2W8BB

Crystal structure of processed tolb in complex with pal
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
409
structure length
409
Chain Sequence
EVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TOLB
publication title Allosteric Beta-Propeller Signalling in Tolb and its Manipulation by Translocating Colicins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/membrane protein
total genus 113
structure length 409
sequence length 409
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04052 TolB_N TolB amino-terminal domain
B PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2w8bB02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2w8bB01
3S94A 2POOA 4JMLA 3DASA 1CVMA 4GN8A 4PWZA 1IJQA 3G4HA 3G4EA 2DG0A 2IAWA 2IAOA 4GN9A 5D9CA 3U0SA 2P4OA 1POOA 5GX5A 2IAUA 3SOBB 1E1AA 2GHSA 3P5BL 5GTQA 2IASA 3LI4A 2IAXA 4DG6A 3S8VA 4Q1UA 3TC9A 3O4PA 4A0PA 3AMSA 4HHQA 4GN7A 1CRUA 3Q6PA 1PJXA 1N7DA 3I1CA 1C5KA 1Q7FA 2FP9A 3WW9A 3FW0A 4O5SA 3V65B 3E5ZA 3SOQA 2IARA 5FWWA 3HLIA 3FVZA 3V64C 2HQSA 4IMBA 2OJHA 3BYCA 1QBIA 3V1SA 3A9GA 5EX7A 2FPCA 3DR2A 2W8BA 3SOVA 1CRZA 2G8SA 4GNAA 5GX2A 4ZLRA 3SREA 5GX3A 3Q6KA 5D9BA 2IAPA 2VAQA 1CQ1A 5GX1A 4GNCA 2IAVA 4HW6A 3A9HA 3KYAA 3S8ZA 1QLGA 3LI5A 1RWIA 3Q6TA 1C9UA 4GNBA 3HLHA 3S2KA 2DSOA 5D9DA 3IAXA 4O5TA 2IATA 1V04A 2IVZA 2ISMA 3SRGA 1RWLA 2FPBA 2DG1A 4R40A 2W8BB 3LI3A 2GVUA 5GX4A 4IYGA 2GVWA 2GVVA 3WWAA 3HRPA 2GVXA 1NPEA 3AMRA 2QE8A 1H6LA 2IAQA 3KGGA 2V91A 4HHOA 2FP8A
chains in the Genus database with same CATH superfamily
2WFLB 2HBYA 2GCOB 2Y6VA 2AJTA 2C29D 5ETJA 3KYDB 3B1XA 3UTCA 2I7XA 2E21A 3GPDG 5FJJA 4QDOA 1BQ3A 2P0YA 4CEJB 1X87A 1J0CA 2NPFA 4HJRA 2XX3A 3KKMA 2BELA 1XZLA 3KQOA 4HTAA 4MV8A 1A9TA 2DM6A 2PZLA 2VJOA 1ZSNA 4LOKA 1X8KA 3FSEA 4Q9KA 4BLOA 4PCVA 2JKYA 3T5PA 2FLWA 2JFXA 4D0GA 3MBIA 4P3NA 2G0TA 4KXVA 4EHHA 1W87A 2O6LA 3FNFA 3GGOA 3TDNA 4ALMA 4DW8A 1YI1A 1C4KA 2XQFA 2HBRA 3BREA 1TAHA 3QUAA 4D99A 4FT2A 4P3OA 2XRMA 2DKNA 3GYGA 4GR5A 4J3FA 1MO6A 3RWMB 5EYPA 5EZSA 2BEWB 4TM7A 1GL9B 1DSSG 4O5SA 1RBZA 3WWDA 4IUDS 3P0IA 1XDBA 2C03A 2P1DA 1V9LA 3B5JA 5KOJB 1YT5A 3KQUA 4ZYZA 4YEDA 1QVWA 2IX9A 2DX7A 1Y98A 2OSVA 3AHEA 4L02A 2BR3A 1D2RA 3GN2A 3AF1A 4ENRA 4AJKA 1SHLA 4OHZA 2Q3HA 3WTCA 2K7FA 1MB2A 4TZ6A 4BMCA 1K6MA 1TO1E 3B6EA 4FZJA 4KRXA 1RIFA 5JEDA 3WXMA 4MR9B 1PHPA 2XSZA 3LLSA 1J5EB 1Y1QA 2HA5A 4WI1A 1PL6A 1ZMOA 1Z6PA 3L0OA 4H27A 4U2DA 2CVPA 1K5HA 5C80A 1AZSC 3GW8A 5EKXA 1XNRB 4R83A 1ZAYA 1DUVG 3FTFA 3OF3A 1VMEA 2X42A 4BKMA 1YR2A 1SCIA 3C6ZA 3D8UA 3PLAE 4ALIA 4IIJA 4TKLA 3F74A 3ACDA 1M2JA 2D54A 2X1MA 2EP8A 4G1CA 1C29B 1FYDA 3GRCA 1ULBA 4G0OA 2DLDA 4V2UA 1QF6A 1W1XA 5CMLA 1JTVA 1F6WA 1HDEA 1YRQA 3QYJA 4YJGB 3RG8A 4B8WA 1MQAA 4YMTA 3KX2A 4GPD1 2Q1WA 1H05A 2I2XB 1X1BA 4FDUA 3UH1A 1DQSA 2WFZA 4YVFA 1JXMA 4CTJA 4CH9A 1IZZA 4X7PA 3NAQA 2LCFA 2OP0A 1UJ5A 2DP4E 2AB0A 1PK9A 4WN3A 1WS6A 3OY2A 1U0LA 3TYXA 2QM7A 1RYBA 4UJ3A 4CM1A 3U80A 1IPHA 3ZTTA 3N8IA 4X1IA 4LN1A 1GCGA 1XZPA 5CW1A 1T36B 2BFMA 2G4LA 1J06A 1MC4A 3SLRA 5HJ7A 2OPHA 5AHRA 5CG1A 2XGOA 4JT9A 3CW8X 5J5CA 4GB1A 1EUCB 1LBSA 3K2QA 5FWXB 1ZONA 4G86A 3TLAA 4A26A 4UNQA 4DLSA 4CM6A 2Y2VA 4MJ3A 3AF2A 1G2IA 4EKDA 3NEYA 1E7RA 4L3OA 4B32A 2HJHA 3ZIAA 3NHWA 8AT1A 1RYNA 1L5LA 3CF0A 3FMPB 5H80A 2R96A 4DXHA 2RK6A 2G25A 3X1YA 1FXUA 4B3TB 1BRMA 1YSCA 1YB5A 1ZP6A 2V9ZA 4EB6B 3OM1A 4NSNA 3SILA 1YACA 4Q12A 4DUGA 4R1UA 4EL0A 1IBKB 5A4AA 4A2PA 3TLXA 1JJBA 1YR1A 4MUKA 1LFDB 1SA0B 1Y5IA 3K9NA 1YONA 1YCDA 2ATCA 3SMVA 5B3JC 2F24A 1DKMA 4PTYA 3GDFA 2PUHA 3O3CA 1Q1BA 1Z4YA 1PF7E 1UBMS 2JI8A 1VCIA 3RS2A 2JG3A 2QNRA 4IKPA 4P3XA 2MCFA 2NV0A 1XZGA 1NWCA 1BH6A 4LJ6A 2OV6A 2NVWA 3M6AA 1POXA 1KEWA 2IEIA 4FMCB 4MRAA 2PMEA 3PXGA 4E7PA 2E3JA 5C7IO 1F2VA 1HLDA 1UT8A 2NT4A 3KVNA 1W5AA 3O2SB 4KR9A 1ZI9A 2WD8A 1N5KA 2WHXA 4HPJB 2MYPA 1WUTA 3U17A 1VKZA 3DHVA 2X15A 2BMJA 1W6UA 4CIBA 1L5OA 1YR3A 2C4UA 4NYIR 3TZHA 4DJ5X 2WF6A 1DJMA 3NQ41 1UODA 1XSEA 3NRJA 1QQ7A 3RK1A 1TJYA 3ZZNA 3M3HA 3CEJA 3G79A 1F8XA 1PR2A 3U4MA 4DC0A 5IX8A 2OCYC 3UQYS 3ZQ6A 5EL0A 3HKEA 1FFCA 2QQFA 4E7OA 4PQEA 1P81A 1QE0A 1WXDA 2I2DA 2R8OA 2MSWA 3BMOB 4RORA 3F6CA 1Y5MA 4KAXA 3RUCA 3UAYA 5BSFA 1XMQB 2BEUA 3ZHZA 2BF7A 5H82A 5MFPA 1EVKA 4S1WA 4B17A 1N0HA 1TKCA 4OXRA 4A82A 2ZB8A 5AW4A 4UE6A 1GL7A 1BX1A 1WX1A 2H00A 1XD9A 2DTDA 1P9RA 3HFRA 3NGXA 3PFGA 4GQAA 4DG5A 1OYVA 2E6KA 2C5LA 3BXPA 4IUCS 5B3JA 1X8XA 4NABA 4PG5A 3WQQA 4AY5A 1P2SA 1DO8A 2JJMA 3TGPA 3PFWO 4DADA 2HFKA 1OROA 2WTNA 3C5HA 3SXUA 5CDTA 2IY8A 2O8FB 1CQ1A 2WUVA 3K0EA 2Z2YA 5DGCA 3UBMA 4EMUA 5TJHA 3W09A 4U1RA 1MHPA 4KGZA 4AM8A 1K8QA 4LOHA 3NVMB 2NO0A 4BV2A 2WM8A 4X6XA 1VFPA 2DKOA 2QRMA 4RC9A 1Q2XA 3A0UA 2VSFA 3CM0A 3TD2A 2SECE 4BFZA 4AAYA 3KQVA 2EWMA 2CXHA 4OJKA 4QOGA 1TC1A 3BRCA 2O7NA 3E22A 4NDNE 1Z5PA 2NOAA 4PBTA 2BF4A 1DLIA 2GN4A 5COAA 4UPVA 1CRPA 4QHYA 4AKHA 1I2ZA 5FUQA 3JSAA 1H5UA 4XMAA 3EXIB 3GNSA 3FSRA 4ZTBA 1XTJA 4C4RA 3UNXA 3N0VA 2CFIA 1NBOA 2CDAA 3F5DA 4CPLA 2D2EA 2C88A 4K1KA 3I39X 2I1QA 2WM3A 4C6TB 4KITB 5JVDA 1HFKA 1OCEA 3M6IA 2PGIA 2NAPA 3LUJA 1ZA2A 2BHRA 2Z9BA 3AHIA 1BC5A 5LXTB 1P9OA 3B6KA 3O3OB 5CGQB 2MINB 3CLUC 1TEHA 3PVSA 4LYAA 3UUFA 2Y93A 5FA6A 1A7AA 4X9XA 2GM9A 4X6KA 4KN8A 4EUEA 3BFKA 1IVDA 4ZT4A 1TUEA 2A5FA 2B3DA 3AFMA 3DE7X 1OWPA 4Y6OA 4XM1A 2OCAA 1MTOA 3MAAC 1WO8A 3KWFA 4N48A 3DMYA 3FUUA 4XJSA 1RXSA 3ENQA 3HFSA 4W8HA 5HKAA 1ZD4A 2I76A 2FMIA 3HLTA 3OEWA 4PYNA 3B1KA 4G1BA 2QORA 1M2KA 4QBIA 2G06A 1HFWA 2QX9A 4JOQA 4F21A 2VWHA 1LLUA 1Z2DA 2FP4A 2ZBUA 3IKJA 4BAUA 1W36D 2BKVA 4TS4A 1CQPA 4YRCA 1JDPA 3TKAA 3GUVA 4NCHA 5HGXA 1MGPA 4XX0B 2MSKA 4B3RB 2FV8A 3U40A 1X13A 3OQBA 4WESA 5TQ2A 4DWVA 2VZ0A 4DLNA 1E2JA 2CHFA 3SYRA 3KFLA 3VKHA 5CGJA 2XIJA 4BO2A 3RTBA 2NTEA 1YCGA 3DBIA 3OD5A 3VC2A 3BMQB 4Z1OA 1PEDA 1S2LA 2L42A 4RABA 4B4KA 4YRKA 3MB5A 1DWPA 2PQMA 1E2DA 5FWWA 3GH1A 3DXXA 3JQRA 3LFHA 3CG4A 4NF2A 4O0LA 3L4JA 4IGAA 1P4JA 4UBIA 1IBMB 3RBAA 3WV5A 3RVMA 3HP7A 2NXNA 3N6XA 2JD1A 3BM5A 4GGOA 4H1TA 3UAXA 1MJHA 3ZXUB 2YYAA 2EQAA 4X8HA 1TE2A 4PX2A 5F9HA 3GVKA 1KNXA 4ZQHA 2XB9A 5ALZA 2JEYA 4QXOA 3WGOA 4RGYA 3WVNA 1XYVA 4DRYA 1UFKA 3FG9A 3N8KA 2IV2X 1L7DA 3F8WA 3NNNA 3ZJVA 1BFUA 3KJNA 1MJ5A 2AMVA 2FEWB 3E3OA 4O2BF 4DA0A 1GL6A 1N8SA 4KAAA 1FFHA 4FEGA 4BFCA 1P9WA 1OLUB 1I94B 1Y6JA 4JLVA 5F76A 3QOFA 3PNPA 1FNDA 5CURA 3Q3IA 3U6KA 3RU9A 1M2VA 3R41A 4MULA 1IG3A 3NATA 2WHQA 1LI5A 3DSRA 3ZCPA 4JIMA 4D6YA 3AKZA 4LY9A 3EVTA 4RJJA 1NKSA 2ZIUB 3WWYA 4J1TC 3Q40A 1TECE 4Z1MA 2BJVA 3HI6A 1PLJA 1AKRA 2GZMA 4RZ2A 2E5FA 2AQKA 3CGWA 4MVWA 1R0YA 1HEUA 3D1LA 3R7WA 1YZNA 4XSGA 4D52C 2FZ4A 3HB0A 2XBUA 4KUHA 1JKJB 4R9VA 1VIYA 4ZO6A 1MB9A 3O93A 2PL9A 4CM5A 3RQSA 2G3YA 3GLUA 1YDGA 2H8GA 2QPOA 1M2HA 1O8CA 2HF8A 2VLBA 3WMWA 4C1YB 1ZH8A 2RCNA 4MUAA 1R5NA 3RROA 4AMYA 5JY6A 4MHTA 1T2CA 1XTZA 2D7JA 4ZI3A 1TKBA 2NXCA 4HUTA 3G8YA 3V7UA 4FE4A 2ZYUX 1P2DA 1THTA 3EEFA 2IU0A 2JHGA 1CUUA 2WSMA 2QMOA 4HEA1 3ST7A 4BLWA 2RHJA 4NBNA 3AR8A 5LOVA 1TU3A 3KHSA 2H2FA 4AJLA 3PHHA 4LXXA 2VQEB 4Z0NA 4LOAA 1IIRA 3KL2A 4PG7A 3QNMA 5AI8A 3TRHA 1M8GA 4G97A 1JF8A 1LJ8A 1QZ3A 5AXCA 1NN1A 3B60A 3EWSA 2C0CA 3A14A 4V03A 4TYWA 2AC4A 2O2EA 1XRNA 2QUAA 3GLHA 4QTZA 1GZ6A 1TEXA 4FN5A 2NXJA 1A96A 1EDBA 3DYVA 2VYFA 4NPCA 4LCJA 3K1JA 2QZJA 3UMSA 4DZRA 4Q21A 1XRLA 2VHXA 1YNOA 4J1TA 3ZD8A 1CUJA 4HVAA 4PW0A 5BSKA 5TGDA 1N77A 2YRFA 3QU2A 2IEYA 1MB4A 3IPYA 4I6EA 1X7XA 3LIPA 1FQWA 3TTWA 1P2UA 5A71A 2OV3A 1XDDA 3WO0A 3K5WA 1CY7A 3L4EA 4J1SA 5BRNA 5C7YA 4D52A 5A3VA 4QREA 3FPSA 5JE8A 3VR3D 3BDIA 3CZMA 1QOPB 4KIJA 1S1CA 2RGBA 4GECA 4WGGA 4X1YB 3ZD7A 1K7YA 3S6JA 2BI4A 1KJ9A 4QDJA 2JHFA 4IYRA 2OFOA 3N8HA 4Q18A 5CLFA 4PRZA 3EVDA 1C30B 5IRCD 4OLAA 3MBKA 3EDQA 2V6MA 2CNOA 5DDIP 5CYOA 2J31A 4R01A 1NMQA 1QVZA 3R0ZA 4E2XA 1H0KA 5KSWB 1UBHS 2HMUA 2C78A 4IZHA 2R8RA 3NC1C 4LGYA 5E7QA 3UMGA 5KWIA 2D13A 3S68A 5LUBA 3W9SA 3KU1A 3AM5A 3S29A 4CM4B 3P2YA 3G68A 4QUHA 3ORQA 1KI6B 4IP0A 3MK31 1X7WB 4QNMA 3MLEA 4UEWA 3LQ2A 9ATCA 4M22A 5K0TA 1RCUA 2W8BA 1RJWA 4Y6QA 1ZHFA 2FR1A 4B40A 4QBGB 1D9ZA 5IK2D 1W8DA 1JIXA 5IT4A 3FHOA 3P9XA 2ID9A 1H1LA 1NXTA 4E5VA 3KKPA 2Z2ZA 3G5AA 2OK8A 2G63A 5AI6A 5EJ9A 3L0BA 1HBJA 2KHZA 5F3WB 3LO8A 3QLUC 4Q4CA 1A1VA 3TICA 2MSDB 4D4IA 4E31A 5TQ0B 3S2SA 1XKQA 5KSOA 1L4BA 1QLGA 4ZGBA 1FK8A 1H0RA 3VDRA 3ZLUA 4XIJA 1FB5A 3IP7A 1QC5B 1TM7E 2QRQA 4PX9A 5KWEA 1GHTA 3UWMA 2EEPA 3HKCA 5F12A 4HGNA 1PZNA 2AD5A 2NUPB 3TKLA 4BV9A 4D4KA 4BAGA 1OYWA 4KWIA 4P7KA 1OHHD 2GAFA 5AOAA 2VCHA 1A7UA 2Z98A 4IDBA 1A95A 2RI1A 4MWSA 4Q1BA 3DQZA 3T7AA 4N1BA 1FRQA 4MR7B 4B34A 1GV1A 1PW5A 2HAEA 2YWRA 3EBOA 6REQA 2X19A 5AVVA 1NRJB 4GI2A 1HDOA 5IVHA 3ZCSA 1JFFA 1KVTA 5CAEB 3TW8A 1I0ZA 5CLQA 3ESZA 4RJKA 1QFXA 4X3CA 1ZOLA 1IEWA 4GMKA 5HF9A 2I3GA 5BW8A 1WCQA 4C9BA 1SUAA 4DIEA 4INZA 1GUBA 2CVZA 2W6JD 2QTFA 4C88A 4JC0A 3KK0A 3CPJB 4BZPA 1KI9A 2QRJA 1GL3A 2Z3VA 2ZU0C 3M6WA 1N1EA 2PEYA 1ZL2A 4LC9A 2WTUA 3MGBA 3BX1A 3I1FA 2GVXA 3EC2A 4UD6A 1M66A 5TEWA 4GLFA 5IJ0B 1TYDE 4JJ6A 1JDSA 3QLVC 1ABBA 4N39A 1BHQ1 1UM8A 4PFJA 1DV2A 4B4WA 1X19A 2JEZA 2B36A 3MPOA 1RABA 3R76A 1T2VA 5C5IA 2MSNA 3QLUA 3W1WA 1EVEA 3BTOA 4UUMA 5IC4A 4YRMA 2NG1A 3MMZA 3TSOA 3C4QA 4PWZA 2OC9A 4ARAA 1SU7A 3C39A 1SC4A 2JEOA 4ZVUA 3S8MA 5BSGA 2ONKA 1GRQA 1HI9A 5GONB 1T4GA 3AKCA 3LX5A 2Y1XA 4PCAA 1KYZA 4W82A 4JLUA 5EO8A 4C0LA 4IAOA 2RJOA 2A9KA 3LI4A 4M37A 2HTYA 2M2IA 4YAWA 1NSFA 1DIAA 2FG5A 4CTNA 4MPPA 3TOCA 1MMFB 1YQWA 1I1NA 2KPOA 2PRSA 2VUSA 4HQRA 4FFWA 2FJUA 5FT9A 3V32A 2PUJA 1U4NA 1G21B 1PEKE 1QIKA 3H18A 4NCXA 4NE7A 2UYOA 3PPIA 4TV8A 2OGWA 3RJTA 2INGX 4PAQA 4UBMA 2NVUB 4C89A 4COOA 5HIAA 4N6OA 2X40A 3TRKA 5EJMA 1F6DA 3I4LA 4W5JA 4CLEA 3SQLA 2R1UA 1XPOA 3ZGZA 1S3IA 4K6OA 1UQTA 5T7BA 1YB6A 4C05A 2W2VA 2X7JA 3TINA 1N3LA 4Y6RA 3L0SA 1YR8A 2IYAA 2ZRFA 1U2QA 2I3BA 3BXHA 2ORIA 3HCOA 3IQFA 3ILHA 4KWEA 4IM7A 1ULSA 3K8YA 4YZ3A 4X8LA 1H22A 1WL8A 1ISMA 4O2RA 4XUCA 1N8TA 3THXA 3CX8A 5K2OA 5J59A 3GHHA 2OO5C 3L49A 3IHWA 4N03A 4XRGA 3LQ1A 2A0YA 3B12A 3M1AA 3SSOA 2D7DA 3FETA 3AVWA 2AOXA 3LFTA 1I3MA 3UVEA 3MB8A 1ZRNA 5I47A 1N6NA 5LU8A 1VP9A 4DNOA 3OCUA 4ZMRA 4U7WA 3RSGA 3H3XA 5AWFC 1K66A 4XIOA 2P6RA 1NUHA 4Z7JA 4GDMA 4KQHA 4ILEA 3WNBA 1KVRA 2OPBA 2VJMA 1NV8A 1E89A 3GCDA 3IPLA 4TL8A 4BC1A 2W6PA 4AULA 3CZQA 3Q3JB 4KYVA 4FPHA 1UMDA 4N5HX 4WBNF 1NGSA 2YNMC 3N2ZB 5K20A 1VSBA 2HOQA 2IJGX 1A9PA 4R2XA 5FULA 1FTSA 3EVZA 1D4FA 1Q0SA 3KZNA 3L6RA 3NKVA 4RPLA 3T1OA 2BC9A 5HMMA 5KTOA 2IATA 2VSKA 1Y9ZA 1RTTA 4QATA 4P0QB 1ZRHA 2P4HX 4JGGA 4DJAA 3OU7A 3SVTA 2RI0A 3RS3A 1G6Q1 1OU0A 4EMBA 5BR8B 1JRLA 1QR2A 4Q1CA 1MAHA 3TEFA 4OLBA 1NFFA 4IIHA 2G9NA 2WQ7A 3BIWA 3L18A 1Z3IX 1UKVY 1NM5C 3DM9B 2IYSA 4FT4A 2QWJA 4RETA 4DVJA 2GJKA 1ZQ9A 2VZ9A 2EKBA 2OLEA 3HJCA 1WY5A 5H68A 4BKOA 3LPNA 4G84A 3AQIA 5KQLA 4MAAA 1OBOA 3AJ8A 4R8RA 2ZDQA 1UL1X 3ADKA 3B9RA 2VJQA 3U4CA 1PJ8A 1TCAA 3C1AA 1SUUA 3ELBA 1AHHA 2OO5A 5BV2P 1FSSA 4D79A 5K05A 1XOEA 5HTKA 5DYTA 1I9GA 4WN9A 1Z4VA 1DBPA 2W2XA 4IVNA 4JJAA 2BZDA 2H2AA 5TLSA 3MZ0A 3IAUA 4YASA 3TAUA 5D3QA 1CERA 2ZBVA 4G5HA 1FS6A 4NATA 4PZDA 4TKUA 3RHSA 3SZOA 1P1CA 4RA6B 1E6EA 1E66A 1JJVA 1F8GA 1GLVA 2X0RA 3G4HA 4BQNA 1AQLA 1UK8A 4I0WB 4GPIB 4WK2B 5A4IS 2IIBA 2OMEA 4FDTA 2YNMA 4X20A 1MPTA 4CGYA 4YRRA 4WZBA 2GS9A 2QENA 1P0QA 1KY3A 2H8KA 2TRSB 2ZBRA 4HUQB 4JITA 2WWIA 4LCBA 4J9VA 4MVJF 4QLOA 4ZARA 3KP1A 2ZT5A 4M1TA 4CFYA 1VHQA 4J49A 4ND8B 3OOJA 2L69A 3T7IA 4RPJA 2HJVA 1U8CB 3RAEC 5BMVF 2GCNA 1TVMA 4IWYA 1VPTA 1JYFA 4X5OA 4OJMX 1PGQA 2C9MA 4BO8A 1UT6A 2IH5A 1LVGA 5B2DA 2QR3A 1Y1RA 2WIKA 5JTTA 5K09A 5E2IA 4AY6A 1GU1A 2J41A 1NM5A 3IIKA 3BL5A 4MV5A 2OXCA 3LS2A 1RQPA 1KKMA 2REQA 3DPUA 2RHOA 1G64A 3C5EA 4F3KA 5JATA 2D1SA 2J7PA 3NTOA 4H3HB 1R7RA 2HWUA 5CTAA 4MW7A 1A2BA 1HMPA 4KUGA 1KJ8A 1KYXA 4S1VA 4EY5A 1S3FA 1ZNXA 1MS1A 3B82A 4JEIA 3LVRE 5FNSA 3V2IA 4MWTA 1NBMD 1N2CB 3QVXA 4Q03A 4ZXFA 3KJZA 4YQYA 4IRUB 4JDPA 4JI6B 4DLBA 5KBYA 3R9WA 5NN9A 1AS3A 2Z2JA 3E9DA 3QXHA 4WOCA 1X7YA 5E2AA 1TRKA 4YMGA 4Z5XA 4PV7A 4YLYA 3NTXA 3PFKA 1K08A 1K92A 2A1UA 1EVIA 2FWAA 2EAUA 2G80A 4UBKA 5F51A 3SR0A 3ZGVA 1TZCA 2AS0A 1JDUA 3GMIA 4HG2A 4OH1A 2WHPB 3AEUB 4YJ2B 3RVSA 1THMA 5CLGA 1O0CA 3TLGA 4BQQA 1E69A 2G1AA 1KZ6A 2X5JO 3EUAA 3TQOA 1G2PA 3AUFA 4QDTA 4BC0A 4FK8A 1WMAA 1B6SA 3WL3A 2R48A 3KT0A 4EJMA 5FNQA 4HT3B 5AW8A 2IA5A 2BGNA 4BNJA 2CDRA 2WTAA 3ETJA 1TM2A 1NTOA 4FZRA 3VPSA 4BBJA 2PPVA 2BFCA 1V6CA 4HI0E 1CF9A 3L46A 5IABA 3F73A 3W5DA 2IP2A 4Z4GA 3C1TA 3LCMA 1G16A 5A5FA 4DV6B 3DEAA 1P5JA 1YO6A 3WHIA 2AD1A 3AIKA 5HCUA 3ICWA 3W4JA 3S1AA 3IYLW 1KPHA 1KYYA 4TWRA 2QIPA 4DAEA 1W8NA 5JCZA 2HT5A 2WYWA 4WZAB 1DEOA 4KQMA 1R66A 3PICA 1IY0A 1JHDA 4JP3A 3UHPA 4S1NA 4YFYA 3RSHA 5CFQA 3N70A 1GQOA 1O6CA 1ATZA 4PE5B 4L2IA 4Y8VA 4C7KA 5IWAB 4A15A 2FA9A 4EELA 1H8HA 1C7JA 3AG6A 1W34A 1KH3A 3GEHA 3OI7A 4RDHA 4RY9A 5B4UA 4N0MA 3VYUB 1X7ZA 3UHOA 3IEMA 3CB2A 3TN7A 3UKJA 2YA7A 2HIMA 2WWRA 3IS3A 1F3OA 2ANCA 2H4ZA 2FQ1A 1E0DA 2O8CA 3DNFA 4IDGA 1K97A 4UCXA 1WDMA 2B98A 1CJBA 2W2PA 2IWHA 2XQIA 4DDHA 4JU9A 1G8FA 2RKCA 5D5PA 4DGSA 4UHJA 5BYKA 3WXBA 5FNTA 2CNDA 5I7OA 3LOUA 1GR1A 4KXWA 2Z1DA 2IIVA 4G07A 4V2IA 1IJQA 3H87A 4TUYA 3ZS9A 1SU4A 1RJGA 4RHUA 4KIFA 4X6LA 3AR7A 1PU2A 3DL0A 4AKEA 3QBDA 4FOWA 3A0RB 1ODIA 4LHWA 3OZFA 3RPEA 4YCMA 3MMPA 4P7BA 4ZQIA 3K36A 1MR5A 3L77A 1W5FA 2IAXA 2ZS8A 2YVUA 4IRMA 5IUJC 1HE3A 3D4NA 4M87A 3ZI4A 3O75A 1GGHA 5EHNA 4FI3C 4OX9B 4B0PA 2F62A 1YK0A 5IAOA 3F7OA 3S8EA 3Q3EA 4ENQA 5A06A 2VTKA 4AU1A 1NSDA 4HDKB 2ZVQX 4WEQA 3HDVA 3T7KA 3AQ4A 1JT2A 2I03A 4OHPA 4QEZA 2PS1A 5T67A 1WDKA 2HD4A 3OP4A 4QRIA 4ARBA 1P3DA 1GQYA 5HJEA 1EXDA 4WXYB 3MD9A 2P62A 1PFVA 5FWDA 4C06A 2JFUA 5HKBA 3P9RA 3SBOA 4HWTA 2GBCA 1ZD2P 4HDAA 3QTLA 1WUIS 3PUXA 2PH1A 4JELA 2H57A 1B4DA 4UW9A 4NCJA 1QBIA 2ZXUA 1OFUA 2OWDA 2YMMA 2X8JA 2W93A 4JI5B 1XZ8A 1WHSB 4ND7A 1E1QA 5HK8A 3NYRA 3TTYA 4BKUA 4C5AA 1XTBA 3SNHA 5JWRA 4HAUA 1SG0A 1BXGB 1T1RA 3M1IA 3AESB 5IWCA 2C2GA 2ZRIA 3E15A 2GGSA 2G36A 3SHQA 2IUEA 1OX4A 1PR9A 3CRNA 3TJRA 4Q15A 3LY7A 2FEPA 3M89A 4NPHA 1ZGZA 1UPAA 2ZAOA 5JYBA 5CT8A 4YRAA 1KJYA 2ZLBA 1OUMA 1UAAA 3IE1A 3H5WA 4O1IA 4DLYA 5HEKA 4IDQA 1WCIA 5L3QB 3WYAA 4O4LF 1KI2A 3KPVA 1AHPA 3F8SA 1BSVA 1I10A 1EJ2A 3S1SA 3UMVA 5JADA 2FEOA 4BZXA 1N25A 5BV8A 1Z4LA 2QZZA 4GYWA 4FOSA 1V0FA 1VBMA 5CGZA 1RSZA 1Z6QA 2Y3IA 3K70B 3QJ5A 2Q6TA 5FOUA 5BNWA 2Z5LA 3IURA 3QFSA 4MVJP 2IVZA 1S0JA 2A1IA 1YQUA 4IINA 5K51A 4JL5A 1AKEA 1BA3A 1CDZA 1DEHA 3TI4A 1SUIA 3AUUA 4DRXB 3D5EA 3K0FB 1NNBA 2P3LA 2OLJA 3DAOA 4JHXA 4KUEA 2ZSKA 3FRIA 1GUFA 5FUYA 1NQXA 5IULC 1W94A 1T2NA 4D4MA 4FGKA 1UBTS 4JMPA 1OYYA 4FPFA 2GK4A 1KS9A 4K3UA 4AJNA 1F5SA 4NZMA 4KQCA 4KW7A 2XZDA 1JNXX 3AONB 4HO1X 5A0VA 4IIVA 3IMGA 1RPAA 1WSDA 2HK6A 2XVZA 3DXZA 3HB1A 3P71T 2HA2A 5B2CA 5J2UA 2VAPA 2WTXA 4MWVA 3EBPA 5ARBA 2NSYA 4KRFA 3AMRA 1JPUA 5JD5A 4BWVA 3IA7A 2B25A 4NXNB 3QVVA 4LE0A 2P4UA 3U7EB 1CJSA 3GX1A 5HBGA 1DAKA 2HLDA 4YRLA 4DMUB 5IXYA 5EWMB 5HFNA 3TF5A 1CVMA 3QE9Y 1PNTA 1JV2B 4IJ5A 4A7PA 1J6UA 1NU6A 2IDKA 4MW5A 5TE9A 1T0IA 3T7RA 2ODAA 1JVBA 2PBFA 1RMTA 1ZJZA 2GEUA 4U9UA 5F52A 3KYCB 2WUDA 1E1AA 3ICCA 4H7PA 4W7IA 5EJGA 3UC5A 2ZSJA 4DMRA 5AJVB 2IUUA 3LDUA 5A03A 3OEHD 1JDTA 3SMQA 4UXIA 4E08A 3NTVA 5FPYA 1BDHA 4FDVA 4NBLA 1ZVQA 1ARZA 1ORDA 3FA2A 2VP6A 3G9QA 4OATA 1E9FA 2FPGA 5IBRA 1I2DA 4ROSA 4JLMA 1XE3A 3X3HA 3MINA 5CA1F 4NEHB 3ZUGA 1TJ3A 4CPDA 1MP0A 3ZHSA 3EIWA 3Q8XB 4WCVA 2VDQB 1IONA 3F46A 3SF0A 3DYIA 3CUTA 4G1UC 2VZ8A 2W6MA 4IFBA 5JXHA 2X86A 4NENB 1SK9A 4QELA 3ZDYB 2P9ZA 3H9JA 3PNQA 1ACLA 1XLVA 1C4WA 1NP7A 1Z5ZA 3W5AA 4LYJA 3PR2B 4BO5A 3KSMA 5ER6A 3SQOA 1E64A 1NMSA 3QFRA 4NC9A 1Z8FA 3ZCRA 1P1HA 3IO3A 3IRUA 1D1PA 4CQMB 1T9ZA 3BEDA 2C58A 2DULA 3F1KA 5DOZA 3GEGA 1YQQA 5FNRA 3C8MA 3QZUA 3A26A 4YRQA 1ZJYA 2H7CA 2RGXA 4A5OA 4ATNA 1SXQA 5BUQA 4EA6A 4NN9A 2BKUA 3IIMA 4L3VA 5F3RA 4CFSA 2Z5VA 3P0JA 1GADO 2EZTA 4FR5A 1LW6E 2C5GA 3MWEB 1VJ1A 2PK3A 3SKYA 3F3KA 1U04A 1Q50A 4OG2A 2P90A 2OA0A 3A9HA 4IHJA 4B3BA 5E1DA 5CA0F 2CV1A 4R1TA 1ISJA 1CUGA 4WA7A 5H4GA 1S2GA 3H4MA 2NN3C 3QENA 1SUWA 3R7BA 2RHTA 2RJNA 4GZLA 1ZI0A 1T2DA 4UOQA 3Q8MA 4PO8A 1BQEA 721PA 4N8EA 4QVGA 3PGKA 4OPMA 4CR7A 4TRRA 1ETUA 3Q9SA 4HX2A 2ZAIA 3E5HA 1ECBA 3KTFA 3OO0A 1TJ5A 4DSTA 2P68A 3IJRA 2PJDA 3QWHA 3KSRA 3KWMA 1VLVA 3W8EA 3RUDA 3Q6NA 1MNAA 1U80A 3D81A 3GT3A 3NIFB 1O4WA 3MAGA 4UNRA 2PKQP 3ZQKA 4KOAA 3FLBA 1XTSA 1E96A 5I6DA 2NVOA 4X45A 4P9NA 3K0SA 2ERXA 2CLLB 3H6HA 5CJPA 3A6LA 1D4ZA 5GM2A 5JBIA 3G13A 2CV0A 1ISSA 1T6YA 3CR7A 4PEVA 2A0KA 3DMTC 3PUYA 4FNGA 3GVLA 1D0IA 4RMIA 4GEZA 2VYNA 4Y2YA 4F97A 2C7VA 3EX7C 2HHHB 2POQX 2ZTUA 2GHTA 1JMYA 4GOLD 1ZAKA 1JMVA 1NASA 3Q9UA 4HNHA 4KH0A 4R8LA 4QEDA 5IH3A 1GDDA 1LSOA 3V9PA 2QWIA 3E2MA 1UJ2A 4OU5A 2BFFB 2CMHA 3EVBA 4JN6B 3II6X 1C4OA 2HRRA 4X7BA 4YIKA 1B0UA 1MA3A 1EX7A 4K05A 4EG5A 4KO2S 4M0LA 5EXEA 4YRIA 1ZJ5A 1LTKA 4XWWA 1XXHA 3K53A 4W9NC 3SBEA 4ASUA 4BNHA 3TUZC 4RK1A 4PANA 2PT6A 2OG2A 4N7BA 2DR0A 1UBCA 3JWPA 3IUQA 3EHEA 4OCZA 3O7MA 3TCNA 3NHZA 3OQMA 1W5TA 5D1NA 2XCIA 1W5SA 3N0XA 1UEIA 2ZIZA 1G6KA 1SU6A 2OYRA 1OU4A 1L4FA 3LP8A 3FTCA 3NHAA 4HIZA 4MAFA 4Q47A 1YWGO 2WTBA 2XOKA 2H7XA 2WSYB 5LYJA 2FW9A 3LCJA 3LPLA 1LTQA 1SB9A 4BO9A 2XUOA 4FDMA 3BHNA 4TTJA 1JA1A 2OFPA 5CT4A 1H5QA 2YWEA 1FFBA 3ODGA 1L7GA 1GITA 1P5RA 2H4JA 3NTRA 2WT9A 4RTPA 1CDEA 1TTHA 3OE7D 4A0PA 3DDCA 1ZCFA 4QQFA 1XZFA 4WNAA 4JSRA 5CDSA 1CRUA 4E46A 3A2MA 1FXSA 2EX1A 2VNSA 4BY9E 1JJIA 1P62B 2QRNA 2J07A 1AKMA 1B16A 1IQPA 1UK7A 1YIOA 3B6JA 1WXIA 3DE6X 3JQQA 5ARCA 4AWXA 5LLTA 4DSNA 2DVMA 3RU7A 4UM9B 4ND3A 4CL2A 2DEUA 1N2OA 3ZWPA 1PYGA 4DLXA 4Q93A 3UMBA 4E51A 1F06A 3DMTA 2IYTA 1WIWA 1DKLA 4D74A 4HXFB 1Z7YA 2NZ8A 4PFQA 1SHZA 2D8AA 1A2QA 4EO7A 3IXMA 4FPLA 4JUAA 3BG5A 2CXPA 1FU7A 4HEHA 4LF8B 1BMFD 1H6CA 3BQ9A 4RPHA 1QSGA 4WKOA 5AKXA 2BD0A 1W581 3T1VA 2A92A 2JIZA 3FWPA 2HUPA 4ZVKA 3ME5A 2FZKA 1DL5A 3D4LA 5KSZA 3TAXA 1F5NA 1JHUA 3ZPXA 2VHUA 3CNEA 1KXZA 4AXXA 4BJ3A 2Q3BA 4W9NA 3IMFA 5AVSA 2FSUA 4QNRA 1YGYA 3HXTA 1RQ7A 1Z73A 3ILVA 3UICA 1ZR4A 3VO9A 4C0KA 3QE4A 4V0KA 1QBGA 2UV8A 1EUQA 3HCDA 2GHIA 5G1NA 4EKGA 3NYQA 1UWCA 4XCQA 1ACJA 4FHEA 2I2WA 3SE0A 2FDCA 2NO4A 3VGJA 1A4RA 1IPEA 1FXWF 1YZFA 4DA4A 4BGDA 1KSFX 1CY4A 1SBIA 2G8NA 2RD2A 1GGVA 4MSUA 3C5WP 1RWIA 4INAA 3MGCA 3L2OB 4RO0A 2JAUA 1QQ6A 4MCJA 1SUBA 5KYYB 4QODA 3IX7A 3AB8A 4NV0A 3IQZA 3S7ZA 1VI5A 2JATA 3WGNA 3WLOA 2FOLA 4R9SA 1G4HA 3AHGA 3DT9A 3EQ9A 2FB9A 2XTMA 3Q5GA 4P92A 5IDVA 3W78A 4NYJR 3KKZA 621PA 1NF9A 1PR3A 1JA9A 2JFBA 4H77A 1U0JA 2P4EA 3N76A 5JH7F 1OB2A 3JS5A 4PZCA 4B33A 1WABA 3GROA 1OJLA 1E2GA 2IYWA 5EHIA 5HIJA 4C0WA 4QUAA 1RRGA 5MDHA 1P5FA 1PUIA 2HRBA 1QU2A 2RHWA 1WULS 3IA2A 3KQWA 3GG9A 2PL3A 1CZUA 1UBKS 4NYMR 1BDBA 3RVJA 3A6KA 4JT2A 2WKQA 4F96A 5CDHA 4P33A 4MW4A 5F9FA 2RAVA 4UZFA 2F48A 2YV1A 2QAGC 4RD6A 1G5HA 4UNIA 3DZHA 1KI3A 2PTHA 3D8TA 1KOFA 1B26A 4NL4H 3C98A 5ES3A 1GUYA 5I9IA 1B3RA 5A6SA 2XNJA 3OPXA 1J20A 3DCJA 1XHFA 4M7PA 2C8VA 2WYIA 1KZ7B 2ZANA 1C7EA 3N0WA 4KCGA 4ZAVA 3UJAA 4BWYA 5IUNC 5E8JA 5I4IA 3VX3A 3BF8A 2PSHA 3AKYA 1QWOA 2QWBA 1KZGB 3K5IA 4Q02A 1QRSA 2HL6A 1L5YA 2OL4A 3GDGA 4HGYA 2F43A 4KQFA 1BEZA 1MD9A 2FX3A 3U9TA 2HA6A 2OY0A 2WICA 3SQDA 2VAMA 1JDJA 1QQBA 3RYCA 1PR5A 2P6NA 3U3MA 4F6CA 4HDNB 3O5AA 5IJ9B 4J16C 3G6KA 5FUWA 3U6BA 3E9CA 3QUCA 5DNDA 1D4OA 1TMKA 1F60A 1GSHA 1SQ5A 1TMOA 2AJCA 4CW7A 1JEQB 4KQXA 3GFQA 1W0OA 1T0UA 2ZJ5A 2J6CA 1SWVA 5JO0A 1L5HB 2WINI 3UYLA 2VJPA 1T3HA 4S2UA 2JGDA 5LA6B 1TQ8A 3BRSA 4AGTA 2AGSA 2GMWA 4HF7A 1AGNA 2JCSA 2H5EA 2Y1FA 3MEQA 3P19A 4F8EA 2VYCA 4U8GA 3PJFA 1Q20A 2R2AA 2WJ6A 1Y6QA 2XITA 2WE8A 1S9DA 1Y63A 1YZUA 2P3SA 3B78A 3Q11A 5FPKA 3E2IA 2NAFA 3FJYA 1CJTC 1GFSA 3RJ9A 4Z53A 4RENA 4HDCA 3PRYA 1WLYA 2HXYA 2QAGA 1SVMA 4HMOA 1L4KA 3FCUB 4BDSA 4EUSA 2D0PB 2DTEA 4WZ6A 3RC3A 3HWSA 2DHEA 3GOHA 2IELA 4ISBA 1FFSA 4IGFA 4OAPA 1MABB 1LNSA 4HH3C 1QYXA 4LTNA 3IE0A 1NI4A 3DVAA 2I9KA 3ZZ0A 1HQKA 2WNHA 3FIUA 1F8EA 1K1EA 3MD0A 3U0VA 5KJ1A 2GEBA 1J2EA 1W1WA 3BXXA 1W0KA 2WUFA 3ICOA 3WGKA 1SR8A 2R8ZA 5CLJA 4RTOA 4R5MA 4PU0A 5B1HA 1UMKA 3TOVA 3SIWA 1IUPA 2REOA 4J16A 2WIFA 3VAAA 2WYVA 1V8DA 2C0PA 2FFRA 2WYHA 3VKWA 4CF4A 4YAEA 2AH2A 2IHBA 1UWKA 3KLBA 4ZQEA 4BFXA 1K7CA 4BO0A 3EGCA 4YZ4A 3OKAA 1OJ7A 3PITA 5KX5B 1A9RA 2XMPA 2JFFA 2EHJA 4M9XA 3U3ZA 1ZW6A 4D3ZA 1GPBA 1Y8RA 1FJHA 1CUIA 1NU8A 1V3UA 4A2CA 5C5DA 1UBNA 1GTJ1 3NH9A 3A71A 2CZCA 4XDYA 3VPGA 3ZWWA 4IHAA 4OQ4A 4DDKA 2PUFA 3AVUA 2OO3A 1UQUA 4E5NA 2UUPA 1Z0IA 4PM4A 2QDXA 4G5YA 5E4JA 1B0AA 3UFXB 4A6DA 4WFKA 3ONNA 1X80A 4IIFA 4RDCA 5LZ2A 4FHZA 2AEEA 3AUAA 1MC5A 1UKYA 2G0NA 3EGXA 1L4UA 1K7EB 4XGQA 3VO8A 5JECA 3N7AA 2XMQA 5EE9A 1G5QA 3ZDFA 3ZCVA 2CF6A 5KHLB 2QIOA 3H1AA 4F9EA 1OIWA 4DQLA 2PKCA 4CMGA 2R65A 4B3IA 4HS9A 7REQB 1GPDG 2W00A 1P2FA 1XQ6A 2P3OA 5AKEA 2X1LA 4PG6A 1XP8A 3WGUA 3X1XA 1L4HA 2VEDA 2ZSEA 4JXJA 3R7DA 4BZWA 1W88B 2JGKA 1QG4A 3C48A 3PEVA 4QD3A 5HE9A 1U1IA 1GTRA 1H3EA 2HQOA 3NBUA 5EIHA 1E8DA 2J4FA 3A05A 3MS4A 3WRWA 2ZE5A 1HDGO 2IHJA 3QHQA 4CIWA 1TVCA 4TQAA 3LWNA 2ZJ8A 4BFYA 4DQ0A 5DHTA 3ZX4A 3WLHA 2YZ7A 4QGGA 2K2WA 4DG6A 1J0DA 2XMGA 3S8VA 2ROQA 2F90A 1PR0A 1DKRA 1NW5A 2GA8A 2FETA 3D2BA 4FKBA 1QNLA 3AMSA 2UZ3A 1ZKDA 3LZCA 1F3LA 2LXNA 4Q4JA 5CFPA 2B1GA 3IB6A 1NATA 2P78A 2R66A 2C9DA 3FZYA 1VB5A 3QEOA 3HBMA 4GSYA 1JG6A 2ZUVA 1DWQA 2GAAA 2HA3A 5LB2A 4YHHB 3O90A 1IZ8A 5LKAA 4KS4A 3A9WA 3QMPA 1OT3A 4Y0VA 3UH0A 4M4SA 4GMFA 1JIVA 3OA2A 2Z5FA 3PGVA 5AM5A 3WZMA 4Z4IA 1WD5A 1WETA 4G5QA 3CZCA 4J0EA 4BECA 4AMUA 3VYSB 3TRDA 4FILA 4JLAA 3DBHA 5E3JA 1SVLA 2KM1A 1EM8A 2VHYA 3CVJA 4MV7A 4MRRA 5ITZA 4RA9B 1U63A 3QJYA 2DBYA 2HV8A 2VYQA 2YN2A 1UXIA 4FE7A 3HCAA 3I1YA 3FY4A 5DEIA 3K6SA 3NGMA 2DJIA 1XZCA 1KI4A 1ZUWA 1VE6A 2R4TA 4IIDA 4NOJA 4YECA 4BGEA 2N47A 3IP8A 3MUOA 2J5QA 4KHPB 2HPAA 2IKSA 3RIGA 2PYIA 3G9ZA 4HK4A 5BWOA 3KC2A 2C83A 3E9ZA 2J0SA 1ZMRA 1ETHA 5EHQA 4UU0A 3AW8A 1Z39A 3E27A 4BUCA 3MM4A 2FPPA 2WUGA 1E3TA 1WVIA 4KE6A 1J5PA 3H2YA 1WZEA 3U4HA 4PLWA 4BP8A 4ZANA 4CODB 3HY4A 2QZ9A 3T38A 2QMYA 1WDLA 4AF6A 4AYWA 4J2OA 5C4MA 2WQZA 4AN0A 4XIKA 3VVCA 2GKOA 1Q0HA 2Q5FA 3L1VA 2A7XA 3L7CA 3OQIB 1JTEA 4H6XA 1M75A 2Z6VA 4M1QA 2JGFA 2HSZA 4BATA 1C3VA 4DZTA 2ZTLA 1X77A 5BORA 4QDKA 5MN6A 2WWYA 4KQEA 1S8AA 3KYIB 2ZSAA 4QBFA 5CNKA 1NT4A 1XLUA 3F49S 3NALA 3FOFC 2O7SA 1ZWLA 5BYBA 1QAQA 3NRCA 4ZVPA 4BQFA 1Z47A 2DHCA 2O2DA 1XU4A 3FNRA 1JMKC 1Z0DA 2CYBA 3KUDA 3LA8A 3JAWB 4J7AA 3CX6A 3HU3A 1IM2A 4X85A 4RF2A 5DBFA 2GETA 1U7PA 1SZDA 1TZJA 3AVTA 2ZPTX 3FHCB 3L0ZA 4EW2A 1A9QA 2JH9A 3PQ6A 4N9QA 4MS1B 3NHKA 2HNAA 2OGUA 1J5XA 2A5YB 2XCUA 1JZSA 4A9AA 1O77A 5JC1A 4II3A 4GS5A 4KQ2A 3H97A 1HLPA 1T8SA 4H4DA 2GCOA 3WGZA 4C7VA 3RF6A 2R68A 4XEHA 2JFHA 4YR9A 3PE3A 1RYEA 3OOWA 5C51B 1ZFNA 4J0IA 1A9OA 1KGDA 4P93A 1PKXA 2X23A 1XDUA 2C9YA 2OFWA 2CEKA 1LXCA 2I6GA 6YASA 2PJRA 4V0RA 1E6UA 5JISA 4DV4B 1RAGA 1VMDA 1A7JA 3PWTA 4M86A 3G1WA 3KVOA 1EWYA 2GXUA 3A1EA 4B6QA 2YA6A 1QF9A 2AGVA 4TSFA 4OKNA 5L95A 2CWDA 4UAUA 1TFUA 3EZLA 4QYMA 3A4YA 2H92A 1CT9A 3H16A 4X65B 4BTVA 1ZJWA 1VG0B 4OP1A 2I99A 2OESA 1C0LA 1VSQA 2ODTX 2XA9A 1MOZA 3G2LA 5FWAA 4DTCA 4GU5A 3A36A 2BGIA 1OR8A 3N28A 2JJ1A 4BNYA 5D2CA 5FLXA 2OBBA 2Y1GA 2BEWA 3C6YA 1ORVA 4A0FA 3FTPA 4D41A 1LK5A 1M6VB 1SUCA 3I2KA 3NJRA 4LGMA 4MA4A 3SQWA 2PKEA 3FUXA 4EYKA 3UWDA 2ZTMA 2ORYA 4OBWA 5M1ZA 1DTEA 1LFAA 3QKSB 5KYXB 3P26A 4JUCA 5TPZA 3FM9A 4C3VA 4ZAWA 2WIDA 3HL0A 4ZCTA 4NX2A 5KWJA 4OB7A 1U2EA 3O8CA 4H16A 5EIWA 4F7DA 2QUJA 3JTMA 2PSDA 4TVBA 4ETMA 3DL4A 3E23A 4P84A 4PO1A 3MJFA 2HEIA 1B8VA 1YS2X 2R84A 3IP9A 5ALQA 1VCOA 1OBFO 3VR5D 1QK4A 2REBA 1XN4A 1PJLA 3L7MA 4LA4A 3CE6A 1H9AA 4PZEA 4KP7A 4XB2A 4GI5A 1S8NA 2HM7A 1QH8B 3ZK9A 1U8ZA 3HO8A 3MUEA 5D1HA 3GARA 1II0A 5G3ZA 3ZZTA 3QBEA 4W5QA 1GRVA 1H65A 3ND8A 3VKFA 2C7QA 4RV9A 4M83A 3RTDA 3I5MA 1BXRB 3DZFA 4CU2A 2ZUWA 2ILVA 4BASA 3PR1A 3SJZA 3DAPA 1LF5A 2A9RA 1IXKA 3L41A 4K2HA 3UCEA 2C3UA 2VSMA 3T3MB 3VR6D 4FUTA 4POAA 3ZGYA 5TY0A 1IZYA 1PW7A 1C1DA 5HW0A 3FVRA 4L07A 3HP4A 3OKCA 4HSEA 4TWAA 2GN0A 4UBJA 4UUAA 5IYZB 2C2ZA 1WU7A 2HWXA 2BTEA 3TI8A 3GELA 2CVOA 4GW3A 3WMEA 4D8YA 4QFCA 4DV1B 1X2EA 2XAAA 4KPGA 4ZV4A 5DLYA 4YRBA 3T94A 2NMVA 1PQYA 1SQSA 4A8TA 1MS4A 1FQKA 1ZGBA 2GO7A 3Q87B 2B2CA 4KMMA 2GPSA 3WIUA 1RIIA 2CZGA 3NBZC 4JB2A 4RTJA 3ZD6A 1E8UA 4J6EA 4JCOA 3FFWA 4WDRA 5CDFA 2C1XA 3W2HA 2OOSA 1I51A 2OAP1 2UYYA 4KLNA 3BKWA 4Z0TA 3SANA 1D2GA 3CNNA 3DWGA 2R9VA 3NPAA 2UUOA 4PAOA 1QH0A 4FONA 3Q1LA 3WWAA 4M1OA 5EP4A 4Z49A 3S1LA 2G70A 3DFUA 2J1LA 4MLDA 4OHRA 3FDJA 4WLVA 3WLIA 4CKBB 1F7VA 1VKNA 4A2QA 4EKNB 2RKWA 3ABOB 1XZHA 4Y2RA 1SA0A 1E0SA 1QHNA 2FNAA 1QHSA 2H1IA 3GMTA 4R1MA 3TFWA 1Z7GA 1NQWA 1K8RA 1PLLA 2NUAA 1EBFA 3I23A 2O1WA 1R0SA 4DQUA 3WIDA 1UCFA 3ENWA 2VCEA 2BONA 2ZB4A 4O8CA 1XQXA 3LYUA 5CVVA 3KR1A 1N1MA 3QUSA 5DLEA 5J9FA 3ZZ1A 3G6WA 4ERXA 4UBNA 1U3CA 1SCNE 4WKCA 4X66B 2QQ5A 5JAIA 3VKUA 3AY6A 3KPJA 2Q9CA 5CVUA 5I8PA 2OCKA 3U7RA 3K5PA 3HM9A 1R74A 1VHDA 3EIUA 3ZCQA 2PLAA 1NJ1A 5FRDA 5H0IA 3H17A 1Z50A 1SC3A 4FOPA 4NE9A 4I4TF 3S44A 1VJDA 2QA5A 2OENG 5BOSB 1GPAA 1RWNA 3AEQA 3T7EA 4BJ5A 1E3WB 1TTTA 2ZIXA 4X63A 1DAEA 4BJ1A 1PWXA 3HPQA 3SQXA 1L5ZA 3IILA 5DLDA 1ILWA 1M6HA 2NADA 1UXJA 4LRWA 1SC1A 1ZM2A 1EJ0A 2HY7A 3DKPA 1ZA1A 4L15A 1BCRB 2WU3A 4RD3A 4ESOA 2B9VA 5BVHB 4WERA 5IF9A 5KINB 5E6UA 3BMOA 3FJ1A 3HN2A 4A92A 2ZJFA 3L7IA 3STHA 4E88A 5HM8A 1T4MA 4D44A 2ZI9A 1MXHA 5D6NA 5ALLA 2QUZA 4GE0A 2GF9A 1E7WA 3QEMB 1T3LA 1D2NA 1Y0BA 4WCFB 2I7TA 3CB4A 1E1CA 3FTEA 1GYPA 3GJ7A 1UP6A 4ODIA 2GZSA 4Z8YA 3TKYA 3ZGLA 1J23A 2OZPA 4EIWA 3FF4A 1AN9A 4JCCA 4WVFA 4R8VA 4UDNA 5L3VA 1Z88A 4XOGA 3GF4A 1B6TA 5K99A 1ONNA 3F6EX 4XIIA 1WR8A 3SJAA 2NPOA 3VU3A 4PAMA 1RAHA 3QPVA 4JR0A 2OCLA 5KQRA 5GX2A 4AUKA 3DBOB 3K1AB 3GCXA 2C54A 1GNTA 1TOAA 3QPBA 4A3SA 4Q82A 4ZC1A 5JD4A 4CXMA 4PYOA 2QDKA 1EK0A 3HU2A 3NIGB 1OBVA 4JVSB 1V3VA 3HJHA 5F73A 1V0EA 1U9JA 3PCRB 4A8HA 5BYAA 1B74A 1M8PA 3DV2A 4JBIA 4F45A 3C15C 5DISB 2IYZA 1ITZA 1GPMA 1U8FO 2IU3A 1VP3A 2V5VA 3KCNA 5CEEA 2H4FA 3HXQA 2I7CA 4AT1A 1OFIA 1VTKA 4L16A 4CNBA 1JX6A 1Y7HA 5IEJA 2XY4A 3HVKA 1Z5GA 3IUBA 2XV1A 4EX7A 1H42A 1KO7A 3E1GA 4YAIA 3LXUX 1O5OA 1U1GA 1EK6A 1CDDA 1H69A 1EH5A 3A58B 1T3ZA 4QU5A 3SFTA 3EYWA 4AUEA 1PT8A 3PL1A 1QDUA 3LCRA 1QCDA 3HA2A 2Q1UA 3PA6A 5CH3A 4EUHA 4TROA 5F23A 1ES9A 1MS0A 3HA5A 5LLSA 3WLKX 5IT5A 1TIPA 2D3TA 1CETA 1OWNA 1RRPA 3G17A 3NUZA 4RKYA 3RS8A 3I8XA 3UXMA 3WQHA 4JJZA 1DJNA 1QGYA 1N2GA 1R8XA 2O5RA 2RGCA 4D57A 2WIBA 3IAS1 3IUMA 3RHTA 2OCPA 4O4HF 3AL2A 1W59A 4FWIB 1ZHHA 2PRZA 1G0OA 3AY3A 3U1VA 4LQDA 1I5RA 2BVNA 3B1ZA 2BMVA 1E5TA 3MHPA 4XFJA 3FDIA 4FZ3A 5KKNB 3ZBUA 2PMFA 3RSZA 1A3CA 3A9SA 3BD9A 3OVMA 2GERA 2YKGA 4ZI7A 1YL5A 2GZ1A 3RHZA 2IUSA 3GAAA 2FE4A 3E1SA 1EGHA 4TLBA 5A1TA 5ECWA 1PX2A 1OWOA 2KS6A 3ZGOA 2Q4RA 1UUFA 4Y1RB 1CY8A 4AW9A 3RGWS 1W36C 1HEIA 4JOBA 4LRXA 1M1YE 3QVOA 4KMOA 4JI7B 4F3YA 1ML4A 2B20A 2PMWB 5IAJA 4BS9A 1QHGA 4RM3A 2R8YA 5K0LA 3R9KA 5GX5A 3EMBA 5JQGF 1QXSA 2B94A 1YZQA 2ZJ3A 3PQ8A 4CL3A 3KB8A 2JCYA 2N9UA 1KYIA 4RVSA 3NN9A 4MS3A 3UOAB 1IDN1 2FVYA 1C8LA 2I2FA 4LX0A 5BQ3A 1B9VA 4UHHA 4G09A 5CDYA 4LY0A 5DZSA 2GAIA 5CW2A 1TMGE 4AZWA 2XE4A 4OUDB 3GIWA 4QJIA 1DU4A 2HSJA 2ODBA 4AICA 1Y3HA 5AUOB 5BV7A 4K6GA 4DWOA 2HYIC 3BMCB 3VTAA 4CMIA 1G20E 1C1XA 2L19A 1CY2A 1KFCB 4OLHA 3I61A 3JQAB 5I45A 2GZ2A 3LKDA 4IIJF 4PGGA 2ISQA 3PPVA 4WXEA 3JALA 3CN7A 1BYUA 3DVSX 4WVLA 1XK7A 4JJ7A 3K7EA 4FPYA 2HUNA 1E32A 3KLMX 4OHKA 3WTBA 4EGJA 4F84A 1O97D 4LDJA 5FBZA 4OQZA 4RTRA 2H08A 3H9UA 2HRCA 3DKIA 1L8AA 1IN5A 1R16A 3C6MA 3UGQA 4DMHA 4DXAA 3BJIC 3MOSA 3P9SA 2F3TA 1XQVA 3W5CA 3S2IA 2GD1O 4IKEA 3LH5A 2X9QA 4B3CA 1KI1A 1WF3A 2CMFA 4BP9A 3PFIA 1IBRA 3UK7A 3G2MA 1OLUA 1VHLA 1SXIA 1XCPA 2A5LA 2RHRA 1X3SA 5DASA 3L3BA 5CHEA 2PMCA 1FDTA 3AC0A 3F2IA 5KWVA 2C1ZA 2C4TA 1VRVA 1M74A 5EEGA 5AJXA 3HI4A 3BXGA 3OQHA 1SBTA 3BQMB 4JR2A 1QVAA 3PEEA 3IPRA 3R7SA 4EB3A 4PNEA 3TD6A 1EUTA 1E4YA 2D5CA 3CO0S 4C0BA 3R5FA 4Q7MB 5EE5B 1LX7A 2ORVA 2NSHA 2R97A 5GV7A 2OFFA 1ZXXA 2P2SA 4HNGA 3RT7A 5KQMA 4LMPA 1PWYE 1AD2A 4LECA 4WAUA 3CRMA 521PA 3RC7A 3KJEA 4AZ3A 2AFIB 1FFWA 3S8YA 3OFSA 3ITKA 1RM5A 4FVTA 4ZPXA 4EJ2A 3TNYA 5IZ4A 3FPCA 3MT9A 4DSUA 9LDTA 1ZKMA 3COSA 3V1MA 5AHKA 3VOBA 3B9BA 2IPLA 1V9SA 1AKQA 2DY1A 5C7OO 3KIPA 4NONA 5EMNA 3ROQA 4MO9A 2JJ2A 4U6SA 1EG7A 1QH1B 1EZ4A 1T6ZA 3WMGA 4BEBA 1NNUA 1F14A 4F8YA 1TLTA 5LZ5A 1O95D 4GAEA 1NLFA 2O3UA 1UKBA 2C2KA 3H84A 3KAPA 4LC1A 2ZAGA 1GSAA 1R5JA 1ZM4A 5HUNA 2IQ5A 1ZXBA 2XT0A 4F5EA 4EPXA 3T0GA 4WOJA 2CL6X 3WI7A 5KQPA 3SGLA 1PT9A 2PWBA 1E6MA 3A6FA 2CXXA 1XMXA 4URZR 1XVUA 3MPUA 3FUCA 3VDXA 1DJOA 4MWJA 5CEFA 3FDZB 1VDZA 1D1SA 1OPRA 3GQBB 4L6AA 4DLTA 1OWMA 3CSDA 3FRJA 5K0SA 1TFRA 4I1YA 4IDFA 4DUZB 4C3OB 2QD5A 2QLTA 4QEKA 4UMDA 5KYWA 3KGGA 4FGSA 4J0GA 2QZPA 4MDYA 5FLYA 2V7VA 2J48A 4LSMA 3NEJA 8ABPA 4NQZA 4RSGA 1LQUA 4KRGA 4MNTA 4RF3A 4CLXA 3LPCA 4YV2A 4FD3A 2N0SA 4ZRMA 4FZ5A 3D8SA 3P52A 4KXXA 3WE7A 4A0SA 5LMNB 2FI1A 5J5AA 1QZUA 4TL7A 4YXFA 3OKPA 2XTZA 2XVMA 3KOZA 4FNOA 4P2GA 1FW8A 1E6CA 1Q1ZA 3AGPA 4OGLA 2V0CA 3E4CA 3FLAA 3PUKA 2XYGA 1L4MA 3LX4A 3VNRA 2JFGA 3GT7A 3NWPA 2PSEA 4ZODA 4MR8B 1YV9A 4KOEC 3ZXIA 1E3DA 5FBRB 4HRAA 4I3FA 2AG8A 5HIKA 3L1IA 3PR3A 3HE3A 2DFNA 1TF2A 3QYFA 5AXDA 1R9NA 2GD6A 4KI0A 2HK8A 3HBLA 3HVIA 3FYSA 4G3NA 4C3ZA 4IGEA 1SKYE 4A10A 2VH1A 2DH6A 4FYVA 2EU8A 3D4BA 4X41A 3ZDBA 1QGUA 4J3JA 4AZ0B 2XPCA 2OMKA 1BEEA 1IQRA 2RG1A 4CM4A 1IVCA 1KI6A 2FE1A 1KRXA 2LIPA 4BX3A 4E70A 3WP0A 4KDFA 2AFRA 1MS5A 3UHAA 1DQZA 4HZZA 4EMSA 4I55A 4CEHA 2BI8A 1IUKA 3LQFA 3M4NA 3GRAA 4CCWA 2V4MA 1FDWA 3NDRA 3C7AA 2B0JA 4IZIA 4BB5A 2IHYA 4NZPA 5FOSA 1R0BA 1U4OA 5DCWA 4DTIA 1CUYA 5JFGA 4UDOA 1VCUA 4FQ4A 5TQ0A 1FQOA 1XMJA 3EQ6A 1C9JA 1UZLA 4BFLA 4IWXA 4KPEC 3E03A 2PLNA 2DR2A 1KAQA 2QE7D 4U7JA 5A0TA 5JVDF 3V97A 1PD1A 2I1LA 1JQAA 2R6DA 2RH5A 4XSHA 3VR3A 1SFRA 5HBRA 3IV6A 3NOXA 3D9QX 3EOAI 1P44A 3CT4A 1OTXA 3HFGA 1MDBA 4WOPA 3ZHOA 1HX7A 3UCXA 4GMGA 3G0HA 5KJEA 4CM8A 1SVUA 3KPWA 3MTIA 2GRUA 2W4QA 2PO7A 5DW3A 3DO8A 3RYHB 3THSA 3TNJA 3VOSA 4IYJA 4RAOA 3TCXB 3U3XA 2YHBA 1T1IA 4NCIA 4RQAA 4RTLA 1GTZA 3DHYA 4GZWA 4JBWA 5E2BA 1U99A 3Q3VA 4E5MA 4J43A 1R8YA 2GWHA 4TWBA 2NZWA 3IQXA 4IV5A 4P5PA 1CP3A 3JQ8A 3DYBA 3R4VA 4K81B 1UZNA 4KS5A 1QK3A 2PXAA 4XA8A 2QXYA 3V7YA 1G38A 4JBYA 5DHPA 3H5VA 3OF5A 1KQ3A 1Y8AA 4HZVA 4IGKA 2MYNA 3OO1A 3OZWA 3CJQA 2CLSA 5IJ0A 3GEDA 3C6BA 1MS8A 3CKZA 4NNOA 3F71A 3EFOB 3NYIA 1KYTA 4I4NA 1PJAA 4NMWA 1IBSA 3RODA 3W5BA 1Y3DE 2J33A 4XJVA 3TQTA 4C07A 3C1UA 4P32A 5T4FA 5HX7A 3L8DA 1PQWA 5D00A 3HYSA 1M1YB 5LKRA 1WOMA 5TARA 1WAMA 3HJNA 5EPEA 2X0KA 4EQZA 4LY6A 5H70A 3MRXA 1CTQA 2QV7A 1Z4JA 1XXLA 1OHHA 4LJYA 3TM4A 3U1TA 5LD2B 2X5XA 1C0EA 3I2IA 5D9CA 1DJPA 2C1EA 3HRHA 1OI3A 1Q0TA 4LGVA 4RDIA 2BBOA 1DFIA 1ZJJA 1G5FA 3H5LA 5HQTA 3UV6A 5GTQA 1OIVA 1WWKA 1G20B 3ICEA 4XJZA 4OREX 1RKVA 1HRKA 1UFRA 1G21A 2FQXA 2WA2A 2LDBA 4INJA 4LNUA 3EXFA 2FWMX 4P53A 1ESDA 3C5CA 2OGSA 2WLTA 2W6JA 1QMGA 3THOA 3STYA 3ZX5A 1OXKB 2IYEA 1EDZA 1U7ZA 1PJXA 1N6KA 3DMNA 2NU8A 2ES4A 1D6MA 1ZS9A 1G2OA 2FMHA 1BMDA 2JIBA 4MKZA 1M7HA 1YZ3A 4UM8B 4KFTA 4AJPA 4I5DA 3O1HB 4TYQA 4RAQA 2DUJA 5AO9A 2AOUA 1O6FA 5FPTA 1NW8A 1P4RA 3EA0A 4MVJI 1F4LA 3UEOA 5I8WA 1Y8QA 3QVSA 2AJBA 4EDFA 2GB4A 3VYRB 4AO8A 1J99A 2YOFA 5ALJA 4ITRC 2I55A 3BYCA 4MJUA 1II9A 3GFFA 4CGZA 2JCXA 4M7RA 1L5GB 4FGJA 4OHXA 4D4GA 5EIBD 2Q7DA 3NBKA 4Z7QB 1AV7A 3MIIA 1OXXK 3E5NA 4UVIA 4NH0A 4RVOA 5B1DA 3Q8KA 1F4VA 4DJEC 1SBCA 2X76A 4N40A 4G8DA 1M7BA 1J9ZA 1WHTA 3SVLA 5L4SA 1Z16A 5G53C 3TTVA 4FLFA 4Y3UA 4RMJA 2R6FA 2P27A 2MSCB 1Z36A 3Q6KA 3EXG1 4W99A 3UC9A 4EFDA 2UUAB 1KMQA 4RE6A 3GAFA 3WLFA 4KQWA 4BX9A 4LJAA 4TV9A 3MMSA 5C4IA 4CEIB 2G1KA 3T1EA 4BNZA 3PHBE 1J1IA 1YS6A 3F6SA 3IEVA 3DHNA 4KN9S 1J90A 2VNKA 3G2OA 5L7TA 4C4XA 3ZWNA 1SXJB 3ZE8A 5FYQA 4GKBA 2RK3A 1CRQA 1X6VA 3WYNA 3PHJA 4CMCA 4X47A 2QTWB 3GMDA 1EDDA 1KFBB 2NPIA 4C14A 5KTYA 3L8YA 3W5IA 4I8DA 2Z3ZA 4GD3Q 3KQKA 3DC7A 3QELB 4DM4A 1AY0A 1TJNA 5FL3A 2FUEA 1NPDA 2Z4SA 2JKZA 1KY2A 1DIHA 2GH1A 2H1FA 2WRZA 3GEPA 3PG5A 1SC9A 3EXG2 3PDIB 4IDDA 2CFOA 3W2TA 1L1RA 2WWVD 1E7MA 1E62A 3PJDA 1EFCA 2ZYTX 4QPPA 4DSZA 7GPBA 4XRRA 3ANNA 4N7MA 4AYXA 2FZCA 3TSCA 4IYGA 4RTSA 2GWRA 2ZR9A 3RM3A 4WLNA 5GJWC 4HVCA 5JLAA 2ZRCA 2VPXA 3VPCA 3E81A 3JASB 3OZTA 5TIIA 3W3AA 3JV7A 4YRZA 1KERA 1OTYA 1PFWA 4GOKA 6LDHA 1FUYB 1RAIA 4XD2A 3V8BA 1AZTA 4CLOB 1P0MA 2XE7A 4WL0A 4DEXA 3TLBA 2Q07A 1JSZA 3I9FA 2IYVA 4G9BA 2HEGA 4FXOA 4FPEA 4RA6A 4YUZA 4IQKA 4AY4A 1UMCB 3EZ7A 5C8YA 5JASA 4NFSA 5FDFA 3JQEA 3ANSA 5H59A 2BR5A 1ZNWA 1N3IA 1E5DA 2I4MA 4I1IA 3COVA 4HUQA 1LA2A 1PZXA 4H1WA 1F8DA 3DR3A 1E94E 2NNLD 4W9MC 1LBTA 3OT1B 1OXBB 2CCJA 4MLPA 3B20A 4HTFA 4JL8A 4I8XA 3V5NA 4DARA 1MKYA 2JIQA 1KQNA 3ADPA 2G08A 2J4CA 4B4UA 4O2BB 1L5SA 3RC2A 5ITWA 4EVRA 1BVHA 1JZTA 1KZ4A 1VYUA 2O06A 3M4JA 4FBGA 3WOVA 4CQLB 3GEBA 2NV6A 3CCBA 3EHDA 3OLYA 3WZ2A 1T0HB 5LMZA 3TW0A 1Z0FA 4K87A 1AF7A 1RJDA 4DBLE 4P80A 2HSEA 3QLJA 5JARA 3GRVA 4NS1A 4XLLA 2RB5A 3NASA 4F2GA 5IP5A 2E89A 5CCDA 1HE5A 4D8TA 1QOZA 3TLYA 5I7AA 2ZW9A 2VOJA 1TC2A 1NUUA 2AF4C 1AG9A 2F12A 3I37X 1IE3A 4JY7A 5K6AC 1POWA 3OJXA 2M98A 3KHKA 4NOMA 4WJKB 3UW3A 2H16A 4C5CA 3C3AA 4MDHA 5DBGA 4D82A 5JAOA 4UZEA 3QKUA 1L7VC 2ZRBA 3LLUA 4P08A 4JQOA 4ZEWA 5L7WA 1Z0SA 1N2CA 1U0TA 5JNRA 2ODPA 2LGJA 2PRJA 3QTBA 3ADDA 3FVWA 1DDOA 4Y9RA 1IYZA 1MQ9A 1E1YA 5IM5A 3U7GA 2GCPA 2VF2A 1LSSA 1W0CA 3COPA 3H1EA 2WWWA 1SCBA 1XZMA 1P1JA 3KVVA 4YJ2A 1XMVA 2EJBA 1I3NA 2WHPA 4PR3A 4FU0A 1NL3A 4BX8A 4G0UA 3AEKA 1CRZA 1SIBE 4MUIA 1GNRA 1GV0A 4LHSA 4UXJA 3TOZA 1XRSB 1RRKA 2VNIA 4KYUA 1DPFA 3RJMA 1D3AA 3V1NA 3WYEA 4RJTA 3H73A 2F8MA 3BMXA 1FTNA 3P9YA 2CLMB 4XUGB 5DSXA 1X3LA 2QRVB 3PDHA 3RVNA 3YASA 1ZN7A 1W0JD 4YMWA 1A8QA 3HU1A 4AS2A 5ISMA 5A2QA 3KTDA 1YR6A 16PKA 4WX2B 1GM5A 3HKDA 3I64A 1KYWA 3ET4A 2BP7B 3UJDA 1CQXA 1SVKA 1US8B 5JALA 1ODJA 4UFOA 4B6FA 3NBXX 3K4PA 3FNGA 2GR9A 2HA7A 1EK1A 4RS4A 4P31A 1L6IA 1C2YA 4WZAA 5EZQA 1FNNA 1ULZA 1KITA 1C0IA 1D7OA 3BL6A 3TGLA 3EE6A 4OGKA 3X44A 1N3YA 4IQ8A 5K6AA 1NBMA 3AHHA 2GVDC 2R7LA 4D2IA 2AR0A 3FVQA 4QUGA 4DCPA 1FMCA 3UC1A 1PFQA 4AG6A 4AUMA 2D74A 2Q41A 3EEIA 3IR6A 3QOYA 5WRFA 5AVYA 4R5HA 2XVYA 1DEXA 3SOPA 3A1FA 2XT6A 5DHUA 2PSJA 3QX8A 1CUDA 3RARA 4PZZA 1Q3KA 3I2HA 3DKVA 3DOEA 4W6ZA 4MKHA 1OBHA 1X1EA 2ZWPA 1JS1X 1NX6A 1QV9A 1ZITA 3BMNB 3ZZMA 1FJXA 1TW3A 3C7DB 3NOVA 1IVYA 3WIOA 3B6ZA 1DIBA 3UJ3X 3HU5A 3OFND 5DRYA 1XL0A 3W3ZB 1DINA 5ECDA 3UCFA 1T5BA 3KQMA 4B8YA 3EIXA 4ZYLA 4C6SA 2XD9A 4TV8F 4RK5A 2VPJA 4PSKA 4JYBA 4DMCA 5JRZA 3D11A 4M1WA 3R8CA 2J5BA 5I7VA 3U44A 2GYUA 4KPYA 1A50B 1JP7A 2ZIEA 1CUWA 3G59A 3BTVA 3OIWA 2CNBA 4E4YA 5JROA 2X8BA 5ADVA 2XCQA 2CJPA 3E9QA 1QPZA 3W1EA 1CZKA 1PSZA 1U7DA 2CKDA 2FPUA 1T4BA 4R2LA 5REQB 5GV8A 2PZEA 2PBRA 3WK9A 1A5BB 2WU1A 3HJUA 1N9GB 4YZ2A 5DN6D 5BN4B 2IYOA 5KNDA 2Q99A 3RH0A 2W0SA 4Y2JA 1E1LA 2XI4A 4BCBA 4QG7A 2I3AA 4RHXA 1NBEA 1V3EA 3U0BA 2CUKA 4ZYXA 3GJ6A 5C35A 4QPNA 1UOPA 1MCZA 4MWOA 4QHSA 1M34E 3UMFA 1BVYF 2ERCA 2YFHA 3IAHA 4R6WA 4UAGA 1CY6A 3I2FA 2FP9A 3A9CA 3I6ZA 5KYUA 2FPIB 1GSIA 2H18A 4MDFA 4KYTA 4R31A 3G7UA 2ZYDA 3PXBA 1XKLA 3QH4A 4L0DA 4JJIA 4QGHA 1U1FA 4Q5IA 3G89A 4Q9JA 2HIHA 3DMRA 2CNNA 3AR5A 1YB7A 4EPTA 3WN7A 1BXGA 4TOIA 3KPYA 4DA9A 4ZMBA 2ZWOA 3I53A 1L1QA 2XNKA 1OV4A 1YA8A 1P1IA 2V0NA 2IL1A 3GCGA 2DFKB 3JZAA 4O6VA 3IXLA 3MN1A 3QWFA 2PFGA 5L3ZA 3NWOA 4EKYA 1VMIA 1W6RA 2VN8A 3M6UA 5KSPA 4GKJB 3BGWA 1YJBA 3OQJA 4YRGA 1AUQA 4KN6A 2X8LA 3GD5A 5G0TA 4XYBA 4ZVVA 3MTGA 3THRA 2OUIA 4HWGA 1QAOA 1S8FA 4P34A 5L3QA 3NR2A 2GJ9A 3QXGA 1N7IA 4ZZ2A 3H8WA 4ZJYA 5UKDA 1K8YB 5A3QA 1APBA 3TZCA 1NI3A 1E5VA 2RG7A 3WWPA 5AKKA 3CF6R 2Z1MA 4YP1A 5KAMA 4DB2A 3DOCA 4Y6SA 4HSGA 3AI7A 2II6A 4Q4DA 2X3YA 3KAQA 4WKBA 1IEXA 1AA9A 2J9RA 3RLIA 5KYVA 4L7VA 3OZGA 4PO9A 3T95A 4DAOA 4RKFA 5AVXA 4KR0A 4P4TA 4DRXA 2FOXA 1PJ2A 1SK8A 2DWUA 1X14A 2L2QA 3K0FA 3E7PA 3CKMA 2GXAA 1NULA 2XDYA 3PNSA 2VJDA 2QLLA 2EZ8A 4R41A 1X1TA 5F7ZA 3UUEA 5EMKA 2C9OA 3HDYA 1EWKA 1KK2A 1E3QA 4YX9A 3U2QA 4IEFB 1SU8A 4MGEA 4TYNA 1FEZA 4D9IA 2PVSA 3WIVA 4HYQA 2WI8A 3FCCA 4TMKA 1HYHA 2GCIA 2I5PO 3AP2A 1QGAA 3T3DA 1E3LA 2FW1A 4YW1A 3CJRA 3H1GA 1B0ZA 1ONPA 1JI0A 2J6BA 2G07A 2V7BA 3VZQA 4YXWD 4N3CA 5IKXA 4BNIA 4BNDB 1UJBA 2BHSA 4OV6B 1A97A 1FU8A 1PI3A 3E8SA 5LWQA 1UADA 4GC5A 4KR6A 4A0QA 2X8WA 4AG5A 3OCXA 3U3KA 1CUSA 1U2PA 4OL9A 3AUTA 5D86A 1EDEA 4DJFC 3OCYA 2FWPA 2P9FA 3L7YA 1GGEA 3LXXA 4WACA 3D6FA 5DYWA 5A3SA 1W35A 2NUTB 2HBZA 4MX0A 4DCSA 4F0JA 5K3FB 1BGVA 1SIUA 3WKCA 5LZ4A 4XWOA 3BFJA 4G1MB 4XDGA 4BPBA 4C0JA 2JIDA 1BCSA 3TLMA 5JAUA 1BE1A 1K6EA 1XJCA 3GEEA 2DG0A 2XKKA 1D8TA 4ZJUA 4KDCA 1BW9B 1V7PC 3EBLA 4H2DA 3UW1A 4MUEA 4N0EA 5HFJA 8ATCA 4XM2A 4NBWA 3WLTA 1B73A 4OM8A 2GHSA 1WCSA 4S05A 5TVKA 3ABZA 4FE3A 1SKQA 2L18A 5DM2A 1BKSB 1INXA 4NEGA 4E30A 3B52X 1I3KA 4QJ3A 3BRWD 2V8OA 2QAIA 6NULA 2O4CA 3RVBA 3CPSA 1DGQA 3R20A 4F92B 2CE7A 2V55B 2O57A 1SEPA 4B6RA 3I1CA 4DPKA 4WBNB 4DDVA 3AP1A 1P0FA 4GPBA 4IHKA 1N2HA 2RBGA 3ILSA 3Q7SA 1RXIA 1Q92A 1ANKA 2Z09A 1B76A 5KNBD 5A3RA 3ELUA 3ILYA 1UJ4A 4IIGA 4KO4S 4U5XA 4DDMA 4MVJD 1SOAA 1AF4A 3HXPA 3P2OA 1K68A 3GLKA 2FRVA 5CJJA 1BDIA 1RDFA 2OECA 4HB0A 1BNCA 3HGTA 4OQFA 4MC7A 2G6BA 3B8EA 4O2AA 1I1QB 3ORHA 3FOBA 4FPCA 1Z0AA 1SCUB 2ZI5A 3H8SA 1V5WA 2P2CA 3C3YA 4KNVA 3K37A 4BXOB 3GK3A 1BFKA 4IN4A 1ADYA 3DHWC 4CWAA 3HY6A 3UJ8A 3OFVA 3WA6A 4M99A 1ESNA 1A9XB 2FDRA 2FPXA 3KTAB 4K6FA 3OEHA 1XPJA 4OOEA 1I33A 2MIIA 4Y6PA 3HO6A 4PNHA 5EMMA 5K6RA 3GT4A 2EDCA 4Q66C 1JI3A 3ALXA 3GQVA 2ZSHA 4C2TA 3AL0C 4EJSC 2IHUA 1UBJS 2B92A 2PRYA 2X4GA 3DVQX 1JN0A 3F2VA 2F10A 3HV0A 4GOND 4IDPA 5M04A 3QX7A 4DYVA 3QWBA 4C1BA 2IYYA 5EFZA 4DLLA 4EI7A 4QO8A 3Q6TA 4U9IS 4FJ0A 3R7LA 1RYZA 4PPFA 1MORA 1GAJA 3BVPA 4X90A 3VTFA 4IV0A 4M6WA 1LPAB 1U2DC 2O8NA 2O0JA 2WF5A 5DW0A 4EW6A 5JY1A 1PL7A 3CV3A 4BZZA 1NP3A 1SZJG 4F4IA 3LXMA 1P9LA 5IVPA 3D5QA 1MPXA 1M2FA 1A8PA 1NNEA 1KZHA 3LT4A 1QX4A 3PNBA 4GO1A 1YJCA 4MTLA 4TUYF 1R27A 5J58A 2P77A 5EIXA 3ABIA 2AHRA 5BT8A 4FQ5A 4XHXA 5BMVB 4FFSA 5I9BA 2BFBB 2MOKA 3OIFA 1NT2A 1E3MA 3OE5A 4NFLA 1KMIY 1Q91A 4ZP1A 3TQIA 1YB2A 2H6EA 3D7SA 4J7UA 4UVGA 3L92A 1GCAA 1HE4A 2X7HA 1PK7A 2YZ2A 4N5DA 1QDLB 2K7ZA 4Z86A 3H9QA 3OIYA 3TR5A 3ACCA 4YZ1A 4HLQB 5BVGA 3K9HA 3UUGA 1KDYA 1FMTA 1GZ7A 3N2NA 4I5IA 3I0NA 2V03A 3R09A 4XEUA 1Y7TA 2OEPA 2IAQA 3Q3HA 2CXOA 5C1PA 3E7WA 2JPDA 4FWBA 2FSFA 1IHYA 4OIMA 1OASA 4EJSA 2YINC 1ZN2A 2JANA 4N54A 1YH3A 3D5TA 3RU2A 2JASA 4REQB 3RABA 1USUA 3G88A 4MWBA 3GFSA 1EP9A 4FX2A 4Q3KA 4US1R 1ECFA 1LH0A 1INHA 5L3RA 3ECCA 2VAVA 2ZJBA 4FX5A 4EHLA 1ENZA 1S0UA 1RI1A 1S8OA 1U2DA 3QEKA 4X61A 2XXJA 4V1CA 4BTLA 1CLEA 3O1LA 2BPOA 1IWPB 1M34B 1Z2OX 2N42A 2Z83A 1ABEA 3QVLA 1ULUA 1T9BA 3RR2A 1RI3A 2XKBA 3ADOA 1WQ4A 3OLVA 2C92A 4Y6LA 4TKVA 2AE1A 4YW5A 3X1DA 4FTWA 3PEFA 4R2HA 4EUKA 2A58A 4QYWA 1I3CA 4YN3A 2Z3WA 5TSDA 2EWWA 4UEOA 4L8LA 2E5LB 1TM5E 3T1TA 1ZM9A 4X54A 5G0UA 4G5SA 4MIEA 4BLUA 2BGUA 2E4ZA 4Q1EA 3PUHA 3RUEA 3NKLA 3STTA 1I3LA 4MMXB 3RSFA 1VIVA 4OHOA 2QP3A 3FR8A 1ZIYA 1NCBN 4RZIA 2AI3A 4H35A 4AS1A 1BOOA 1P6UA 2IW3A 5HKKD 2EZUA 4AWBA 4BNXA 3UHJA 5JLJA 4NZZA 6Q21A 5AMXA 5HS6A 2GVNA 4BNKA 1SD1A 2HU5A 4M60A 1VCHA 1MS9A 1L0BA 5DVZA 1DUIA 1R88A 2BUAA 5H5JA 1V1JA 1Y3IA 4C7JA 4GC9A 1JJAA 1NMCA 5BW5A 1S2NA 1RWBA 3TL6A 4KIGA 1OXUA 1PDOA 1NN2A 4GNAA 3IIIA 5C53B 3IJEB 1SPXA 5TMPA 5CITA 1KF0A 3NT5A 1EQUA 2OZVA 2AK2A 3PLRA 4FCCA 4U3JB 3I5YA 3ZBQA 3OE7A 1WCWA 2F3RA 4RD4A 3N2LA 4BVLA 5DNUA 4NBRA 1IZ9A 1WB6A 3O9VA 4WRRA 5DGHA 2FTKE 1CXZA 4K1HA 4V0ME 2BKLA 1C3XA 4IO1A 1RC8A 1MOQA 1V3CA 2HQBA 5KYYA 3WYDA 1ZRSA 1KQFA 3GRKA 1V2HE 5HF5A 1JG7A 5DXFA 3A9TA 3U7HB 5J2UF 4QKQA 2HIGA 4ZQCB 1XRRA 1R0WA 3CR8A 4KXNA 1F2TA 3BGOS 1D6JA 5FADA 1QONA 1JLSA 1F8FA 2XUPA 4BQIA 2PUDA 2W98A 3SX0A 1DKQA 3JQCA 2FRDC 4YUWA 1ORHA 2I6QA 2TMYA 2XVXA 3A1CA 3AFNA 3H5OA 4JBXA 1IUBA 2ISMA 3M7IA 4LXTA 4BX2A 4ZVQA 2YMQA 4PQYA 4RJLA 2CDBA 3MNFA 4Z2YA 2R751 4KO8A 4ZAFA 4PLCA 1RHQA 1RQRA 2ZCUA 5AKHA 1YOVA 1ADCA 4R3UC 4ZO9A 2FUCA 5GZ1A 1Q7EA 1R4MB 2EKQA 3CG0A 1WZNA 2V7PA 2GVUA 1NPYA 5GX4A 4LJ9A 4RGBA 3VJMA 5KDOA 2W2LD 2XMSA 4GKAA 4X0EA 1L3IA 1JHOA 4JT4A 4QRHA 1JLLA 4NV1A 4ZEXA 2P35A 3M1LA 1YJ5A 2LVBA 4MGYR 4ALNA 1Y48E 2O7RA 4EJ6A 5A5DA 1BWQA 3N2IA 3RUAA 821PA 4YREA 4GPZA 3SM9A 2WAAA 5AVJA 2WWFA 5T4HA 5K45A 1JT9A 2IYFA 4XJRA 4MB2A 1GPJA 3SR3A 4QUIA 4V3CA 3ZI7A 1ZCBA 1F9AA 1KK3A 2JFYA 4H3VA 4M1MA 5HR5A 3MF4A 4LDNA 4EB0A 2FCAA 4L57A 3GAZA 4JLOA 3GZNA 4NNPA 3SSNA 3WQRA 2B61A 3F1LA 4YGYA 5DHRA 4I1PA 4JBNA 5DM60 2IOHA 3UT5B 1KDTA 4GZ5A 4NEQA 3ZDQA 4JLKA 4OJYA 4H6VA 3HMKA 4M4UA 4YV1A 2J6IA 2GTHA 5DTQA 2FRDA 2RH8A 2R5NA 3A3NA 2IU4A 3GZ4A 4EG8A 4IUYA 2DFTA 4HGPA 4XTRA 1Z4ZA 4B7JA 5LA6A 4EF5A 1C7FA 3QFFA 1XPUA 2DPYA 2XDQB 3MOIA 4M0EA 2EKLA 4IFIA 4O4LB 2PWAA 4XVHA 3U09A 1XVTA 2AXNA 1AQNA 4YLGA 3T7SA 3ZHTA 1J00A 1XKXA 4FC7A 1VCJA 5EQDA 2OCIA 4MW2A 4P0PB 2YXEA 3VM6A 1M73E 1VLHA 1AUVA 3R44A 4PIMA 2QTVB 4IHJF 4EQ6B 1UP7A 3NBMA 4ZVRA 1V2GA 4D8UA 3D7RA 1OQAA 2Y9MB 4KC0A 3TL3A 3FMVA 2VW0A 3DWEX 4BO4A 4UHEA