4IYGA

Structure of strictosidine synthase in complex with 2-(1h-indol-3-yl)-n-methylethanamine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
302
structure length
302
Chain Sequence
KEILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASPYWNKAFCENSTDAEKRPLCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLATSVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLIKYDPSTKETTLLLKELHVPGGAEVSADSSFVLVAEFLSHQIVKYWLEGPKKGTAEVLVKIPNPGNIKRNADGHFWVSSSEELDGNMHGRVDPKGIKFDEFGNILEVIPLPPPFAGEHFEQIQEHDGLLYIGTLFHGSVGILVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Using Strictosidine Synthase to Prepare Novel Alkaloids.
pubmed rcsb
source organism Rauvolfia serpentina
molecule tags Lyase/lyase inhibitor
molecule keywords Strictosidine synthase
total genus 81
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 4.3.3.2: Strictosidine synthase.
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03088 Str_synth Strictosidine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 4iygA00
3G4HA 1C9UA 4HW6A 1RWIA 5EX7A 3FW0A 2OJHA 4GNBA 2IAUA 1RWLA 4JMLA 4O5SA 4PWZA 3E5ZA 4GN7A 3A9GA 3DR2A 2GVVA 3P5BL 3U0SA 2GVXA 4O5TA 2IAWA 3SOBB 2V91A 2IATA 2IAXA 2W8BB 2P4OA 1NPEA 4ZLRA 2G8SA 4HHOA 3WWAA 2GHSA 1POOA 3O4PA 5GX3A 3S94A 2IASA 4A0PA 2HQSA 2FP9A 3Q6TA 2FP8A 3HLHA 2DG1A 1C5KA 2DG0A 3IAXA 3V64C 3V65B 1V04A 1IJQA 1QLGA 3SRGA 5GX2A 2IARA 4Q1UA 5GX5A 3FVZA 3TC9A 2IAVA 2FPCA 3LI4A 3SOQA 3SREA 5GX4A 2GVUA 4IMBA 4HHQA 3AMSA 3G4EA 3KYAA 3AMRA 2GVWA 1H6LA 1CRZA 3Q6PA 3DASA 3S8VA 2IAOA 2VAQA 3S8ZA 4R40A 4DG6A 3S2KA 3LI3A 3A9HA 2QE8A 5D9BA 3Q6KA 5GTQA 5FWWA 3HLIA 3KGGA 4GN9A 3SOVA 3LI5A 1N7DA 1E1AA 2IVZA 1CVMA 2FPBA 1QBIA 2IAPA 3BYCA 3V1SA 3WW9A 1Q7FA 3HRPA 2IAQA 3I1CA 4GN8A 4IYGA 2W8BA 1PJXA 1CQ1A 5D9CA 1CRUA 4GNCA 2DSOA 4GNAA 2POOA 2ISMA 5GX1A 5D9DA
chains in the Genus database with same CATH superfamily
2HTYA 4FVKA 1RWIA 4K1HA 4YW3A 4YW2A 1IVEA 4M4NA 1RWLA 4O5SA 3A9GA 3ALWA 3DR2A 2QWFA 3SILA 2IATA 1INHA 2W8BB 4XILA 2GHSA 2YA7A 4B7RA 3GVKA 5FNQA 2XZKA 2ZB6A 2YDPA 1A4QA 4A0PA 4FPYA 3CL0A 4AH4A 3A72A 1NCAN 1EURA 3GVJA 3IAXA 4MWLA 4AHAA 2F29A 3V64C 2F26A 4QNPA 4HZZA 4XMBA 5FZJA 4UF7A 1DILA 1V3EA 1NCCN 4WA3A 1ZI0A 4CPZA 4MZAA 1MS1A 2DYHA 2FPCA 2GVUA 3CYEA 4XE9A 4D52A 4XJQA 4C1YA 3AMSA 2W38A 1NCBN 3G4EA 1W21A 4ASCA 4CHBA 4XMAA 3H73A 4X49A 5H47A 3WN7A 2H2UA 4YZ1A 1NNCA 1SO7A 4J9TA 4MX0A 2IAOA 1K32A 3S8ZA 3TI4A 3TI3A 3LI3A 1NNBA 4FOQA 5GTQA 4X6KA 2VK7A 1XOGA 2FLUX 2QWIA 1N7DA 4IFJA 2HU4A 4CPYA 2QWHA 2W5NA 4SLIA 4H52A 3H71A 1QBIA 5FNSA 3BYCA 1IUBA 1N6EA 3V1SA 1SNTA 3WW9A 5FNUA 1INWA 2C4LA 3I1CA 4GN8A 2VW0A 1V3BA 2W8BA 1F8DA 4GZSA 3K3AA 5NN9A 4XMIA 3CL2A 2AH2A 4FP2A 4BBWA 1IVFA 5F72C 4GNAA 2F25A 4FOWA 5HX0A 4GZXA 1W0PA 1E8TA 1WP5A 4QN6A 1C9UA 2QWAA 4IFNX 1B9VA 5HUKA 4FZHA 5F9TA 4YZ3A 2IAUA 4YW4A 4QN7A 1B9TA 4YZ5A 4O5TA 2IAWA 3II7A 2SILA 2P4OA 1NPEA 2F10A 5M1ZA 1USXA 3B7EA 3S94A 2FHRA 2YA6A 4X47A 4CPNA 4IQKA 1OFZA 3K36A 3Q6TA 2DG1A 2DG0A 4NC5A 5EO7A 1INFA 3V65B 2JKBA 4N1BA 4XJAA 1EUTA 1IJQA 2YA4A 1IUCA 3B69A 1MS3A 2F11A 4MWQA 4X4AA 3INBA 5GX5A 1EUUA 4YZ4A 4L7DA 1Z4WA 2RKCA 3SREA 3NO0A 4IMBA 4FPEA 1V0FA 4YW5A 1IVBA 2XZJA 4MWXA 1N1YA 2YA5A 4XJ9A 2VWDA 4YZ2A 4GZOA 2XZIA 1U6DX 6NN9A 4WA4A 3KYAA 2GVWA 1H6LA 1Z4YA 4MWVA 3Q6PA 4FPCA 3S8VA 4C1YB 1L7GA 4K3YA 2VPJA 1MWEA 1MR5A 1VCUA 3D11A 4YY8A 4R40A 5D9BA 2HT8A 3Q6KA 4FPJA 2VK6A 4XIKA 3SLIA 2VSMA 3LI5A 4QN5A 3A71A 2HTUA 4FP3A 1E1AA 4IFLX 1NNAA 1XOEA 4IN4A 4MWUA 4B7JA 2AEQA 1INGA 4FPOB 4M4UA 3T1EA 4WEGA 4KS1A 4GZWA 2ZW9A 3H72A 1MS4A 4KS5A 4XHXA 1CRUA 1X2JA 2ZWAA 3TI6A 2X9MA 4FPGA 4MC7A 2POOA 2QWDA 3PJQA 1Z4XA 4MWYA 1USRA 1V2IA 2AEPA 4XJUA 1WCQA 4FPFA 5EX7A 3FW0A 4AGIA 2OJHA 4GNBA 4JMLA 4B7NA 1W8OA 4PWZA 1SLIA 4GN7A 2QWCA 5HUNA 2GVVA 3P5BL 3U0SA 2GVXA 1E8VA 3SOBB 3NSSA 2IAXA 5HUGA 4MJVA 4XYXA 3WWAA 1W20A 1IVDA 2ZZKA 2QWJA 5FNRA 4D52B 2HTWA 5GX3A 4XHBA 1INVA 2XN4A 1V0EA 5FNTA 2HTQA 2FP9A 3HLHA 4K1KA 2SLIA 2HT5A 4MZEA 3ADEA 2F12A 2QWEA 3O9KA 5EO8A 4AGTA 1V04A 4HZYA 4KS4A 1NSDA 3TI8A 1F8BA 3W09A 4ZY3A 4Q1UA 3ZGCA 4FPHA 1N1TA 3FVZA 1KITA 1DIMA 4XJ8A 4XJRA 2XCYA 4M3MA 2VK5A 4GDIA 3ZGDA 1E8UA 2HTVA 4QN4A 3K38A 2W5OA 3AMRA 7NN9A 1BJIA 2F24A 3DASA 3SALA 4FPKA 2F27A 1SLLA 1Z4ZA 4NN9A 2HT7A 2VAQA 1A14N 4FOVA 4DG6A 3S2KA 1MZ5A 1N1SA 2QE8A 2ZB5A 1A4GA 4KS2A 1NSCA 4FOYA 5FWWA 2B8HA 3HLIA 3KGGA 3SOVA 5B2DA 3H6JA 3TI5A 1IVCA 2IVZA 3TIBA 4WEFA 4DGRA 4L7CA 1B9SA 1L7HA 1ZGKA 4CPOA 2IAQA 4IYGA 1X2RA 1W1XA 4MWRA 1W8NA 2QWBA 1PJXA 1MS9A 5D9CA 5JYYA 2CMLA 1F8CA 3BEQA 2ISMA 2BERA 5GX1A 3G4HA 4HW6A 2C4AA 4K1IA 2F0ZA 1NCDN 2VW1A 1IVGA 4QN3A 2HTRA 3E5ZA 1MZ6A 3K37A 4HIZA 4B7QA 2BF6A 4XJZA 2V91A 5HUMA 1V3DA 1WCSA 4ZLRA 2G8SA 2BZDA 4HHOA 1N6FA 1POOA 3O4PA 4GZPA 1Z50A 4GEZA 5FZNA 2IASA 1V0ZA 2YDTA 2HQSA 1NMBN 4WA5A 1S0JA 2FP8A 1C5KA 2HU0A 4HZVA 1S0IA 3D12A 1MS8A 4GDJA 2W20A 4UOUA 1QLGA 3SRGA 4Q6KA 3VNHA 4H53A 5GX2A 4MWWA 2SIMA 2IARA 4I00A 2VW2A 4HZXA 1INYA 3TC9A 1NMAN 4FPLA 2IAVA 4D52C 3WDZA 3LI4A 3SOQA 5GX4A 4NCSA 1V3CA 4HHQA 3K39A 4CH9A 1F8EA 1L7FA 3L6VA 2Z32A 1MS5A 1CRZA 4G3NA 2A75A 2VVZA 3JU4A 2QWGA 1SUUA 4D4UA 5CGJA 1NN2A 2BATA 4CPMA 4GZQA 2WOZA 2H2NA 3TICA 5B2CA 1Z4VA 3GVLA 4XOGA 3NN9A 3A9HA 4GB1A 3UC1A 1S18A 4KS3A 2F13A 4CSDA 4GN9A 4HZWA 4L7BA 1N6DA 2YA8A 4FQ4A 3OPZA 4CPLA 4YW1A 1CVMA 4K1JA 1INXA 2FPBA 2QWKA 2IAPA 3CKZA 4GZTA 1EUSA 2AGSA 1Q7FA 4XJWA 3SANA 1W0OA 2F28A 3HRPA 4FJ6A 1NSBA 3O9JA 1MS0A 4B7MA 1VCJA 1CQ1A 4GNCA 4M4VA 3ALXA 4MWJA 3VNGA 4ZGCA 4JF7A 2DSOA 4D8SA 1S1DA 3TIAA 2VSKA 4GJTA 4MJUA 1NMCA 1N1VA 5D9DA 4XIOA
chains in the Genus database with same CATH topology
3G4HA 1C9UA 4HW6A 1RWIA 5EX7A 3FW0A 2OJHA 4GNBA 2IAUA 1RWLA 4JMLA 4O5SA 4PWZA 3E5ZA 4GN7A 3A9GA 3DR2A 2GVVA 3P5BL 3U0SA 2GVXA 4O5TA 2IAWA 3SOBB 2V91A 2IATA 2IAXA 2W8BB 2P4OA 1NPEA 4ZLRA 2G8SA 4HHOA 3WWAA 2GHSA 1POOA 3O4PA 5GX3A 3S94A 2IASA 4A0PA 2HQSA 2FP9A 3Q6TA 2FP8A 3HLHA 2DG1A 1C5KA 2DG0A 3IAXA 3V64C 3V65B 1V04A 1IJQA 1QLGA 3SRGA 5GX2A 2IARA 4Q1UA 5GX5A 3FVZA 3TC9A 2IAVA 2FPCA 3LI4A 3SOQA 3SREA 5GX4A 2GVUA 4IMBA 4HHQA 3AMSA 3G4EA 3KYAA 3AMRA 2GVWA 1H6LA 1CRZA 3Q6PA 3DASA 3S8VA 2IAOA 2VAQA 3S8ZA 4R40A 4DG6A 3S2KA 3LI3A 3A9HA 2QE8A 5D9BA 3Q6KA 5GTQA 5FWWA 3HLIA 3KGGA 4GN9A 3SOVA 3LI5A 1N7DA 1E1AA 2IVZA 1CVMA 2FPBA 1QBIA 2IAPA 3BYCA 3V1SA 3WW9A 1Q7FA 3HRPA 2IAQA 3I1CA 4GN8A 4IYGA 2W8BA 1PJXA 1CQ1A 5D9CA 1CRUA 4GNCA 2DSOA 4GNAA 2POOA 2ISMA 5GX1A 5D9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4H A;  1C9U A;  4HW6 A;  1RWI A;  5EX7 A;  3FW0 A;  2OJH A;  4GNB A;  2IAU A;  1RWL A;  4JML A;  4O5S A;  4PWZ A;  3E5Z A;  4GN7 A;  3A9G A;  3DR2 A;  2GVV A;  3P5B L;  3U0S A;  2GVX A;  4O5T A;  2IAW A;  3SOB B;  2V91 A;  2IAT A;  2IAX A;  2W8B B;  2P4O A;  1NPE A;  4ZLR A;  2G8S A;  4HHO A;  3WWA A;  2GHS A;  1POO A;  3O4P A;  5GX3 A;  3S94 A;  2IAS A;  4A0P A;  2HQS A;  2FP9 A;  3Q6T A;  2FP8 A;  3HLH A;  2DG1 A;  1C5K A;  2DG0 A;  3IAX A;  3V64 C;  3V65 B;  1V04 A;  1IJQ A;  1QLG A;  3SRG A;  5GX2 A;  2IAR A;  4Q1U A;  5GX5 A;  3FVZ A;  3TC9 A;  2IAV A;  2FPC A;  3LI4 A;  3SOQ A;  3SRE A;  5GX4 A;  2GVU A;  4IMB A;  4HHQ A;  3AMS A;  3G4E A;  3KYA A;  3AMR A;  2GVW A;  1H6L A;  1CRZ A;  3Q6P A;  3DAS A;  3S8V A;  2IAO A;  2VAQ A;  3S8Z A;  4R40 A;  4DG6 A;  3S2K A;  3LI3 A;  3A9H A;  2QE8 A;  5D9B A;  3Q6K A;  5GTQ A;  5FWW A;  3HLI A;  3KGG A;  4GN9 A;  3SOV A;  3LI5 A;  1N7D A;  1E1A A;  2IVZ A;  1CVM A;  2FPB A;  1QBI A;  2IAP A;  3BYC A;  3V1S A;  3WW9 A;  1Q7F A;  3HRP A;  2IAQ A;  3I1C A;  4GN8 A;  4IYG A;  2W8B A;  1PJX A;  1CQ1 A;  5D9C A;  1CRU A;  4GNC A;  2DSO A;  4GNA A;  2POO A;  2ISM A;  5GX1 A;  5D9D A; 
#chains in the Genus database with same CATH topology
 2HTY A;  4FVK A;  1RWI A;  4K1H A;  4YW3 A;  4YW2 A;  1IVE A;  4M4N A;  1RWL A;  4O5S A;  3A9G A;  3ALW A;  3DR2 A;  2QWF A;  3SIL A;  2IAT A;  1INH A;  2W8B B;  4XIL A;  2GHS A;  2YA7 A;  4B7R A;  3GVK A;  5FNQ A;  2XZK A;  2ZB6 A;  2YDP A;  1A4Q A;  4A0P A;  4FPY A;  3CL0 A;  4AH4 A;  3A72 A;  1NCA N;  1EUR A;  3GVJ A;  3IAX A;  4MWL A;  4AHA A;  2F29 A;  3V64 C;  2F26 A;  4QNP A;  4HZZ A;  4XMB A;  5FZJ A;  4UF7 A;  1DIL A;  1V3E A;  1NCC N;  4WA3 A;  1ZI0 A;  4CPZ A;  4MZA A;  1MS1 A;  2DYH A;  2FPC A;  2GVU A;  3CYE A;  4XE9 A;  4D52 A;  4XJQ A;  4C1Y A;  3AMS A;  2W38 A;  1NCB N;  3G4E A;  1W21 A;  4ASC A;  4CHB A;  4XMA A;  3H73 A;  4X49 A;  5H47 A;  3WN7 A;  2H2U A;  4YZ1 A;  1NNC A;  1SO7 A;  4J9T A;  4MX0 A;  2IAO A;  1K32 A;  3S8Z A;  3TI4 A;  3TI3 A;  3LI3 A;  1NNB A;  4FOQ A;  5GTQ A;  4X6K A;  2VK7 A;  1XOG A;  2FLU X;  2QWI A;  1N7D A;  4IFJ A;  2HU4 A;  4CPY A;  2QWH A;  2W5N A;  4SLI A;  4H52 A;  3H71 A;  1QBI A;  5FNS A;  3BYC A;  1IUB A;  1N6E A;  3V1S A;  1SNT A;  3WW9 A;  5FNU A;  1INW A;  2C4L A;  3I1C A;  4GN8 A;  2VW0 A;  1V3B A;  2W8B A;  1F8D A;  4GZS A;  3K3A A;  5NN9 A;  4XMI A;  3CL2 A;  2AH2 A;  4FP2 A;  4BBW A;  1IVF A;  5F72 C;  4GNA A;  2F25 A;  4FOW A;  5HX0 A;  4GZX A;  1W0P A;  1E8T A;  1WP5 A;  4QN6 A;  1C9U A;  2QWA A;  4IFN X;  1B9V A;  5HUK A;  4FZH A;  5F9T A;  4YZ3 A;  2IAU A;  4YW4 A;  4QN7 A;  1B9T A;  4YZ5 A;  4O5T A;  2IAW A;  3II7 A;  2SIL A;  2P4O A;  1NPE A;  2F10 A;  5M1Z A;  1USX A;  3B7E A;  3S94 A;  2FHR A;  2YA6 A;  4X47 A;  4CPN A;  4IQK A;  1OFZ A;  3K36 A;  3Q6T A;  2DG1 A;  2DG0 A;  4NC5 A;  5EO7 A;  1INF A;  3V65 B;  2JKB A;  4N1B A;  4XJA A;  1EUT A;  1IJQ A;  2YA4 A;  1IUC A;  3B69 A;  1MS3 A;  2F11 A;  4MWQ A;  4X4A A;  3INB A;  5GX5 A;  1EUU A;  4YZ4 A;  4L7D A;  1Z4W A;  2RKC A;  3SRE A;  3NO0 A;  4IMB A;  4FPE A;  1V0F A;  4YW5 A;  1IVB A;  2XZJ A;  4MWX A;  1N1Y A;  2YA5 A;  4XJ9 A;  2VWD A;  4YZ2 A;  4GZO A;  2XZI A;  1U6D X;  6NN9 A;  4WA4 A;  3KYA A;  2GVW A;  1H6L A;  1Z4Y A;  4MWV A;  3Q6P A;  4FPC A;  3S8V A;  4C1Y B;  1L7G A;  4K3Y A;  2VPJ A;  1MWE A;  1MR5 A;  1VCU A;  3D11 A;  4YY8 A;  4R40 A;  5D9B A;  2HT8 A;  3Q6K A;  4FPJ A;  2VK6 A;  4XIK A;  3SLI A;  2VSM A;  3LI5 A;  4QN5 A;  3A71 A;  2HTU A;  4FP3 A;  1E1A A;  4IFL X;  1NNA A;  1XOE A;  4IN4 A;  4MWU A;  4B7J A;  2AEQ A;  1ING A;  4FPO B;  4M4U A;  3T1E A;  4WEG A;  4KS1 A;  4GZW A;  2ZW9 A;  3H72 A;  1MS4 A;  4KS5 A;  4XHX A;  1CRU A;  1X2J A;  2ZWA A;  3TI6 A;  2X9M A;  4FPG A;  4MC7 A;  2POO A;  2QWD A;  3PJQ A;  1Z4X A;  4MWY A;  1USR A;  1V2I A;  2AEP A;  4XJU A;  1WCQ A;  4FPF A;  5EX7 A;  3FW0 A;  4AGI A;  2OJH A;  4GNB A;  4JML A;  4B7N A;  1W8O A;  4PWZ A;  1SLI A;  4GN7 A;  2QWC A;  5HUN A;  2GVV A;  3P5B L;  3U0S A;  2GVX A;  1E8V A;  3SOB B;  3NSS A;  2IAX A;  5HUG A;  4MJV A;  4XYX A;  3WWA A;  1W20 A;  1IVD A;  2ZZK A;  2QWJ A;  5FNR A;  4D52 B;  2HTW A;  5GX3 A;  4XHB A;  1INV A;  2XN4 A;  1V0E A;  5FNT A;  2HTQ A;  2FP9 A;  3HLH A;  4K1K A;  2SLI A;  2HT5 A;  4MZE A;  3ADE A;  2F12 A;  2QWE A;  3O9K A;  5EO8 A;  4AGT A;  1V04 A;  4HZY A;  4KS4 A;  1NSD A;  3TI8 A;  1F8B A;  3W09 A;  4ZY3 A;  4Q1U A;  3ZGC A;  4FPH A;  1N1T A;  3FVZ A;  1KIT A;  1DIM A;  4XJ8 A;  4XJR A;  2XCY A;  4M3M A;  2VK5 A;  4GDI A;  3ZGD A;  1E8U A;  2HTV A;  4QN4 A;  3K38 A;  2W5O A;  3AMR A;  7NN9 A;  1BJI A;  2F24 A;  3DAS A;  3SAL A;  4FPK A;  2F27 A;  1SLL A;  1Z4Z A;  4NN9 A;  2HT7 A;  2VAQ A;  1A14 N;  4FOV A;  4DG6 A;  3S2K A;  1MZ5 A;  1N1S A;  2QE8 A;  2ZB5 A;  1A4G A;  4KS2 A;  1NSC A;  4FOY A;  5FWW A;  2B8H A;  3HLI A;  3KGG A;  3SOV A;  5B2D A;  3H6J A;  3TI5 A;  1IVC A;  2IVZ A;  3TIB A;  4WEF A;  4DGR A;  4L7C A;  1B9S A;  1L7H A;  1ZGK A;  4CPO A;  2IAQ A;  4IYG A;  1X2R A;  1W1X A;  4MWR A;  1W8N A;  2QWB A;  1PJX A;  1MS9 A;  5D9C A;  5JYY A;  2CML A;  1F8C A;  3BEQ A;  2ISM A;  2BER A;  5GX1 A;  3G4H A;  4HW6 A;  2C4A A;  4K1I A;  2F0Z A;  1NCD N;  2VW1 A;  1IVG A;  4QN3 A;  2HTR A;  3E5Z A;  1MZ6 A;  3K37 A;  4HIZ A;  4B7Q A;  2BF6 A;  4XJZ A;  2V91 A;  5HUM A;  1V3D A;  1WCS A;  4ZLR A;  2G8S A;  2BZD A;  4HHO A;  1N6F A;  1POO A;  3O4P A;  4GZP A;  1Z50 A;  4GEZ A;  5FZN A;  2IAS A;  1V0Z A;  2YDT A;  2HQS A;  1NMB N;  4WA5 A;  1S0J A;  2FP8 A;  1C5K A;  2HU0 A;  4HZV A;  1S0I A;  3D12 A;  1MS8 A;  4GDJ A;  2W20 A;  4UOU A;  1QLG A;  3SRG A;  4Q6K A;  3VNH A;  4H53 A;  5GX2 A;  4MWW A;  2SIM A;  2IAR A;  4I00 A;  2VW2 A;  4HZX A;  1INY A;  3TC9 A;  1NMA N;  4FPL A;  2IAV A;  4D52 C;  3WDZ A;  3LI4 A;  3SOQ A;  5GX4 A;  4NCS A;  1V3C A;  4HHQ A;  3K39 A;  4CH9 A;  1F8E A;  1L7F A;  3L6V A;  2Z32 A;  1MS5 A;  1CRZ A;  4G3N A;  2A75 A;  2VVZ A;  3JU4 A;  2QWG A;  1SUU A;  4D4U A;  5CGJ A;  1NN2 A;  2BAT A;  4CPM A;  4GZQ A;  2WOZ A;  2H2N A;  3TIC A;  5B2C A;  1Z4V A;  3GVL A;  4XOG A;  3NN9 A;  3A9H A;  4GB1 A;  3UC1 A;  1S18 A;  4KS3 A;  2F13 A;  4CSD A;  4GN9 A;  4HZW A;  4L7B A;  1N6D A;  2YA8 A;  4FQ4 A;  3OPZ A;  4CPL A;  4YW1 A;  1CVM A;  4K1J A;  1INX A;  2FPB A;  2QWK A;  2IAP A;  3CKZ A;  4GZT A;  1EUS A;  2AGS A;  1Q7F A;  4XJW A;  3SAN A;  1W0O A;  2F28 A;  3HRP A;  4FJ6 A;  1NSB A;  3O9J A;  1MS0 A;  4B7M A;  1VCJ A;  1CQ1 A;  4GNC A;  4M4V A;  3ALX A;  4MWJ A;  3VNG A;  4ZGC A;  4JF7 A;  2DSO A;  4D8S A;  1S1D A;  3TIA A;  2VSK A;  4GJT A;  4MJU A;  1NMC A;  1N1V A;  5D9D A;  4XIO A; 
#chains in the Genus database with same CATH homology
 3G4H A;  1C9U A;  4HW6 A;  1RWI A;  5EX7 A;  3FW0 A;  2OJH A;  4GNB A;  2IAU A;  1RWL A;  4JML A;  4O5S A;  4PWZ A;  3E5Z A;  4GN7 A;  3A9G A;  3DR2 A;  2GVV A;  3P5B L;  3U0S A;  2GVX A;  4O5T A;  2IAW A;  3SOB B;  2V91 A;  2IAT A;  2IAX A;  2W8B B;  2P4O A;  1NPE A;  4ZLR A;  2G8S A;  4HHO A;  3WWA A;  2GHS A;  1POO A;  3O4P A;  5GX3 A;  3S94 A;  2IAS A;  4A0P A;  2HQS A;  2FP9 A;  3Q6T A;  2FP8 A;  3HLH A;  2DG1 A;  1C5K A;  2DG0 A;  3IAX A;  3V64 C;  3V65 B;  1V04 A;  1IJQ A;  1QLG A;  3SRG A;  5GX2 A;  2IAR A;  4Q1U A;  5GX5 A;  3FVZ A;  3TC9 A;  2IAV A;  2FPC A;  3LI4 A;  3SOQ A;  3SRE A;  5GX4 A;  2GVU A;  4IMB A;  4HHQ A;  3AMS A;  3G4E A;  3KYA A;  3AMR A;  2GVW A;  1H6L A;  1CRZ A;  3Q6P A;  3DAS A;  3S8V A;  2IAO A;  2VAQ A;  3S8Z A;  4R40 A;  4DG6 A;  3S2K A;  3LI3 A;  3A9H A;  2QE8 A;  5D9B A;  3Q6K A;  5GTQ A;  5FWW A;  3HLI A;  3KGG A;  4GN9 A;  3SOV A;  3LI5 A;  1N7D A;  1E1A A;  2IVZ A;  1CVM A;  2FPB A;  1QBI A;  2IAP A;  3BYC A;  3V1S A;  3WW9 A;  1Q7F A;  3HRP A;  2IAQ A;  3I1C A;  4GN8 A;  4IYG A;  2W8B A;  1PJX A;  1CQ1 A;  5D9C A;  1CRU A;  4GNC A;  2DSO A;  4GNA A;  2POO A;  2ISM A;  5GX1 A;  5D9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...