 1NDMB 4BKLA 3S97C 2G75B 2HT4C 4U6YB 4XNXL 3MBEB 3WHE0 4HWNA 1C5CH 5J3HC 2GT9A 3WS3B 1AO7B 2AJZA 3V4UL 3AS1A 5TFSH 3TIEB 1J10A 4S1SH 2X4PB 1G0DA 1NLDH 3NABH 5C70A 3W39A 3HZYB 3C6LC 4NQCD 5DZNA 2EYRA 5DTFA 3L5HA 5E94A 3QDME 4EXKA 3LMJL 4KRLB 4YIQB 3M1BB 1X5HA 4BFIB 1INQA 1YDPA 3BI9X 3OZ9L 1C12A 2YD8A 1I3RA 3QQ9C 1ITBB 3NGBB 2BDNH 3ZDYF 2G60H 3NIFF 2J6EL 5FYKH 2FX9L 2VJXA 1K5NB 1U3JA 5HGBB 2VLLA 1JWUA 5BS0A 1IGFH 4P59H 1RIVH 5HHXL 1LO4L 5MERA 4UOJA 1G7JB 2ED9A 4Y19A 1T20B 1PG7W 2PTUA 4OAWA 1WTLA 3FQRB 4WFGE 4ALAL 4H25A 5TGBA 2VE6B 4XVTL 3D2UB 4PJEE 1PDKA 5DDHA 1AGBB 5MHSD 1A6WL 1U41A 1RUAH 1G6RA 1UM4H 1JHLH 1JGUH 3ULUC 1D5ZA 3UTQB 1PSKL 5DHVH 3HHRB 2AS5M 1OAYL 4KKAD 3BIBX 3WUWB 1MWAL 4GKSA 4O02H 4U0RB 1I8MA 4YFLF 1IAKA 4L9DA 4JO3H 3CFBB 2B39A 3PHQB 2NXZB 2R29L 4LP4A 4NGHH 4XPTL 1OTUC 4HK3J 5C0DA 2W60A 5EBGA 3QXDB 2CUIA 1T22A 2QHLA 3Q5YA 5A2JH 1AJ7H 1CU4H 1E27A 1IJQA 5EO9B 1LE9B 2FSEA 3MLXL 1TNNA 3MLYL 1JTOA 3N1QC 4Y2DD 4D94A 4YXKH 3QB7C 4JB9H 3C2AH 4G6AD 4HMCA 3HLAA 1Z0NA 1ERNA 2W9EL 1R5IA 1ZLWK 1UB6A 3SDCC 3RVTD 5DRNB 2X09A 3FFCB 4EDWL 3D39A 5F1IA 5E03A 2VRAA 4HWBL 4Q2ZB 5TQ2L 1V3LA 5CILH 4AY0A 5C6TH 2FIKB 2OL3A 4S2SA 5F7EH 1WUNT 2DIBA 3X11B 3X3FL 5JA8B 1CQKA 2ZNWA 4ONGL 2RCSL 3B9VA 4EN3B 3TBYB 2VUYA 4HKXA 2X4TA 4KPHH 3GIZL 4PTTB 1BVKA 4YUEH 3NCJL 2ZPKH 2FBJL 1S7VA 3MNVA 5GJTH 2GSGA 2HFTA 1G9EA 3QXUA 2FB4H 1OLLA 2ZNXA 4FTVB 3PABA 4PJ9D 4HUVA 5GRXG 3CZJA 1TITA 1BLNB 4HD9A 1SBSL 1MFBH 1YYLL 4BZ1H 2R1YA 4HIIB 4QHLA 3BIKB 5HYEA 4FMKA 2CKBB 4JDVA 4JZOA 5IP4A 2V2TB 4ZSOB 5JOFA 5E2WH 5GSRB 3QIUB 4L9LA 1QTYT 4WUKH 1ZGLM 4JPVL 5FV2A 3G9AB 3G6JF 4X80L 4ZAKC 3KG5A 4M6AA 4N0RA 2A38A 2L7JA 2LQRA 3FONB 5C0CB 3T65B 2YUVA 1CL7L 1ED3B 4UILL 2Y07L 3Q6FA 4XRCA 3UTTA 2FJGB 3JBG7 2UZIL 1YQ2A 1RUPL 2VLJD 3LH2H 3X12B 3QFJB 2NW3B 2EXWC 3FQTB 1CDUA 4M7LL 4ENED 2OK0L 2ARJA 4TUOB 3QDGA 5EOTA 4ZNEE 1Z9LA 2FLBT 3FQUB 3HC3L 4Z7QE 4JPIB 4K94H 1LD9A 5L8JB 1PAMA 5TPWH 4ELMA 1TIUA 7CGTA 3FHQA 1C5DB 4POZD 1BOGB 4U1KB 3U36A 1RSFA 2DQGL 2C1PA 1NGQH 2VDRL 4PGBA 4X7EC 5C07E 3EDFA 3PWNB 3SGEI 3R4DA 1TLKA 4CADB 4XTRC 1J1XH 3V5DB 3VD3A 1A7OH 4YDVB 4RWHA 1J8HB 1PX3A 3BZ4A 3PGDA 4KK9C 1VADA 4RGNE 1IGJB 2DG0A 5CD5D 1QEWA 4JREB 3BWAA 5CD3B 2GI7A 3H9SA 5FGCB 4BYHA 1JZ6A 1KUMA 5J06A 3MYZA 1A2YB 5FGSA 3K81A 1DN0B 4U6TA 1SEBB 4YGVB 3FT2B 3LQMA 1I9IH 4PG9A 3UP1A 1EFQA 4CVXA 5TF0A 3REVB 2A9ML 4XNMB 1S9YA 3ULSB 5KG9A 4OCRH 2BFVH 1EVUA 4KRPC 3DO7A 2ATKB 3EYFB 4UT9H 4HX1A 3BRDA 4M02A 4OZGF 2OQJA 4OD1H 2IFFH 2FJHA 5JXAL 1LP9A 2M2DA 1HH9B 4KROD 4RAUB 3V95A 3VGHA 5C0FB 4CU7A 1KCRH 2IAOA 3L3OA 2MHAB 1L7TL 5CBEA 4I18A 5ABDE 5EZIH 4DGYH 1H0DB 2WUBL 5D2LA 3SJVB 3BZEB 3WNOA 4Y1AA 3ROOA 5I9QB 3RGVB 5CKGA 3EOTL 4IDJH 2BNUA 2RAMA 1BWWA 3MTRA 5ALBH 4OZIA 2XN9A 5DJ0A 4URTB 4J8RA 4PRDB 3QIWA 1JF5A 1QPXA 4XMKH 5D7IA 1AKJD 1QSFB 3IGAB 3S4SB 3TJEH 2IAUA 1BD2B 3UTZB 2PYEB 2KUTA 4PJDF 4MAYD 4ZFGL 4L3AA 2VQ1A 1NCCL 4QRTB 3I6LE 5GX1A 4UTAL 3NIGE 1OP9A 3NH7L 3PL6A 2DJ4A 2X4RA 4ZQKA 2QQNH 1T04B 5D6DC 3EDJA 4MB4A 3IDYC 4NPYB 3MX0A 4WUUB 5A2LH 2VN7A 3NN8B 3DNKA 1AY1L 4UIKL 5ESAA 3VJ6A 3GSWA 4YHZL 4NZDA 4I0PB 2H9GB 3WE6A 2VC2H 2ZOKB 4I2XE 1F6AA 1ACYL 5KANG 1MJJA 3SDAA 2BCKA 4OV6F 1TXKA 4XX1E 1YC7A 5FUCC 2AGJL 3DUSB 3N1FC 4M62L 2QQKH 1SVCP 2D03L 2VZUA 2PW1A 3G6JB 2HFEB 3IFPB 3RUGB 5E8OB 3QUZB 4HT1L 4GT7A 1UH3A 4JFFE 3U9PH 4M7ZB 3DI3B 2KZ1B 2V2XB 2BRQA 5B8CB 1MCDA 2X1QA 1YQVH 4NFDA 1CD1B 4OZHE 4DOHB 1WIPA 1I8KA 3AMRA 4NZTL 3ARZA 4PIRF 4UINH 2VLMD 3KLSA 5JIHA 5TQ0L 1CT8A 2XICA 3R8BB 3EDKA 4GN7A 3U46B 5D1XD 1FO0A 4XB8A 1MREH 4N8CH 4E42B 2ZP0T 5HHPA 3DXAE 3UC0H 4CNIB 3G5VB 4XNZC 3ULVD 4GW5A 5A2IH 2GK2A 4QLRA 4O58L 3CDGA 4Z7VE 5FIEA 1LMKA 1FL5B 2B8OT 1UM6H 5EC2A 2LTQC 5C0RL 4L3EB 3Q6GH 5BQ7A 4KTYA 2DIAA 2QHRH 4G8IA 1OAXH 3F58L 4HC1H 5HHMD 2R1WA 3RX7A 2A74B 1BJ1H 1MRCL 4TNWF 4N0CD 3LV3A 3DHMA 5D8JH 4F7TA 1DUYA 9CGTA 2NY6B 2R2HB 4XCEB 3ZYIA 1ZHBA 4LF3A 3BUYA 2JB5L 1WT5C 2FR4A 4GG8A 1WC7B 1P7HL 2F9BT 3A67L 5C9JA 5T3ZH 3MLTB 3FVZA 5CIPB 4O5TA 2ZJSH 3NCEB 3RWJB 5CJOH 1CK0L 1EEZB 4AG4H 1PJ9A 2XTJB 3EYUH 5I15L 5I8OL 2WLYA 1F97A 1Z5LB 3EYQD 3GFUA 4H8WC 2OJZH 5IQ7H 2VLRE 5JA9A 1HSBB 1P7QB 4YR6B 1OGAB 1F90H 4ODSL 4XX1G 5D72L 1K8DA 1I7RA 2GJ6A 2C1OA 2N7AA 5IBLD 2D7MA 1U3HA 5D7JC 2P4AB 4OZ4A 3MA9L 3IJYB 1YEDB 3S35H 1EUUA 2CR6A 4LRIC 3DETC 3H7LA 4W6WB 2AI0H 4FHBD 4G7VH 3QG6B 5FO7A 7FABH 1KFAH 4ZTPL 1Q72H 1ZA3A 1MH5B 2EECA 3D18B 2V2WA 5ENWB 5HSFA 2J5LB 4PRPA 3LB6D 5SX4I 2PXYC 3A6OA 3EGSB 3DUUB 4RWYH 1CTNA 2Y23A 4PJDB 4QOKA 3ZKMC 4JFDA 3W2DL 3SDDA 1JN6A 3TBSB 4JO1H 1DEEA 2OMBA 2DI7A 5J12B 4AEIL 1AHWB 1A6AB 5BZWB 2Z8VC 3TVMA 4LEXL 3STLA 4PJIA 3P5BL 4BUHA 2D3VA 1Z0MA 1R3JB 1CLYL 3O6FC 4X9HA 4XCYB 3O6LL 3MO1A 1FNGB 1CLZL 1EFXD 3PWLA 5F7NC 1T2XA 1BJMA 5DJ8B 2VSDA 4APQA 3LPWA 5ERWB 3OG6B 4K3HA 4L8SC 1NKRA 4JHZA 1XF1A 4UT7H 4P3CH 3KXFB 1QACA 3QZWB 1IEBB 3HMWH 4RIRB 4OI8A 4DGIL 2GJZA 2E7LC 3PWPB 5C09B 1OP5K 3U1SH 5GGRY 5ESVB 4D8PA 2OR8A 2VXQL 4MJ4A 4TUJB 3T09A 1LE5A 2HN7B 3QI9D 4L4VA 5CZVH 5F8RC 4NJ9L 3P30H 3H3PH 3SOBL 4Q0XH 5BJTA 4JFEA 4PPTA 3UBXB 5CP3H 4JFOB 4KXZI 3CXDH 2X4QA 1HYRC 3O4LD 1TJGL 1CFQA 5ISZE 3O6KH 3MRNB 3KPQB 2EKSA 5EUKB 5EORH 5DJYB 3VWJB 2ICEB 2CKNA 1FNFA 4A6YB 2A83A 3O2WL 4I3SL 1U6AL 4JO4L 5EU6A 3ZHKA 2YD3A 2Q87A 5TDOB 3SCMD 2VISA 4WU7B 5AYUL 1LDPL 1B4JL 1KB9J 1ZLUH 2O5YH 2D2OA 4G5ZL 4PRIE 3K3QA 1IKFH 4N68A 5FYJH 4OCYH 3TV3H 1GAFL 1QRNA 2LV4A 1NAML 3V6FB 5JORA 3D9AH 3IXAB 1ACZA 2QQLL 5HYQA 1G9MC 4QWWC 3MRIA 2P42B 5KAQG 3BQUC 1MHHB 3MRCA 5JW4Q 3E1F1 1BZQK 4RCAA 4MXVE 4XNUL 1JUFB 3JWOC 4QTIL 4ZOEA 4OTXH 3L9RA 1XGQB 4OIIL 3OJMB 3CUPB 3FMGH 3CK0L 1IGMH 5DJ6A 5HHVL 4M61A 5I73C 4Z78B 1N0LA 2DYPB 3MRKA 1D5XB 2QL1A 2XTLA 3KPSD 1JE6A 3LCYA 4WEBH 3NPSC 3C60C 5BS0E 1XGYH 3RP1A 1RJZB 1A9BA 3ARFC 4Z76B 1LEGA 4Y19E 2ZUYA 4PGDB 3UJTH 3ZTJG 4JRYB 5IBUB 1XF2B 5EPMA 5J13B 2HYMA 3RTQC 4XXDB 4NM4L 1BAFL 3I3EA 1BZ7A 3PWJB 1I8LC 1RV6X 1N6QH 1POOA 2R56H 3H3BC 3TZVB 2NY5L 1Q9WB 5CZXC 4IRSD 2F74A 4U31A 1Z3GL 1SYVB 2DKMA 4RMWA 3QUMB 4L8CB 1C7SA 1U8PA 3VMPA 4R4FH 3PHSA 4LL9A 1DR9A 3OX8B 3UCRA 4ZYKB 4NHUB 1F42A 3O9WD 3WLBA 4B7LA 5FYKU 1YN6A 5C3TA 3QPXH 4L4TB 5DJZB 1P2CB 4WHCA 3CU7A 4JQVA 5HJ3B 4Y4KC 4JY4A 2W38A 3TCXA 1KJ2H 1CZ8H 1Q9KA 1JGEA 5BV7H 5GIRA 5JIIA 3QUKA 2DMCA 4S1DD 3O3BB 1CFSA 2XFXA 1C08A 5EBMA 3MV8D 2NY3D 5F7LB 4P46D 4GQ9L 5EC1B 4HIEA 5DD3L 3RAJH 1IEAB 5IOPA 3MJ9H 3C87A 3PQYA 4FQLL 3VXUB 2E8ZA 3P73B 4GMSL 1EBAA 3L7EB 3RGHA 3VXTB 4RISH 2DQUL 2R0LL 1PY4A 5HYFA 4U7SA 3RX5A 1UQSA 1CIDA 3BW9A 4POYA 4IOIB 3QDMD 1ZT1A 4PJ5E 3OGCA 3QNXB 4DTGH 1SBBA 2ITDA 2OTUA 4M5YH 3RHWK 1QR1A 3NAAH 3MREB 4RNRA 2HVKB 3SKOA 4GBXB 3S36X 5IUSA 3CSBA 3DROA 1EHNA 1G9NH 3KPNA 4AM0B 5LG1A 3WFDH 4OD3H 1IL1A 4X4ZA 2DI9A 4LP5A 3NIDE 4MQ7B 2IMNA 4OKDA 5DUML 5IV2A 2B4CL 4XP6L 1G7LA 2BVUA 2DD8H 3CZFA 3MLVL 4YWGL 4YDIH 5D7SH 2P5EA 1BIIB 1JPGA 1CICA 1I1FB 4MS8C 4XCNA 1XH3A 2KZWA 3KDMA 2P46B 5GX2A 1A1OA 3KPMA 2PCPB 1F6LL 3BP5B 1T21B 5CSGA 3DPBA 4XMPL 3ARRA 3PP4L