3G4EA

Crystal structure of human senescence marker protein-30(smp30)(calcium bound)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
297
structure length
297
Chain Sequence
SIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human senescence marker protein 30: insights linking structural, enzymatic, and physiological functions .
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Regucalcin
total genus 82
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.1.1.17: Gluconolactonase.
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08450 SGL SMP-30/Gluconolactonase/LRE-like region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3g4eA00
3FVZA 3LI4A 3SOVA 2IVZA 4IMBA 1CQ1A 3V64C 5GX1A 1RWIA 5EX7A 5GX3A 1POOA 3P5BL 2FP8A 1E1AA 2FP9A 1PJXA 3I1CA 4O5TA 5D9BA 4HHQA 3SOBB 3Q6KA 3LI5A 3KGGA 3KYAA 1Q7FA 3V65B 2GVWA 2IAXA 3S8ZA 3AMRA 2IAPA 2IATA 4GN7A 3V1SA 3A9GA 3HLIA 2G8SA 4HW6A 3IAXA 3U0SA 1H6LA 2IASA 3DR2A 4JMLA 4GNAA 3S8VA 1N7DA 1IJQA 1NPEA 4Q1UA 1QLGA 2GVXA 3SREA 4ZLRA 2QE8A 2DG1A 2DG0A 2IARA 4GN9A 1QBIA 2IAQA 1V04A 2IAWA 5GX5A 4GN8A 1CRZA 3Q6PA 3G4EA 1C9UA 4DG6A 2FPBA 2IAVA 2W8BA 3O4PA 1CVMA 2VAQA 2OJHA 3BYCA 4GNBA 4IYGA 2FPCA 3A9HA 3DASA 4A0PA 2P4OA 3SOQA 3AMSA 2DSOA 3S94A 2GVVA 5D9CA 1CRUA 5GX2A 3HRPA 4R40A 4O5SA 3FW0A 3WW9A 1RWLA 2V91A 5FWWA 5D9DA 4GNCA 3TC9A 4PWZA 4HHOA 3WWAA 2GVUA 1C5KA 2ISMA 3G4HA 2W8BB 3E5ZA 2IAUA 2GHSA 3LI3A 2POOA 3S2KA 3SRGA 2HQSA 5GTQA 3Q6TA 5GX4A 2IAOA 3HLHA
chains in the Genus database with same CATH superfamily
2HTQA 1L7GA 4FQ4A 2QWJA 4YZ5A 4K1KA 4X6KA 1W0OA 4SLIA 3T1EA 4NC5A 3SALA 3SLIA 4D8SA 1ZI0A 5GX3A 4FJ6A 3L6VA 2FP8A 4FZHA 3O9JA 1MR5A 5FNTA 4DGRA 5FNRA 4L7BA 3H71A 5HUKA 3INBA 2FHRA 1L7HA 3LI5A 1NN2A 3V65B 4K1HA 4KS2A 3TI4A 1INHA 4GN7A 3A9GA 4FOVA 2BERA 3IAXA 3W09A 2IASA 4FP3A 4GNAA 3S8VA 1N7DA 2HU4A 1NPEA 2HTRA 1INXA 2QE8A 1MS9A 3TIAA 2DG1A 4FOYA 4HIZA 1Z4YA 1A4GA 2IAQA 3K36A 4X4AA 1E8UA 1Z50A 5GX5A 2QWHA 4GN8A 1CRZA 1A4QA 1V3DA 3Q6PA 3TI3A 5JYYA 3G4EA 4DG6A 2VPJA 2VW1A 4M4NA 5CGJA 2XCYA 2VAQA 4KS4A 2W5NA 1NNAA 3VNGA 1X2RA 4GNBA 1N1VA 1DIMA 4IYGA 4XE9A 2FPCA 3A9HA 4I00A 1E8TA 3K37A 4H53A 1EUTA 4FP2A 2QWAA 2H2UA 2HU0A 5D9CA 4FPOB 1CRUA 5GX2A 1XOEA 1MS0A 4ZY3A 4YW1A 4UOUA 1EUSA 4H52A 2VK5A 5B2DA 1RWLA 2QWIA 3TC9A 4AH4A 1X2JA 4Q6KA 2F24A 2VW0A 1NCDN 2HTYA 3CL0A 4FPCA 3NO0A 1Z4ZA 2ISMA 4CPNA 3TI5A 4GZQA 2AEPA 2IAUA 2HQSA 4AGIA 1NMBN 4N1BA 1NSDA 3GVKA 3NSSA 1N1YA 1NNBA 3HLHA 4MWRA 4GB1A 2HT5A 4G3NA 4AHAA 1IVCA 1CQ1A 5EX7A 3K39A 3P5BL 4M4VA 1E1AA 2AGSA 4GZTA 1K32A 1Z4WA 4O5TA 1XOGA 7NN9A 4XIOA 1W0PA 5D9BA 3B69A 4XIKA 1W1XA 1EUUA 4WA4A 3UC1A 3CYEA 4FPYA 2CMLA 3TICA 2IATA 2HTVA 1N6FA 2F26A 3HLIA 2G8SA 4XJRA 1F8BA 3U0SA 2HTUA 4JMLA 1SLIA 4B7JA 1SUUA 4QN6A 1IJQA 1S1DA 2XZKA 2SILA 4XMIA 4XHBA 2H2NA 1ZGKA 3OPZA 2A75A 1NCCN 2W5OA 5FNQA 4YZ1A 1V04A 4MWJA 2XN4A 2QWDA 1USXA 3SANA 4FPFA 3ZGDA 4XHXA 3GVJA 1S18A 4MJUA 4WA3A 2QWEA 4WA5A 3O4PA 4KS3A 1INYA 2XZJA 4YW2A 4QN3A 1WP5A 4IN4A 1IVDA 2VSMA 4MWVA 1SLLA 2HT7A 5HUGA 2X9MA 3GVLA 2P4OA 4D52A 2F13A 3O9KA 1V3EA 1V0EA 4D52C 2ZB5A 1KITA 3S94A 4XJUA 4XYXA 4NCSA 1A14N 4HZXA 4CSDA 2XZIA 4M4UA 1Z4VA 1INWA 5FWWA 4GNCA 4B7RA 1DILA 4FOWA 4B7NA 3K38A 1V2IA 4FPGA 4FPJA 3G4HA 4MWYA 4QNPA 4XJQA 3E5ZA 4HZZA 4AGTA 1MWEA 4WEGA 2YDTA 2ZB6A 3Q6TA 1WCSA 4CHBA 3H72A 2DYHA 3FVZA 3LI4A 1F8DA 3ALXA 1U6DX 4IFJA 1NMCA 1INFA 4IMBA 2JKBA 4GDJA 3V64C 5GX1A 1RWIA 2HTWA 2QWKA 1WCQA 5H47A 1W20A 2FP9A 1PJXA 1IVFA 3I1CA 4MWXA 1S0IA 2VVZA 4XJ9A 1MS1A 2Z32A 4M3MA 4XMBA 5HUMA 3SOBB 4FPEA 4IFNX 4YW4A 3Q6KA 5NN9A 1E8VA 1MS5A 5F9TA 3KGGA 1F8EA 4XJZA 2BZDA 3S8ZA 1NCBN 2VW2A 3AMRA 4NN9A 4YY8A 3TIBA 2BF6A 4GZWA 5FZJA 4HW6A 4J9TA 2F29A 1F8CA 1H6LA 4QN7A 1IVEA 2ZZKA 4K3YA 1W8NA 1EURA 1Z4XA 4GEZA 4Q1UA 4IQKA 4GZXA 2YA5A 1NSBA 4ZLRA 4B7QA 4YW3A 2WOZA 2W38A 1L7FA 4XJWA 2F11A 2IAWA 1BJIA 4CPYA 3CL2A 4UF7A 1C9UA 2B8HA 4C1YB 4X49A 2FPBA 4MZEA 2IAVA 2W8BA 5HUNA 1CVMA 3JU4A 2F0ZA 2ZWAA 4MWUA 4BBWA 2VSKA 3BYCA 1N6DA 1INVA 5FNSA 4CPZA 3VNHA 4GZSA 4X47A 1V0FA 4MX0A 2QWBA 2SLIA 1IUCA 1USRA 1B9TA 1IVGA 3SOQA 4QN4A 4B7MA 3ZGCA 4QN5A 2C4LA 2GVVA 2AH2A 3A71A 4R40A 2QWGA 3K3AA 4D4UA 2QWFA 1OFZA 3SILA 3FW0A 3B7EA 2QWCA 2V91A 3ADEA 6NN9A 5D9DA 2YA4A 4K1IA 4HHOA 3BEQA 1NMAN 3WWAA 2GVUA 1C5KA 1SNTA 4FPHA 5HX0A 4HZVA 3LI3A 1N6EA 2POOA 4MZAA 5GX4A 4YW5A 2AEQA 2HT8A 3ALWA 3SOVA 4YZ2A 5EO8A 2RKCA 5EO7A 2IVZA 4L7CA 2YA8A 1NSCA 4CPOA 2C4AA 1POOA 4XMAA 4GDIA 4XOGA 2F28A 1N1SA 2VK7A 4FOQA 2W20A 1V3BA 5FZNA 3WDZA 4ZGCA 5B2CA 1NNCA 4GZPA 4XJAA 4HHQA 3WN7A 4MJVA 4D52B 4FPLA 4FPKA 4JF7A 1VCUA 3KYAA 1MS4A 1Q7FA 1S0JA 3H73A 4CH9A 2GVWA 2IAXA 3PJQA 4FVKA 5FNUA 4CPMA 2IAPA 5M1ZA 3V1SA 1NCAN 2BATA 2YA6A 5F72C 4MC7A 2ZW9A 1VCJA 3DR2A 4YZ3A 4XILA 2FLUX 4KS1A 1QLGA 2GVXA 3SREA 4CPLA 2DG0A 3NN9A 2IARA 3CKZA 4GN9A 1QBIA 1MS8A 2F27A 4XJ8A 4KS5A 4MWWA 2YA7A 2VK6A 2F12A 1INGA 1V3CA 4GZOA 4MWQA 2F10A 2F25A 1V0ZA 4MWLA 2OJHA 4HZWA 1B9SA 1IVBA 2SIMA 3DASA 4L7DA 4A0PA 1MZ6A 3H6JA 1SO7A 1N1TA 3II7A 1W21A 4K1JA 3AMSA 1MS3A 1B9VA 2DSOA 4C1YA 2YDPA 2VWDA 3A72A 3D11A 3HRPA 1W8OA 3TI8A 4GJTA 4O5SA 1IUBA 3WW9A 3TI6A 4WEFA 4PWZA 4IFLX 1MZ5A 4YZ4A 2W8BB 2GHSA 3S2KA 3SRGA 5GTQA 3D12A 4HZYA 2IAOA 4ASCA
chains in the Genus database with same CATH topology
3FVZA 3LI4A 3SOVA 2IVZA 4IMBA 1CQ1A 3V64C 5GX1A 1RWIA 5EX7A 5GX3A 1POOA 3P5BL 2FP8A 1E1AA 2FP9A 1PJXA 3I1CA 4O5TA 5D9BA 4HHQA 3SOBB 3Q6KA 3LI5A 3KGGA 3KYAA 1Q7FA 3V65B 2GVWA 2IAXA 3S8ZA 3AMRA 2IAPA 2IATA 4GN7A 3V1SA 3A9GA 3HLIA 2G8SA 4HW6A 3IAXA 3U0SA 1H6LA 2IASA 3DR2A 4JMLA 4GNAA 3S8VA 1N7DA 1IJQA 1NPEA 4Q1UA 1QLGA 2GVXA 3SREA 4ZLRA 2QE8A 2DG1A 2DG0A 2IARA 4GN9A 1QBIA 2IAQA 1V04A 2IAWA 5GX5A 4GN8A 1CRZA 3Q6PA 3G4EA 1C9UA 4DG6A 2FPBA 2IAVA 2W8BA 3O4PA 1CVMA 2VAQA 2OJHA 3BYCA 4GNBA 4IYGA 2FPCA 3A9HA 3DASA 4A0PA 2P4OA 3SOQA 3AMSA 2DSOA 3S94A 2GVVA 5D9CA 1CRUA 5GX2A 3HRPA 4R40A 4O5SA 3FW0A 3WW9A 1RWLA 2V91A 5FWWA 5D9DA 4GNCA 3TC9A 4PWZA 4HHOA 3WWAA 2GVUA 1C5KA 2ISMA 3G4HA 2W8BB 3E5ZA 2IAUA 2GHSA 3LI3A 2POOA 3S2KA 3SRGA 2HQSA 5GTQA 3Q6TA 5GX4A 2IAOA 3HLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVZ A;  3LI4 A;  3SOV A;  2IVZ A;  4IMB A;  1CQ1 A;  3V64 C;  5GX1 A;  1RWI A;  5EX7 A;  5GX3 A;  1POO A;  3P5B L;  2FP8 A;  1E1A A;  2FP9 A;  1PJX A;  3I1C A;  4O5T A;  5D9B A;  4HHQ A;  3SOB B;  3Q6K A;  3LI5 A;  3KGG A;  3KYA A;  1Q7F A;  3V65 B;  2GVW A;  2IAX A;  3S8Z A;  3AMR A;  2IAP A;  2IAT A;  4GN7 A;  3V1S A;  3A9G A;  3HLI A;  2G8S A;  4HW6 A;  3IAX A;  3U0S A;  1H6L A;  2IAS A;  3DR2 A;  4JML A;  4GNA A;  3S8V A;  1N7D A;  1IJQ A;  1NPE A;  4Q1U A;  1QLG A;  2GVX A;  3SRE A;  4ZLR A;  2QE8 A;  2DG1 A;  2DG0 A;  2IAR A;  4GN9 A;  1QBI A;  2IAQ A;  1V04 A;  2IAW A;  5GX5 A;  4GN8 A;  1CRZ A;  3Q6P A;  3G4E A;  1C9U A;  4DG6 A;  2FPB A;  2IAV A;  2W8B A;  3O4P A;  1CVM A;  2VAQ A;  2OJH A;  3BYC A;  4GNB A;  4IYG A;  2FPC A;  3A9H A;  3DAS A;  4A0P A;  2P4O A;  3SOQ A;  3AMS A;  2DSO A;  3S94 A;  2GVV A;  5D9C A;  1CRU A;  5GX2 A;  3HRP A;  4R40 A;  4O5S A;  3FW0 A;  3WW9 A;  1RWL A;  2V91 A;  5FWW A;  5D9D A;  4GNC A;  3TC9 A;  4PWZ A;  4HHO A;  3WWA A;  2GVU A;  1C5K A;  2ISM A;  3G4H A;  2W8B B;  3E5Z A;  2IAU A;  2GHS A;  3LI3 A;  2POO A;  3S2K A;  3SRG A;  2HQS A;  5GTQ A;  3Q6T A;  5GX4 A;  2IAO A;  3HLH A; 
#chains in the Genus database with same CATH topology
 2HTQ A;  1L7G A;  4FQ4 A;  2QWJ A;  4YZ5 A;  4K1K A;  4X6K A;  1W0O A;  4SLI A;  3T1E A;  4NC5 A;  3SAL A;  3SLI A;  4D8S A;  1ZI0 A;  5GX3 A;  4FJ6 A;  3L6V A;  2FP8 A;  4FZH A;  3O9J A;  1MR5 A;  5FNT A;  4DGR A;  5FNR A;  4L7B A;  3H71 A;  5HUK A;  3INB A;  2FHR A;  1L7H A;  3LI5 A;  1NN2 A;  3V65 B;  4K1H A;  4KS2 A;  3TI4 A;  1INH A;  4GN7 A;  3A9G A;  4FOV A;  2BER A;  3IAX A;  3W09 A;  2IAS A;  4FP3 A;  4GNA A;  3S8V A;  1N7D A;  2HU4 A;  1NPE A;  2HTR A;  1INX A;  2QE8 A;  1MS9 A;  3TIA A;  2DG1 A;  4FOY A;  4HIZ A;  1Z4Y A;  1A4G A;  2IAQ A;  3K36 A;  4X4A A;  1E8U A;  1Z50 A;  5GX5 A;  2QWH A;  4GN8 A;  1CRZ A;  1A4Q A;  1V3D A;  3Q6P A;  3TI3 A;  5JYY A;  3G4E A;  4DG6 A;  2VPJ A;  2VW1 A;  4M4N A;  5CGJ A;  2XCY A;  2VAQ A;  4KS4 A;  2W5N A;  1NNA A;  3VNG A;  1X2R A;  4GNB A;  1N1V A;  1DIM A;  4IYG A;  4XE9 A;  2FPC A;  3A9H A;  4I00 A;  1E8T A;  3K37 A;  4H53 A;  1EUT A;  4FP2 A;  2QWA A;  2H2U A;  2HU0 A;  5D9C A;  4FPO B;  1CRU A;  5GX2 A;  1XOE A;  1MS0 A;  4ZY3 A;  4YW1 A;  4UOU A;  1EUS A;  4H52 A;  2VK5 A;  5B2D A;  1RWL A;  2QWI A;  3TC9 A;  4AH4 A;  1X2J A;  4Q6K A;  2F24 A;  2VW0 A;  1NCD N;  2HTY A;  3CL0 A;  4FPC A;  3NO0 A;  1Z4Z A;  2ISM A;  4CPN A;  3TI5 A;  4GZQ A;  2AEP A;  2IAU A;  2HQS A;  4AGI A;  1NMB N;  4N1B A;  1NSD A;  3GVK A;  3NSS A;  1N1Y A;  1NNB A;  3HLH A;  4MWR A;  4GB1 A;  2HT5 A;  4G3N A;  4AHA A;  1IVC A;  1CQ1 A;  5EX7 A;  3K39 A;  3P5B L;  4M4V A;  1E1A A;  2AGS A;  4GZT A;  1K32 A;  1Z4W A;  4O5T A;  1XOG A;  7NN9 A;  4XIO A;  1W0P A;  5D9B A;  3B69 A;  4XIK A;  1W1X A;  1EUU A;  4WA4 A;  3UC1 A;  3CYE A;  4FPY A;  2CML A;  3TIC A;  2IAT A;  2HTV A;  1N6F A;  2F26 A;  3HLI A;  2G8S A;  4XJR A;  1F8B A;  3U0S A;  2HTU A;  4JML A;  1SLI A;  4B7J A;  1SUU A;  4QN6 A;  1IJQ A;  1S1D A;  2XZK A;  2SIL A;  4XMI A;  4XHB A;  2H2N A;  1ZGK A;  3OPZ A;  2A75 A;  1NCC N;  2W5O A;  5FNQ A;  4YZ1 A;  1V04 A;  4MWJ A;  2XN4 A;  2QWD A;  1USX A;  3SAN A;  4FPF A;  3ZGD A;  4XHX A;  3GVJ A;  1S18 A;  4MJU A;  4WA3 A;  2QWE A;  4WA5 A;  3O4P A;  4KS3 A;  1INY A;  2XZJ A;  4YW2 A;  4QN3 A;  1WP5 A;  4IN4 A;  1IVD A;  2VSM A;  4MWV A;  1SLL A;  2HT7 A;  5HUG A;  2X9M A;  3GVL A;  2P4O A;  4D52 A;  2F13 A;  3O9K A;  1V3E A;  1V0E A;  4D52 C;  2ZB5 A;  1KIT A;  3S94 A;  4XJU A;  4XYX A;  4NCS A;  1A14 N;  4HZX A;  4CSD A;  2XZI A;  4M4U A;  1Z4V A;  1INW A;  5FWW A;  4GNC A;  4B7R A;  1DIL A;  4FOW A;  4B7N A;  3K38 A;  1V2I A;  4FPG A;  4FPJ A;  3G4H A;  4MWY A;  4QNP A;  4XJQ A;  3E5Z A;  4HZZ A;  4AGT A;  1MWE A;  4WEG A;  2YDT A;  2ZB6 A;  3Q6T A;  1WCS A;  4CHB A;  3H72 A;  2DYH A;  3FVZ A;  3LI4 A;  1F8D A;  3ALX A;  1U6D X;  4IFJ A;  1NMC A;  1INF A;  4IMB A;  2JKB A;  4GDJ A;  3V64 C;  5GX1 A;  1RWI A;  2HTW A;  2QWK A;  1WCQ A;  5H47 A;  1W20 A;  2FP9 A;  1PJX A;  1IVF A;  3I1C A;  4MWX A;  1S0I A;  2VVZ A;  4XJ9 A;  1MS1 A;  2Z32 A;  4M3M A;  4XMB A;  5HUM A;  3SOB B;  4FPE A;  4IFN X;  4YW4 A;  3Q6K A;  5NN9 A;  1E8V A;  1MS5 A;  5F9T A;  3KGG A;  1F8E A;  4XJZ A;  2BZD A;  3S8Z A;  1NCB N;  2VW2 A;  3AMR A;  4NN9 A;  4YY8 A;  3TIB A;  2BF6 A;  4GZW A;  5FZJ A;  4HW6 A;  4J9T A;  2F29 A;  1F8C A;  1H6L A;  4QN7 A;  1IVE A;  2ZZK A;  4K3Y A;  1W8N A;  1EUR A;  1Z4X A;  4GEZ A;  4Q1U A;  4IQK A;  4GZX A;  2YA5 A;  1NSB A;  4ZLR A;  4B7Q A;  4YW3 A;  2WOZ A;  2W38 A;  1L7F A;  4XJW A;  2F11 A;  2IAW A;  1BJI A;  4CPY A;  3CL2 A;  4UF7 A;  1C9U A;  2B8H A;  4C1Y B;  4X49 A;  2FPB A;  4MZE A;  2IAV A;  2W8B A;  5HUN A;  1CVM A;  3JU4 A;  2F0Z A;  2ZWA A;  4MWU A;  4BBW A;  2VSK A;  3BYC A;  1N6D A;  1INV A;  5FNS A;  4CPZ A;  3VNH A;  4GZS A;  4X47 A;  1V0F A;  4MX0 A;  2QWB A;  2SLI A;  1IUC A;  1USR A;  1B9T A;  1IVG A;  3SOQ A;  4QN4 A;  4B7M A;  3ZGC A;  4QN5 A;  2C4L A;  2GVV A;  2AH2 A;  3A71 A;  4R40 A;  2QWG A;  3K3A A;  4D4U A;  2QWF A;  1OFZ A;  3SIL A;  3FW0 A;  3B7E A;  2QWC A;  2V91 A;  3ADE A;  6NN9 A;  5D9D A;  2YA4 A;  4K1I A;  4HHO A;  3BEQ A;  1NMA N;  3WWA A;  2GVU A;  1C5K A;  1SNT A;  4FPH A;  5HX0 A;  4HZV A;  3LI3 A;  1N6E A;  2POO A;  4MZA A;  5GX4 A;  4YW5 A;  2AEQ A;  2HT8 A;  3ALW A;  3SOV A;  4YZ2 A;  5EO8 A;  2RKC A;  5EO7 A;  2IVZ A;  4L7C A;  2YA8 A;  1NSC A;  4CPO A;  2C4A A;  1POO A;  4XMA A;  4GDI A;  4XOG A;  2F28 A;  1N1S A;  2VK7 A;  4FOQ A;  2W20 A;  1V3B A;  5FZN A;  3WDZ A;  4ZGC A;  5B2C A;  1NNC A;  4GZP A;  4XJA A;  4HHQ A;  3WN7 A;  4MJV A;  4D52 B;  4FPL A;  4FPK A;  4JF7 A;  1VCU A;  3KYA A;  1MS4 A;  1Q7F A;  1S0J A;  3H73 A;  4CH9 A;  2GVW A;  2IAX A;  3PJQ A;  4FVK A;  5FNU A;  4CPM A;  2IAP A;  5M1Z A;  3V1S A;  1NCA N;  2BAT A;  2YA6 A;  5F72 C;  4MC7 A;  2ZW9 A;  1VCJ A;  3DR2 A;  4YZ3 A;  4XIL A;  2FLU X;  4KS1 A;  1QLG A;  2GVX A;  3SRE A;  4CPL A;  2DG0 A;  3NN9 A;  2IAR A;  3CKZ A;  4GN9 A;  1QBI A;  1MS8 A;  2F27 A;  4XJ8 A;  4KS5 A;  4MWW A;  2YA7 A;  2VK6 A;  2F12 A;  1ING A;  1V3C A;  4GZO A;  4MWQ A;  2F10 A;  2F25 A;  1V0Z A;  4MWL A;  2OJH A;  4HZW A;  1B9S A;  1IVB A;  2SIM A;  3DAS A;  4L7D A;  4A0P A;  1MZ6 A;  3H6J A;  1SO7 A;  1N1T A;  3II7 A;  1W21 A;  4K1J A;  3AMS A;  1MS3 A;  1B9V A;  2DSO A;  4C1Y A;  2YDP A;  2VWD A;  3A72 A;  3D11 A;  3HRP A;  1W8O A;  3TI8 A;  4GJT A;  4O5S A;  1IUB A;  3WW9 A;  3TI6 A;  4WEF A;  4PWZ A;  4IFL X;  1MZ5 A;  4YZ4 A;  2W8B B;  2GHS A;  3S2K A;  3SRG A;  5GTQ A;  3D12 A;  4HZY A;  2IAO A;  4ASC A; 
#chains in the Genus database with same CATH homology
 3FVZ A;  3LI4 A;  3SOV A;  2IVZ A;  4IMB A;  1CQ1 A;  3V64 C;  5GX1 A;  1RWI A;  5EX7 A;  5GX3 A;  1POO A;  3P5B L;  2FP8 A;  1E1A A;  2FP9 A;  1PJX A;  3I1C A;  4O5T A;  5D9B A;  4HHQ A;  3SOB B;  3Q6K A;  3LI5 A;  3KGG A;  3KYA A;  1Q7F A;  3V65 B;  2GVW A;  2IAX A;  3S8Z A;  3AMR A;  2IAP A;  2IAT A;  4GN7 A;  3V1S A;  3A9G A;  3HLI A;  2G8S A;  4HW6 A;  3IAX A;  3U0S A;  1H6L A;  2IAS A;  3DR2 A;  4JML A;  4GNA A;  3S8V A;  1N7D A;  1IJQ A;  1NPE A;  4Q1U A;  1QLG A;  2GVX A;  3SRE A;  4ZLR A;  2QE8 A;  2DG1 A;  2DG0 A;  2IAR A;  4GN9 A;  1QBI A;  2IAQ A;  1V04 A;  2IAW A;  5GX5 A;  4GN8 A;  1CRZ A;  3Q6P A;  3G4E A;  1C9U A;  4DG6 A;  2FPB A;  2IAV A;  2W8B A;  3O4P A;  1CVM A;  2VAQ A;  2OJH A;  3BYC A;  4GNB A;  4IYG A;  2FPC A;  3A9H A;  3DAS A;  4A0P A;  2P4O A;  3SOQ A;  3AMS A;  2DSO A;  3S94 A;  2GVV A;  5D9C A;  1CRU A;  5GX2 A;  3HRP A;  4R40 A;  4O5S A;  3FW0 A;  3WW9 A;  1RWL A;  2V91 A;  5FWW A;  5D9D A;  4GNC A;  3TC9 A;  4PWZ A;  4HHO A;  3WWA A;  2GVU A;  1C5K A;  2ISM A;  3G4H A;  2W8B B;  3E5Z A;  2IAU A;  2GHS A;  3LI3 A;  2POO A;  3S2K A;  3SRG A;  2HQS A;  5GTQ A;  3Q6T A;  5GX4 A;  2IAO A;  3HLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...