2W8BB

Crystal structure of processed tolb in complex with pal
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
409
structure length
409
Chain Sequence
EVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/membrane protein
molecule keywords PROTEIN TOLB
publication title Allosteric Beta-Propeller Signalling in Tolb and its Manipulation by Translocating Colicins.
pubmed doi rcsb
source organism Escherichia coli
total genus 113
structure length 409
sequence length 409
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04052 TolB_N TolB amino-terminal domain
B PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2w8bB02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2w8bB01
1CVMA 3DASA 5GTQA 3A9HA 3KGGA 2GVUA 3A9GA 2IASA 1Q7FA 3O4PA 2P4OA 5FWWA 5GX2A 3TC9A 2IAXA 3G4HA 1C5KA 2IAVA 1QLGA 2IARA 4HW6A 4HHQA 3S8VA 2IVZA 1NPEA 3SOBB 5GX5A 3BYCA 3SREA 2FP9A 3HLIA 3E5ZA 2GVWA 4HHOA 5D9CA 2G8SA 4GN8A 3AMSA 3Q6TA 4R40A 3LI5A 4Q1UA 5D9DA 3IAXA 2ISMA 2FPBA 2GVVA 2POOA 1CQ1A 3WW9A 3V64C 2IAWA 2V91A 4GNAA 1POOA 1C9UA 4O5TA 1E1AA 3WWAA 2IAPA 4JMLA 2W8BA 2QE8A 4O5SA 3Q6KA 1CRUA 3SRGA 5EX7A 3S94A 2DG1A 4PWZA 2OJHA 3LI4A 3V65B 3LI3A 2FP8A 2IAUA 2W8BB 3I1CA 3SOQA 2DG0A 4ZLRA 3SOVA 1H6LA 5D9BA 4GNCA 3U0SA 2VAQA 3AMRA 4DG6A 3Q6PA 4GN9A 2GVXA 3HLHA 3HRPA 2GHSA 1V04A 2IAOA 3V1SA 5GX3A 3P5BL 3DR2A 2HQSA 1IJQA 4GNBA 1RWLA 4IYGA 4GN7A 3S8ZA 3KYAA 4A0PA 3G4EA 2IATA 5GX4A 2DSOA 2IAQA 2FPCA 1RWIA 5GX1A 1N7DA 4IMBA 1PJXA 1CRZA 1QBIA 3FW0A 3FVZA 3S2KA
chains in the Genus database with same CATH superfamily
3G0HA 3BB4A 2ZJ6A 3UJ7A 1U02A 1XLVA 3EXIA 4HEA1 1TCUA 1PR0A 2F8MA 3KE8A 1H69A 1NQVA 3B6MA 4ZANA 2QOEA 2BZDA 1CD5A 1UFQA 4UUMA 2BM9A 4YRLA 5C3MA 2J5XA 4G8JA 1QP4A 3NYRA 1VCUA 4KS2A 5JDIC 1NUAA 2I2BA 3E03A 2ZWOA 4JAVC 1YO6A 1OWPA 1A04A 2PLAA 2GLTA 3PXBA 4YRBA 4TRJA 3W2EA 2UZ4A 1UOQA 1WMSA 1YUNA 3NAGA 1MC1A 1RZUA 4JEUA 4JXJA 4QTUB 1HTBA 4D7AA 1PSZA 1RRMA 2XNDD 4MV0A 2K87A 4XWTA 1V7QA 1DAHA 2OYSA 2J3JA 2OAGA 3FGPA 4FVKA 3MJSA 3TGPA 4YO8A 3GLHE 5HYVA 4Y2UA 3ZV4A 2CDAA 1I94B 3PI6A 4CPZA 2QN8A 1RI4A 3MAAC 1YMUA 4MR7A 2XNDA 3NTLA 1TF7A 5K3BA 5LLTA 4HBZA 3VVLA 4KVAA 5G1PA 2YY7A 2IP2A 3A6KA 4AZ0B 5BYJA 3ZWKA 1Q7RA 2B4KA 3NBMA 4RF4A 3HXOA 4RQAA 1QKIA 2KMLA 4TZKA 2MMCA 1Y0BA 3JU3A 3DG9A 1IK6A 2YIDA 1LEHA 4DQVA 2DT8A 4I50A 2CDBA 3ZU6A 2BMAA 2XLCA 3ELDA 2GPYA 5DHAA 5BSWA 3SIWA 4B43A 3NN9A 4U39A 4BBWA 1E2IA 1FRFS 1N5MA 3N7AA 3ZXUB 4GPEA 4O2BA 2D2FA 3A1NA 2GNAA 1D4OA 3HDQA 4RELA 2FLUX 3BF8A 3WI7A 1L7NA 4C7XA 5LCXA 5I48A 1W1XA 3MQFA 4PWZA 5KYKA 3AKEA 3MMZA 5ALIA 4JQSA 5TX7A 4I9GA 4JIGA 1WCV1 2EKDA 2FP8A 4MVJF 5D6NA 1Q57A 2IY8A 3VM6A 1FQJA 2YZGA 4MQ5A 4H6XA 2XQGA 2EJCA 1TT5B 4YAJA 1HR0B 5EFOA 4JYZA 3PVCA 1YRBA 3BJEA 3KVRA 4YDHB 1VM6A 2H1IA 4YR9A 2HXYA 5LKRA 1M8KA 1E4EB 1FX1A 5ALWA 3RYFB 2P11A 2W2NA 3L1UA 4MXDA 2Q3FA 1XPRA 4ZT6A 2POQX 1LW6E 4PYQA 4J7CA 2EW8A 5LNK6 4FWTA 4MDFA 2VZLA 2CFRA 3TL2A 2YJNA 1N7GA 2YVKA 5IASA 4HLUA 4NZ9A 2XXBA 4DARA 1QDLB 2GCOA 2V74B 1KOFA 4HNAB 1TZBA 3RUFA 2OQIA 3PNPA 4KE6A 1SU4A 3BHNA 3FRJA 4NN9A 1LS6A 4OQDA 1GTRA 1FYWA 2D5IA 3LWDA 2YDTA 2ZULA 4LYYA 1JAHA 1H9CA 3RAPR 4CV0A 1NI4A 2HA0A 4K6FA 2QJOA 2XJ4A 4NH4A 2FGKA 4TN5A 5L3QB 3FHLA 1W4BA 3CVUA 2WU3A 4AW9A 2RKCA 3CM0A 3MM4A 1LLQA 4S1VA 1BVUA 4PTYA 4QDTA 3OKCA 3BCSA 3C41J 2EX0A 3NZEA 3ZE9A 4KPEC 1GZ3A 5BWMA 4ZOEA 3DB2A 5DHSA 1MCZA 3GFRA 3V97A 4GBGA 4QQFA 3EF0A 3KSBC 4WXEA 3FUVA 1KORA 1QTIA 2JFHA 3IB6A 1XZDA 4H0CA 4J0IA 4JJAA 4LNUB 2B30A 4PNZA 1E58A 2CZQA 3BUSA 2FP4A 3Q3VA 1JYEA 2O3SA 2ZTHA 1IPEA 1G6Q1 4WKGA 1XTKA 1H4QA 1NW4A 2I7DA 5BPFA 2JATA 4BJ6A 3LZ6A 1E4VA 1O95C 4DBVO 4BGEA 1OREA 3TFQA 4YRMA 1E4OA 3HV2A 2GN9A 5JWRA 2VYCA 4BFLA 1J5EB 4Z4IA 3RTCA 1TMGE 3LT2A 3I9JA 3VPDA 2O8DA 3DYBA 4K1JA 2YYYA 2ID4A 1KZYC 2AE2A 4B4KA 2BT4A 5C9ZA 4H15A 4UU0A 1AUOA 2YWFA 3NYQA 4NV0A 4BQSA 4ESHA 5BQ3A 4EY6A 3GT0A 3AY3A 3SOZA 5DSZA 1Z4XA 1XP5A 4C6TA 5JNVA 1DC8A 3DR5A 3ZGYA 4X94A 1NDQA 4YZ5A 2QTBA 1VL1A 4I1YA 4CF7A 1U8UA 2BR4A 3PXCX 3CVWA 5BNZA 2NVUA 1UJBA 2IOYA 2WTEA 2P9CA 4PGGA 1LNQA 5DW3A 2GEBA 3L8MA 1R37A 1USRA 3CC8A 1GV0A 2XHZA 5CM9C 1N9GB 3DV0B 1A7JA 2X9GA 4J3JA 1JP7A 4MV4A 4A23A 2QTHA 4G5QA 3S8EA 3IDZA 1MZPA 1ECPA 1C7RA 5T6MA 2CFIA 4JBLA 3WWAA 4YCJA 5DP1A 2QTMA 5K8UA 4P4SB 3C7AA 1Z29A 2P4UA 3CIOA 1XXHA 3Q6KA 4JCOA 4V1CI 5LLDA 1TYDE 4M0PA 1U2SA 3O75A 1SVUA 3MQ2A 1OV4A 2VNAA 4JL5A 3T9DA 4PRKA 1YBMA 2HQBA 3EQ6A 5GM1A 1DCMA 2P5YA 4KR9A 1BYUA 5K0EA 3WWCA 3GQBA 2WU8A 1K98A 1Z7GA 3EAFA 3IMFA 2ZE7A 4GQIA 5CNIA 5F23A 1I7NA 2IVFA 4TSRA 5JAPA 3ER8A 4V24A 4EGCB 4F2PA 1O57A 2IS2A 3BYZA 5ERXA 3NO0A 3OQIA 1NY5A 4Z7OB 3L0YA 5IANA 3EG5A 5KNDH 3VKGA 2AEMA 3MJ4A 3FZNA 3C3JA 3GN2A 1OT5A 3IUEA 1NP7A 1F8UA 3V1MA 3HU3A 4A0RA 4ARZA 4B5KA 1M2FA 1JEYB 6REQB 5AR1A 4V2UA 4G0YA 1NMZA 4MQMA 4MARA 4CCWA 3C2QA 4L95C 3LSTA 4M1KA 1PFGA 4LJ8A 5GV8A 3QMWA 1IY0A 4TXNA 1YCDA 2P3OA 1NQTA 2GO1A 4RJTA 1WZEA 1K08A 1PQUA 1R4MA 5FI3A 1CUEA 1GAXA 1PZGA 1YZFA 4CIVA 3BWMA 5M34A 1SO8A 1SPXA 2D0IA 4FVTA 5DNYB 5ES4B 1L2TA 1WBDA 4C04A 4B4WA 5D5PA 4X3PA 5ILQA 3N74A 5EGSA 5H70A 4K1LA 4EVQA 3EJWA 4MWDA 1F8DA 2GFHA 4LCBA 5IKMA 1DG3A 2FSPA 3M2TA 4V0NA 1QO7A 2GYWA 1EUQA 4JJGA 1RWWA 3FPGA 3M5WA 1N5LA 1I1NA 3HYSA 4C3UA 4EA8A 2X1VA 2QSUA 4RYDA 1VYVA 2PUVA 5CA0F 1B8UA 1L4YA 1Q16A 2C59A 1DCTA 2CCJA 1QWOA 2RIRA 2WMOB 1RABA 1OFUA 1Z4IA 2V6BA 2WB4A 3NI2A 1LDMA 2B4QA 4N0MA 3WRWA 4DZRA 1SMKA 5DGDA 4D74A 2XCLA 4YT8A 1DKLA 4YDSA 5J9FA 4M0FA 3W9SA 4XX0A 1GADO 1Z26A 2QMYA 3K8QA 2JJMA 3DL2A 4LMPA 2NV0A 1MDFA 5JNSA 3E1GA 3NOOA 2IE8A 3ZVMA 1OH8A 3FFWA 3I5AA 2RE8A 1GV1A 1S3SA 1VECA 3E3MA 3HH8A 4CQMD 1PSDA 2PR7A 3UMFA 4ZHSA 5C7IO 4TWBA 1M2EA 3U4IA 5K3EA 5K3AA 2JFVA 1JEAA 4I5GA 4P81A 1DTWB 1GCAA 1Q15A 4H7JA 5KHLB 5KQRA 4JLKA 4HEQA 1V3DA 2VPZA 4LI0A 3LVBA 1T2FA 2WU1A 4R3WA 2OCKA 4FR0A 4CQMA 3AFNA 3F1KA 2XPCA 1CJBA 1WZCA 4Y6GB 5FWYA 2A59A 3ANSA 4TXMA 1L4MA 4AO6A 1S0UA 4JNCA 1HDEA 1MTZA 4B75A 3MOIA 2VHXA 4WFIA 3QI7A 4IJKA 4PAWA 3SZLA 4CDMA 1EXWA 4Q1EA 1Q0TA 3OEEA 4DY6A 3TSYA 1OJLA 1JE0A 2X2PA 1LBTA 1OFVA 2XWQA 1E69A 1L4FA 1DILA 4WXPA 1UQUA 4ND6A 2BI7A 1Y8CA 3CPJB 2H9IA 5GGYA 1PR3A 1I6KA 2GN6A 2GCPA 5ALUA 2JIDA 4E5YA 1SXJC 3ILSA 2O6HA 4Z7QB 1ONPA 3TRDA 4YV1A 3AB8A 4R2KA 1XZMA 3PJGA 721PA 5IEBA 3PDUA 1YNOA 1RDFA 4HFRA 4YMTA 3OTOB 1Q1ZA 3STYA 4E1BA 1ABBA 2B1IA 3OO1A 5ICMA 1IUNA 2VSFA 3RV4A 1VYHA 3OZSA 1KQOA 1LA2A 3M5DA 2HPZA 2P91A 3L06A 4GYKA 4I4TA 1L7DA 3PJQA 4QHYA 5A4JA 2RKBA 3OUTA 2AH5A 4WKCA 2F1OA 1WZUA 5DYYA 1Z0JA 2AQKA 3ZD9A 4YB8A 2JEYA 1DAGA 1AZSC 1ULBA 4HTFA 2H51A 1RM3A 2DC1A 3JAKB 5KREA 3CYFA 1BWPA 1J8DA 4MWTA 5JG7A 3AERB 3OOSA 2WZDA 4JNKA 4XA8A 4DVJA 5AVYA 1FUEA 2AFHE 4PAQA 2GBLA 4UTRA 5FNQA 3GEBA 1GSIA 3VU8A 1YS2X 2O5EA 1G5RA 3EZ7A 4LYAA 4MV8A 4A7PA 2N1BA 4Q48A 5C2JB 3VR5A 4Y2TA 3I3OA 7ABPA 5G4KA 2IYFA 1IULA 2YHBA 1CKEA 1PGJA 3ETHA 3F4LA 3FKQA 4UHJA 4URYR 5JAOA 1B8OA 3IHLA 3KJQA 5GZ6A 1VBKA 4JUBA 1MJHA 2X3YA 2XBLA 4ZQHA 4HDKB 2I2WA 4UE6A 4C07A 4D9CA 1RYBA 2ZU6A 4EOGA 3C0KA 2A4KA 5TF0A 3MB5A 3PUYA 2EKZA 1LQTA 3O2SB 5SZKB 5JTTA 4PQYA 4GZ6A 3HL4A 1E3TA 5FFNA 1JR3D 3KUKA 3OM8A 1X2JA 4FHEA 5FV4A 4J7AA 4OV6B 2FTKE 5FPSA 5CD1A 5DGHA 4EARA 1FNSA 3AVYA 2PKEA 1IM5A 4RD0A 4C1YA 4FEYA 4W7HA 5CFOA 1EVYA 4OQMA 4BO8A 1EGMB 4BE9A 2AEQA 1JR3A 1UBNA 3ZOZA 4IS3A 4V0MA 3W8DA 2YDYA 3C15C 2AGVA 5HS6A 4YIHA 5IHPA 5JSFA 1G18A 4YLEA 1QYIA 1QF9A 1BEUB 2E82A 2IHZA 3HYTA 2BMWA 3QENA 4GC9A 1P4HA 3GVLA 2BEJA 2OESA 2SCUB 2EFCB 3EUEA 3V6LA 5B2ZA 1PZMA 2GM5A 2QLMA 3HY3A 4E09A 1K86A 3DMRA 4G9GA 4RKEA 4Y9UA 5B6JA 4KQHA 4DV5B 4RACA 3UWPA 2OHXA 4HYYA 1DHRA 5K51A 3LVRE 2UU9B 2PGDA 1CJMA 1ZJYA 2F11A 3G2IA 3NHJA 1AUVA 4PTZA 3QMPA 4Z0NA 3H16A 5E3HA 1T8YA 3PQ8A 1B1CA 2VDPB 4Q4HA 4ENSA 2R4QA 1PVVA 2VUHB 3V7YA 5B7NA 1FTSA 2AOXA 3BTVA 5F35A 5BW8A 3ABOB 4D02A 4LKOA 2IYLD 1Z56C 1UMDB 1L4NA 2HWXA 4KGZA 3ROEA 5A5EA 5DNVA 3PKZA 3DHNA 4WNCA 4AU1A 3IOEA 3UAXA 1WCSA 2ROQA 4BN5A 3MMSA 1CTQA 3CNLA 3I52A 3IPAA 2NU8B 3WGQA 2CNBA 2R7AA 5LDDC 1ENYA 2QRVB 1ODJA 4HR7A 4D9HA 1GXSA 3AXTA 5AI9A 3ESYA 3H9QA 3FN4A 3KUUA 3GT7A 1AMOA 2GZRA 4I5EA 4WUTA 3VZRA 2C2WA 1SCUA 1X87A 1MZ5A 1WW3A 1NSYA 3I6MA 3I37X 3WO1A 3QMVA 4C0SA 5DHFA 1JHVA 1DRKA 1W36B 1E77A 1CCWA 1R3UA 4JI8B 4WA5A 1FK8A 1JI0A 4IMJB 4OSEA 4H1UA 4JI1B 4MS3A 2CFOA 2RHMA 2RI6A 3LL4A 1K0FA 1DLJA 1G21B 2C9OA 2I4RA 3G17A 4L76A 2WV9A 5PGMA 2B8EA 3QLVA 2R6JA 4RQBA 4FFRA 4CPDA 4AICA 2X7JA 4UZSA 4BUCA 1PU2A 2QRPA 2H2GA 3SHOA 3W2GA 2I8CA 2YXBA 1GUAA 3CZQA 1MPXA 4EZIA 2C4AA 1QYDA 1SA0B 3ZD7A 2OOKA 3B38A 4GPZA 4JA2A 3EJ6A 1E18A 4KKXB 4X71A 3WGMA 4YRAA 3ZHSA 2EBWA 3U6BA 2UVDA 3WB2A 3DT8A 4R2IA 5LIPA 3PHJA 3QEJA 2XUJA 3ZI4A 2QN1A 1O6CA 3B82A 5HTOA 2YXLA 3I04M 2KJQA 1JFLA 3V8EA 1G6OA 1QZZA 2OBYA 1B8NA 3BEQA 1G3UA 2CJPA 2GYYA 1GYQA 1QX3A 4QX6A 4M99A 1RSZA 3CW2A 5BSEA 2D13A 2OO7A 2IOFA 2ORYA 4ZODA 1U7ZA 1YR1A 1SXPA 5J1SB 3STWA 4Q18A 4QIHA 3M5CA 1KEEB 1YE5A 2Z43A 4FPJA 1RAGA 2ZYSA 4IEFB 3RC7A 4AY3A 1U65A 2ZT5A 3DOCA 2ZTVA 5GX1A 4E2WA 5BV7A 1H4SA 2ZRDA 3HI4A 4NJMB 3LT0A 4DAOA 3VNQA 3MLBA 4J3FA 1EEHA 2NV2B 1Y1RA 4D79A 1A2QA 2PFGA 3CUKA 3TTXA 4JLOA 3I4CA 1W49A 2R6ZA 3V3KA 3CRNA 4FGZA 3KGGA 1V37A 1U9IC 4A0GA 4QBGB 5EKUA 3A9GA 4I1RA 4MHOA 4O6VA 4WESA 4IFBA 4ZIRB 4AYXA 3QU4A 2PZFA 4KSCA 4HQ6A 2WFZA 1O4VA 3EGCA 4KS4A 1ABEA 3HCWA 3MCTA 1WA5A 5IXYA 1HYHA 1Z62A 4YMGA 4K1IA 4CKZA 4GI1A 5H80A 2XZLA 2BHLA 3LXUX 2PYDA 2PX8A 5K6RA 3JTMA 2GJ9A 2PVSA 1JGTA 4AJKA 4EA9A 2Q27A 4P7FA 4G23A 3UJDA 2D0DA 2H0AA 2C3OA 4J29A 2PKXA 3AEUB 1EFKA 4TMTA 2GN1A 5JYBA 4IFTA 1H94A 5TRTA 5CB6A 3BFXA 1VHQA 2BLNA 4UUBA 1OGJA 5C35A 3P9SA 5K99A 3E9MA 3F71A 1HT2E 4MJ3A 2XXAA 2GVWA 2C5HA 2XCUA 2AFRA 1S2OA 3RUEA 4B48A 2WHQA 4HNHA 4DQXA 2O8BA 1JHMA 3FXAA 4XPZA 4K9KA 5EEGA 2DTEA 2N1MA 2WJWA 3I0ZA 3QKUA 3TLYA 2ZS9A 2J3EA 1TJ5A 4G63A 3D8UA 4GZLA 3GDHA 1W75A 4D6PA 3VKWA 3BQMB 3A3PA 4FYPA 4DSNA 1V2HE 1P73A 2VP6A 4Q7LA 4M53A 5L53A 3LQ1A 4ZT4A 3AUSA 1ADYA 5GPBA 4DCVA 1L1EA 3DF7A 4W5TA 4FNMA 2Z09A 3HM9A 3P2KA 2APJA 3K2BA 4TKZA 4AJHA 5JCJD 2PGNA 4E07A 1SRRA 1VL0A 4S35A 5KTOA 5F72C 3SBEA 3DVSX 3S94A 2HJGA 3JPYA 3LMKA 3G89A 3PYMA 3F3KA 1CIVA 4DA8A 4XJVA 1T8TA 2YW2A 1N2ZA 2FE4A 2I03A 3F7OA 1EGAA 4H1VA 1D2EA 2E6UX 5JCJA 1N0UA 1Z6ZA 3PA8A 3LI3A 1UUFA 3EVGA 2PRZA 1RWKA 5KU7A 3QHPA 4MGIR 3TL6A 3FSRA 1Z8HA 3AHCA 1E3IA 3EFOB 3BGVA 1M8FA 3NH9A 4K26A 3ZBUA 4EB8A 5MN5A 3VR2A 1ESMA 3OP1A 4WASA 1D7AA 1J9EA 5BRNA 4RPJA 2E87A 3E48A 1AU9A 2ZJ5A 1PQYA 3DTVB 2FN3A 3CSSA 3N86A 3O2QB 4YMVA 4OTZA 4RHXA 1M1ZA 2MSDB 1W0JA 3O38A 3HKEA 4GZ5A 2OGSA 4I2VA 5DU2A 4NXMB 2B5OA 3U7JA 4HP8A 1JFRA 5JS1A 4PLGA 1UM9A 3K0CA 1VB3A 4S05A 1MC5A 1OPXA 1ZHFA 4NULA 1KEPA 4WACA 4JS0A 4DG9A 1CQJA 3LUAA 4CM8A 4EFNA 4W5JA 4TMYA 3HZRA 1J25A 1Z2DA 2IGTA 3OKPA 5EVJA 1AM4D 1C0LA 1BWQA 3T3MB 1R7RA 1QS0A 2CD9A 5FPTA 2OBXA 3GRRA 1YB2A 1OHHA 4YTEA 3GFSA 1MH1A 3IPXA 4YQZA 4HHEA 3UW3A 4OLFA 4C05A 2F3RA 3ZWMA 4GNRA 1DT3A 3RG8A 4JVNA 3QH4A 3H73A 4NY1A 1HY3A 1WTCA 1MB4A 3ID6C 4ND8A 1L5OA 1L8QA 3WSTA 4D82A 1YIAA 3H1TA 1F6BA 2VA9A 2YIMA 3RASA 4GBMA 2H1LA 4RH0A 5G41A 4E11A 4QM7A 1KTIA 1YB4A 4QHTA 4HLNA 5C5IA 3Q98A 2X4IA 3GVJA 5TS3A 1UZNA 2I87A 1ID1A 2FZWA 2ZRIA 5CNMA 2WKPA 3WDMA 2QA5A 1BKDR 1XWWA 2FW7A 4NENA 2PANA 3H2ZA 3W2IA 1LS1A 2RHBA 4R2LA 1XD8A 3IMKA 1A9ZA 2MU1A 3NTXA 3ADDA 4I99A 3ZWQA 5ELMA 4U4AA 4R41A 1E3SA 5EJGA 3H86A 1PKXA 1OLUB 2IPXA 3ADOA 1LCIA 2GH1A 4MGEA 4LXQA 3G1TA 1R6UA 3BWCA 1GY8A 3SLRA 4RTKA 3OCJA 1V1RB 2P6NA 2DFKB 3DCNA 4L9WA 2AXQA 3IR6A 4MMXB 3PXGA 3TEMA 2UUBB 4BXOB 2YDXA 4AAYA 3FWHA 4M1SA 1WKBA 1YA4A 1WSWA 2GEKA 1V8DA 1V1MA 2AIRA 3U31A 3FYDA 1INVA 4TN1A 5IU6A 3FPAA 4A6XA 2Q6KA 5KOHB 4Q19A 1T5OA 2Z32A 1QC5A 3BRSA 1N2HA 2EL9A 2J32A 1GUZA 3IDOA 4MNTA 2A86A 2QAGB 2Q9BA 4X7MA 2OCLA 4AX4A 5B55A 1XCBA 2DPHA 3EFHA 4DYDA 1QVAA 2O3UA 4BNJA 2VQ3A 4NEQA 1ZUNB 1A5TA 4JHXA 4LHZA 4RVOA 3W90A 1TEXA 4BEBA 5AKIA 5INTA 2J33A 4K86A 3GEHA 1A71A 1UPFA 4JYMA 2CBGA 1P61B 3GVKA 3ESDA 4ZO9A 4PZUA 4LRUA 2V5UA 4YGXB 3FH0A 3QFSA 2DUUA 5AVJA 5CB0A 3FUUA 2HD4A 5FNUA 1L7GA 2XT6A 2ZBQA 1Y89A 2FSGA 2Y1GA 1BMDA 3GC6A 1G2QA 3IPYA 3N8KA 3W5DA 3EZ9A 3L46A 2YS6A 3NHYA 1K9VF 2C7QA 1DXHA 4TWZA 3GK3A 4WA4A 2IKQA 4B6FA 2YV2A 4B84A 3AOEC 2C54A 3F9IA 3VPBA 3E7XA 4CU5A 3QPAA 2H4FA 5JANA 1ECJA 2FEOA 2VDJA 1Q0PA 2NYAA 3A7DA 2V54A 3L40A 4NAVA 4TV9A 4BBPA 5KJ6A 4GKJB 5G3YA 2NT3A 4B6EA 5I3ZA 1WCXA 2QW0X 2RB4A 5H3HA 3VYVA 2FQQA 3TOZA 5EIEA 1JE1A 3A06A 3IQFA 5FR1A 1XTQA 3A1VA 2NP7A 5COQA 5EP3A 5ENVA 4IH1A 1KU0A 3SCZA 4UPEA 5IZCA 3WKBA 1J06A 3MGBA 4HL6A 1P9LA 4YRFA 2QUZA 1MO5A 3JWPA 3TLGB 2HADA 1WR8A 1BJKA 1IY8A 1UADA 3A1TA 4FGSA 1RS0A 4CI9A 3MHTA 1SOUA 4H53A 4NR0A 4BMCA 2X6TA 5SYNA 4INPA 4G0XA 3WZ2A 5T5QA 1W85A 5DOZA 4NG5A 4PG6A 2JASA 3I2YX 3L04A 2F4VB 3AFHA 5HEKA 3HEAA 3F4BA 1RM4A 2ZBPA 3I2FA 2CFTA 4GMXA 1PDWA 3SS8A 3GRAA 2YBDA 4KPGA 4OQXA 1AE1A 4DW8A 4E5MA 5A7FA 3K30A 5H16A 1W30A 3P71T 2WC1A 3I0NA 4A03A 5ENZA 5B1YA 2PNJA 3B7WA 1A98A 2HTFA 4AY6A 3ZDQA 4IQGA 1IJKA 1US8A 3UVEA 1J8QA 2IPMA 1YB7A 1XQYA 3CMMA 3JRWA 3WL8A 4D92A 5I4KA 4KRYA 2FQ1A 4L28A 4JWKA 4TQAA 3AFIA 5DXJA 3L8EA 4ARSA 3D8NA 3R7WA 4YDQA 3WL4A 1E6CA 3B78A 3A3OA 3N76A 2PX2A 4OGGA 3W4KA 1IQUA 3A0UA 3WQRA 5IT5A 1N2CB 1QX4A 3TNDA 4JEMA 4LQ4A 2ZRMA 3ZDXB 3OWXA 2ZIEA 4AJPA 5B2CA 4A9AA 4K46A 3FOEC 5JXGA 1A2OA 1VE9A 2EZ8A 3NX4A 2LZ0A 1TEZA 4G1FA 3NKFA 1H22A 4UE2A 1OX6A 2M6LA 2HSDA 4LXUA 5HHTA 3ZJVA 4BVGA 1Y3IA 2J0UB 3URKA 2OFPA 4BVKA 4O4JB 1AJEA 4MVJH 1ESZA 3MGAA 3U3OA 2V9CA 4CL0A 1WP9A 3GD7A 3PFNA 3W4JA 4DQUA 5B2EA 1JIXA 2DPYA 1GN9A 4GGPA 1NVWQ 3EUWA 1YB5A 1YQTA 4QT4A 1PW5A 2ZBFA 5IW8A 2IEBA 3KYJB 2BFAA 3FKSA 2HTEA 3DMFA 3NC0C 2FW8A 1C7QA 1X19A 1TYAE 2YWGA 3NKLA 4C0JA 4EF6A 4KGVA 1RC0A 2O7NA 3I12A 2O3RA 2PWAA 4EENA 5HGXA 4B9EA 1FSPA 4FGKA 1NNLA 2F62A 3OU7A 3IUMA 3MXOA 4Q9HA 1EM8B 1Y80A 2OQ2A 2AOTA 1Y1PA 3WLEA 3VZPA 4C0BA 3SXUB 4KIUA 5JS8A 4RK1A 1LF5A 3DQPA 1KVSA 5ALFA 4E1VA 4GNKA 1T2UA 3ZWYA 4HLDA 2C4NA 4CKXA 4RVUA 1P7VA 4JV5B 4Q03A 1KDRA 2EZTA 1OFZA 2IPNA 3SYLA 4JR2A 1GNVA 1FQKA 4ZVTA 1HOXA 2PUCA 1KO7A 1N5JA 1U4SA 5HZHA 1D2GA 3R6GA 1ZOOA 1XRNA 4TOIA 3PLAE 4FW9A 2OJHA 1EX7A 4L8FA 3F8TA 1BCRB 4C4SA 3MWKA 4DXDA 1RPTA 3NBXX 3D4OA 4HGPA 4E5PA 3RYFA 4E4TA 4F38A 5BRJA 5JJCA 5GY7A 2VRCD 3TZLA 3F6RA 2B1RA 5TGDA 1TMYA 3UQZA 1E0AA 1R6DA 2VJBA 2CK3A 1W94A 5LYJB 1TIKA 3BWEA 3PGLA 4ZDKA 2DFVA 3H5VA 3N70A 2W58A 3ASVA 4FMCB 5C18A 1I9CA 2P8JA 1RXIA 3CWZA 3U60B 4JKYA 3AP3A 3HRPA 3GEDA 4HNAA 4HB2A 2FN9A 1HFKA 1O96A 3VTAA 4B17A 4UBMA 5JASA 1U7XA 5IC6A 1Z0ZA 4BFZA 4HWPA 2AZMA 5ESWA 4BNXA 3KE9A 2AKAB 1YI1A 4DR3B 2OILA 13PKA 3D5QA 3BIOA 3JQFA 3LQ4A 5HIJA 5A6VA 3KJEA 1M6VB 4NQZA 4PS0A 2LGJA 1SCAA 3DVRX 1ZH6A 3QPVA 5AYVA 4EATA 5BWOA 4DV6B 1NPDA 2HL6A 2YCBA 3D7MA 2JPDA 1H2RS 3INGA 1CJKC 1I2ZA 4MIOA 4LFCB 1SUCA 3CJTA 1CQZA 3AF4A 4L3VA 4LKRA 1CHDA 2C03A 1YDFA 4YW2A 1QBGA 3GAMA 3K05A 5JIBA 3IV7A 4XQ9A 3ZHBA 3ZTTA 3R24A 1ODLA 3L4JA 5LYJF 1ZM9A 5A7GA 3DUFB 4LNUA 4ZN6A 4PG4A 5IABA 4FMCF 4AB1A 1SVLA 3DBHA 2Z2KA 5A3QA 5J4YA 4IVQA 4PF1A 4Q6BA 3T7CA 4PO8A 4ZI2A 3OM9A 4J03A 3TSAA 1W19A 3HJCA 4W1QA 3SF0A 3PZRA 5C37A 4ZQFA 3NJ8A 5DJ5A 3A8TA 2WP0A 4RVGA 4L16A 4WHMA 1ZXBA 2YIJA 1IRXA 1V5WA 2VAWA 1IQPA 2C9MA 2VO1A 2WFAA 2UZIR 1AHNA 2GVNA 3BAFA 4PINA 1RHQA 4QASA 1DEHA 2WNIA 3HB7A 3R0VA 4IKEA 1RLIA 4KYTA 5HF5A 5HP4A 1VKRA 2HK9A 3T3PB 2WRZA 3VZSA 4PNEA 4Z99A 3ZD8A 3DDUA 4Q4AA 2IAXA 1QH8B 2JK0A 5DNDA 2R8EA 5MFPA 1M8JA 2E6KA 2PXXA 4YT4A 4D44A 3ZCTA 2IU4A 1JPUA 3S2EA 1Y6QA 4AG6A 4UM5A 4CMBA 4PZYA 2PRYA 2RHLA 1HT1E 1VP3A 2W48A 1BE0A 2QUIA 3QXXA 5IHXA 2DECA 5P21A 1N78A 5A4DA 3CVVA 1OTYA 4OJTA 4C14A 1O6BA 1QPBA 3DV0A 4MQEA 4P53A 2JEOA 4ZO6A 3D2CA 3AB7A 3STTA 5JVDA 5F98A 3HEBA 4WFKA 1Z4VA 2R1VA 3AKDA 1L7MA 3AI1A 4R40A 2NU7B 3VZCA 3VZQA 2NP6A 1DOZA 1AKEA 3QU5A 3G79A 3M4XA 4NBKA 3L7CA 1ULAA 2WSSA 2PS1A 3WG9A 1RBMA 2WWXA 3MFYA 4FNAA 2BIFA 5B1IA 2BKEA 1KC1A 2RHWA 2NO0A 2FJUA 1GKIA 1Q50A 3FPSA 1QOQB 3BQNB 1IIRA 1OLOA 4GZSA 4RYLA 3UJ9A 5FADA 1A69A 5EO7A 4NPCA 2PSSA 4C5AA 4EVSA 4J9UE 1KAHA 5BNWA 5KC8A 1SUEA 4C20A 5IYZA 1JZTA 2FK8A 2H1OA 2Q6LA 1DRUA 2X5XA 2NPOA 4KOAA 5AOBA 1E8UA 3DAYA 4R2HA 1MO4A 3UUFA 2E1PA 1KEUA 3KQSA 3MJVA 5DYNA 2QXTA 3GLFE 2I8AA 5ICFA 4BFTA 4EA7A 3S5JA 3NRJA 1PS0A 3KQOA 2J3QA 3ZZMA 3NBYC 1XCOA 4NJEA 4A5SA 1JEYA 2ZVPX 3REOA 3FWYA 6REQA 1V3QE 1MJ5A 1VIMA 5C31A 1ZD9A 2DAPA 1MJFA 4J2HA 2QR3A 4KHPB 2R7MA 2OR3A 5H02A 4B2IA 3BMOB 3I72A 4HJXA 3NBZC 1T6YA 1VMAA 5BQPA 1O5OA 4GX1A 2JCSA 4Q9AA 3RRYA 1PJCA 4AG5A 4P4NA 2HLHA 2PU7A 1HUQA 1RXVA 2CXNA 3QNWA 2I2AA 2OM2A 2WR8A 4M9RA 5ALJA 5FF9A 2GEUA 1MS0A 2IYZA 2VHUA 3WDKA 4KLNA 1JKMA 3SBOA 2IKSA 4HDNB 4PO3X 2WTXA 4D0SA 2IBTA 1AO3A 1UINA 2HTUA 3EYAA 1WHSB 1N1YA 5FWAA 1V3BA 1V5FA 2ZSIA 3EBOA 3T99A 2WJIA 2IXGA 1TZKA 2CYCA 3HVKA 2O1EA 2A5JA 2QYHA 2AR9A 3THWB 2R9VA 1OFTA 1YUBA 1PWYE 3QVVA 3VXKA 2QT0A 2WKQA 2GI4A 1XPOA 4DTIA 5DCWA 2W20A 4LGMA 5JHHB 3DYIA 1Q0QA 4OP3A 3QXJA 4QPDA 4XD2A 3VC2A 3C3DA 3UMJA 2BFFA 1WVIA 3AUTA 3OICA 4H0NA 3DO5A 5BMVB 1IVEA 4KO3S 3F5QA 4P93A 5K0LA 4EO4A 1VRCA 1ULTA 1ZP6A 3GPBA 3VVMA 3WLPA 2ONKA 1XYVA 5IVPA 3CZMA 4XGIA 1IOVA 4Z0PA 1KBZA 3QBDA 3GL9A 4E31A 3PNOA 3ET4A 3OZFA 4NYJQ 3TQTA 4AN4A 4RSHA 4RD1A 3ZE7A 5LOVF 1A8IA 5CGQB 1X1CA 3TNJA 5C8VA 1Z6XA 5K0ZA 3LC0A 1NYTA 2JCVA 4QODA 5KMGA 5ALNA 4GXQA 2PO7A 2V7GA 3H2JA 1QRUA 5F2EA 3LHIA 3OJ0A 3U5ZB 1OFGA 1CUDA 4GPTA 1HT3A 2VXOA 3U3MA 1X8XA 2UZ1B 4LGCA 4FFBB 1NT4A 4ZMBA 1EZ1A 4PLFA 3HN7A 4WFJA 1R12A 2BGMA 5HCIA 1G8PA 2DHQA 4PGMA 2AI2A 4UNPA 1J2UA 1X14A 2ECPA 2RARA 5F7ZA 3D2BA 5C4MA 2FPPB 2JFZA 1CXZA 2P9ZA 1DBVO 4UU1A 4YCCA 3OZIA 1KJYA 4OHYA 1YCFA 3USCS 4KXYA 1YZKA 1ZL2A 3Q6TA 3CX8A 1KXJA 4Y6QA 3RUCA 3V00A 1GQSA 2EFHB 2GN2A 2E85A 3ONDA 4NABA 5IMBA 3WFZA 3WDSA 2CNKA 2VYND 5LQAA 3JD3A 4FFSA 1IEWA 2A8YA 4NZNA 4R3UC 2C84A 1SZPA 2FSUA 5JYYA 1CDEA 4L0MA 5F7OA 4N8DA 4TZ6A 3W6ZA 3G7SA 3T9AA 4JC4A 5FR2A 1IUPA 3WBBA 3K0AA 4IQ8A 3RH0A 4UBOA 4V38A 2UAGA 5HBRA 2IYQA 1OZAA 3VX3A 3ELUA 3BHIA 3L5KA 4GXTA 2A30A 2Y99A 3N2IA 2GZAA 2CXHA 3H2BA 5CMLA 3UHFA 3WB0A 4WKPA 2F3QA 1YIOA 1KY5A 2UXDB 3DFMA 2SLIA 3PFWO 3TPZA 4Y1FA 2BUBA 4W7SA 3AERA 2Y68A 1II8B 2I1WA 1UPCA 5D5QA 3V8VA 1QGAA 2XA2A 5TEWA 1NXTA 2CW5A 1RADA 3EIHA 9ABPA 2YS7A 3DDOA 4RPIA 2R2AA 3GLQA 2IPAB 1AQ6A 4MPTA 3AM5A 4X8MA 3KSZO 1OR8A 1AHHA 4KH0A 4N7MA 3T9FA 4ZYZA 3N05A 1N33B 1D07A 3MIIA 3RKUA 2Z6VA 5AJZA 2VKQA 1AO0A 3KC2A 4GEKA 1K8RA 1PDVA 3RJMA 2OM6A 3L4SO 3H87A 4HDKA 2RHTA 3AU9A 1XN1A 2CYAA 4IVNA 1NQ5A 1WXGA 3L7OA 3PSAA 5HQ3B 1SKMA 2PD6A 1UZAA 1EFVB 3FOZA 3ICCA 1WV0A 4OK5A 2HA2A 1QWSA 4M0MA 4C0LA 4WINA 2BGNA 5HMLA 1PL0A 1SKYB 3CH4B 1MR5A 3A9WA 5CVJA 1JWLA 3U4MA 1C1HA 2QTAA 2YIVX 1R5BA 1XCGB 2WMNB 3RSCA 5A9SB 1LX7A 1BFKA 4HC4A 4GGOA 3P9YA 3BE4A 1BXZA 1QB7A 1RYDA 2EFEB 3ELYA 3L3BA 4OB7A 4TZTA 4IFJA 4JZYA 3ZE1B 4ARVA 2ZUWA 3H1BA 3OPQA 3N2LA 1ZGKA 2HRZA 2C3MA 4GP7A 4X85A 3V8NA 2PAAA 5EJ9A 2PVCA 3MERA 1Z36A 5JMPA 2EAUA 4WCFC 4XDGA 1GG9A 1J2EA 1EZZA 1RHRA 2MTBA 3R74A 2EJUA 3WL3A 4J6FA 7ADHA 4J1TA 4L1KA 4EDHA 4R1NA 2EJTA 2OZKA 4KQJA 1ZW6A 2FPSA 4CQNA 4QN3A 2Y2VA 4HWRA 2HMVA 4JC0A 1M7GA 4L51A 4A73A 4D3SA 5CXQA 2BN4A 1XP8A 4B7NA 2HAEA 3DMTA 4M86A 3RHSA 2EFDB 2QN9A 5F4ZA 2XKKA 2BMFA 4TM8A 2VK1A 3B5JA 3Q40A 3F46A 3ST7A 3CLTD 3MIZA 2OZVA 1LK0A 2RGGA 4HH1A 3ZKAA 3W5SA 4PR3A 4KWCA 4XB1A 1SUSA 3G8YA 3F97A 1Y33E 1P29A 3K6SB 3HVIA 1OT3A 3ZDCA 4GQBA 4BNIA 4WZBA 5F2NA 3PG5A 1N25A 2PAFA 3L1VA 1MWEA 1U28C 2IPOA 3EWIA 4W1RA 3AI2A 5B58C 5GVSA 1NF8A 4Q37A 3HDVA 4BTVA 4MB0A 4MOWA 3D1LA 2GDZA 4R2MA 2FDCA 4JBXA 4I46A 3LBHA 5DRYA 1PR6A 2A9RA 3D8SA 3GP3A 5EXSA 2J5KA 4MB2A 2NU8A 2D5LA 3TJRA 5IT4A 1TLTA 4ZU3A 1W36D 4P0PB 2FHSA 2MMGA 3AGQA 4W9NA 4UVGA 2CVOA 1JQBA 1NJ1A 3EQ2A 3KVNA 3RNOA 1XVAA 5C7LO 1E20A 4IJWA 2H08A 3AJRA 2H0QA 3JQ7A 5LMCA 1Y8RB 2OXEA 3IIIA 2NZYA 1YJQA 2QY6A 4KW7A 1XC7A 2DTDA 1L8LA 2A1IA 2P4SA 3LPDA 3UTDA 3OIWA 2IU6A 1VRVA 2ZSHA 3S6JA 2PUWA 1W2WB 2JH3A 2JRCA 1G9SA 3E3NA 4KU4A 5ECGC 2Q7XA 1KO4A 3OPNA 2DBVO 5KVQA 4XJQA 4KPYA 1YE3A 3IT3A 2A0FA 4H6PA 1SA0A 4DIFA 3AUUA 1VJ5A 1J8FA 4R1PA 1RC1A 4ETMA 4UNSA 4RHUA 4AF8A 2A2ZA 1DXQA 1HDZA 1WIWA 2ZU0C 3AWIA 4RZ3A 2XWBF 1Z7EA 2R4UA 3PDCA 4TPKA 4H7DA 4G1UC 2FOXA 5EJ4A 3C70A 3K20A 4AQDA 5JJ5A 3I5XA 4YI5A 3UK2A 4URUR 4IGIA 1U9CA 3NNDA 4IW3B 4JK3A 1K4MA 3O4FA 1CR4A 5HIKA 1NF3A 1XJCA 4JT9A 4Q1DA 1XB2A 1AKWA 3A1SA 4QFBA 3SY8A 1GO2A 2I66A 2HCFA 2JLRA 1PUXA 4FGLA 3ACBA 1KEEA 4XDHA 1F0NA 1RHJA 4XWYA 4EUHA 3SJAA 1C4KA 1VP9A 5HPYB 1GTMA 2OV8A 2VLBA 5I4BA 2AUMA 2WKSA 1HK7A 1M10A 2HU0A 1CDZA 2FI1A 4G0PA 2VHEA 2I78A 5IXJA 5KJFA 1EE2A 2EFGA 1E0JA 4FR5A 4ZXFA 4A8PA 1E7MA 2G7MC 2A3NA 1RTTA 3AM3A 4C0QC 4C0KA 3TXAA 4PAOA 4YW4A 1UBKS 2FXVA 3W3AH 4B74A 1XTUA 5LQRA 1MOPA 3AM4A 1SK8A 2B21A 3OIUA 4YJFA 1Y7HA 2VSOA 2VSQA 3GWZA 4XVUA 1U0FA 1K8XB 2YYAA 1P1RA 4B7MA 5CLQA 2JFGA 4PX3A 5IAGA 4EL5A 2I7TA 3NASA 4RLSA 1H42A 5JQGB 3P19A 3R4VA 2F6RA 4U9IS 2BLLA 2VEOA 2ZJFA 3E1SA 3THRA 2JIQA 4DN6A 3KHSA 2QL5A 5C1IA 1F0YA 1MAAA 1ECBA 4MV1A 5HIMA 1K5PA 1T3LA 5IK2D 4B76A 3DHYA 2FCRA 4RMGA 5CHYA 3RQSA 2G8NA 3MWGA 3RODA 2IASA 4LPKA 3CUTA 3JVDA 4BRUA 5GVRA 1JJVA 4P35A 3C74A 3AEUA 1EBFA 3N2KB 1Z68A 2NYVA 2O4CA 1G9TA 4LPSA 4OY3A 4P8RA 4RESA 1NZJA 4FFWA 1P0CA 3TD9A 1YKFA 5CDFA 1GPDG 4AS2A 4F3YA 4CLOA 3FY4A 1CUFA 4PTLA 1XPUA 1UWCA 1XBTA 3L0SA 3L1HA 4UD2A 4BWFB 5BR4A 1M5UA 1CUWA 1T2CA 4IQKA 1ZK3A 4EUFA 1KKLA 5I9NA 4YY8A 1N77A 4HQNA 3S8VA 1Y7IA 1NPEA 2I6SA 3FOAA 3LUFA 2O5CA 4C4PA 4Q7JB 1PIWA 2JA2A 2B82A 2P62A 2JFBA 2P7HA 4LNHA 4GBJA 4Z0TA 4K9SA 1CRLA 1QTRA 3IHTA 4Y3UA 1S4QA 3N59A 1D9XA 3NFRA 5JQGF 3DBRB 4UZFA 2HU2A 5J3JA 2G5TA 3P0EA 1KK1A 4XYMA 2IHYA 1YZUA 5FPPA 5BSUA 4CCYA 1I3MA 2QU8A 2GAFA 2XNJA 3MTAA 4MTCA 4Q9NA 5CDHA 4KQ9A 1U80A 4REOA 1YTLA 3GRCA 4ER3A 4JF7A 3PNVA 4DLYA 5ELLA 1F4LA 4ZAVA 4TV8F 1AA9A 4EJ6A 1QHFA 4WLOA 2ODAA 1GNSA 2IZ7A 3D7LA 4S3MA 4TLAA 2ZB6A 4ZKDA 5ALRA 2X14A 3EFOA 4DLPA 1FBNA 2K2QB 4LVOA 5JAIA 3A27A 3D31A 4B6GA 1QZUA 4OJYA 3WGLA 5HXAA 3NHFA 1WKVA 3KSRA 1RI1A 1WXXA 4IXMA 1QAOA 2XRFA 5EZSA 4E3ZA 2CMHA 4EJSC 5K6TA 3I1CA 1S3FA 2P5SA 1NXXA 2J9GA 2ZJ1A 1JAXA 1KO5A 3TCNA 3QKRA 3C5WP 1G4UR 4PLPA 2XQKA 2XOXA 5L3SB 4G0NA 1Q7GA 3ZDEA 1G7CA 1UC9A 4M38A 1T4GA 1FVXA 5E6SB 3CLVA 2WILA 3Q85A 4MGZR 1NM5C 3L2OB 1I0IA 1ZGJA 1V3UA 3UICA 1NVVQ 5K0FA 1IFXA 1EA7A 1L4EA 3FOCA 1Z7WA 1JEOA 3INYA 3MQ4A 3NRBA 3KPVA 3WNBA 1NFFA 3ZGNA 5FL7D 5KAMA 5D85A 4E1AA 4MYDA 3P32A 4MUEA 3M49A 3LGAA 3ZNNA 3DDZX 3PICA 1O3YA 2NTVA 3T1OA 5BSHA 4ZWNA 1JFVA 1LPOA 4FYJA 1DBSA 4KQXA 4EJ2A 3I53A 5IFLA 2WQZA 3PNLA 4WK0B 5FL7A 4HWOA 5BQOA 3RUDA 1TUBB 3CRQA 1EBBA 1K32A 3H13A 3VO2A 2I4IA 5EJ7A 1HYQA 2ZTMA 3OEHD 4HN2A 4MUXA 4D52B 1M8PA 1Z4YA 4LOIA 4D43A 3BE5A 2IIQA 3ND5A 5H1YA 2Z3ZA 3A1EA 1OLUA 4TWJA 3KXLA 4FPGA 4MWWA 1D8AA 1Q92A 3P9CA 5F12A 1QZ3A 1FYFA 3CEAA 3DAPA 3KCNA 3LUGA 4BASA 2B2XA 4ND5A 5IVKA 1ZNYA 1DKUA 2XTZA 3OEHA 5EQJB 3ZS8A 3GZ4A 3O9KA 5B3JA 4BXOA 3HCDA 1JT2A 4OBBA 4RMJA 5FOSA 4LGYA 2R6DA 5JSYA 4UQPA 3AVQA 4QPPA 4XARA 5KOHA 2IS4A 1ZI6A 1CBUA 1T8PA 3H4IA 1CRWG 4MWYA 1SC4A 1UXOA 2CLMB 3GLHA 5TGZA 2NLOA 2FPLA 4JT2A 4RU1A 4MQUA 1RVV1 3A4TA 3WBFA 4IZ6A 4EDFA 4N48A 1RQ2A 2XUGA 1RPNA 1EFCA 1QNFA 3KM0A 3LXXA 4I1VA 1X74A 3JQEA 4FIZA 1FNDA 3OQPA 1MO2A 3H84A 1H6DA 2VPIA 4Y8VA 4PFSA 3ZHQA 2Z2XA 5K3FB 1ZUNA 2DYHA 1H2YA 3GJ4A 4JASB 1U0EA 1SKAA 5FNRA 3V4OA 1E8VA 3CVYA 1F1JA 2N42A 1QFYA 2IBMA 3ESBA 2IT1A 1Z0FA 3J81A 1K92A 2QAGC 2H9YA 3G9XA 3GNSA 2PO5A 3NAQA 1YI8A 1PJ2A 2CC2A 2P2LA 1NR5A 3X1MA 2QE6A 4JB0A 1A4RA 3GOHA 3FI0A 1QAQA 3PC7A 4FT4A 2W6JD 2PZEA 4P4TA 3LYUA 2QSZA 1H8ED 4FP2A 1FDRA 1ZUWA 3GXBA 5JMTA 1BKSB 5A1JA 4WLFA 3BL8A 3TAUA 2CCKA 2JFUA 3U4DA 3PL1A 1JSCA 1K97A 2UYYA 3IEIA 3OLCX 2W6JA 1DCKA 1JSXA 2EL7A 3C4VA 1NI5A 2ZUDA 2BBTA 4LSWA 4UDOA 1HNWB 3NV9A 4YLYA 4FOVA 1PI3A 5ARDA 3RTGA 3HFSA 3L1JA 3EXHA 1S2LA 3IXQA 1DQNA 4XAQA 3U1VA 1PVDA 2FEPA 3IERA 4UJ3A 4YAFA 3SSAA 1NV9A 2K7FA 3SYNA 5IUJC 3ETCA 2QWFA 4MP3A 1WP5A 1EZ4A 1JRLA 4HBGA 5TJ9A 1PGQA 4BKMA 1ZW1A 3PC8A 4PGAA 5FNZA 4FFMA 4K40A 4GVLA 4HPXB 3L84A 4QXOA 1UWKA 4C3ZA 1CUBA 3SIXA 4ZT7A 4K1HA 1R0YA 1R6AA 3TTSA 4U1RA 3CH5A 3DEKA 1ILEA 1FL9A 2I6FA 1FTWA 1VG9B 3KKOA 1Z4OA 2HIMA 1Z34A 2QTTA 3LXRA 4UVDA 4AVYA 1FFCA 3A6GA 3TM5A 3U7IA 1HG0A 1N6LA 2JI6A 2XT0A 2GTIA 3E3OA 3TFOA 2H5IA 3JQAD 1GPYA 2Y1DA 4PEVA 2YWXA 1VI5A 4OB6A 3LX5A 3A9VA 1ND6A 2AV6A 3RLIA 4HVTA 1E7YA 2AVNA 4E0BA 1SZJG 3C7DB 2DUNA 1E8NA 4WERA 1GU7A 1JDJA 3ENNA 2O3TA 1XZKA 1XL1A 2Y71A 3JQAA 2CXTA 3OMWA 3K9HA 3MINA 3CZAA 2HIHA 1H6BA 1TYCA 3OMLA 4XSGA 3Q3GE 3VZBA 4QNMA 3DZFA 1JG4A 2VUIB 1LU9A 3L0PA 3P4UA 1P9RA 4RPCA 2OOSA 1N2CA 1E1LA 1XQ1A 3PT5A 4CFZA 3RT1A 1UPTA 4J43A 2P7IA 3ZIAD 2Q4TA 4XJ9A 1DADA 1MPTA 3IVAA 4JUIA 5JYCA 2Q3LA 4Z7NB 1BGXT 1IZ8A 1GA6A 1IC6A 1YR9A 2JL1A 3H04A 1CVMA 3ZTWA 2J0UA 3TB6A 3MGCA 1L5ZA 1Q0UA 3CV3A 1XROA 3IQXA 4O59O 4XJTA 2QPTA 4DR7B 3EIFA 4O4JA 1KI2A 4W1PA 3H1AA 1ZVMA 3ZIAA 3AR3A 1DAFA 2H2NA 1IB0A 1UDWA 2HUNA 1BWSA 4XVQA 4L8GA 1YQWA 1X7YB 1ZKMA 3BH6A 3SVZA 2H1CA 3N8GA 3SMQA 2OECA 4B6JA 5LFAA 2VTBB 3FNFA 3BL5A 2C97A 3BKXA 1U8CB 2B37A 3GXOA 4G41A 3P45A 2B3DA 4BL5A 2XVMA 3RFCA 4HDOB 4YPVA 3W05A 3FZYA 5FXMA 4UAUA 1ESDA 5DW0A 4AN0A 4QN7A 3ZWNA 3OM0A 1BMFD 1J07A 3N0XA 1I14A 4RSRA 5SZHB 5FX2A 1TADA 5FKJA 2ZKLA 3T7RA 3A4LA 4RIGA 2E7ZA 1EM8A 1NMAN 1PTJA 1J1IA 1TIBA 2VBFA 2ZUCA 1XMPA 1JDVA 3DL7A 3K2EA 4ML3A 4PZDA 4V2IA 1GKYA 2XX3A 3SXUA 5KVCA 3TQFA 1O6FA 3JARA 4QDKA 1ZMBA 3WA6A 1P2GA 1BMFA 1PD0A 2NTEA 1NMQA 2VWHA 2D3WA 3MLAA 4KEAA 4TKVB 5CHEA 3IUPA 5EHIA 2IDMA 3AF0A 4X3OA 1ADBA 4LE2A 4CN9A 1SU7A 1PJBA 1JAZA 1NA5A 4U2EA 4KAJA 2Q0SA 4OAQA 2PGIA 4I1PA 3AESA 1L5GB 1W21A 1TKCA 1R64A 3MRXA 5IXSA 3CLUC 4FD3A 4QEDA 4RZUA 1BCRA 2X22A 2DF8A 4OMDA 3LVQE 3F7NA 1AV7A 2FA9A 4MWSA 2YHIA 2DUMA 1UJ5A 1TYBE 3F47A 5TPZD 4XYGA 4ACBA 1EG2A 2W22A 4M36A 3B1XA 4OJKA 2WUWE 5J4KA 1QIDA 1AF7A 6Q21A 2QN7A 2WFMA 1VI6A 5GONF 1SUDA 2JLAA 2XY4A 2ZS8A 3KJXA 4D5EA 4C2TA 2XTNA 1KK0A 4OHWA 3PQCA 2F29A 2QWKA 3PRYA 4KYUA 4EG8A 5K3DA 5IJAA 2B99A 4ZYYA 5JPCA 2X1MA 3GYBA 3N3BC 5A6SB 3WXBA 2YKGA 4BQFA 1QUFA 3SEFA 4BMOB 1Z08A 2QM8A 2AG5A 2GBGA 3U3JA 3VOSA 3U1BA 1IK4A 1JAYA 4KS1A 1GGVA 1Y8QB 2WE8A 3D6JA 3S2UA 2IUTA 1C41A 2V98A 2C95A 1LBSA 3CN7A 2GVZC 1I9GA 3GLGB 1CQIB 3H2YA 3ZLBA 3FYCA 3GP8A 4MRPA 5CUQA 3Q87B 5ADUS 1EWKA 2NOAA 4YONB 3AIOA 3OJWA 3S27A 4PCUA 2WAYA 1HNZB 4MRNA 3UGJA 1F7UA 3NM5A 1T43A 1A9PA 4KLCA 3TNFA 2AT1A 1TK2A 1KYTA 3O5AA 5A5VA 2WMYA 4G5XA 4YBRA 1P4GA 4JVOA 4QUIA 2JD0A 1RQRA 1F38A 2H3HA 4YUVA 1KE1A 2AOUB 1QQ6A 2JCBA 3ZGCA 2EARA 3KR1A 4ZOLB 2BGUA 4K2HA 4BLVA 5LB2A 3BCUA 4UNNA 4B6QA 4MCIA 1D2AA 1FP6A 3DD5A 1YFZA 1OPRA 221PA 3C7KA 1JEQB 1YDHA 2W2LD 1UBSB 1A2KC 2BKAA 2OFXA 5FT9A 4ZVNA 4ZZ2A 3ZY5A 4DA9A 1C50A 3VUFA 2JD2A 3B3GA 4FSDA 2J8ZA 1G98A 1T5DX 2VTEA 1FE8A 2ZTLA 3AJDA 2GPBA 2VFAA 3ANNA 3KOYA 3DBLB 2AL7A 4LI3X 2XT9A 3V2GA 1JHRA 2D4HA 2D62A 2W2LA 3KQNA 2R87A 4TT8A 3ZWXA 1YDWA 2XZIA 3QLUC 2PMEA 4Q3BA 1P81A 5HTKA 3BD8A 2XUQA 3OAAD 3PPYA 3HG7A 4G4GA 3NYIA 4GS5A 4U0JA 3C8HA 1ZK1A 4KR6A 4HWTA 1HFJA 2JNWA 2YRWA 3AL2A 2VCHA 3H3XA 3QYFA 3VR1A 2WVGA 1C1XB 3HB5X 2NXNA 3PNMA 2NV6A 3VTFA 1P5ZB 4L2IB 4P7GA 4PQFA 4QECA 3IEPA 3OAAA 5GAJA 2IAVA 1AKYA 3OD1A 4QYMA 4ZOLF 3P2EA 3ZXIA 4PYJA 2GUGA 5DOVA 3VHRA 3OOEA 4LBYA 2F1KA 3U2QA 1GDDA 5HRUA 4HEHA 2NU7A 2ZIUB 3C45A 1R9MA 2VG8A 3IE0A 3VJLA 4RE5A 2XRMA 4OI2A 2VBGA 4X92A 3BYCA 4MPRA 3WRYC 5BQFA 4NCAA 1U2PA 1VCJA 4J7UA 3ZY3A 3GA5A 4LQCA 1FVFA 3CURA 3B8EA 3DOOA 2WYUA 2XHEA 4A10A 3VU9B 1BX3A 2GD0A 1AT1A 1M2VA 1GNQA 3RS4A 5CEJA 3C97A 1BDIA 5EHXA 2AJ8A 3EFEA 3E5MA 4FKZA 3WIDA 4JI4B 1G5PA 3VR5H 3QTTA 4CUJA 4P9NA 4MA5A 4IO0A 1BAPA 1TVKB 3UK6A 1PDOA 4CV2A 2NUBA 3EC1A 4GD3Q 3WLOA 2HA6A 4H16A 4CYMA 1GCUA 4O4LA 3ANMA 2G3YA 3RS0A 2Q62A 1QLWA 3VSCA 4IUCS 1M6YA 2QTFA 1PJLA 1AF4A 1WE2A 1QCDA 2AE1A 2X4LA 5FLEX 4QG3A 3CN9A 3ACCA 1VCOA 2O07A 1KP2A 2JAQA 2YH2A 3IDQA 3LUBA 5FBVB 4BC1A 4LF4B 1ZWLA 4J0HA 2CWWA 4J4HA 1CR0A 2BMDA 4UF7A 3ZZ1A 3P9ZA 2H1WA 4LCEA 1AHIA 1W4AA 2BFMA 5BW4A 2PBLA 3IP1A 1EINA 1G3IA 3OE7D 1M9NA 2XNSA 3F74A 1WUHS 4QOIA 4Z2YA 3RJ9A 1QONA 1TX4B 1RJWA 9LDTA 1N3BA 5AKLA 1K68A 1GOTA 5ALLA 4AWAA 4E6PA 3ICEA 3DWEX 3P8ZA 4GM0A 4C4ZA 4F1KA 3I04A 3JALB 4C4RA 3AVUA 4IXTA 4XQGA 5M1ZA 3L4BC 4HDNA 3OE7A 3WLMA 4FS8A 1ST3A 1WHSA 2R5FA 3BD9A 5ER9A 2WY2D 4ZVMA 2C92A 3H7AA 1IZ7A 4AJNA 1WU8A 4KNWA 4JN6B 4M8NE 4EFLA 3THWA 3THXA 2WIBA 2NUAB 2VL7A 1DIHA 1YQQA 1HV8A 4RFSB 4JWTA 4O25A 1PWXA 3BCHA 2WWWA 3QM1A 5DTQA 2G9RA 1P1BA 3D7KA 1GT6A 5TF4A 3SM3A 1NW5A 1WXHA 2RBEA 3F0TA 1EFPB 1ZK2A 2OZLB 4X4AA 4Q4CA 1VGRA 5AUPB 1SJ9A 2E4AA 1ECLA 1NHGA 1CE8A 1GZHB 1XDGA 3O8BA 4PYLA 3VU3A 1FFEA 4HGZA 2OZPA 2DJ5A 3EGIA 1E3WB 1XO1A 1LVUA 3TXXA 4B71A 2VS1A 3HXQA 3HDJA 4PN7A 1RI3A 2BCEA 1WXWA 4CF3A 1H2ZA 1DJLA 3L7IA 1J39A 1W5AA 3UHPA 2XMSA 4JEIA 4CQLB 2MJLA 1DINA 4F9FA 2N75A 2BSAA 3LWZA 4L9AA 4RK4A 2YY5A 5EXXA 5AW6A 1DTSA 4FZHA 4X00A 1QH0A 2BZ0A 2A35A 1Q7FA 4YMIA 1PZFA 1XT6A 2E48A 2Z57A 5EMKA 6NULA 4R05A 3RB8A 1IBMB 3DLPX 5TQ2B 3WHIA 1FYXA 3PX7A 2JVIA 2ZR8A 3Q0TA 2HO5A 3WGTA 2WA1A 3IAUA 3S8MA 4X9XA 3QA3E 1ZYUA 3O1HB 4HAVA 1CK4A 3SJ7A 2XCTB 2VPXA 1ZFNA 2CZGA 3TFWA 3TZHA 4QHSA 2WWVD 3TI4A 3F3SA 2IU3A 3T35A 2O0MA 1DEKA 1BVRA 3B69A 1JUDA 3OVMA 2DQSA 1ZMOA 5LSAA 4GFDA 1P8JA 3DW1X 3KWJA 4QGBA 5GZ1A 4OB8A 1CZRA 4LY6A 4ISBA 4RO0A 1EUUA 3H8VA 5L4LA 4EB0A 3AF6A 4FHCA 5HR5A 2TYSB 2XMDA 1FUIA 4JUCA 2ZRGA 4Q3CA 1L1RA 1Y9ZA 3KR9A 3L6OO 4JKIA 4WT7A 5EQFA 5TMBA 3RG2A 3ZHRA 4WZAB 4WZZA 1SVMA 1C8VB 1WS6A 1SR8A 3ZH9B 1KI3A 3H4VA 3KT6A 1HO3A 4I9HA 5EP4A 3OJLA 2RGNA 4F4HA 1RAAA 4DBLC 3C14C 5BNTA 2WM9B 1UFOA 2RGCA 2AYZA 1II8A 2M6RA 1JDNA 3FYTA 5AVUA 3OC0A 4E2ZA 1NW8A 2CJFA 1CQWA 4KR7A 4CKBA 3H99A 1SQSA 1V16B 4PRLA 1MS4A 4YZ1A 3UPDA 2P2GA 1THTA 4L5BA 2X9VA 2ZRLA 3Q10A 4PRZA 1Q91A 1WCWA 4DNFA 4DLKA 1XVLA 5BVGB 3H5RA 4KRFA 2OBMA 4OYHA 2AZXA 3URMA 2JIBA 4LXGA 2Y3IA 3WMGA 1WX1A 3QOXA 1W4ZA 2GZ2A 2PDAA 1W52X 4LOKA 2X4GA 4R71A 2P2CA 1GIAA 2R1TA 3F2VA 4PBTA 4GI7A 4BE7B 3UY4A 3S1AB 1ZY2A 2I7VA 3SLKA 4ZEVA 3M3PA 1ADJA 3EQ7A 4ZGWA 4ZCPA 3CUWA 1VPTA 3KJIA 2GK6A 1E3MA 3WGGA 1J22A 4QDXA 4EK9A 3QVGA 4DCGA 3UJNA 3H19A 2INGX 4XE5A 1B3BA 1D04A 1H9AA 5LUAA 1TKAA 1NBME 3CCFA 4OA8A 2FWMX 5F9TA 4U7FA 3GJTA 3QUBA 2WHPB 4REQB 2PQ6A 3K3AA 1ESEA 3IAS1 5D1HA 3SSMA 3CRVA 3UA4A 3VR6A 4BFWA 4ZYTA 1USVA 5KSWB 3G2OA 3UBMA 2J0SA 4EITA 4YCMA 1VLLA 1R8QA 1VXRA 1X70A 1XMJA 2B34A 5DXAA 1TM2A 1W47A 4BNUA 1LWOA 4UBKA 1QIFA 4I4LA 5A06A 5DN6D 2H7YA 2HDWA 3EF1A 3EXEB 1G3MA 3CUYA 3QVXA 5JLJA 5F21A 2H2UA 1MNQA 2R47A 2W2KA 1L3IA 1WY5A 2BD0A 3P2YA 4KQGA 3R6TA 4DGRA 3CKLA 4GR5A 5DN6A 5LC1A 5EIOA 3WNCA 3BE8A 3NH6A 1IOWA 2H1VA 3D8TA 3MWFA 1IHPA 3CLSD 2XDYA 4TSKA 1UKEA 1CUCA 5ADHA 1HI9A 5K8VA 1WDLA 1DWUA 1ORDA 4U6NA 5CNKA 4B6SA 5FH9A 2DETA 4A36A 3VNVA 3C5VA 3DMHA 3UMBA 3G9QA 2SILA 1EVQA 4V0RA 4JI2B 2PZGA 1W25A 3P9KA 4C0WA 3C8DA 4BQNA 1YOVB 1QG4A 5FOXA 4CETA 1RJDA 3L02A 3RVJA 3M6IA 5CLIA 4EY8A 1JDSA 2R7LA 4GECA 5BVHB 4L0DA 3ZCUA 4XRGA 1NR7A 2GCNA 1EWYA 4BWGA 4I6EA 2HOQA 2JAPA 2QD1A 4KXUA 3UGKA 1NONA 1TB4A 1BCSA 3MWEA 4V0LA 3RWMB 4AGIA 4QJ5A 2LDXA 1NMEA 2V9PA 3IVXA 1JYFA 1CDOA 1UDXA 2GJSA 2VUUA 3DWGA 4K9LA 5FBQB 4PVCA 4PSAA 1T34A 4F3TA 3P0JA 3BB1A 1Q3KA 1UC5B 1Y8RA 3PDJA 2YHUA 5FPKA 4FHGA 2YVUA 1R6XA 3U09A 4WN3A 4I3HA 2P9EA 1V2GA 3CRW1 2QN2A 4Z4HA 1U5CA 1YBFA 3O9MA 3PD7A 3HDYA 1T35A 3O9VA 3WYFA 4BNZA 1FP4B 4YUZA 5HDQA 1AN9A 2N9UA 2I91A 2UZ0A 4XM2A 2IXEA 3QI2A 4EKYA 3U80A 5KC9A 3BXHA 1L1QA 1TYEB 1QJ4A 3WK6A 2Z4SA 5JS6A 3TRJA 4V39A 1E2MA 4XB2A 1ZICA 3VOTA 5EC8A 8GPBA 1UJ4A 5FWXB 2FVYA 4GZPA 2WU0A 3OX1A 2G5CA 1PFUA 3IULA 4NU6A 3QP9A 4MIKA 4XILA 4MKFA 3TTWA 3ZS9A 4BAGA 5A71A 3T3EA 4WEFA 3IUNA 4JLUA 3KSAC 1U2DA 5H7XA 2JHAA 4QNNA 2E9SA 2WDZA 1CZKA 1XDDA 3BGOS 3RKSA 1NX6A 5FYQA 3PEWA 3LAWA 3F73A 2QWAA 4E94A 5F3WB 2WUVA 3RK0A 2IQIA 4A0HA 3HCPA 1RKQA 2GD2A 4PC2A 2CLDX 3BK1A 3AWDA 1IMJA 2BZ1A 4Z9XA 3UOAB 4DR2B 2HWUA 3ZX5A 1JLLA 4FMDF 8OHMA 1QVRA 1N3IA 4H7HA 4XPIB 4TXHA 5M5BA 3RAJA 3EEOA 1N1GA 1YZLA 3H72A 2AA3A 3SJCA 4LVNA 2CN1A 4KK4A 5K2MA 1UWLA 3D3JA 2HPHA 1USWA 2IC5A 1G0NA 3LH5A 3LCVB 1D7OA 5FBZA 2D8AA 3P9IA 2PY6A 1LSSA 2DVMA 1UFVA 3R77A 3UXEA 3VO8A 1A8HA 4AROA 3CNOA 4YDRA 4IDEA 5H59A 3T41A 5TLSA 3PIIA 1ISJA 4QGHA 2B6HA 3QU2A 1ESCA 2ONZA 2VK8A 4EFDA 3IEMA 3AV3A 4RPGA 4Y67A 1AQUA 3ZV5A 4D8WA 2Z5FA 2GERA 4AO8A 2WU4A 1ZUIA 4OMUA 1ZJ5A 5C8YA 5KCZA 1W8NA 1P3DA 3R7LA 5JFGA 4IKOA 1L4BA 1U0SY 2CYBA 2W8ZA 3LI2A 4QBIA 2B9VA 2E21A 1VPLA 1JNXX 4UUAA 1OI2A 4Y9RA 1F0PA 4FC7A 4NAHA 4JR0A 3RYIA 4AJIA 4QOEA 3D5EA 4OJQA 4NONA 3TE6A 3TICA 1SHLA 4JP2A 4QTYA 2HYIC 1Z4WA 4AJJA 1SUWA 2EHDA 4CPYA 4TLMB 1KNQA 1T4DA 2Z30A 3L18A 3A2NA 3RW9A 5C4IA 1K5GA 4F72A 1EUYA 1Z35A 3HWWA 1ZS9A 3Q2IA 2HH9A 3MJFA 1SKQA 2JZCA 1LDYA 2IZ5A 5DNCA 1F12A 1KSHA 4LY9A 1DJQA 1M3SA 4F45A 4P0QB 3LD9A 1EQAA 1O9GA 2O6LA 4M7RA 5B64A 1LTKA 1GL6A 1YZNA 2PH7A 1N8KA 3ABQB 1A9XB 3P96A 1LUAA 3B1WA 4XRRA 2I34A 1JA0A 1CUJA 1L5LA 2VDLB 3S2IA 2P9YA 3WTCA 1L8AA 5KDOA 2FRVA 4DDHA 1Z4LA 1NKSA 2I65A 1CUXA 2RHGB 4G5GA 4Q0MA 2R66A 2YHSA 1M34B 4P3PA 1TD9A 1QHHB 2IGBA 2Q2QA 2HCBA 1U3TA 2XVYA 4DLTA 5B36A 1CULC 1L8OA 5L40A 4PBSA 3T7DA 5D3MB 2DMRA 4EEXA 1SRQA 1KWGA 1X9HA 1KJ9A 2O5RA 2WAMA 1FPMA 1ZXXA 3ODGA 2DG2A 3RU3A 1YK1A 3TD6A 4HOYA 4FGUA 2JA1A 1RJFA 4ADSG 3CB4A 3Q72A 2ZXEA 4BPBA 3TVTA 5IF9A 1TZMA 1G8GA 1P3Y1 1CYEA 1NCDN 1E60A 2H4HA 3ADEA 3UIEA 4NXNB 5C80A 1ZGAA 3E3LA 3I9LA 4Q4JB 1KQPA 2I76A 3HY4A 4KQCA 2YJ6A 2HBZA 4XWKA 5I01A 5CM8B 3M4ZA 4U5QA 5C1BA 1QO0A 4FM9A 1PFWA 4B3BA 5DLQC 1OYYA 4J9VA 3JAMA 2SKCA 3GUHA 3GELA 3H1PA 1AS3A 2FPKA 4BQOA 2A7XA 1PT6A 5L3SA 2J0EA 3D02A 1G7RA 4TYYA 3I2KA 4FFVA 1EM6A 1KAOA 1BMQA 4KACA 4W9RA 1F2UB 3CVJA 4Y9SA 3CX4A 1I2CA 1OX4B 4IDAA 2FNAA 5E6SA 1NVEA 3OA0A 4AJ2A 1OX5A 3BJIC 3OUZA 4IBOA 4DA6A 3MBKA 2HQRA 4JDUA 1JR2A 1M6WA 2ACVA 3DVAB 2G63A 4FPOB 4NU0A 3NM4A 1XZNA 2RC6A 4NV3A 5NLLA 3ZHCA 1WETA 4BZZA 3KQMA 1IOZA 2O8FB 1C3JA 1L4GA 1O77A 2ADOA 1ZNZA 4OO3A 2NAPA 3P2JA 5LP6A 4S1TA 1Q19A 4XR9A 1BHJA 4DDTA 3SHQA 1YV9A 4MI1A 3M6AA 2WOJA 3HNPA 1WVMA 4R2XA 3WHPA 2IEYA 1NQAO 4UM8B 3RSGA 3W5VA 2OLJA 1RWOA 3RK1A 2H06A 1GA4A 1P1FA 1JKIA 4CGYA 5CLGA 1NCBN 2FLKA 1O4WA 3UHJA 1H2XA 3F3YA 3M9XA 1HWYA 4O8ZA 4PYOA 1UC8A 1KVRA 5BN5B 2F13A 2W93A 3KJFA 3U49A 5FQNA 1X3SA 4P5EA 2ZDGA 2JZNA 3I8SA 2DSOA 1YCGA 4G26A 4PZLA 3REQA 2H5EA 2PQ0A 4UHDA 4D81A 2DBZA 1YVEI 2NMVA 1GEGA 2YWHA 1AKVA 4XCXA 3H5LA 1YRAA 2WUGA 3G0IA 4OHCA 4CPLA 3TS1A 4N0EA 4BMNA 1AG9A 3CX3A 4M2LA 3T7TA 3ABRB 1TW2A 3PQ4A 2CXXA 1K8ZB 2OP1A 4LOAA 5CBPA 1MAHA 1MVNA 4F93B 3TSCA 5G3ZA 1LY1A 2C2KA 2VP5A 1V8PA 2VNHA 3TW8A 1OYVA 1M1YB 4UCWA 2VPTA 1T26A 3DEAA 2M2IA 1HORA 2PWYA 3GJZA 3TB4A 3HPRA 3LGSA 2ABWA 1YFLA 1MW8X 3DOIA 3DE2X 1YULA 4LBZA 4XTCS 5K3FA 4DJ5X 1PE0A 3PTLA 4XYBA 4EFKA 1RWBA 5BQ5A 5AQ1A 4X20B 2X0FA 2PSDA 4HDRB 4RK0A 3U56A 3JQBC 1PNOA 2P6UA 1QLGA 3PQ6A 4WECA 4KN8A 5EMHA 3X1JA 2CE2X 4X1YB 5REQA 1K6EA 4AZWA 1TJPB 1QHNA 1Z39A 3PDIA 3D54D 3W5IA 2NQTA 3LZCA 4ENQA 2L19A 1KQFA 4GG1A 1E1DA 1P31A 5GX5A 4J0CA 2O4UX 3OPMA 4B7UA 1IVDA 5ALOA 3DMDA 1AGRA 3D6UA 4GDFA 3O1IC 4L74A 4WGFA 4YIKA 3MAGA 2NZUG 1TZ2A 1VE7A 2QV0A 2E1RA 5KKNB 3ADBA 4YQFA 3LDAA 4D4LA 4MDHA 2XSZA 4WEGA 2FPGB 1KH3A 3NBAA 2XF8A 2P6OA 3MVEA 4S0ZA 1O0SA 1P0MA 1QP8A 4ND7A 1OIXA 1U8ZA 5HOQA 4FNOA 4KR2A 3R0XA 1DGQA 2F3PA 3WZMA 2W2PA 4ZZ0A 1CZUA 2A5YB 1XTJA 3DL0A 3WLFA 1HM5A 1E3LA 1QORA 1K7YA 2PRJA 4CKWB 1NLFA 2G04A 2VT7A 4ALJA 3T3DA 2GSWA 5HK9A 1IUCA 4B82A 1G8MA 2CLLB 2A0XA 2CXQA 4BNNA 1NN3A 1KI9A 2GF2A 1ZLYA 3A1FA 1A97A 1YRYE 1T9ZA 3SS9X 3GUYA 1KR2A 2DUJA 1AC5A 1XLTA 3ECSA 3GCDA 1Z4ZA 2BDTA 2ZYVX 2QI9F 5SV2A 2QX4A 5THQA 4D4IA 1G42A 1PEDA 4AQYB 3C87A 3IAS6 2FW0A 2C96A 1K7SN 3KD2A 3IEUA 4GLLA 5CVTA 4X64B 2FMUA 4E4RA 3IOCA 1QGYA 3DZDA 3EXG1 2ZP1A 2OFFA 5LDHA 4RORA 1H0SA 1ZGBA 1N4AA 4KO2S 1YHZA 4IFLX 1T2NA 2BDEA 1YJAA 1Z28A 5KQPA 1Y1QA 1C9KA 1ZVVA 2EJWA 5J47A 3U40A 2A1UB 1N7IA 4US0R 2QTWB 2CMKA 1PR4A 1Z82A 3ZJTA 3ENZA 1EFUA 5CG2A 1IG0A 1ELOA 3GG9A 3HKCB 3M6VA 3HA7A 5F1OA 4CWAA 4CBVA 2AN3A 2NO9A 3GRFA 4RY8A 4DZZA 1IHXA 2XKJE 1WMFA 2IYAA 2XYQA 2VJNA 3F7TA 4FYKA 4IUYA 3GMTA 4B3RB 2VW2A 1XZAA 4I5IA 5G4LA 2A0WA 1AB6A 4FFNA 1JIVA 4LHWA 1SVWA 1TAHA 2EYUA 2NTNA 3G5MA 1L5SA 2RDMA 2QBYB 5A03A 3UEOA 2LE0A 4LX0A 3AH8A 3EYWA 1NL3A 1X7YA 4RHYA 5JXJA 1KITA 3W09A 1NUUA 1T36B 4RIFA 3SWWA 3RF7A 2LR0A 2VTBA 3B3JA 3NP9A 5I9BA 4NE2A 4OQZA 3MW8A 5JAUA 1HE1C 1ZNXA 3EVZA 1EFRD 4MUHA 2CBXA 5CB4A 3F6SA 3PNYA 3HRIA 3F6EX 3DOJA 4ZCRA 1T5BA 1L5VA 3C5HA 4OH7A 1B0ZA 1MENA 2AS0A 1L9KA 2JVJA 4O2AB 3D6VA 3BULA 1SXJE 2P5TB 2JBAB 4OXIA 1I0ZA 3LF1A 1EFRA 3IKJA 4BJHB 2PS0A 3BSFA 4BU0A 4DM4A 1P77A 4MP8A 4IAOA 4KS5A 5JD3A 4ZKEA 2R4TA 3MEQA 2Y1CA 1JKJB 1M0SA 3NG1A 1JHDA 4MIYA 3UUGA 2A9OA 3AF5A 3HUEA 3O3MB 2YHAA 4WCVA 2HU4A 1RLTA 1JLMA 2X2OA 1SG0A 2WIAA 3HWSA 4P0TA 3S55A 3TRIA 1IJEA 2GBCA 2O2IA 5LXTA 3GPLA 3ENKA 1ZJJA 1JFFA 3GZNB 5JY6A 4PFJA 2Z8XA 3U4CA 2PT9A 4UEQA 2W0MA 2DEUA 1N5IA 1GPUA 1JZSA 4OX9B 2XUZA 3HJNA 4ARAA 3FCOA 4FXOA 4KJZA 3OZBA 4NC5A 1WM1A 4CV3A 1MQ8B 4N12A 4R1LA 4HX5A 5E7JA 4DLAA 5G0SA 2HCTA 4KO8A 4A6DA 4BKPA 4DZTA 2HGZA 3I4FA 4L4XA 3GFTA 1DDIA 3A10A 4HVLA 5T64A 2PMBA 2A5DA 4X6UA 3LLVA 5IJZA 1OTHA 3Q7IA 5GINE 3DFKA 1XEAA 2Y67A 4O5TA 2WD8A 3HV0A 5J4VA 1KETA 1USKA 2K2WA 3GLFA 4FQ8A 4LQLA 2QQ5A 4H4DA 3QRWA 4KE8A 4D9GA 3PR3A 5A6SA 3UT6A 4X66B 3HBLA 2X4DA 3SD7A 1GG8A 3BA6A 2AMVA 3LLMA 1Y3HA 3P94A 4F4DA 1VJ1A 2QVCA 1Y8QA 1K27A 3G2LA 1CJSA 1YBVA 4IP0A 5MFZA 3LCUA 6AT1A 1E2HA 1Q2UA 1QLHA 1CQIA 3H7IA 3TI5A 3HCEA 3L0BA 3QEMA 3R0ZA 2WM3A 4G0MA 5EYPA 2XGSA 4W5OA 3KAPA 2IHUA 2PFKA 1Z17A 3P20A 1D6SA 4R6WA 4JVLA 3ICVA 5B3KA 2YDPA 3D6NB 2X23A 1T3SA 3BIWA 1T9AA 4KDEA 2MCFA 4J16A 3RBVA 3R9XB 1P7YA 1Q17A 4I08A 2D3TA 1Q7EA 1GGKA 4MGYR 2X6RA 1ZOSA 1JWBB 2J3LA 2AOUA 3U4QA 3GV0A 2WUDA 3KLOA 1P18A 1ZD4A 2HSGA 1VZ2A 2OAQ1 2OL4A 2WYOA 3GYGA 4UM7A 4UTXA 4WVLA 1QZTA 1I10A 2WAXA 3JQPA 4Q05A 1WOMA 3GCGA 2UDPA 4XEHA 4DJTA 2ZI6A 4EW6A 2ETVA 1XTVA 4YRDA 1XRLA 2BF7A 1MG5A 2WWFA 5HUHA 2F59A 4MK4A 1YH3A 4LZLA 4UBNA 3A70A 2CUZA 2GBIA 4C87A 1O97D 3DBLA 3I6ZA 3I4LA 5A0VA 1E6WA 3KV3O 1QFSA 1XLUA 1YKSA 1JR3E 4QFDA 4CR7A 3CR8A 3RCBA 1FXSA 2FPRA 3NHWA 1ZIXA 4QUDA 3NATA 3GUZA 3IVRA 1ZGCA 2N0SA 3NOQA 3C48A 4MMYB 5KDDA 2JGMA 4OBEA 4UEOA 4DIKA 4NECA 4RTMA 3W4IA 1C1XA 3PD0A 5CB8A 4Z49A 3LSYA 3NYWA 3TWOA 4H6VA 3IQDB 1NPTO 4F2HA 4RD4A 2XZPA 3R7FA 4X1KA 3TMKA 2YUTA 2HZBA 4DMKA 1WXDA 4KDCA 2GRJA 2AH2A 3OZDA 1N1TA 4GKBA 5SYAA 4NOKA 1NMYA 4E08A 1O97C 4CT0A 4EYEA 2J7PD 1BEEA 1KPIA 4Q82A 1ADCA 4XGKA 4MTLA 5CX1A 3KELA 2VSXA 4GI5A 4NZMA 4RSMA 2E4UA 3I34X 5E6UA 1AGXA 5KNCA 4TTJA 4O33A 3SC3A 2J7PA 1H2HA 1L7XA 4JGGA 4QFMA 4XDZA 1A5AB 3O8QB 4WRRA 8ADHA 1TVKA 5KYXA 4B7QA 4RJ2A 1V4BA 2OE2A 3LNTA 4ESOA 4EHAA 1FMTA 1FP7A 3D43A 2FFQA 1FYEA 3K16A 3JZMA 1FMFA 4KXLA 5HUNA 4D8VA 2HTRA 1XEWX 1G5FA 3T3GA 1V6SA 1FLAA 5A9RA 1KEWA 3QYPA 4IQ4A 2Q49A 2QDXA 4RC9A 5JBNA 4DNQA 3ZV6A 4Z54A 5JRJA 1IM8A 2BFNA 4RKRA 1DAKA 1VPVA 2HQ1A 1JPVA 3VYTB 1T0UA 1T2AA 2GNOA 3CUEF 3DS8A 3WP0A 5L6MB 4L5CA 3JQ8B 4QN5A 1Z74A 3V80A 1MXFA 1QHSA 2QLLA 1H66A 2Q8PA 2W83A 4MA4A 3BJRA 2ZXUA 1FX0B 4ETNA 4DY4A 3S40A 4DWOA 5J2UB 1IZ0A 1RHUA 3TBKA 4F85A 4FK8A 4F60A 4C6RA 1C1DA 1EDZA 2YV3A 5IM5A 1R66A 2YWBA 3ASYA 3EPLA 2ZIWB 1JVNA 3GDOA 3AK4A 1ZA2A 3DBOB 3JALA 3JQ9C 3ME5A 3NGLA 4HGRA 4RW0A 3CO0S 1SEPA 3M0EA 1LBIA 2P30A 2I3GA 3L43A 3NKVA 1X8KA 1XKXA 4JSRA 1PL8A 5CVUA 5EE1A 3SIPA 3HR8A 1ODTC 3LY5A 4DLSA 4BVFA 2FZKA 4RNDB 3NRCA 1FFXA 1OXTA 1GN8A 3ITEA 4Y2QA 1ULSA 1GR1A 3T4PA 1ZJWA 4MIEA 4WDRA 4TTAA 3R3JA 5TV2A 1ZGZA 1QPGA 4UUOA 2NUAA 1DKMA 1OXMA 1Z7BA 2HY7A 1WKCA 3NBFA 3CIFA 3K1AB 5K8IA 5TNXA 4OD0A 5BN3B 4FEAA 5IBQA 1CIJA 3DOHA 3JRXA 1J21A 2RG7A 2QN3A 3DDHA 3NNNA 4Z4GA 4DV3B 3DMTC 2R8RA 3KYBA 3AONB 3SHWA 2OZLA 3IURA 4MWBA 3P5BL 3D81A 1VOTA 1XCMA 3SBDA 4BP1A 1OJ7A 4HD8A 3TLAA 2OSVA 1D4FA 4C76A 2UVPA 3KPYA 2X86A 4NVRA 4NBVA 4S12A 2BC9A 4KXQA 4LJ5A 4OYRA 3IVCA 3JWJA 5LN1A 3R3ZA 1N6NA 2VSMA 2EG9A 5DTMA 1JI3A 4U7WA 4CQLA 1E6KA 3U4HA 1RQNA 3PZBA 4Q6WA 2VQDA 5I5GA 5EJ5A 1SKUA 1NZDA 1HFEL 1KSFX 1VHDA 5ERYA 3BIXA 3FUTA 3KEOA 4M8KA 2R62A 3TDNA 1ZU5A 4J91A 1Z0DA 5TQ2A 4J9TA 2EX4A 4AKGA 1XU7A 2P75A 3K9WA 1EUDB 3UMSA 3HJRA 2QMUA 2WPDA 4XMIA 3V48A 5M04A 1SXHA 5E2BA 2VXYA 4BO1A 5EE9A 2HEGA 2G25A 1YB1A 3QOFA 4YW3A 1ZXLA 1Q74A 4OFXA 1RFLA 1SNTA 3L6BA 1AXRA 4ON9A 3DPIA 4MR9B 5IKXA 4QXQA 1IAQA 4MQFA 1T5HX 5HKBA 2HO4A 2CJWB 4R98A 4DA4A 2KQUA 2R7NA 4BAZA 5EIAA 4CMHA 5HUQA 4OHZA 1T3GA 4AP9A 1SIOA 2V7WA 4L4RA 4WI1A 5I7OA 4BVLA 2ORWA 4MKXA 4NYIR 1XTRA 5CDGA 2CD7A 2AMLA 2G07A 3RDPA 6ADHA 4EKGA 4N0QA 1L6RA 6PFKA 5PNTA 3K53A 3PFIA 3F5SA 4ROTA 1TNDA 1LB1B 3GNTA 2RAFA 3VDQA 5IG2A 2JAOA 1KOGA 5HNKA 1DZ3A 1JJBA 2M32A 4CEIA 4BJ3A 4EYOA 4IIJB 2BL4A 1ZEMA 4UW9A 3OTGA 2XXJA 2E5WA 3Q8KA 1WNTA 2NU6B 3I9V1 1FCJA 2OXIA 4MO9A 4PFQA 2VF2A 2F8TA 5LNK1 4HUTA 1CQ1A 3LCRA