2W8BA

Crystal structure of processed tolb in complex with pal
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
409
structure length
409
Chain Sequence
EVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVLYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/membrane protein
molecule keywords PROTEIN TOLB
publication title Allosteric Beta-Propeller Signalling in Tolb and its Manipulation by Translocating Colicins.
pubmed doi rcsb
source organism Escherichia coli
total genus 111
structure length 409
sequence length 409
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2w8bA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2w8bA01
3U0SA 2POOA 4DG6A 2IAQA 1QLGA 3HLIA 2P4OA 2FP8A 5GTQA 3WW9A 3A9HA 3V1SA 3Q6PA 3FW0A 2IAWA 1POOA 3A9GA 2FP9A 3E5ZA 2IAUA 3LI5A 4GNAA 1CQ1A 4HW6A 5GX4A 3P5BL 1CRUA 2DG1A 2W8BB 3AMRA 3Q6KA 2IVZA 2OJHA 3V64C 5GX2A 1PJXA 2W8BA 3V65B 3KYAA 2V91A 2GHSA 2G8SA 3LI3A 4GNCA 2GVXA 4O5TA 5GX3A 4IMBA 3S8ZA 2GVWA 3SOVA 2GVUA 4GN8A 4R40A 5GX5A 1C5KA 3IAXA 3AMSA 4HHOA 1N7DA 2ISMA 3DR2A 3I1CA 3O4PA 4JMLA 1C9UA 1Q7FA 2IAVA 3HLHA 4PWZA 3S94A 3Q6TA 2DG0A 3SOBB 2FPBA 1NPEA 2IAXA 3KGGA 3SRGA 4Q1UA 4ZLRA 2IAPA 5D9CA 4GNBA 4HHQA 2IAOA 1E1AA 1IJQA 4GN9A 5D9DA 3BYCA 1V04A 2GVVA 2IARA 4GN7A 2VAQA 4IYGA 5GX1A 5EX7A 4O5SA 5D9BA 1CVMA 3SOQA 3TC9A 3S2KA 3FVZA 1RWLA 2IATA 3WWAA 2QE8A 3DASA 2FPCA 3LI4A 2IASA 2DSOA 3HRPA 1H6LA 1RWIA 3G4EA 3SREA 1QBIA 2HQSA 5FWWA 3S8VA 1CRZA 3G4HA 4A0PA
chains in the Genus database with same CATH superfamily
4AJKA 5HW0A 1EA5A 1IH8A 3NV9A 1T3HA 2J3KA 2ZAGA 4NABA 4INZA 2NTJA 2V74B 1MZ5A 2WWGA 4M9RA 4AWBA 4XJQA 1JEQA 2HRDA 2OSBA 3GIDA 4YACA 4GPZA 2GXUA 4XRGA 3LG2A 4I1RA 3WW9A 3MT7A 3WZLA 1MLDA 1Z88A 4EUHA 2BSXA 5L3QB 1W52X 4KTVE 1RAFA 5B1EA 1P33A 2BBTA 4ECAA 3ABRB 5IJ0A 4F4DA 1MQ8B 2WTNA 4NH0A 2OILA 1CQ1A 1U2SA 1F8GA 3FSGA 3HR7A 5KQPA 1KZYC 3MBIA 4Y6PA 1I7DA 3D0RA 4BMOB 5TSDA 2NVBA 3RW9A 4F3NA 4DCPA 2YZGA 4N3CA 4PRLA 5AOCA 3IO3A 5J40A 4MW5A 3DHVA 3ETLA 3L7KA 4WESA 5LXTF 5LQAA 1P5FA 2N1BA 2WHYA 4GE0A 1U02A 1ZBQA 1KWKA 3GGDA 3LQKA 2OLEA 2ACEA 3S28A 1HE2A 3OX1A 1M0EA 1EK0A 3HGMA 1W8DA 1RRKA 2AI2A 2C0CA 2I6XA 3FDJA 2OYCA 2G1PA 4RMIA 4GNCA 1KJ8A 2M6SA 1W0PA 3K6KA 4YI5A 1R10A 2HPVA 5AW4A 4ONEA 4AP5A 1TCUA 1WXDA 2HJHA 3V46A 1YSCA 2XQFA 4IGKA 3AHFA 3PE6A 3SM9A 2I7DA 3K96A 4CMAA 2O52A 5JD3A 3IURA 1NVKA 3TOVA 4IFLX 1DAEA 3F8SA 4N6OA 3HUDA 1COWA 4YP1A 4KVAA 2F1JA 4DEYA 4RF3A 3OQMA 5BW8A 1TCVA 3L1IA 3VR2D 3ME5A 1L5QA 2MHCA 4Q3CA 1TIPA 3AEUB 4W5RA 2DWQA 3UGKA 5DRYA 1XZFA 3Q9UA 3MWDA 4Y9SA 3RSLA 2GEUA 2ZUUA 2C3PA 3D4NA 4Z2AA 5EIFA 3B5JA 4HX9A 1T8TA 4J7CA 2XVAA 4Y6GB 5GQSA 3IDOA 5IJAA 3T06B 2YUIA 4RNCA 1N0VC 2AV6A 5KJEA 1ZMRA 4DDUA 4LCBA 1AZLA 5TJ9A 4X61A 3OQPA 4LOKA 2Z6QA 1Z3IX 1THTA 1LLFA 1VSTA 3KJGA 1GO2A 3PENA 5TGTA 3WJAA 2I7TA 4DDVA 3NH9A 5FBRB 4IRXA 821PA 1A9TA 4MS4A 4V1CA 4AY4A 4OI0A 1XVAA 5FA8A 1YWGO 2FUCA 5IZ4A 2NQ2C 3M1AA 1IBMB 1MTZA 5JMPA 4G0ZA 1G59A 1X8LA 2QXUA 4Q82A 1ISSA 2VNIA 5KNDD 3OWHA 1U5CA 4F5YA 4V1CI 1OA0A 4R5HA 5GZ6A 5FWYA 1JG1A 5FWNA 5BRNA 3CRMA 3H1GA 1CRQA 4ZHSA 1YIDA 5KTOA 4KSYA 1IQPA 3FWKA 2PGJA 5ITSA 1E6MA 5JDIC 1PVDA 1SOVA 2XX3A 3ZK7A 4EG0A 3WHPA 5I7SA 1EFAA 4P3KA 3RKUA 3SANA 2UUBB 5HF9A 3DNMA 1G1AA 3CKKA 3KKEA 4MNTA 1A50B 3CRVA 2ZRAA 3LYUA 3ZW7A 1DZIA 1OFZA 3LOUA 3GYBA 4H17A 5ALZA 4KN5A 4P7JA 2PZLA 4TV9A 3PPYA 2NT4A 4HWRA 3KB8A 1WCIB 3OCCA 4KQEA 3WYCA 5JFOA 5JSQA 3IJPA 2JIBA 3D8TA 3EVAA 4KQ9A 5TS2A 4F5DA 2JIOA 2OESA 1L3BA 3WNZA 3SALA 1DU4A 1SVSA 5ECYA 5C3UA 5E7QA 4IQKA 2GZ1A 4F84A 3KYDA 2GJKA 1S4QA 1GTVA 2VPWA 4KYIB 3CQ9A 4XYLA 3OT5A 1ORDA 1CRZA 3GGSA 5FA6A 1LNZA 4KNWA 3JARB 4TWAA 4RIIA 5DSZA 3TMAA 1NQTA 4YLEA 4D79A 5KKNB 3FWHA 4AXXA 3WHIA 3CR3C 3FFTA 2BM8A 2BUCA 2OCIA 3EYWA 1EK6A 2P11A 5F3DA 4ZV7A 1YCHA 3VUEA 4CJXA 3HRKA 1ZVVA 3Q8LA 1QVWA 2NUAB 1X15A 2FSGA 3EGXB 4AAYA 5U1PA 2AZXA 3DVLA 2VT7A 3O3MB 4OFWA 2W42A 3DM9B 2PKYX 3GA0A 4GKJB 4R1OA 2FR8C 3U9SA 4AZVA 3JZFA 5K2OA 1JKIA 2H2WA 1EFRA 4QATA 1ENZA 2OBXA 2Z83A 4M8IA 1TYZA 4NE2A 3PGLA 5JBNA 1K9SA 2EL9A 4FOSA 1PGOA 2A86A 2C4NA 2H1FA 1JR3A 1N5JA 2OZPA 2VTEA 2XA9A 1G8MA 3DHYA 2A78A 3PNSA 1PV2A 1DC8A 3BSSA 4AJNA 2FOIA 4IG9A 3OECA 4J9TA 4F0JA 1CWUA 5AQ1A 1XYYA 3CRNA 3G2KA 5FBHA 2X76A 2VK5A 4WLEA 1E62A 2IOYA 2I3DA 4O3FA 4RVGA 5GJCA 1UQTA 3F90A 2A9QA 4MVJA 3A58B 5C52B 3ADOA 4WBSA 3LFTA 1JR2A 3RODA 1EXVA 1NL3A 5BWLA 2JCBA 5CNIA 4YRTA 4C1BA 3WRXC 1CQJA 1MJ5A 2G09A 2R6GA 3EDOA 1J8FA 1GZ3A 1MO6A 1QCCA 1TM4E 1URPA 2HF8A 3AJEA 3PNQA 4J1QA 4MVJI 4OQMA 2X0NA 4K6KA 1Y6GA 3CLUC 1ACMA 1Y3IA 3PUJA 3QA9A 3BRCA 4TOIA 2PUFA 3AY7A 2HMTA 3LQ1A 5KJ1A 1OSNA 4IMPA 3B5IA 1ZD2P 2UVDA 2Y2UA 3F5DA 4GXTA 5LM3A 4E14A 3IE1A 1JSLA 1B6TA 2PZFA 1GNSA 1T25A 4L7DA 4OCZA 1TRKA 3H5LA 4OFXA 2QT0A 3IP3A 3OTOB 3ZJUA 4ZOEA 2CJXA 2IAVA 4MDEA 2J3JA 2WJ3A 3O9VA 3RS3A 4L9WA 5A3JA 3F6PA 1PJ2A 1VLVA 3GQBB 3T38A 4MMZB 2FDXA 4DRZA 1A9QA 2XVMA 5J2UB 1ADCA 1WUYA 1AZSC 4YXWA 3STHA 4TZ6A 2EZ8A 3HCDA 1X1CA 4FPGA 1IL0A 4XJXA 3VOBA 1ZR2A 3KL4A 5JCXA 1HZZA 2CL5A 2OCKA 4JLWA 4JJKA 3E35A 4OUKX 1P1HA 2PRZA 4UMVA 2IHVA 1TYDE 1AQNA 1FLVA 3GB9A 2VZEA 1WP5A 1FXUA 1MOZA 4KLZA 2E18A 5DGXA 3RF6A 1Y48E 2IYQA 1AVTA 1UJ4A 3ZCRA 3EODA 2G4VA 2V7UA 3BDAA 3NYQA 3TQQA 4EY8A 4F92B 1XMIA 3LFUA 1H2XA 1RWPA 4ZOLF 1E7SA 1RQLA 3A4IA 4N41A 1RC0A 4R0NA 1HE3A 4OYHA 4ISCA 1FU7A 4QGSA 2C5EA 1L5KA 3A4VA 4N0EA 4S1OA 1ZUWA 2BGLA 1VPLA 1VE6A 3RV4A 3IB3A 4EKDA 1II0A 5CB4F 4UAUA 3GU3A 1TJNA 4HNRA 1EBFA 4MRPA 4R9UC 4ZAVA 2NO6A 3HLTA 1P1JA 3LCCA 4CHTA 4MEAA 4JK3A 1FSZA 2J87A 3MBOA 3MS7A 4S04A 4MQEB 2OZEA 4AMVA 4LBWA 2RH9B 2GOYA 5DPMA 2CF6A 5CFNA 2NV0A 4HZYA 2WZQA 1M0SA 4D4UA 2GTIA 2C4HA 1GSIA 2C20A 2P27A 1KYVA 4RVFA 4URZR 4UPDA 3V8MA 4QAJA 2WVGA 4GI7A 2FLKA 3QPAA 1HTTA 1DMRA 2ZJ7A 4XB1A 3ZCPA 1YZLA 1IB6A 2BFFB 4IJVA 1U2TA 3UYLA 3C3JA 2ONCA 4P0QB 4XSVA 4R8SA 3JALA 1KJZA 1YI8A 4Q3EA 3SEAA 4AZ0B 3K09C 1GG8A 2FPUA 2GPAA 4XUGB 1IWPB 3JX9A 1CEYA 1QFSA 3GPBA 3T4EA 4DMMA 4M3MA 3EAFA 1NBHA 3ENKA 2XXJA 5ALHA 1D2HA 1JMVA 1M2NA 4NCJA 3CWZA 1A2QA 5TVKA 4DHEA 2ZSIA 4NK5A 2PLNA 1DX9A 1SVLA 3QBJA 1N6EA 3TOCA 4AY5A 1K9VF 4Y2VA 3U39A 3UQZA 1EZZA 4BMVA 4CN8A 2I6QA 5A4AA 4JEHA 1DV1A 3HKEB 1TM5E 5FNVF 4CPDA 1NOIA 3CIOA 3DD5A 2NTYC 3UHOA 2XMRA 3GT4A 4K2AA 1UKVY 2G0AA 3ET4A 4OBXA 4C6SA 1EB8A 2O1WA 3E22A 3EDQA 5JJ5A 4WA4A 1FUUA 3OFKA 2OZLB 1Y8AA 4AW9A 1BCRA 5F98A 3AVWA 4DR4B 4TMKA 3ESQA 3FF4A 2UYHA 4RXTA 1QDEA 1NW6A 4FSDA 3I9FA 8ADHA 1NXSA 1RLMA 1LLQA 3F4LA 1Z75A 2GI4A 2Y4NA 1TAHA 3OFNA 4D44A 2W2KB 3IT1A 1XA3A 1NBMD 4C1YB 4C3VA 3OZVA 5B30A 3K5IA 1QFYA 3TLXA 4RL6A 8GPBA 3JTMA 4HAWA 5KJ6A 5ALFA 3CC8A 5C8YB 1G2QA 4ENWA 3EOZA 4R3UC 3FOCA 2Z8YA 4M0EA 2ODQA 3V42A 1HE8B 2CNLA 3HFGA 1NT2A 1ESZA 2HA0A 2IEBA 5DNCA 2VDWA 1J6UA 1AKMA 1XZKA 1UMCA 1E2DA 3P0IA 3BWYA 4N5HX 4CKZA 3VO9A 4PXYA 5FNRA 2O7QA 1A4XA 1UKZA 4ZPJA 2W6NA 5D01A 5FFMA 5HE9A 2MCFA 3TLGA 1SQ5A 4X6UA 2BE9A 4XVHA 4DZZA 2C94A 2ZBPA 4TUYF 4KE8A 1SXQA 2WWRA 2X6RA 3AF4A 3B2NA 4CQMA 2BFBB 2O0LA 4HWOA 3TQOA 1ZUNA 1KZ1A 1XKTA 3LZDA 3W1WA 4F5ZA 2AC4A 1WKCA 2O5RA 3B7EA 2RHDA 3QHAA 1UZMA 1C2TA 2YHSA 4GMFA 3NTVA 4WLNA 2OG2A 3P2EA 2JW5A 2AD1A 4C30A 4DQVA 2BFNA 1X13A 4EPXA 2XMGA 2DFLA 2C5BA 5E6RA 4N3NA 1G64A 3EK2A 1S89A 3DB2A 4D4KA 1OOEA 3KUXA 2QMQA 1TUIA 1E8DA 2EHDA 1AS3A 1CG6A 4I9FA 1Q7EA 3DKKA 1VMEA 1WW2A 4IKOA 4I55F 4I0WB 3HS3A 4MW7A 4ETIA 3JATA 5H3CA 1IUNA 1DWPA 5JXHA 1QGUA 3OU7A 1E0JA 1SOMA 2Q41A 4DYVA 3EFEA 5GZ1A 3E9DA 1U8UA 4N6GA 3NBAA 2AVNA 4E5UA 3KHSA 3U16A 1PNRA 4XIOA 1BVYF 1ONPA 4K5QA 1QRSA 2WUGA 2OC9A 4BBWA 3AOGA 3CKLA 3G0DA 3K92A 5FL3A 2OXIA 4D45A 2B1JA 4JSYA 2D3TA 2A5JA 4QG7A 2WFAA 1F9EA 1JLMA 1QE5A 1WCQA 4M87A 4ZT4A 4JELA 2ZB5A 4URWR 4IVRA 2XUAA 4TXLA 2BDEA 1RWIA 4R8VA 1QO7A 3CRZA 3LUJA 4Y2TA 5TY0A 1VOTA 2MJLA 1V8OA 5FI3A 1NBME 1HYEA 3OX3A 4WXEA 1SIOA 4YRDA 5G4KA 2JIRA 2O4UX 3EPHA 1B2LA 3C41J 4YZ4A 1DIMA 1XI2A 2AVDA 1NLZA 4CPOA 3FMIA 1U0NA 2EARA 4ITUA 1QIHA 5LDGA 4B34A 2DQSA 3L82B 1BX0A 3KTAB 1XD9A 2ZJ0A 1DBSA 1E77A 3ORFA 4E5VA 3A3KA 1H3NA 4FOOA 3ELWA 4XDHA 2FZCA 2B8EA 2J85A 2W2TA 3N0VA 4LFBB 3PFIA 3NCHA 2ZSFA 2WIFA 3FKQA 2V8OA 4MB6A 4DRXA 1VCMA 3HZOA 3OIGA 4J0CA 1I7PA 2XB6A 5F33A 3V7YA 3FMGA 3IIEA 3AOEC 3F1KA 4F5WA 3A28A 2HF7A 5FCDA 2VNAA 1J8MF 3QNUA 1G1MA 1KZ9A 3CNEA 3FZNA 4MI3A 4MW0A 1GGEA 3KC2A 4NJOA 1MT3A 4US1R 4Y18A 1Q50A 2XVZA 1X9HA 1A82A 3AU8A 1VZ3A 1QC5A 1ZIOA 3O8LA 1CDZA 1YZVA 4CMIA 1P1KA 3DDWA 1N6HA 5A5VA 3EA4A 3IE2A 2QWDA 2VW1A 2PCLA 4MUHA 4W4TA 1SG0A 4ZO7A 1SUDA 4BYGA 5J47A 2BEVB 2PZKA 3ISTA 4FFOA 2YZNA 3O0TA 1TYCA 2D4AA 6REQA 3I62A 4RTKA 4BTVA 2XSZD 3RQSA 3TSOA 3FM9A 4I9GA 3NVAA 3GDGA 3H2ZA 4BHTA 5CX4A 1X7XA 3FDXA 4WUVA 4O8CA 5JZSA 5JT1A 1YACA 5KDOA 4P3YA 3AJ8A 1T2DA 3IP7A 5D86A 1XRNA 2X6QA 3L5KA 3T35A 4MUXA 3WJ2A 4KS4A 4P7BA 4CF3A 4DA9A 2EKBA 1ZRNA 5FJJA 1CRLA 1M1NA 3CINA 5BUQA 4MWXA 5AUQA 2FLUX 3FPAA 2QZJA 4GI1A 4TSFD 4UXJA 4I1IA 1VSBA 2O5CA 4IJ6A 3HSSA 1U1GA 3L01A 3KGGA 1B15A 1UDXA 2AKAB 3UA3A 1QAQA 3O21A 3QIAA 1M8KA 2OPBA 1SRRA 4MO9A 2P8JA 1X1DA 4H77A 3TLBA 3IMFA 3SIPA 3UWKA 4CIAA 4MV8A 5KPJA 1M8PA 3DDOA 1SWVA 3SF8A 2Z9BA 2G36A 3DAPA 4FCWA 4HNAA 1XLTC 3K9BA 1L5SA 5AOVA 4C7XA 2C4VA 1PFWA 4G1VA 1O4WA 4HDSA 1ECGA 1DXOA 4MYSA 3VHLB 3N0XA 4CCYB 2O7RA 3DGFC 2HDOA 2O7SA 3KJEA 3N0RA 4NPCA 4ZDJA 2W38A 1BG6A 1W47A 1P31A 4KIUA 1Z39A 4MV9A 3IXQA 5LMNB 3I28A 1UDRA 4CU2A 1EUCA 3TKAA 2W00A 1WP9A 1GD1O 1RLUA 3SJUA 1ZM4A 1F8CA 1GSHA 1WXGA 1YB6A 2YC4C 2ZKLA 2V7TA 3B1ZA 5ARCA 4AFNA 1AGYA 1GN8A 3NHYA 3TZEA 4XYEA 2Q3EA 4LV8B 1JE0A 4OP1A 1C0IA 4Q3BA 4EVSA 4AG5A 1W2GA 4QFMA 5K3EA 3NBMA 1DEXA 4ML3A 1W581 3B20A 3KXDA 3LRTA 3BRWD 3ND5A 3WL7A 1XEXB 2BGGA 4PG6A 4TQ9A 1A4QA 2PBFA 3MJCA 1QF7A 2ZB3A 3NV7A 4N0PA 2VBCA 3KSRA 3C43A 3R3ZA 4BPBA 3VTFA 2HA6A 1ZYUA 3UB3A 5LMUB 1XZGA 2VFAA 1R0LA 3A1TA 3GLHB 1FP2A 2ZYDA 3KJXA 4LJKA 4LXGA 4PICA 3SOZA 4AULA 2NP6A 3A10A 1YQEA 2FG5A 2FJUA 1P72A 2WFLA 4C0WA 4UM7A 3PEEA 2VYQA 4PYMA 1XPUA 2VRNA 4NF2A 1XG5A 2ZRPA 5BRAA 5FP0A 3N2KB 1AO3A 5KNBA 2QQ5A 1UFRA 2EBHX 1UBKS 2CNKA 2I87A 4IX1A 1BW9A 4TT3A 1O6GA 5T41A 1L5MA 2ASVA 4QGGA 3IEUA 2GF0A 3A9WA 1I1QB 5EMMA 2DKOA 2AC2A 4HGPA 1ZAYA 3B82A 1LX7A 3D6UA 3TQHA 1R0CA 1T36A 3RIEA 4DM3A 2YV1A 1Q2XA 4RA6A 4A6DA 5IK2D 4YN3A 3UGTA 2Z5FA 3QLTA 5BQ3A 3C39A 4FIDA 4J07A 1G4HA 2R4UA 4WQMA 3VOTA 3V80A 2AE1A 3FG9A 2C2OA 2R25B 4ES6A 1GM5A 1KAGA 4ZYWA 4M1KA 4WZBB 2BR4A 4EB8A 1YS6A 1FSSA 1T6NA 2NXWA 4WK6A 4YX9A 4UTNA 2C42A 4ZYVA 3I83A 4UPVA 3TJMA 2OZVA 4B76A 4C14A 1P2UA 2NAPA 4LGVA 5EKXA 2VH5R 5TQ2A 4NE9A 1A8HA 3RKSA 5AM3A 1TF7A 3K2IA 1HEYA 1RAHA 3OM8A 4P86A 3GAFA 2D5CA 4JDPA 2VPZA 4Y1RA 1VFNA 2GSWA 2LCQA 4DPKA 1UMDA 4NCNA 5LXTA 2CUNA 4WBNF 5JBQA 5BN5B 3BSYA 1QTRA 1AGPA 3R0IA 3DG9A 4GE3A 1Y4ZA 4IIHA 2VF2A 4QFCA 4B5LA 4ZHQF 4M46A 1Y1RA 4UMFA 1EUDB 3AONB 1U2PA 2H2IA 3P71T 4H7JA 3GBSA 4Z51A 1AHPA 3WGUA 4G5XA 4QXPA 2VP4A 1UZAA 4HZGA 4M37A 4CR8A 4XZ3A 1NQUA 1C80A 1J23A 4UCWA 3ER8A 3A6JA 1Y80A 3NEYA 3UOAB 4D9IA 4MV3A 5AKJA 5BVGB 1SH7A 4HAOA 4YP5A 1AMOA 1ZEJA 3P9YA 1F17A 2D74A 3A3YA 3IPXA 3ONDA 4OFBA 2XITA 3BGIA 1U0RA 3BSFA 4RLSA 5D7NA 4FYWA 4B7XA 1I24A 4DMUB 4DEVA 4FEYA 2AFIE 5E2BA 3PNMA 5IF9A 2EVWX 3X2SA 5EX7A 4DJFC 4MWGA 1F60A 10MHA 2E4YA 1IXZA 3KO8A 4CV3A 2ILTA 5CT9A 2AI3A 4NPHA 5H80A 4IIJF 3UAVA 4LOJA 4UU1A 1YB7A 4FD3A 5A7HA 1TVMA 2RHJA 3DA8A 4KQXA 1FQOA 5SZIA 2HV8A 5J43A 2RGAA 5T3YA 3AVXA 1GWNA 1SKBA 3H6KA 4LSWA 3RBVA 4LJ6A 2EFYA 5ESWA 3UO8B 1JWLA 2IP1A 1MT0A 2XQGA 4OHUA 4WFKA 3PFGA 3V3TA 1TUBA 1P19A 3C1TA 4XRRA 2VOJA 4OF4A 5GIOE 1XBTA 1XAJA 1ZM3A 1TMOA 1LD3A 1KNXA 3NHMA 5TMEA 4G0VA 3T5MA 1GQSA 3K15A 4LFAB 4MWQA 1MX3A 3KAJA 4O4IB 4BE7B 3OETA 4AWAA 2FMFA 5FPHA 1UKBA 3AV0B 3IUYA 3U7RA 1KS9A 4V03A 4MJ7A 4MDFA 5ER9A 3SHTA 2P5SA 2JHPA 1UOPA 1RJ9B 3S3TA 4PLWA 2Z4RA 2HT8A 1DFIA 2C3UA 1JVSA 3EC7A 3QKRB 3GLIE 1H8HD 1MJHA 3OO1A 1OLUB 3AEZA 4BVFA 4JT8A 3KIPA 2JC3A 3UJ6A 1M3SA 3CSDA 3EXHC 3HKDA 1JFLA 4CPMA 1LJUA 2BEKA 3F4KA 1XAIA 2QRLA 3RK0A 2ZPTX 3AHJA 4L75A 5I5EA 2PUAA 2AG8A 2Y68A 4QYIB 2QWKA 1RM0A 2VYNA 4PX3A 1TZKA 1AV6A 4UNIA 1LTHR 4HRXA 5T8KA 2PX4A 2SCUB 3VPFA 1UPCA 4A92A 4EWLA 2FSUA 2ZYIA 2P4QA 3OBIA 3ZQ4A 4B0PA 4NN9A 4A0QA 1L8OA 1E1CB 4KQGA 1WU8A 3L18A 4L28A 2LDBA 5AVUA 5CXQA 3THWA 4I4IA 2FZEA 2LUOA 2VUHB 3II6X 3IQFA 4H18A 4M9CA 1CTQA 1UK6A 1XMVA 2DFPA 3DKRA 4OSOA 2NT3A 3TKLA 3KVNA 3IAEA 4UMEA 1T24A 4CKEA 1G8JA 1OMOA 1F7UA 2GETA 2P9CA 3DDCA 1EXDA 2XCQA 3HDJA 2GVZC 4RKYA 3VKVA 5JMTA 2OK8A 2HWUA 1MDBA 3I2IA 1QBKC 2FPGA 4G5OA 4JJEA 1H9AA 4LC9A 4PHTA 2AFVA 4Q00A 4Q7KA 3RUPA 3RVQA 3J81k 2VQ6A 5KKCA 2NXEA 4G4GA 2OO3A 3O1HB 1JF8A 1XNJA 3BTOA 1JHOA 2BFAA 5JADA 1LS6A 3DUWA 4QTZA 4C0HA 3LPDA 2JCGA 4GC5A 1Z0DA 3NDPA 1ZKDA 2LVBA 2WAAA 5H82A 1G8KA 1CZUA 3JAKA 3TVTA 3MOIA 3U9LA 1SELA 4FQ5A 1IVDA 2HWWA 1ULAA 3MINA 1MJGA 1K6IA 3PT9A 4L15A 4MJ3A 1W0CA 3D81A 2XJ4A 5D3MB 5DWDA 4GN9A 1JHRA 1FVOA 4Q3KA 1R6DA 2EYQA 4YZ1A 3EXG2 3D6TB 2JCVA 3HDGA 3LNCA 4BFXA 1D0SA 1LWNA 1YBMA 1N2CA 1P5JA 2QRKA 3HB5X 4W6ZA 2R44A 3C7CB 3U7GA 1ZEMA 2HTWA 3KEFA 1EDEA 3N86A 3WLHA 3AU9A 3PBKA 1KERA 4RFSB 1J0XO 4J1SA 1FMJA 4AWXA 2PMWB 1C9MA 3BCHA 1RRPA 1OX5A 2F17A 3OKFA 3CZQA 4CDGA 3SOQA 2JBAA 1VGQA 4TVKA 5KSWB 3KVVA 4MRAA 1WB4A 1VKHA 1JSXA 2JH8A 3JQRA 4G5QA 4QJ5A 1FVFA 2GCOA 3D5TA 4YRCA 3CNLA 4BZQA 3HYCA 4MA0A 4NJMA 3SDZA 1Q2UA 1ODLA 4IFTA 3WB0A 3ZYZA 4YUXA 4BO5A 1RLIA 4NBLA 4F2PA 1XALA 3FIJA 1BXRB 3K8OE 1OI3A 2BBOA 1NV8A 3Q3JB 4Z3DA 5LNK1 3LWDA 8MHTA 3Q6IA 2ZPUA 2R8YA 4HSGA 4ZT3A 3RYFA 3ZWOA 4KRXA 3EAGA 3DTVA 3L04A 4BO9A 5CCBA 1FRQA 1P60A 3PQ2A 4J4BA 3O2SB 4RWZA 2OB2A 3AEYA 5BV1A 2WJAA 2XGSA 5LDHA 3BDIA 5AI4A 4ZOLA 4LZOA 1TD9A 1D03A 4HEA6 3RC3A 1NQ5A 2ZI6A 1NUAA 3HMKA 3OPXA 1XTJA 1J2YA 2AFHB 2C0PA 1E5DA 1GR1A 2XA2A 5DHPA 1WQ1R 3X2FA 3U4QB 1VG9B 5HDBB 2BFWA 1V26A 2DPYA 3IDZA 5KX5F 3EGOA 5CB4A 2PKQP 3NP9A 2VDRB 1AK2A 1Y8RA 1BA3A 2OR3A 3CYFA 1NFFA 3FFAA 1C30B 3NBFA 4LVOA 4EB6A 4DIDA 3ONFA 4KQ2A 3CN7A 4QBIA 1WJGA 2OENG 3KU4A 5AD1A 2D3WA 2FFQA 3HLYA 1ABBA 2PT5A 4A8HA 4M9UA 5C81A 1M1XB 1JRLA 1OYWA 3JRNA 1YUBA 3SDSA 1XEWY 3TXXA 4IEFB 5REQB 1C3LA 2K7FA 2GHRA 3JD4A 3OZWA 3AI7A 4EF6A 2G8SA 3NKLA 5EIXA 1PR4A 4FNGA 3QHPA 1U2RA 3QPCA 5LDDC 1PW7A 1AGRA 3MJ4A 1MW9X 1GEGA 3WSWA 3R7LA 1H6AA 2CYCA 5AVSA 4R7GA 5ENZA 4KREA 4IXMA 3R0ZA 2GD0A 2BZ1A 5KZMB 1AC5A 3QYPA 1ZVMA 2X0KA 1JJBA 2XYHA 2R60A 2CJFA 5IBPA 4Y9DA 1IY9A 1WCYA 2YFKA 4IIVA 4B3SB 3BH7A 3DT9A 3LVBA 4TLCA 5AR1A 1AG9A 2ONYA 4XJWA 5FNVA 1BNCA 3ZY3A 2GZRA 3WAGA 3IP5A 1GCGA 3E6AA 1E20A 2ECQA 1Z36A 1EVLA 3EBPA 3IBFA 3PWZA 4GMKA 3WK5A 1UBRS 3X1XA 1XU4A 4AO7A 4Y2SA 3IEMA 3TRIA 4MR7B 2PRJA 1GFSA 3E8XA 3RS9A 2ZT7A 4CIWA 4QM7A 2P6PA 1WF6A 1XZEA 1JLSA 4C1NA 4G4SP 2AZ4A 1WW3A 4H53A 3I0ZA 2GCIA 2ZJ8A 3IPLA 1H42A 2HGZA 3L7BA 3OPYA 4ME6A 3IMKA 3IPYA 3O8BA 5FPTA 1FK8A 3LUCA 4BLWA 4DCCA 3OPMA 3O31A 4WZAB 3AM4A 3UB2A 1ZM9A 4OHWA 4EJ2A 5DH9A 5C8DA 1SNTA 3AL3A 3BMCB 1NM5C 4IMRA 4J16A 4Z4IA 2HX1A 1OXMA 1GRCA 3OPYI 4HNQA 4MW6A 4L9SA 2GEVA 3LFHA 1I1NA 1RRGA 1XVIA 3ES9A 4P34A 1R0ZA 1FTYA 1G291 1JYFA 4L4XA 4NBKA 4Z0NA 3ZV6A 5HRAA 4YMGA 2NZ2A 2HIAA 2QPAA 3TXAA 3AY0A 3HNPA 1UPUA 3EJ6A 4IPTA 4UBJA 5TRTA 4DIOA 3NP7A 2Q1YA 5E7JA 1GRVA 1TQHA 1W96A 2ZT6A 3KKKA 1ATIA 4GLOA 4P2GA 1U04A 4TUYA 4EGSA 1Y3BE 1OXSC 4N65A 1JQBA 1T1SA 3EXIA 5IWAB 2IATA 5CNKA 3A4MA 3BFXA 5ALVA 1U1EA 2DBRA 1N5MA 1XTPA 4ZAYA 3ZHVA 3OIWA 2BL4A 4IHJF 3COJA 5BSVA 1WPGA 3SREA 3BGSA 1YL7A 3NOQA 1EWKA 3K30A 4XSHA 1JYEA 1DBPA 1GQYA 1U8TA 2ZIXA 1NXTA 3EH2A 4GPD1 4L0CA 4AJLA 2ZYWX 1FEZA 1JJVA 2Q3JA 3JV7A 1HZZC 2XV1A 4QN6A 3P9PA 4P6VF 3W77A 1QLGA 1LXCA 2O8EA 3E2IA 3F8TA 3OPVA 1GGKA 5HA5A 5E2AA 4I55A 4M86A 3THYB 3AYZB 1IHPA 2XB9A 3SHOA 3E03A 1S1MA 2DBQA 2AJTA 4YRFA 3MRTA 1KAMA 1LVGA 4JQCA 3GOHA 5I7VA 1GLNA 4Z9FA 4K1KA 4TL7A 2C2YA 5DHAA 1J0CA 1Y37A 4F11A 4ABTA 1B76A 1Y8QA 4JUBA 4E12A 3HXMA 1QG0A 3ICOA 5FF9A 3WRVA 4R2IA 2B1QA 2O3RA 4P82A 4B46A 4YR7A 2CEKA 5G3YA 1ARZA 2NSJA 3AZPA 4MP8A 3QPDA 1PJXA 2QTVB 4UD2A 5JISA 1HPLA 3HU1A 3LKZA 4TYNA 4L02A 1O96B 1SCJA 2FSFA 4UCQA 3B78A 2IPNA 3JD1A 3LQQA 3X1DA 2YHUA 2O7NA 1KPIA 1M6VB 1O6ZA 4F3CA 1Y4SA 3CZAA 3OZAA 3QFRA 4MCIA 3TR6A 2DB3A 3V6MA 1O97D 2AQIA 2RFLA 4K1IA 2WB4A 3JYHA 1KGDA 1BD3A 5AHWA 3HXTA 5I9IA 2JASA 1XA4A 2DM6A 2X19A 2TMDA 3EEIA 4JB2A 2YS6A 5HWSA 5CB8A 1SCKA 4PINA 3A9SA 3BKXA 4QAQA 3RRMA 1FZTA 2FLVA 2J4CA 3JS5A 4OMUA 4O4HB 2X4GA 3DLHA 2BH2A 3PC8A 1ISJA 4HZIA 5T67A 1WQ4A 5K3OA 1J42A 1GNLA 1K63A 3MTEA 4N0QA 3AFOA 1MXHA 1TKRA 1MJFA 4Q4AA 4AZTA 3NHUA 3GRAA 4D57A 4GG1A 3PA6A 1OH5A 2RONA 3G2LA 4M1ZA 3QWIA 1GPMA 1PYOA 2X0IA 4ND1A 5TE9A 3L8ZA 4DCNA 3M1LA 2PQMA 3QE2A 4PG8A 2TECE 2K6GA 1SAYA 2CGEA 5LR6A 4RPKA 1YZGA 4QRHA 9MHTA 2CMDA 3PKIA 1C8VB 1ZI8A 4HWPA 4GRIA 1DMSA 3RVSA 1TTQB 3D11A 1TCCA 3H6GA 5DGTA 4PVCA 2ZUEA 3RUCA 3TL3A 1CQPA 2ZJ1A 4MWCA 1EFVB 4DDTA 3AYXB 4BNUA 4BQIA 1ISGA 3RS7A 1PJTA 4HHQA 3U17A 5LMCA 1JU3A 4JLKA 1E5TA 1DUVG 3HVIA 2J59A 1BS9A 1ULUA 3HTXA 2CFCA 5H81A 1B23P 3T7TA 2NSDA 3QI7A 1AKNA 1D0VA 1RI4A 1WULS 3E61A 4HN9A 1NXQA 3WDKA 1WY7A 2HHCA 2CXNA 3W3AA 1N0IA 1F14A 2AW5A 2JJ1A 1V47A 2JIDA 1K3TA 2H1RA 1Z5ZA 2FUEA 2R8XA 4RCYA 5E6UA 5LBIA 1FTSA 1LBTA 1CYDA 3K1AB 4MV7A 2J5RA 3SXPA 5D9BA 1U1CA 3ODPA 5AHOA 1LTQA 2HWKA 3RFTA 3T7CA 4JF7A 4D3XA 4NESA 2BRUA 3HI4A 2I54A 3OQVA 5JYBA 5C18A 3RS8A 5K7SA 3W09A 1RXSA 4R2HA 1YL5A 2RHTA 3L7IA 3DP7A 3UJNA 3U3DA 4N5LA 4KFRA 4WY5A 1S0JA 3BCUA 4EG6A 1XTTA 4LS3A 4WOBA 2C2ZA 2P0AA 4HEJA 1L7NA 2XUGA 4IMIB 3RFCA 4RTOA 3S70A 3UHPA 3N2EA 3GLTA 4DYDA 3AILA 4UHJA 1KH1A 4HNTA 3QI2A 5SYNA 4OUDB 1U0EA 6NULA 2ZR0A 1ZI6A 5K0EA 1JEAA 2PNFA 4ZT6A 5JS1A 5DNDA 4ARUA 4C4ZA 1YNOA 3S29A 5NLLA 1G21E 3PEVA 2Q9AA 1WUKS 4QDOA 1QK4A 1YOBA 4K03A 2WU4A 3UM9A 4W8GA 5IAAA 1F38A 3N2LA 1IM5A 3F6BX 2C4UA 2ZJ4A 2QMOA 3M0EA 1RW4A 3R6TA 4AJIA 2XGOA 2ZE8A 1U2EA 2HL6A 1T2NA 5I7OA 4OHBA 4Z0HO 3W5DA 3RTEA 2F59A 5LD2B 2OUIA 1BE8A 1FFXA 5LWHA 4MWYA 1SEVA 3PRKE 4ZGGA 2J31A 2QJRA 3TI5A 3EXEA 4BVGA 5A02A 3MTIA 1L3IA 3OUZA 4PN3A 2IDJA 5DK4A 2PTHA 2BGNA 1WG8A 4L8WB 2FMIA 2TS1A 4K3VA 1VSUA 4X65B 4V2IA 1NVTA 1EHCA 3QPBA 5IP5A 2IA5A 5J23A 5AVXA 1INWA 4FR2A 3RSQA 3KAQA 2CV1A 1O6BA 2LV8A 3ZZMA 1OXUA 1GAWA 4DDHA 2C4MA 1NR1A 4ZMSA 1YDWA 4FYKA 4BO0A 1RQRA 2F43A 4PFKA 4ZYUA 3LH5A 4A10A 5CP8A 1U90A 2AR9A 1SKYB 1XRSB 2I4TA 2PKRA 2YC2C 1E8NA 4JEIA 3CMMA 1OLXA 4A2WA 3HNRA 4DLVA 2QLLA 3GVPA 2I34A 2GN0A 5C1OA 2HPZA 3PQ7A 5TPZD 4FWBA 2JPDA 2JGDB 1XVTA 1F8BA 1EFPB 4ZTBA 3E48A 4D1YA 4P33A 2Z1DA 4FYIA 3SOVA 3FGNA 3I73A 1OX4B 3ND7A 1Z63A 1XKLA 2YDTA 1ZUD1 2FUKA 3OZBA 4NV1A 4WADA 3VR4H 4BEBA 3HCEA 1E8MA 1REQA 1XRLA 4U5XA 5LN1A 2JVKA 5C7LO 2D1RA 1JKFA 1FYVA 1ZOOA 2DH6A 2TYSB 1XPRA 4LOHA 3KR0A 3QUCA 4HHOA 1MGOA 3NTUA 1JAYA 1AX9A 1M76A 1W4BA 2OGZA 3KKZA 4ZO4A 5IAOA 1K7SN 3TRJA 1QR6A 3OP4A 3ZDFA 3ESXA 1Z18A 4M0MA 2P69A 3DZHA 1FDIA 2XCSB 5IN4A 3OT1B 2IYLD 1YULA 1IN7A 1KEUA 2WD7B 3I39X 3OHMA 4DNXA 1CP2A 2ZQ5A 3W2TA 1JP7A 5DNWA 4ZZ1A 1U1IA 1NPEA 1KO8A 2PSEA 2WABA 5G1NA 5JMWA 1G20B 3UUFA 4A8PA 1Z2AA 1DDIA 2PGOA 1AK9A 3KQPA 3C15C 3OCZA 3GUVA 2BN4A 2QW0X 2A58A 3R09A 3ELYA 1GITA 4UUOA 1VJGA 3LHIA 4QVGA 3VR3A 1P80A 3K1ZA 4FZJA 3DO8A 4G6ZA 2E21A 4FKBA 4ZAZA 4HX2A 2P3SA 1RT9A 1J2JA 2GN8A 1SC4A 4NENB 5GADl 4CLEA 1N2HA 5K01A 1Y8CA 4B6OA 3GJ8A 2P2ZA 4BX9A 5EYPB 3H8SA 2B2NA 1UEJA 1GZUA 2FMHA 1P4GA 3CIFA 4QOFA 4PIMA 5CW2A 1F5NA 2F1HA 4NQRA 1I9GA 5HFAA 5CYOA 2HDHA 3NTQA 3V4RA 4WBNA 2GLUA 3O8CA 4FEGA 3DV0B 2C4AA 3M6FA 2VXBA 4QOJA 4ZHQA 1BWRA 5K0GA 5AI9A 3JQBA 2Q4RA 4G89A 4JLUA 3WIOA 4B3MB 2VK2A 3Q11A 3Q7SA 1P0MA 4JLVA 4MCAA 1OXTA 4MRMB 1WLSA 4R5MA 3VDXA 2P79A 3MB8A 2HT7A 5EXPA 3VPSA 1P6XA 2P5TB 4GM4A 5CDGA 1R8QA 2JCXA 3UMCA 3TECE 1WTCA 2TMGA 4OOEA 2VTVA 4CQJA 3GFRA 5B3JC 3WNVA 3TICA 1RAIA 1ZGZA 4QNNA 4E1AA 5KC9A 3AFGA 4MAFA 3VR2A 2HMUA 1LKZA 2H5IA 4GZ3A 1GXSB 4O4JB 1DFHA 1JQDA 1CLUA 1XUOA 3JAWA 4HDNB 1HFWA 2EP5A 3K0AA 4MZEA 4BNDB 1JAXA 2CK3D 4OLHA 4YYZA 4C7OA 2DWOA 3Q3VA 2HQOA 2C2BA 3JQPA 4G1CA 3RNOA 4CH9A 1GARA 4LHYA 2Q5JA 1RC1A 2A67A 2GPTA 3QVXA 3U37A 3V64C 4HRAA 4I08A 3UC5A 2QRVB 2VHVA 4JLSA 3ZLJA 1JEYA 5EUCA 1XEAA 3ILSA 2W8BA 1GQQA 2F4VB 1PR0A 1ZD4A 3USCS 3OIUA 3FOWA 4RY0A 1ZVJA 4F71A 3MGBA 4JI3B 4LPKA 1M8JA 2B4AA 5FBLB 2I55A 4K6HA 4B5KA 1GU0A 2ZVJA 4HI0E 2P9TA 3UMJA 3EW9A 3TLJA 4F38A 5F7XA 1MX5A 2BKEA 2EQ5A 1ZVKA 2XDQA 5KNDA 3OF5A 3O9JA 4CM5A 1JHUA 4R6WA 1GZ7A 3G1UA 3K9HA 5E4JA 4CEIB 5CLIA 1H8ED 1CSEE 3NHWA 2C00A 3SQLA 3ZUGA 3SS8A 3TNFA 1OWPA 1PJAA 2R6JA 2ZAOA 4EVIA 1BD4A 2OKCA 5AW7A 3DBLB 1L9KA 1N2JA 4RK4A 3E70C 2BEWB 3MJSA 4D4GA 2I3ZA 2YZMA 4NP6A 1P7ZA 3FJYA 5DTIA 5A4MS 5IKOA 3W6NA 5HSGA 2J9XB 1N7JA 5CHYA 2C88A 4X47A 3HCAA 1N2ZA 4K6FA 1N92A 2AXNA 1GJRA 1CT9A 2VK4A 3KQMA 3WWCA 4KIGA 5I8PA 4R71A 4WV3A 5JLAA 4NYJR 1Q7TA 3FYHA 1D1QA 5G1PA 1U0GA 1UIMA 1T5IA 1EWYA 2WKWA 4MGYR 2WAXA 1J8QA 1THMA 3HPRA 4PHFA 3DLBA 3FFXA 3WFZA 1KK3A 4PO1A 1M8FA 1D2RA 2J6CA 1VKZA 3ON5A 4AX8A 1OASA 2I4LA 2G04A 3AI3A 1K88A 4YPFA 5LA6B 2PMEA 3P27A 1KVTA 5IVHA 1F5SA 1X94A 1HFEL 2DWCA 3FNEA 1SKMA 5IC6A 1UWVA 2UAGA 5CD9A 3EPLA 3NDBB 3L5OA 4KWHA 4INJA 3CW9A 1E3IA 4L6IA 4AQ7A 2CLHB 5EP3A 3VDRA 3PHCA 4N82A 2Q3DA 4IYGA 1VPWA 1G7SA 1RXWA 1QUFA 5AW9A 3LC2O 3VZSA 4EQ6B 4MYRA 1M34E 3VPAA 1ZRMA 3HRHA 2DYKA 3WO0A 3H8WA 2QQGA 3BFJA 1WX1A 5IVDA 4UD6A 1PX2A 3SE7A 1YZQA 1ZA1A 2FVXA 3GLHE 1V3UA 5F4BA 2Q5FA 3OZEA 3T0GA 2BTQB 2P9JA 4G86A 3I0MA 3RHZA 2IASA 2ZYHA 3A1EA 3UK6A 5CLFA 3H65A 1XTBA 3C3KA 2XOKD 5L6MB 2XGJA 1ZBDA 4QXAA 3RHTA 5EVCA 3I04A 5KSZA 3ZWNA 2HDWA 2YVKA 4PWYA 1AQJA 1HLPA 2PL5A 5BP7A 3H8JA 2L19A 4RTPA 1A8SA 1P5HA 1ISRA 2FE4A 5CM8B 3MWKA 1T4MA 3QGMA 1NI4B 2ZSBA 6GPBA 2ACVA 2FSSA 4PTZA 2WF8A 5CTJA 4XMAA 3DW3X 3TLMA 1SCQA 4QEZA 4K9RA 3VR4D 3BTUA 3H0EA 1CR0A 1ZD3A 4MJXA 2Z6AA 1S2MA 2PEYA 2YYSA 4TMZA 4ZU3A 3ZWCA 3IYLW 4HX5A 4ZVLA 4DLNA 4CKCB 5KOHB 3QITA 3GUZA 1T8RA 1VG0B 2CHQA 1YBVA 4EKIA 1N5OX 1QCYA 3F5QA 1Y63A 3PFKA 1RQXA 4WXHA 5TQ0A 5KREA 4KR3A 3ZCSA 2XMDA 4NRDA 4XR4A 5FBZA 5E3IA 2VWDA 1N5RA 4IDPA 5TPWB 4AKSA 5TDHA 3DOFA 2W98A 1RZ3A 4H1WA 4IP0A 2C57A 4KN8A 3RABA 3PHHA 1BX1A 1GUAA 1QCDA 1F0YA 1GU7A 1AB5A 1PDWA 3HVHA 2B82A 2O1SA 3G5TA 4J0HA 3V2HA 1N33B 3ROGA 4M4SA 3FMFA 3OE5A 5IJ9A 1SK8A 3IKTA 5SZKB 4G0QA 1XL0A 3ILVA 3KUUA 4CYMA 3J81A 1RBYA 4WEFA 2D1YA 2ZCVA 2IV2X 2QGNA 3LBAA 2G82A 5K0FA 2M1ZA 3CONA 3TIAA 1OAKA 4OQYA 4UE2A 4I50A 2NPFA 3KOZA 4X84A 3W7AA 4ND5A 4R9VA 4BFVA 2FK7A 3RYHA 2C4LA 1YTUA 3PNLA 5KX5A 1DV2A 3D8HA 3OY7A 1V5EA 6ADHA 5FNTA 3R5FA 4WEGA 2PS9A 2HMVA 5JSKA 5CPBA 1MAHA 3T61A 4WE3A 3WL6A 4ZCRA 4HF7A 1USKA 3OCXA 2GESA 2LXNA 3ABOB 4MVJG 2PXHA 2EW8A 3TS1A 4LYDA 1WRBA 2BM0A 2HT6A 1XQVA 5H1YA 1NLMA 1AN0A 3N6VA 1EDOA 3TQTA 3QVTA 1SU4A 1Z0SA 1B8UA 3ZWAA 4EM6A 3FNFA 4AJEA 3GJ5A 3L7AA 3NNSA 1NASA 3OIYA 4OMDA 4DVJA 4FU0A 4H3KB 3AVTA 1E2UA 3Q5EA 1E3EA 1H4TA 2Y0DA 3ZW8A 3HDVA 3FLBA 1FU4A 4QQKA 2QKYA 3LW7A 4DANA 1DL5A 1O0CA 4YDHB 3TW4A 4DCSA 4MW9A 3TQIA 2O57A 3AKZA 1T9CA 1P2TA 3IGFA 1FQJA 3AZOA 3AR5A 2O59A 1LLCA 5CLGA 2I6GA 3QEKA 2IYFA 3TVDA 1UOQA 3G49A 1SCNE 4QRIA 4UJ3A 2QF7A 1NUPA 3H2HA 2FW9A 5F73A 1JPUA 4PRYA 3T3EA 1T8SA 1ZWLA 4WJZA 3E0XA 3GOQA 4QTUB 3VPBA 2EJTA 5EMNA 4OKNA 3B1JA 3KEOA 5AICA 4AD8A 1E4OA 5TIIA 3STYA 2V7QD 3COWA 4N5IX 3PYLA 3R5TA 1CUUA 3NONA 3F2VA 4FPKA 1T9BA 4RHEA 3AJAA 3A0RB 1GPH1 3BIOA 2IYUA 4FP9A 4JVNA 3F9RA 3R5SA 2P3OA 2VZLA 3K9NA 4TWBA 4D46A 3F6YA 4Q3OA 1PWXA 2VPIA 4FT2A 3LWZA 4L0MA 4BP3A 4CETA 3M6LA 1RQNA 3HB7A 1L2TA 4XHXA 2GJAA 3TQRA 1ORVA 1N2XA 1WMBA 2DPHA 1GV0A 1UDCA 1CUFA 1DQZA 2Z5GA 2ZSUA 4X1IB 4XA8A 1VPVA 2E87A 1SVNA 1EKXA 3AFMA 1NUQA 5J2UF 1VE7A 4M7RA 3HYRA 3VPGA 4DREA 1HOXA 4S05A 2O3SA 1P44A 1JG3A 4BFLA 4E2FA 3ENZA 1SK9A 2Q3BA 2VQDA 4PZLA 3G5LA 4K9MA 4Q6BA 2A4MA 3GG9A 4ZO9A 3SZ3A 3A9GA 1MR5A 3E15A 5DIFA 3DOCA 4CT0A 2OAP1 4IW3B 4BP1A 4BRWA 1W5AA 4JUFA 4CTMA 1G0OA 3OMXA 1JZQA 4Q19A 1P17A 1WCSA 1K6MA 3G9XA 3OQJA 2R4QA 4NATA 3PQ8A 3OEED 5JCOA 1R88A 3SYTA 4P3NA 3DE4X 4UM8B 2GBPA 4DKXA 2O54A 2NNLD 2VCYA 4IWXA 2PL1A 3SSAA 1PD0A 4S1TA 2CDAA 4BNNA 2JHAA 3H86A 2IS1A 4WERA 2MOKA 5KQMA 5IZCA 1DSSG 3PIRA 2AZDA 4OHCA 1HI9A 4CXMA 3WYDA 1IJFA 1QQ7A 4HNVA 1Q0TA 2WRZA 4MV1A 3OLZA 2R87A 5HUQA 4HIZA 4MITA 5D1NA 1O5OA 1FYDA 1B0UA 1RKXA 1TLFA 1V7PC 3ZPXA 4XKJA 5FI1B 4HV4A 1P2DA 1XDBA 2IHNA 2OZKA 1WU7A 4TROA 3FNQA 2JFFA 4C0XA 1USRA 1A88A 221PA 2GEJA 1ECLA 3UXEA 4X3OA 1TW2A 2NV6A 4OU4A 2REXB 3E53A 2C1ZA 4IY1A 1P0PA 1PNQA 1A77A 3P2MA 5IEJA 3LO5A 3WB1A 4KH1A 2D2FA 3HXKA 1ZESA 2Z9DA 4IBOA 4YMWA 4G5FA 3NR2A 3NXSA 5CK4A 5JAQA 3W6PA 4LYEA 2GVNA 5FNZA 5LZ4A 4IGAA 3GJSA 3I8SA 2BV3A 2ZIGA 2CLMB 5BMOA 3CL2A 5SV2A 2JFXA 3L8CA 4JI7B 1ML4A 1L4BA 1K0UA 3NWBA 4D41A 5IHPA 2OC4A 4OAQA 1Q0ZA 3MMXA 1E2EA 2WC1A 4NQZA 1YS4A 3P0JA 4PZDA 4RV9A 1WBDA 1M2JA 3V9AA 5LZ8A 2YMQA 3S55A 2FPPA 4YRAA 1E6UA 4IDHA 3N2ZB 4YMTA 1XOIA 3CF0A 1ZH4A 4QC2A 2JDID 2AMJA 4RGYA 5I4BA 3GLVA 1VHDA 2R7MA 1A3CA 1V39A 2V7GA 1EGQA 3BD7A 1RXIA 4IDOA 4B71A 3KXIA 1LA2A 5E8RA 5C8YF 1XHFA 2KB0A 1O7JA 1W29A 2J1LA 1ENYA 3AETA 4MR8A 2FZ5A 2GYUA 5DP2A 1BTOA 5F5LA 3WADA 4DUPA 9LDBA 5KVAA 3JQQA 4KGVA 5GY7A 1DBRA 1YE5A 3OAAD 4QUDA 2AFHE 3TI7A 4B31A 5PGMA 1GTMA 2J5XA 5FPYA 4IO1A 1VMAA 3WLLA 4B6FA 2EIHA 4RWEA 1UJMA 3T41A 5IUKC 4DTCA 4QUIA 2ENWA 4OGFA 3ADCA 4RIEA 5L4LA 4KAJA 5JRDS 4G3NA 3G4HA 3AUKA 4HXFB 4D99A 3PLAE 2FRDA 1PVOA 5CA0B 5CVCA 2X1MA 3SZMA 1N34B 2O8BA 2TMKA 3JZIA 1WOMA 2CL7X 5L9AA 5EHZA 3THWB 2GSDA 4N7JA 3AEXA 2BP7B 2ZVDA 3IP6A 3B3JA 1CUGA 2JKZA 5COAA 2XSZA 3PC6A 2V4UA 2YY5A 3HA5A 4ZVKA 5LYYA 2E4WA 2R66A 2IODA 1FDWA 2X9LA 5CR9A 1HL7A 3PCXA 5JTTA 1Z4VA 1QVZA 3PA8A 3PKJA 3INNA 1R66A 1UDBA 1T2FA 1E0SA 5JXGA 4RCVA 4OREX 2XF2A 3OI7A 3RIHA 4MLPA 3PHJA 1PT9A 3N70A 4GSYA 3GJ7A 5IBCA 3G88A 3F3MA 3T54A 1E89A 2Y77A 1JLRA 3D8SA 2VH2A 3LVRE 3PS9A 2P4UA 2CFOA 2OCDA 1Y33E 2Z8XA 2EL7A 2ERYA 5DNYB 4TSFA 3ZLUA 1N2IA 1IHDA 5GM1A 4EITA 3WE7A 4LQLA 4C7BA 2I80A 3AVPA 3QLVC 5J4LA 1DBVO 3T94A 1OV6A 1UOOA 5T64A 4AC9A 1Y4DE 3WBFA 2XXAA 3LP6A 2FX2A 5A1TA 1L4EA 2QNBA 2X23A 1BOFA 1WPQA 3W6UA 1JAIA 4R1QA 2FXIA 2P6NA 3G0HA 3GFPA 2IC5A 3UCXA 5I7UA 3B2EA 2CE7A 4PONA 2R8EA 4BO8A 4JJ4A 5CYGA 4CTKA 1AU9A 1G16A 3UT5B 3F96A 5HP4A 1JEEA 1ZSVA 4DE5A 5KMGB 5FBKA 2WINI 3A1FA 4PAOA 3WHKA 5J1SB 1P5RA 2OFOA 1NOJA 1GGVA 2L0XA 3NWPA 4O6VA 2DKFA 4TZKA 4J0JA 4F6LA 3DBOB 5KTPA 2XCLA 2WMNB 3QTBA 1GKIA 1Z6QA 5MN4A 1YB5A 3C6QA 1XRRA 3NBZC 3JU3A 4XTCS 3WMRA 4YJ3B 4DT1A 5JVDA 2ANCA 1NVUQ 3O4PA 4MUEA 1U81A 3IULA 3HBLA 4OK5A 4FFPA 3VTAA 2ZIAA 5HGJA 1IPEA 2GUWA 3I2FA 4D9JA 4DSNA 4EMUA 2RBGA 4PXSA 3O75A 4J0KA 2Z2IA 4KHZA 3O38A 1T3TA 3H6HA 4F4FA 2BMWA 2Q5LA 3C6MA 3LDFA 1CE8B 3L0SA 5EFZA 2R6HA 1PEYA 3BRWA 3BHNA 3CKMA 4MKFA 1LBIA 2BJVA 5F51A 3UZUA 4AKTA 3Q5GA 1GGFA 3PDIB 4OP2A 3WGGA 2R6DA 4EFMA 1SD1A 3ST7A 2H2HA 4RF5A 2YV5A 3DNPA 1SFRA 1F48A 4UEQA 5DLEA 2O2EA 2WJZB 3CPHA 5ALQA 2AR0A 4IF4A 4KS2A 1YU9A 3V7NA 1YK1A 2D00A 2ZK7A 3NJ8A 1SNYA 3LT2A 4GICA 4N3AA 4U7JA 3SFVA 3G0BA 4E1BA 5K09A 1IEWA 2VYCA 2C95A 4TMWA 4C5BA 3B9PA 1TVKB 4MQFB 5LUAA 3EXHB 4REOA 4IJKA 2FUG1 1JPJA 3HCRA 3L43A 1U7UA 5A4DA 5ARBA 1JHYA 1DAFA 3S2FA 1NCDN 1KFJB 4CKWA 3ZGVA 1O89A 4J2TA 1HKHA 4OFZA 2F90A 1EQUA 1Q1NA 3EPPA 5ECDA 2R1VA 4AF6A 5EKTA 3F6RA 4AT1A 1Z2DA 3WGIA 1VI2A 4KVFA 1T2UA 3BWCA 2V7WA 5BUZA 4IFEA 1U7OA 1LQUA 1USGA 1Q7BA 2C2GA 2RK6A 2QX9A 2X13A 2VBGA 3GIWA 2QLJA 1PS0A 3HY6A 4X20A 1L4LA 4CMEA 2LTAA 3M6XA 1OLSB 5IK2A 3SOPA 1DADA 2RGWA 2YOFA 2I29A 3IILA 3SC4A 1V7CA 1V8FA 2MIIA 2XZTA 1YQQA 2IXDA 2QJWA 3TAXA 4CG2A 3DYBA 1I0ZA 2XLCA 1A97A 3CF4G 4JS0A 2QTFA 3QKSA 5CVJA 5DXAA 2GK7A 4MDYA 4C5AA 1ZNQO 2B8JA 2PGNA 2CLIB 4E03A 4MYDA 5FV7A 2IDZA 1L5HA 5EPEA 1IBRA 1Y9JA 1YRAA 2AEEA 3AERA 2DFTA 3LT1A 4WXYB 2YZ7A 3WVNA 4AROA 1L7AA 1SR8A 2L42A 3SZRA 621PA 5ALDA 2QYTA 1JEOA 3QJ5A 1PQ4A 4HWTA 2ZJFA 1NW8A 1ZX1A 2DF8A 4Z1MA 1WDKA 3DWIA 4QM6A 4XYXA 3PGJA 5LYJB 3VTKA 1RPZA 1LLUA 5H0IA 3RLFA 4RVOA 4LJ7A 1NSBA 3FI9A 5IF3A 4UU0A 1ZN8A 1NTOA 2IF0A 3FTDA 3VZCA 4DSZA 3EC1A 1NBAA 4OXNA 2XNCA 2PA0A 1INFA 1XSEA 3QKUA 4MVJM 3Q3IA 1E7MA 3GA5A 3PE4A 3KQOA 5A5FA 1EP3B 5BOSA 1N0HA 1TRHA 1C29B 2IYYA 1QHGA 1IRXA 1ZHHA 3I9JA 1S8OA 3O47A 4H0FA 1VE1A 4RJ2A 2FW7A 3ANMA 3DZCA 4B3IA 2G9RA 3E7FA 2NPIA 5E9JA 3PIIA 2WOJA 1W35A 2HHJA 3ZU5A 3AM5A 1X7HA 1AQUA 3ITEA 4CPYA 4O5TA 4TKUA 1U8FO 2IFTA 3FYUA 4NZPA 3QELB 2R62A 3PF8A 3RHSA 1NNEA 3D6MA 3E5MA 3QPWA 4URHA 3WK8A 4RPJA 2Z4SA 2HJVA 5A9SB 4B3RB 3FOAA 2W5NA 1CEEA 3MWFA 1JFFA 2WV7A 2W6PA 2V0NA 2ZI9A 1AB6A 2YFHA 3H13A 3H9CA 4AS3A 1X39A 3VYUB 2X4DA 1LX6A 3EIXA 4YASA 5CA1B 2W5UA 3QSYA 4DR6B 1GPYA 3IVMA 1IWBB 4YRRA 1V3BA 4ZZ2A 1N1YA 4W8HA 2H16A 5JLJA 1YJ5A 4L07A 2CCGA 5J4HA 2ISSD 1TQDA 3AQ4A 1K27A 3IBSA 1G5HA 4FWIB 4IDEA 1SD2A 1G8AA 3M4ZA 1BWSA 1PJZA 2GO7A 2I7VA 4ZRMA 3A72A 1G9SA 1AUOA 3WK9A 3RYCA 3NI2A 4I9NA 3R74A 3ZY5A 4Z4HA 3DL0A 2QRQA 2PZJA 3H05A 1AQ6A 2VPJA 1QIIA 3F9IA 2HCRA 4HYEA 4QXQA 5FR2A 5KYVA 2PNJA 4E2XA 5L3SA 4B6SA 3CX8A 5ERXA 3QOFA 3IQGX 3ROKA 3TNYA 1EM8B 3CTPA 2ZYSA 3EPJA 4YECA 5A6VA 1Q84A 1OU4A 2F9FA 2IZ0A 4CPZA 3E7PA 4FS3A 4YJ2B 1V25A 4QDKA 5KYWA 1OVGA 3VI3B 1L9XA 5AJWA 4U7FA 4KW7A 3VR5D 1KQNA 2AXQA 2QD2A 1E2MA 4BB6A 4KXFB 1H2FA 2WVHA 1T5TA 3MMNA 1E2KA 1FP7A 4YGXB 3FW1A 4G26A 1ULBA 2R2AA 1KDTA 2P6UA 4IF6A 2FQ1A 4AIRA 1G3QA 1G2IA 1WDWB 1D1TA 1H8HA 2HJWA 4W7HA 4D5EA 3N3AC 5LQDA 2WNIA 3R3XA 2JAWA 3OZFA 3WA6A 4HZVA 3EZXA 5L3QA 4Y2HA 1FS4A 4DWOA 3WWAA 1X74A 5BQFA 4OTZA 2SLIA 4BQSA 3IDAA 1E2JA 2XMPA 1K8YB 3X0DA 3KJIA 2HMSA 3MELA 4Y9UA 2Z5VA 1K92A 3EQ7A 4ASCA 3NFRA 1M54A 1N8SA 2COUA 3PGVA 4G9GA 2JI6A 4F45A 2XQJA 2HIGA 5BQPA 3DOOA 3NRBA 1SGWA 2BPOA 5A03A 1ND5A 1N32B 1JHQA 2RHLA 5GOZA 1X77A 1ZMXA 5BWCA 2W48A 3QVKA 4GDMA 2V7EA 3LGSA 3MQ4A 3HDQA 3FWPA 3HO6A 5TJHA 3GG2A 4YRPA 5BV0A 2H7XA 4NULA 1U63A 2ZBRA 4LJSA 1MN6A 2GK6A 3OFSA 1CR1A 1P9NA 2PKWA 1INHA 1YMQA 4Q9DA 2II6A 1SVMA 3CLUD 3UY4A 1FTWA 2PXAA 5AXAA 4CMHA 2YN2A 1WSAA 3ID6C 4YCAA 4G23A 4GM0A 2B8NA 2W2QA 4LGCA 2BZDA 3M9XA 3M3DA 4CPNA 3KOUA 3U3RA 2XUJA 1NMXA 1X0VA 4M8KA 1DIOB 5IXJA 2FAXA 2OMKA 1DQNA 3AEUA 1P3JA 3SXJA 4DVGA 4IN4A 3A6GA 3P9IA 4KK4A 4F6RA 4Q24A 1H94A 3NALA 5J59A 5GMOA 1V37A 1W49A 2IE8A 1B3BA 3HWSA 3M6AA 4A2CA 5B1YA 1P9LA 2L18A 2ZIUB 4YRGA 4QU5A 2OCGA 4D9GA 3FGZA 3MCTA 1JALA 1R5JA 2Z8YM 2QWFA 4ZAWA 2G83A 1YCGA 5AVWA 4RK0A 3IJ5A 1DP4A 16PKA 2QX4A 1KO1A 1C4OA 2Q5IA 2ZRGA 5H4HA 2JLBA 3L0CA 1H85A 4RTNA 4Q37A 1EK1A 3OOEA 4XJVA 2FN8A 2VXCA 1S3GA 2REBA 2WD8A 4AJ1A 5JECA 1L5LA 3RFUA 4B6JA 2Y1FA 3PXEA 4K46A 4DQDA 2XRFA 5CT6A 3DSRA 3DC2A 2F55A 3P0FA 3LKDA 3B1YA 1BS2A 4O4IF 2XRMA 4WCVA 4XEHA 5CRIA 3T7RA 2GYVA 4M54A 1KOGA 5I48A 1KAHA 3ZGDA 2EFJA 1QHNA 2MYUA 2Q0XA 4QUGA 1IN6A 2HIMA 3BIJA 4H7PA 2JCSA 2PKCA 2PS3A 2PX2A 2HHLA 3EIOA 3QWHA 1J49A 3I76A 5G3ZA 2ZM6B 2WU3A 3UMMA 3ZHRA 1NMYA 4CR7A 2X9VA 1WCIA 1IOWA 3OJLA 1EFTA 4U02A 5FXMA 1HWYA 2HT5A 1KDOA 3RM3A 5B6JA 4C78A 4HNGA 2JEYA 3RJTA 2NO0A 5DZSA 1KGSA 3DZFA 3K38A 2OHHA 4OQPA 4QVKA 3DKVA 5JRZA 1OI4A 1SBTA 1Y7PA 3QFHA 1RZRD 1FNSA 1ZGGA 4FGSA 1E0KA 3JARA 5A2GA 4YJDA 3QU4A 1PNTA 1IM2A 4NPAA 5EWMB 5EMLA 3W4IA 2R85A 4OMCA 4CKYA 5BW5A 2QTHA 3U3MA 5KUTA 4M0UA 2FGKA 2XZPA 5JR3A 1LTKA 2GFQA 1M6YA 1U3FA 2FPLA 3D7RA 1ZVQA 3N2GB 4ICIA 1K7FB 1T2EA 2NUAA 3B9BA 4QX6A 3EGXA 3W06A 4GDJA 2HI0A 3OQ1A 3W2EA 4ND8B 5C7IO 4RKQA 1AQYA 2F0ZA 3D7KA 4GBGA 3MRXA 5CD1A 4TMFA 1N7HA 4KR0A 4PO3X 3THXB 1U0OC 4J0IA 4U9HS 1EZ4A 1B26A 1RJEA 1XWIA 5ALPA 3A1NA 4RL4A 1H1LB 3OLXA 2IS4A 1AKTA 4U7PB 5B4UA 3REOA 2OWDA 1TVEA 1PNOA 3LX6A 1TJ5A 5F9HA 1LK5A 5U4QA 4B45A 3ELUA 1N9GB 4A9AA 3KXKA 2ETXA 3AR4A 3JVVA 3IT3A 2BJWA 3UIEA 3CZCA 2C1EA 3Q9SA 2SNIE 4X8LA 2XCRB 4IEEA 3KT3A 3NHBA 1SCAA 4ZEMA 4QTYA 4AKGA 4GYYA 3SJ7A 3RREA 3K37A 3PUWA 5DGCA 4J49A 4JJGA 2RG1A 1H5UA 3SJAA 1Q11A 4Y3UA 4YT2A 2GQ0A 4UBIA 2DBVO 4UOZA 4LVUA 3MLAA 4JT9A 4G09A 1FLNA 3V55A 5BQ5A 4EUFA 5LQKA 3MGKA 4AQDA 5I01A 4FPHA 1EG7A 4NWIA 4WNAB 3ZV5A 3QX7A 4F3TA 2XKBA 1NY5A 2HTEA 4DMHA 4TSRA 1JIXA 1O0BA 2EP7A 5IKPA 3GD7A 4WKCA 4RIFA 2HLHA 1E1YA 4PCAA 3SIXA 3KAKA 2F3PA 4JCCA 4KODA 3TLAA 1K08A 1SBIA 2FSPA 5K05A 2JGEA 1XL1A 5A2QA 1X14A 3TTYA 1S1CA 5F9TA 2B36A 3GQBA 3NAQA 4PW0A 3VOSA 4PSCA 4EUNA 2ENUA 5JCJA 5J2UA 3HM2A 1VGVA 1OROA 2MSNA 3WYGA 2YA7A 4HXYA 1II9A 2EF1A 2AE2A 5DOZA 3RT1A 1NMQA 5CXXA 1YIAA 2WJYA 5C53B 2B99A 3G9UA 3U7IA 3FRIA 3WWOA 4FM9A 5B7QA 3NYIA 2ACKA 5G4LA 3HPQA 2D1SA 4BNWA 1PWZA 1Y1TA 3C6YA 4H0CA 3WNBA 1LB1B 1TZBA 3EASA 1AT1A 3CUYA 4QDTA 1NP6A 1OE0A 2PIDA 3WLNA 4D3ZA 2TSYB 3B8EA 4TKLA 1LPAB 1RYDA 2ISCA 4NYIQ 2IXGA 4GL2A 4J43A 4E0BA 2WOOA 4U8HA 3GFTA 1E3MA 4BNKA 4XMIA 4R3WA 4F04A 4YZ3A 4GI2A 4MQEA 2R79A 4XIJA 1TADA 3CVOA 4HQOA 3UA4A 2OORC 3IIJA 5CGQB 3GN1A 4HVTA 3BJRA 2RH4A 3G82C 3R0XA 2ZM5A 4F8YA 2B37A 2AS0A 1SD5A 3P20A 3AW8A 2CJPA 1GL9B 4LDJA 1SOUA 3GR6A 1ETUA 2BFFA 2YXDA 1SJ9A 3HWWA 2NACA 3UK2A 3LA6A 4GOND 4ZI7B 5HIKA 3F49S 4AZ0A 1AKYA 2DT8A 4N1AA 1C2YA 1MS4A 1EVIA 1AXRA 2EGGA 1PFUA 2ZJAA 3LLCA 2CY0A 3IKLA 1NVXQ 3PITA 4ITVA 4DGSA 2LIPA 5KTTA 1UP6A 2QUIA 3EMBA 1AN9A 4DF3A 1HA3A 2QQEA 4DMCA 3DEAA 3DLPX 2IHTA 2GNOA 3QLUA 1TJYA 3ZGNA 7MDHA 5LKRA 2B0CA 4Q03A 2Q9UA 2BMDA 1N0UA 4G8CA 4R68A 1Z29A 2FZWA 3HKEA 4JOSA 4WDRA 4AJ9A 4JVOA 4NBTA 1MRNA 1NNAA 1F0PA 4IIYA 3BILA 4NECA 1EZ1A 3AB8A 1Z6XA 1L4GA 1U7PA 4U2DA 2PGXA 4TMXA 2PZAA 4ZYLA 2HBYA 2OZLA 3R40A 3TI8A 1U2DA 4GLBA 4UXIA 4FSHA 4KE6A 3B1FA 2A84A 2C5FA 3AUSA 3VTZA 4NBSA 1SN7A 4RTMA 2WIGA 4B85A 1Z3CA 2W2KA 5ALKA 4WJLA 1XTRA 4C1YA 1U65A 1MB2A 3G8DA 4Q1VA 5JYYA 5AXBA 2J3LA 1DNPA 2FQXA 1U3DA 3AF5A 4N8SA 4PIPA 3IKMB 2NU8B 2HNBA 4F4CA 1Z37A 4L73A 4ZIRA 4G5RA 2R751 2IEDA 1MC5A 1WO8A 3OMLA 1CUHA 4K28A 5C8YA 4B6EA 4AO6A 3I2GA 4GWKA 2Y4OA 2ZDHA 3OZXA 4TMVA 3V7WA 4EA9A 3KE9A 4B74A 4LTDA 1YE3A 3GMSA 3HCCA 2IV7A 4IDQA 1US8B 3RVLA 3SYLA 1SU8A 4RD0A 4EYSA 4F93B 4WINA 2UYOA 4PYJA 1XQXA 1GG9A 1B43A 3HUEA 3V8PA 1VB3A 4L4SA 4E5YA 1JSZA 3KYAA 1BEZA 1YIOA 4N6NA 1WHTB 4NCAA 2HGSA 3TPCA 5I7FA 3YASA 4DABA 2WLSA 1HQCA 1NYLA 2IOHA 1KO4A 4IWYA 3I4CA 3OT4A 4OA8A 4X90A 4EF5A 2BFBA 4L8LA 4YPOA 1IDOA 4ZYZA 5JFTA 1Y98A 1TA9A 2OGSA 1RXCA 4F2GA 2FWAA 1IVBA 1B74A 2CJWB 4CL3A 1KAEA 1AZWA 4XIYA 1E3WB 4FEAA 2I9KA 4Z7NB 4D74A 3L8FA 3LLSA 1KMNA 2A5YB 2H1CA 3G0GA 1X1AA 4R2JA 4BO3A 2ZXUA 4PQFA 4XPZA 1OJ7A 2V5AA 3A6FA 4PO9A 3T1OA 1OV4A 4U8GA 1ZHOA 2EXXA 2I2BA 4N5MA 1QLHA 2ATCA 2B21A 1PJ8A 4ZVPA 1JDBB 5G0TA 3O8OB 4NXMB 5F72C 1N1EA 4MDHA 4PRZA 1SXPA 1AA6A 3SU8A 4BMXA 4DCJA 2GD2A 4Z4GA 2XJ9A 2NTEA 1J99A 2E49A 1DEOA 1XYGA 2QD4A 4KNVA 5JCOC 1R2QA 5L7TA 2JGRA 4YW1A 3MXOA 3QQPA 1CPYA 3ORYA 4MHTA 5GJBA 3Q7QA 2VZ8A 3PXBA 1EAYA 1W21A 1DINA 3EIEA 3H2YA 4RADA 4TXJA 1VBKA 1E4YA 1FPMA 2B3DA 2D2IA 1FFYA 4Z9XA 3D1VA 1SCUB 4FMDB 1XQYA 3FNHA 3DE5X 3MYYA 2FHPA 4QBTA 5EXXA 5L4SA 2GM4A 2IBTA 5TNXA 4O5OA 1F1BA 4NR0A 5FT9A 4IXDA 5BW4A 4OJTA 4QDXA 3ZJVA 1HFKA 3QY0A 1J09A 1XU9A 1WVGA 2PRIA 1T0PA 3G8YA 4IFJA 3ONWA 1GGHA 5FD8A 4AZ3B 1U4NA 5DHTA 2E89A 4FUQA 4DM7A 4EHKA 4MEJA 1KEEB 3F2IA 3O1IC 4L1KA 3PFNA 2O8CB 1E9EA 1J22A 3KTAA 1EUUA 4O4HF 1OBOA 2IK8A 3MCWA 3WMGA 2W43A 5AKLA 4RFVA 1ZO8A 4CL0A 1EG2A 2HSDA 3PRYA 1GQOA 4Q1EA 1U80A 1PTJC 1Q0SA 5K0TA 3IXMA 5ESDA 2PYIA 2JLSA 2AB0A 2VWGA 4LTNA 1GPKA 3V00A 1OFIA 3BB1A 5DLYA 1WSWA 5C0OE 2XUOA 4BCDA 4G07A 3RWBA 1RCFA 3EGDA 4BOYA 1NPTO 2BZ0A 4PC7A 2J33A 1HLDA 3G2HA 1BMDA 1NRJB 1ODCA 3CVXA 3FDZB 5HFNA 5TPZA 3T3HA 1ZJ6A 4UUNA 1KY4A 2V7BA 3EQ6A 1BWPA 4M3NA 4N3GA 4CL2A 3D4BA 2QY9A 2VVZA 1UT6A 3E4DA 3TAUA 3I1YA 2ZBFA 2ZCJA 4JJIA 2WFLB 3MEQA 4BCCA 4D2IA 2VZ0A 2XGMA 3L8DA 2UDPA 3S2YA 2I5PO 2AG5A 1J1UA 4ZOQI 3HXPA 2NX2A 3HB0A 3HR8A 3IOEA 1N36B 2BEVA 3IC5A 2H4FA 2NZXA 3RHFA 3E3MA 2EBWA 4ZFNA 2O0KA 5JSFA 2R2GA 2P9BA 2ZUTA 2GEFA 5ALRA 1GPUA 3U81A 5BUCA 2YJTD 3TLEA 1MQ9A 3ZZUA 3NNDA 1XRPA 3T7AA 1E94E 1OB2A 3LLVA 2VC2B 4ZVTA 2GB4A 2QWCA 2I22A 4U7TB 1VPDA 2PWAA 2YIMA 2FEMA 1T36B 1V5FA 3G7NA 5I9MA 2H2NA 2NTVA 1UXGA 3QVUA 3SC2B 4ER7A 1T6ZA 5CG1A 2VF8A 3HCOA 2FF7A 4N8EA 4B9AA 2FRDC 3PFBA 2AXEA 3QX9A 1GG5A 1GFZA 1MB3A 3FHJA 3VBEA 4PFSA 5G2OA 4Q9JA 5GX3A 4IMBA 2H31A 5DX0A 2QHXA 3BIWA 2O2ZA 5LPNA 3FZGA 4Q4JB 1H0SA 1RCUA 2IEZA 3FCUB 1ZS9A 5L3VA 3EJWA 3LL7A 4WCFC 1WZNA 4K7JA 5LBUA 5CLJA 4NFSA 1C5KA 2FFAA 4TL6A 4O63O 4XARA 3G2QA 5A04A 1ZGKA 2H4XA 3A27A 4PLZA 1KJYA 3IHKA 2XWSA 2H48A 1DELA 1G3RA 1WMAA 4KXUA 4CIBA 2H57A 1ABFA 1PZXA 5KCZA 2IS2A 4H7FA 3L4JA 3IOBA 4E33A 4MEBA 2OP0A 2NGRA 1ZN7A 5JROA 5ETJA 2UV8A 1ICEA 4R7TA 4IZIA 3KB1A 5AHRA 3PNVA 3AW9A 4JN6B 1DG3A 4ESOA 2J0EA 4HJRA 3QEMB 3FN4A 1X2RA 2FV8A 4K87A 2RJ3A 2CVHA 2IHBA 1Z25A 2IP2A 2SHKA 2QE7D 1PV1A 1GA4A 2QZPA 2P90A 3W6OA 2JAUA 5FOTA 3OICA 1TOAA 2IS6A 4YAGA 1ZI9A 2C3MA 4XJTA 5JJCA 3QVJA 1CRWG 2REQB 3BFPA 4BEVA 2OFFA 1QQAA 5BUSA 3FZEA 2FLWA 1G6OA 4O1MA 2CK3A 3WLEA 5BNIA 1UAAA 1XEXA 1W1IA 3X44A 4ER0A 4KUEA 1EFUA 2FEXA 2Q1TA 4JXJA 1Q0LA 4KOAA 1SHZA 2Y3IA 3K39A 5JEEA 3GLHA 4U2CA 3RVNA 3GRUA 4LA4A 2CDBA 2FN4A 4G36A 1GDHA 2BGTA 4LHXA 5TVGA 4C06A 5HG0A 3AF6A 2H07A 2ICAA 4AXBA 2YTZA 5FO1A 1HYQA 5F7OA 1KU6A 1M2OB 1CR6A 3OCWA 3Q1LA 1QBIA 4FZ5A 4P8RA 1E9RA 3N2KA 4OIFA 3ISJA 1DTSA 5JS2A 4BLOA 3I3OA 4CZ2A 3TZHA 1H8EA 3BPSA 5DOVA 4WHMA 4JY7A 3BBPA 4DG6A 3B85A 5LJLA 2CMGA 3FB1A 3SX4A 2A5DA 4F3KA 4WOCA 1E18A 1EUTA 1ONBA 3PUIA 1ZN9A 3H8VA 4X6LA 1PZGA 3G0OA 3OMWA 3ZVLA 1YVPA 3CJRA 2CE2X 1PS8A 1QX3A 5D85A 4XWKA 1KL7A 2VDJA 3O74A 5EPUA 5F2NA 1R74A 3ILXA 3N5KA 2G7MC 5CFLA 4BNYA 3QPUA 2BLNA 2JFYA 4XVQA 4WZBA 1SKAA 2O19A 4QFDA 5CDHA 1B7GO 1NNLA 2BKVA 4XD2A 4Q1DA 5J58A 1E2BA 2IZ6A 3VYVA 2H52A 1XX6A 2PBZA 2XNKA 3NG1A 4TGLA 4S12A 1EE1A 2FHRA 1T4BA 3IL2A 1F2UB 2XCUA 5KHLB 5BN5A 3QYAA 3R7NA 4CMEC 3IOCA 1NMCA 5EJ7A 5BWBA 3EFBA 5KSOA 3H17A 2WZDA 2FP4B 2VOEA 1NC1A 3LXUX 4LK2A 1EUDA 3N74A 3UKJA 1W20A 5AFSA 2GD1O 3PQ3A 2QBYB 3PXXA 3F6EX 2J9RA 1Y1KE 1G8SA 3GJ0A 3B36A 3NANA 4AB1A 1QO9A 3CZ9A 4JGBA 3WGQA 2DFNA 1XCBA 3L0PA 3LVQE 1UBNA 2HNAA 3FOBA 3BF8A 4CKEB 1CP3A 2Z2KA 1FW6A 1QRRA 4G5YA 3QU2A 5BVGA 4DMFA 5LL6P 4TMTA 2PD4A 3HJRA 1XZNA 3LBYA 1COWD 4DAOA 1Z16A 1V3VA 2X7HA 3BB3A 4I2NA 4LHSA 4O4JF 1XQ9A 2YMPA 3O9MA 2VHZA 2N3ZA 3HA2A 3ITDA 5KCMA 4ESHA 2VHEA 3WMFA 1BMTA 1PR2A 4EL5A 1Q91A 1PZHA 4C6HA 4TKZA 1TAQA 1EWQA 2ZITA 5CGZA 5HYVA 3T7KA 3JAKB 3SOBB 3WKEA 4E09A 2OT3B 1AGNA 3D0OA 3QVVA 5J1TB 2CEAA 4YUWA 5A1JA 3GRVA 1D2NA 2FA9A 1XZMA 4V2UA 4NBWA 1JEDA 3I61A 1VL6A 2P6RA 2RHMA 4YMIA 3RRFA 1E1RA 5LZ5A 1E5QA 2C96A 2YQZA 4KK3A 1WB9A 1QB7A 3SLRA 3L8EA 1YHYA 3VR4A 3DAYA 4J1TC 4LMRA 1XNQB 4ZCPA 4KDCA 2J07A 1VIMA 3RTAA 5J4YA 3M4NA 1CUYA 1EX6A 1GA1A 2MSDB 3ZK9A 4LYHA 2D1FA 1NLUA 3N76A 4N8DA 3AUUA 2NMVA 4J75A 4JSTA 3RTGA 3EVBA 5BYAA 1HNZB 1ND6A 3NDJA 4HQLA 1WD5A 4O4IA 2IOFA 4XWYA 3U3OA 1OKKD 3FROA 1JT2A 4FQ7A 2P65A 1V35A 3B1VA 4HB2A 3MW8A 4L50A 3U3JA 5TV2A 4AI6A 3HVKA 1HEUA 4IIUA 3NATA 4LSZA 1PJCA 1RJ9A 1Q20A 1SVKA 2IIBA 2QZSA 4JR1A 3STXA 1ADFA 5A71A 1YRWA 3G1WA 3EEBA 1B8VA 1RHKA 2H0QA 4YMVA 1QU2A 2C92A 5LQUA 1I80A 3L4BA 4RJKA 3VSCA 2XCOA 1OLUA 1J0BA 2JI9A 4MWTA 4KXXA 4PNPA 5AHXA 1UK7A 3U0SA 4ZK2A 4NU6A 3ULKA 4BQPA 3EZ6A 1TK9A 3ENQA 3FUXA 1U0FA 4MPTA 3W6ZA 4P4TA 3K70B 2AG1A 2XE8A 1S02A 4QYIA 3ANTA 3CUUA 3SR3A 3RUAA 1N6DA 1NF3A 1AKEA 2F3TA 1MEOA 3Q7EA 2BI8A 5G02A 4H7IA 5JSYA 4B81A 1ZJJA 3AF3A 4ENVA 2V5VA 4C03A 3THSA 5CYPA 2SCUA 1DRUA 3EEFA 3WQQA 1Y8RB 2G67A 4FZRA 3REQB 4RQTA 3ZC3A 5KHOC 2CV0A 1MXFA 2P4HX 1R4NB 4J9VA 1E1CA 1MG0A 1X92A 1XF1A 3C5EA 4M0PA 1MS1A 4B87A 4LXQA 4L8FA 2WP0A 2QRNA 3IPAA 1XMPA 4DV4B 5CJPA 4JB3A 2PGIA 4PX2A 4DCUA 2HYIC 2IXAA 3I9NA 5C5DA 3PI6A 4MGZR 5K2MA 3SBOA 2Q28A 4JENA 1E9FA 4CCSA 3UJHA 1YMUA 2LRHA 1DEKA 3G6WA 4C5CA 3LI3A 1V8PA 2PWZA 2QVBA 4ZQCB 5EINA 1E9BA 3CY6A 5CFZA 721PA 7REQB 2B1IA 2IPXA 4H27A 1GPNA 1WPRA 3LM8A 3R4VA 4MIYA 4MRVA 2QL9A 5DF1A 3UWPA 3BRQA 3GROA 3GK3A 4ARAA 3OCYA 4CKBB 2MYNA 2EEPA 4GLJA 2F12A 2X15A 3JD2A 3GELA 5D3MA 4JJAA 4RTSA 1U28A 1EURA 3EXFB 2DYHA 2WE7A 2V7QA 3B70A 4FOTA 4CT4B 1FDSA 4OL9A 1C1YA 4BAUA 1JUDA 2PS1A 2VPPA 4L5IA 1BJTA 4DLTA 5IHXA 1H3EA 1B9TA 1OIWA 4RFSA 1S0UA 1HDYA 2R7LA 1Z0FA 2NYVA 2YJNA 1I36A 1W4ZA 2O2CA 4LCEA 4QLBA 4RTLA 5JD4A 2WWHA 5EJ4A 3CA8A 3HEAA 3H99A 3KLOA 4ZDIA 1KC1A 4RZQA 2V6JA 3ZHOA 4J4TA 4TYMA 3W8DA 2P40A 2RHWA 2VUUA 4RD3A 2PAAA 5IX8A 5FZJA 3AK4A 3RTDA 1BXRA 3IRVA 2GYYA 2ZBEA 2RHGB 2D5IA 5CXSA 2O4CA 3MWEA 2Z08A 2BMAA 3ZJTA 3UPDA 5AM5A 4QXOA 3FOEC 4RBNA 1OAOA 1C7JA 1N2OA 1W5SA 3ZY2A 5B7PA 4RVDA 1KR2A 3UJ7A 5CNJA 3BFKA 2CFSA 2DC1A 4ERXA 4LXUA 3DWFA 1XK6A 3EXIB 3RR2A 1BU5A 3P45A 4WY8A 2GKSA 2ODNA 3U4QA 4J2OA 4KAAA 1DIBA 4BVEA 3F6SA 4LSGA 4S0XA 3PFCA 3K2BA 4BFUA 4DR2B 1BN7A 4EUSA 1C30A 4LZLA 4U7DA 2PT7A 3KVRA 4ENRA 2FSIA 3SMVA 1WPXA 4QECA 4RF4A 1KR5A 5M1ZA 5A9TA 2AI1A 4A0HA 1Z4IA 2IYWA 1OFTA 2RHBA 3INGA 2CV2A 2IXTA 2D0PB 4IDGA 3S27A 1YR2A 3U3XA 2O8EB 5EZYB 5REQA 4XLLA 2Q27A 4GKVA 3HLIA 1NC3A 1N3BA 1TT5B 2WPDD 5F76A 5MN6A 2JI8A 2C4TA 4ATNA 4M9SA 3VNAA 4MVJE 4KQKA 3TEMA 1DZ3A 1AE1A 2XB8A 4RFLA 4RHCA 5TC4A 5L3RA 3JYPA 3WV4A 5B1HA 1IVFA 4QGHA 3KFVA 3WNQA 5C1DA 5KIAA 2W20A 1TJPB