3AMRA

Crystal structures of bacillus subtilis alkaline phytase in complex with ca2+, co2+, ni2+, mg2+ and myo-inositol hexasulfate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
352
structure length
352
Chain Sequence
LSDPYHFTVNAAAETEPVDTAGDAADDPAIWLDPKTPQNSKLITTNKKSGLVVYSLDGKMLHSYNTGKLNNVDIRYDFPLNGKKVDIAAASNRSEGKNTIEIYAIDGKNGTLQSMTDPDHPIATAINEVYGFTLYHSQKTGKYYAMVTGKEGEFEQYELKADKNGYISGKKVRAFKMNSQTEGMAADDEYGRLYIAEEDEAIWKFSAEPDGGSNGTVIDRADGRHLTRDIEGLTIYYAADGKGYLMASSQGNSSYAIYDRQGKNKYVADFRITDGPETDGTSDTDGIDVLGFGLGPEYPFGIFVAQDGENIDHGQKANQNFKIVPWERIADQIGFRPLANEQVDPRKLTDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3-phytase
publication title Crystal structures of Bacillus alkaline phytase in complex with divalent metal ions and inositol hexasulfate
pubmed doi rcsb
source organism Bacillus subtilis
total genus 100
structure length 352
sequence length 352
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2010-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3amrA00
2DG0A 1RWLA 1PJXA 3A9HA 5D9CA 1RWIA 3Q6PA 4IYGA 2V91A 3Q6KA 5FWWA 2ISMA 2W8BA 5GX1A 3LI5A 3E5ZA 2IAXA 4HHQA 2W8BB 3V1SA 3V65B 4GN9A 5GX5A 4GNBA 2IVZA 4A0PA 3U0SA 3LI4A 3AMSA 3TC9A 1CVMA 2GVXA 3S2KA 4IMBA 1V04A 4GNAA 3P5BL 2IAQA 2IAUA 5GTQA 2IASA 1E1AA 3KYAA 2POOA 3LI3A 2IARA 3G4EA 3DR2A 3G4HA 3HLHA 1C9UA 2IAVA 5GX3A 3AMRA 5GX2A 2G8SA 2DG1A 3FVZA 3O4PA 5D9BA 3IAXA 4O5TA 2GHSA 2GVUA 2DSOA 2QE8A 4ZLRA 2FPCA 3SRGA 2IATA 3S8ZA 2IAOA 4HHOA 3SREA 1N7DA 1QBIA 1POOA 3WW9A 5D9DA 3SOVA 2IAPA 4JMLA 2IAWA 5EX7A 4GN8A 1QLGA 3S8VA 3HRPA 3SOQA 2HQSA 3A9GA 3I1CA 1CRUA 3DASA 4HW6A 2FPBA 4O5SA 3BYCA 2FP8A 5GX4A 3KGGA 3HLIA 1CQ1A 2GVWA 2VAQA 4R40A 4Q1UA 2P4OA 4GNCA 3WWAA 4DG6A 1NPEA 3S94A 2GVVA 2FP9A 1IJQA 4PWZA 4GN7A 3SOBB 1CRZA 1Q7FA 3Q6TA 1C5KA 3FW0A 2OJHA 1H6LA 3V64C
chains in the Genus database with same CATH superfamily
1NNCA 3SANA 2BATA 4ZGCA 4FPEA 2DG0A 1RWLA 1PJXA 3A9HA 5D9CA 2ZB5A 3Q6PA 4NC5A 4IYGA 4HZWA 2VSMA 1INHA 4DGRA 4YZ4A 1B9TA 4XHBA 2YA5A 3L6VA 4Q6KA 4FPLA 1IVDA 2W5NA 1V2IA 2QWHA 1MR5A 3AMSA 4GZWA 2HTRA 2X9MA 2F10A 3TC9A 1X2JA 1NCAN 3WDZA 4NCSA 4AHAA 1WCSA 2QWCA 2F26A 3P5BL 4XMBA 2AEQA 1U6DX 2IAQA 2IAUA 4XJUA 1IVGA 3TI6A 2VVZA 1F8DA 4MJUA 2POOA 4MZAA 4GZPA 4NN9A 3G4EA 2QWBA 1C9UA 1N1YA 4MWYA 1XOEA 3FVZA 3TIBA 1SNTA 1MWEA 4MWQA 5D9BA 1MS4A 1W21A 4O5TA 1Z50A 1VCUA 1SLIA 1IVCA 2HT8A 2FPCA 3W09A 2QWEA 3GVLA 4MWJA 1K32A 3SREA 3A71A 2BF6A 4IFLX 4YZ1A 1INWA 2IAPA 5FNUA 2BERA 5EX7A 3ZGCA 1W0OA 1INFA 1SLLA 2W5OA 4GN8A 1INVA 4XJAA 3SOQA 2HQSA 1NNAA 2F11A 2FPBA 1S0IA 4XYXA 2ZB6A 5H47A 4FPYA 3BYCA 4FP2A 6NN9A 5FNTA 2VK7A 1E8VA 4AGIA 2QWAA 3S94A 3H6JA 4JF7A 4M4UA 1IUCA 2VW2A 4PWZA 3SILA 1MS8A 2QWGA 3ALXA 3K36A 4B7QA 2B8HA 3K38A 4FP3A 2HTVA 3SALA 4GDJA 5FNQA 4YY8A 1USXA 3SOBB 4MWUA 1V0EA 3CYEA 1C5KA 4X47A 2OJHA 4UOUA 3V64C 1V3CA 1SO7A 4MWRA 1USRA 4FZHA 4G3NA 4CSDA 5B2DA 2V91A 2C4LA 1MS5A 2VSKA 2ISMA 2W8BA 3LI5A 1B9SA 3E5ZA 2YA8A 4GN9A 4GNBA 4HZVA 1ZGKA 1MZ5A 4M4VA 3NSSA 3U0SA 4XILA 3NN9A 2HTUA 4FPJA 4K1KA 4WA3A 1EUTA 1V04A 2WOZA 4GNAA 4XJWA 4B7NA 2H2NA 2HTQA 1F8EA 3ADEA 2DYHA 5GTQA 1NCBN 1NSCA 1E8UA 3KYAA 2ZW9A 4XJ8A 3DR2A 4YW3A 4IFNX 4GZTA 4MWWA 3HLHA 3D12A 5GX3A 5GX2A 4BBWA 3H71A 3H72A 1S0JA 3TI4A 2F25A 4CPLA 4IFJA 3IAXA 1N6FA 2F24A 2HTWA 2F29A 1W0PA 1V3BA 2DSOA 2QWJA 4XJQA 4ZY3A 4ZLRA 3S8ZA 1S18A 1S1DA 1IVBA 5EO8A 5HUKA 4C1YB 3WW9A 4MZEA 3JU4A 4XOGA 3TICA 4B7RA 1V0FA 1Z4ZA 4JMLA 3NO0A 4YZ2A 3I1CA 1NSBA 3VNHA 4I00A 1Z4XA 3UC1A 3OPZA 5FNSA 4WEGA 1SUUA 4GB1A 2HU4A 3HLIA 1CQ1A 4WEFA 2GVWA 4M4NA 4B7JA 5M1ZA 2VAQA 4YW2A 2SIMA 4HZXA 4X49A 4GNCA 4DG6A 4D52B 1NPEA 4FJ6A 2W38A 4YZ3A 2FP9A 4C1YA 4CPZA 3BEQA 4AH4A 1ZI0A 4MWVA 2XZIA 1W8OA 2F13A 4XIKA 1KITA 1Z4WA 3O9JA 1CRZA 2QWIA 1N6EA 3Q6TA 3ZGDA 4D4UA 4QN5A 1DILA 2FLUX 1N1TA 1X2RA 4D8SA 4D52C 1L7GA 2YDTA 1RWIA 1N1SA 3A72A 4D52A 3Q6KA 4HZYA 5B2CA 5FWWA 4CPYA 4L7BA 5GX1A 4MC7A 1MS1A 2IAXA 2W8BB 3V65B 5GX5A 4K3YA 2VW0A 2HU0A 2YA7A 2AGSA 5JYYA 3LI4A 2AH2A 1WP5A 4QN7A 3TI5A 2GVXA 4XIOA 1V3DA 3S2KA 7NN9A 1IUBA 4KS5A 1IVEA 4HIZA 3T1EA 2CMLA 2IASA 2SILA 4GJTA 2F28A 4GZSA 3LI3A 4XJRA 4FOWA 5HUGA 5CGJA 3TI3A 3AMRA 2H2UA 2G8SA 2DG1A 4B7MA 4FPKA 2VWDA 4GZOA 4YW5A 4FOQA 2GHSA 4K1IA 4KS3A 1WCQA 4GZXA 4AGTA 2QE8A 4CPOA 3K39A 3SRGA 1OFZA 3WN7A 1MS3A 2QWKA 2VK5A 2IAOA 1INXA 2HT7A 4HHOA 4QNPA 4QN4A 1QBIA 2AEPA 1POOA 5D9DA 3SOVA 1Z4YA 4GEZA 2IAWA 4WA4A 5HX0A 4CH9A 3CL0A 1QLGA 3S8VA 3HRPA 4FVKA 4XE9A 3A9GA 1BJIA 1NSDA 4HW6A 4FPHA 4KS2A 4O5SA 1NCCN 3K37A 2FP8A 5GX4A 2RKCA 1A14N 3KGGA 4YW4A 1E8TA 4R40A 2F27A 1W8NA 1N6DA 5FNRA 4QN6A 2HT5A 1NCDN 3K3AA 2GVVA 1MS0A 3ALWA 2YDPA 4XMAA 1NNBA 1IJQA 3INBA 4MX0A 4FQ4A 1MZ6A 1DIMA 2VPJA 4GN7A 2HTYA 3FW0A 4MJVA 5EO7A 4MWLA 2W20A 1NMBN 2F0ZA 4SLIA 2XZJA 3TIAA 4CPNA 4YZ5A 2Z32A 2VK6A 1EURA 3TI8A 1VCJA 2JKBA 3GVJA 1EUSA 3B7EA 4HHQA 3V1SA 2F12A 2IVZA 4CPMA 4A0PA 1B9VA 4L7DA 3VNGA 3II7A 4GDIA 4XHXA 2BZDA 1CVMA 2ZWAA 4IN4A 4K1JA 4FOVA 2SLIA 4XJ9A 4X4AA 1A4QA 5F72C 2ZZKA 1E1AA 5NN9A 4L7CA 5FZJA 4X6KA 1INGA 4KS4A 2IARA 3G4HA 1F8BA 2C4AA 2IAVA 4KS1A 3PJQA 2VW1A 4WA5A 2XZKA 5FZNA 3O4PA 4J9TA 3H73A 1Z4VA 1EUUA 4XMIA 2GVUA 1NMAN 4FPCA 2IATA 1L7HA 2YA4A 4IQKA 4FPGA 4H53A 1N7DA 3B69A 4MWXA 1N1VA 1NMCA 1L7FA 1INYA 1F8CA 5HUNA 1CRUA 3DASA 1A4GA 4CHBA 4FPOB 3D11A 2YA6A 4ASCA 3SLIA 2XCYA 4K1HA 4M3MA 4XJZA 2FHRA 2QWFA 4N1BA 4YW1A 4FOYA 1XOGA 3CL2A 2P4OA 4Q1UA 3WWAA 5HUMA 4H52A 4FPFA 2XN4A 4QN3A 2QWDA 2A75A 1IVFA 5F9TA 1V0ZA 3GVKA 1V3EA 4GZQA 1MS9A 3O9KA 4UF7A 4HZZA 1Q7FA 1W1XA 1NN2A 4IMBA 1W20A 3CKZA 1H6LA
chains in the Genus database with same CATH topology
2DG0A 1RWLA 1PJXA 3A9HA 5D9CA 1RWIA 3Q6PA 4IYGA 2V91A 3Q6KA 5FWWA 2ISMA 2W8BA 5GX1A 3LI5A 3E5ZA 2IAXA 4HHQA 2W8BB 3V1SA 3V65B 4GN9A 5GX5A 4GNBA 2IVZA 4A0PA 3U0SA 3LI4A 3AMSA 3TC9A 1CVMA 2GVXA 3S2KA 4IMBA 1V04A 4GNAA 3P5BL 2IAQA 2IAUA 5GTQA 2IASA 1E1AA 3KYAA 2POOA 3LI3A 2IARA 3G4EA 3DR2A 3G4HA 3HLHA 1C9UA 2IAVA 5GX3A 3AMRA 5GX2A 2G8SA 2DG1A 3FVZA 3O4PA 5D9BA 3IAXA 4O5TA 2GHSA 2GVUA 2DSOA 2QE8A 4ZLRA 2FPCA 3SRGA 2IATA 3S8ZA 2IAOA 4HHOA 3SREA 1N7DA 1QBIA 1POOA 3WW9A 5D9DA 3SOVA 2IAPA 4JMLA 2IAWA 5EX7A 4GN8A 1QLGA 3S8VA 3HRPA 3SOQA 2HQSA 3A9GA 3I1CA 1CRUA 3DASA 4HW6A 2FPBA 4O5SA 3BYCA 2FP8A 5GX4A 3KGGA 3HLIA 1CQ1A 2GVWA 2VAQA 4R40A 4Q1UA 2P4OA 4GNCA 3WWAA 4DG6A 1NPEA 3S94A 2GVVA 2FP9A 1IJQA 4PWZA 4GN7A 3SOBB 1CRZA 1Q7FA 3Q6TA 1C5KA 3FW0A 2OJHA 1H6LA 3V64C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG0 A;  1RWL A;  1PJX A;  3A9H A;  5D9C A;  1RWI A;  3Q6P A;  4IYG A;  2V91 A;  3Q6K A;  5FWW A;  2ISM A;  2W8B A;  5GX1 A;  3LI5 A;  3E5Z A;  2IAX A;  4HHQ A;  2W8B B;  3V1S A;  3V65 B;  4GN9 A;  5GX5 A;  4GNB A;  2IVZ A;  4A0P A;  3U0S A;  3LI4 A;  3AMS A;  3TC9 A;  1CVM A;  2GVX A;  3S2K A;  4IMB A;  1V04 A;  4GNA A;  3P5B L;  2IAQ A;  2IAU A;  5GTQ A;  2IAS A;  1E1A A;  3KYA A;  2POO A;  3LI3 A;  2IAR A;  3G4E A;  3DR2 A;  3G4H A;  3HLH A;  1C9U A;  2IAV A;  5GX3 A;  3AMR A;  5GX2 A;  2G8S A;  2DG1 A;  3FVZ A;  3O4P A;  5D9B A;  3IAX A;  4O5T A;  2GHS A;  2GVU A;  2DSO A;  2QE8 A;  4ZLR A;  2FPC A;  3SRG A;  2IAT A;  3S8Z A;  2IAO A;  4HHO A;  3SRE A;  1N7D A;  1QBI A;  1POO A;  3WW9 A;  5D9D A;  3SOV A;  2IAP A;  4JML A;  2IAW A;  5EX7 A;  4GN8 A;  1QLG A;  3S8V A;  3HRP A;  3SOQ A;  2HQS A;  3A9G A;  3I1C A;  1CRU A;  3DAS A;  4HW6 A;  2FPB A;  4O5S A;  3BYC A;  2FP8 A;  5GX4 A;  3KGG A;  3HLI A;  1CQ1 A;  2GVW A;  2VAQ A;  4R40 A;  4Q1U A;  2P4O A;  4GNC A;  3WWA A;  4DG6 A;  1NPE A;  3S94 A;  2GVV A;  2FP9 A;  1IJQ A;  4PWZ A;  4GN7 A;  3SOB B;  1CRZ A;  1Q7F A;  3Q6T A;  1C5K A;  3FW0 A;  2OJH A;  1H6L A;  3V64 C; 
#chains in the Genus database with same CATH topology
 1NNC A;  3SAN A;  2BAT A;  4ZGC A;  4FPE A;  2DG0 A;  1RWL A;  1PJX A;  3A9H A;  5D9C A;  2ZB5 A;  3Q6P A;  4NC5 A;  4IYG A;  4HZW A;  2VSM A;  1INH A;  4DGR A;  4YZ4 A;  1B9T A;  4XHB A;  2YA5 A;  3L6V A;  4Q6K A;  4FPL A;  1IVD A;  2W5N A;  1V2I A;  2QWH A;  1MR5 A;  3AMS A;  4GZW A;  2HTR A;  2X9M A;  2F10 A;  3TC9 A;  1X2J A;  1NCA N;  3WDZ A;  4NCS A;  4AHA A;  1WCS A;  2QWC A;  2F26 A;  3P5B L;  4XMB A;  2AEQ A;  1U6D X;  2IAQ A;  2IAU A;  4XJU A;  1IVG A;  3TI6 A;  2VVZ A;  1F8D A;  4MJU A;  2POO A;  4MZA A;  4GZP A;  4NN9 A;  3G4E A;  2QWB A;  1C9U A;  1N1Y A;  4MWY A;  1XOE A;  3FVZ A;  3TIB A;  1SNT A;  1MWE A;  4MWQ A;  5D9B A;  1MS4 A;  1W21 A;  4O5T A;  1Z50 A;  1VCU A;  1SLI A;  1IVC A;  2HT8 A;  2FPC A;  3W09 A;  2QWE A;  3GVL A;  4MWJ A;  1K32 A;  3SRE A;  3A71 A;  2BF6 A;  4IFL X;  4YZ1 A;  1INW A;  2IAP A;  5FNU A;  2BER A;  5EX7 A;  3ZGC A;  1W0O A;  1INF A;  1SLL A;  2W5O A;  4GN8 A;  1INV A;  4XJA A;  3SOQ A;  2HQS A;  1NNA A;  2F11 A;  2FPB A;  1S0I A;  4XYX A;  2ZB6 A;  5H47 A;  4FPY A;  3BYC A;  4FP2 A;  6NN9 A;  5FNT A;  2VK7 A;  1E8V A;  4AGI A;  2QWA A;  3S94 A;  3H6J A;  4JF7 A;  4M4U A;  1IUC A;  2VW2 A;  4PWZ A;  3SIL A;  1MS8 A;  2QWG A;  3ALX A;  3K36 A;  4B7Q A;  2B8H A;  3K38 A;  4FP3 A;  2HTV A;  3SAL A;  4GDJ A;  5FNQ A;  4YY8 A;  1USX A;  3SOB B;  4MWU A;  1V0E A;  3CYE A;  1C5K A;  4X47 A;  2OJH A;  4UOU A;  3V64 C;  1V3C A;  1SO7 A;  4MWR A;  1USR A;  4FZH A;  4G3N A;  4CSD A;  5B2D A;  2V91 A;  2C4L A;  1MS5 A;  2VSK A;  2ISM A;  2W8B A;  3LI5 A;  1B9S A;  3E5Z A;  2YA8 A;  4GN9 A;  4GNB A;  4HZV A;  1ZGK A;  1MZ5 A;  4M4V A;  3NSS A;  3U0S A;  4XIL A;  3NN9 A;  2HTU A;  4FPJ A;  4K1K A;  4WA3 A;  1EUT A;  1V04 A;  2WOZ A;  4GNA A;  4XJW A;  4B7N A;  2H2N A;  2HTQ A;  1F8E A;  3ADE A;  2DYH A;  5GTQ A;  1NCB N;  1NSC A;  1E8U A;  3KYA A;  2ZW9 A;  4XJ8 A;  3DR2 A;  4YW3 A;  4IFN X;  4GZT A;  4MWW A;  3HLH A;  3D12 A;  5GX3 A;  5GX2 A;  4BBW A;  3H71 A;  3H72 A;  1S0J A;  3TI4 A;  2F25 A;  4CPL A;  4IFJ A;  3IAX A;  1N6F A;  2F24 A;  2HTW A;  2F29 A;  1W0P A;  1V3B A;  2DSO A;  2QWJ A;  4XJQ A;  4ZY3 A;  4ZLR A;  3S8Z A;  1S18 A;  1S1D A;  1IVB A;  5EO8 A;  5HUK A;  4C1Y B;  3WW9 A;  4MZE A;  3JU4 A;  4XOG A;  3TIC A;  4B7R A;  1V0F A;  1Z4Z A;  4JML A;  3NO0 A;  4YZ2 A;  3I1C A;  1NSB A;  3VNH A;  4I00 A;  1Z4X A;  3UC1 A;  3OPZ A;  5FNS A;  4WEG A;  1SUU A;  4GB1 A;  2HU4 A;  3HLI A;  1CQ1 A;  4WEF A;  2GVW A;  4M4N A;  4B7J A;  5M1Z A;  2VAQ A;  4YW2 A;  2SIM A;  4HZX A;  4X49 A;  4GNC A;  4DG6 A;  4D52 B;  1NPE A;  4FJ6 A;  2W38 A;  4YZ3 A;  2FP9 A;  4C1Y A;  4CPZ A;  3BEQ A;  4AH4 A;  1ZI0 A;  4MWV A;  2XZI A;  1W8O A;  2F13 A;  4XIK A;  1KIT A;  1Z4W A;  3O9J A;  1CRZ A;  2QWI A;  1N6E A;  3Q6T A;  3ZGD A;  4D4U A;  4QN5 A;  1DIL A;  2FLU X;  1N1T A;  1X2R A;  4D8S A;  4D52 C;  1L7G A;  2YDT A;  1RWI A;  1N1S A;  3A72 A;  4D52 A;  3Q6K A;  4HZY A;  5B2C A;  5FWW A;  4CPY A;  4L7B A;  5GX1 A;  4MC7 A;  1MS1 A;  2IAX A;  2W8B B;  3V65 B;  5GX5 A;  4K3Y A;  2VW0 A;  2HU0 A;  2YA7 A;  2AGS A;  5JYY A;  3LI4 A;  2AH2 A;  1WP5 A;  4QN7 A;  3TI5 A;  2GVX A;  4XIO A;  1V3D A;  3S2K A;  7NN9 A;  1IUB A;  4KS5 A;  1IVE A;  4HIZ A;  3T1E A;  2CML A;  2IAS A;  2SIL A;  4GJT A;  2F28 A;  4GZS A;  3LI3 A;  4XJR A;  4FOW A;  5HUG A;  5CGJ A;  3TI3 A;  3AMR A;  2H2U A;  2G8S A;  2DG1 A;  4B7M A;  4FPK A;  2VWD A;  4GZO A;  4YW5 A;  4FOQ A;  2GHS A;  4K1I A;  4KS3 A;  1WCQ A;  4GZX A;  4AGT A;  2QE8 A;  4CPO A;  3K39 A;  3SRG A;  1OFZ A;  3WN7 A;  1MS3 A;  2QWK A;  2VK5 A;  2IAO A;  1INX A;  2HT7 A;  4HHO A;  4QNP A;  4QN4 A;  1QBI A;  2AEP A;  1POO A;  5D9D A;  3SOV A;  1Z4Y A;  4GEZ A;  2IAW A;  4WA4 A;  5HX0 A;  4CH9 A;  3CL0 A;  1QLG A;  3S8V A;  3HRP A;  4FVK A;  4XE9 A;  3A9G A;  1BJI A;  1NSD A;  4HW6 A;  4FPH A;  4KS2 A;  4O5S A;  1NCC N;  3K37 A;  2FP8 A;  5GX4 A;  2RKC A;  1A14 N;  3KGG A;  4YW4 A;  1E8T A;  4R40 A;  2F27 A;  1W8N A;  1N6D A;  5FNR A;  4QN6 A;  2HT5 A;  1NCD N;  3K3A A;  2GVV A;  1MS0 A;  3ALW A;  2YDP A;  4XMA A;  1NNB A;  1IJQ A;  3INB A;  4MX0 A;  4FQ4 A;  1MZ6 A;  1DIM A;  2VPJ A;  4GN7 A;  2HTY A;  3FW0 A;  4MJV A;  5EO7 A;  4MWL A;  2W20 A;  1NMB N;  2F0Z A;  4SLI A;  2XZJ A;  3TIA A;  4CPN A;  4YZ5 A;  2Z32 A;  2VK6 A;  1EUR A;  3TI8 A;  1VCJ A;  2JKB A;  3GVJ A;  1EUS A;  3B7E A;  4HHQ A;  3V1S A;  2F12 A;  2IVZ A;  4CPM A;  4A0P A;  1B9V A;  4L7D A;  3VNG A;  3II7 A;  4GDI A;  4XHX A;  2BZD A;  1CVM A;  2ZWA A;  4IN4 A;  4K1J A;  4FOV A;  2SLI A;  4XJ9 A;  4X4A A;  1A4Q A;  5F72 C;  2ZZK A;  1E1A A;  5NN9 A;  4L7C A;  5FZJ A;  4X6K A;  1ING A;  4KS4 A;  2IAR A;  3G4H A;  1F8B A;  2C4A A;  2IAV A;  4KS1 A;  3PJQ A;  2VW1 A;  4WA5 A;  2XZK A;  5FZN A;  3O4P A;  4J9T A;  3H73 A;  1Z4V A;  1EUU A;  4XMI A;  2GVU A;  1NMA N;  4FPC A;  2IAT A;  1L7H A;  2YA4 A;  4IQK A;  4FPG A;  4H53 A;  1N7D A;  3B69 A;  4MWX A;  1N1V A;  1NMC A;  1L7F A;  1INY A;  1F8C A;  5HUN A;  1CRU A;  3DAS A;  1A4G A;  4CHB A;  4FPO B;  3D11 A;  2YA6 A;  4ASC A;  3SLI A;  2XCY A;  4K1H A;  4M3M A;  4XJZ A;  2FHR A;  2QWF A;  4N1B A;  4YW1 A;  4FOY A;  1XOG A;  3CL2 A;  2P4O A;  4Q1U A;  3WWA A;  5HUM A;  4H52 A;  4FPF A;  2XN4 A;  4QN3 A;  2QWD A;  2A75 A;  1IVF A;  5F9T A;  1V0Z A;  3GVK A;  1V3E A;  4GZQ A;  1MS9 A;  3O9K A;  4UF7 A;  4HZZ A;  1Q7F A;  1W1X A;  1NN2 A;  4IMB A;  1W20 A;  3CKZ A;  1H6L A; 
#chains in the Genus database with same CATH homology
 2DG0 A;  1RWL A;  1PJX A;  3A9H A;  5D9C A;  1RWI A;  3Q6P A;  4IYG A;  2V91 A;  3Q6K A;  5FWW A;  2ISM A;  2W8B A;  5GX1 A;  3LI5 A;  3E5Z A;  2IAX A;  4HHQ A;  2W8B B;  3V1S A;  3V65 B;  4GN9 A;  5GX5 A;  4GNB A;  2IVZ A;  4A0P A;  3U0S A;  3LI4 A;  3AMS A;  3TC9 A;  1CVM A;  2GVX A;  3S2K A;  4IMB A;  1V04 A;  4GNA A;  3P5B L;  2IAQ A;  2IAU A;  5GTQ A;  2IAS A;  1E1A A;  3KYA A;  2POO A;  3LI3 A;  2IAR A;  3G4E A;  3DR2 A;  3G4H A;  3HLH A;  1C9U A;  2IAV A;  5GX3 A;  3AMR A;  5GX2 A;  2G8S A;  2DG1 A;  3FVZ A;  3O4P A;  5D9B A;  3IAX A;  4O5T A;  2GHS A;  2GVU A;  2DSO A;  2QE8 A;  4ZLR A;  2FPC A;  3SRG A;  2IAT A;  3S8Z A;  2IAO A;  4HHO A;  3SRE A;  1N7D A;  1QBI A;  1POO A;  3WW9 A;  5D9D A;  3SOV A;  2IAP A;  4JML A;  2IAW A;  5EX7 A;  4GN8 A;  1QLG A;  3S8V A;  3HRP A;  3SOQ A;  2HQS A;  3A9G A;  3I1C A;  1CRU A;  3DAS A;  4HW6 A;  2FPB A;  4O5S A;  3BYC A;  2FP8 A;  5GX4 A;  3KGG A;  3HLI A;  1CQ1 A;  2GVW A;  2VAQ A;  4R40 A;  4Q1U A;  2P4O A;  4GNC A;  3WWA A;  4DG6 A;  1NPE A;  3S94 A;  2GVV A;  2FP9 A;  1IJQ A;  4PWZ A;  4GN7 A;  3SOB B;  1CRZ A;  1Q7F A;  3Q6T A;  1C5K A;  3FW0 A;  2OJH A;  1H6L A;  3V64 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...