2W8BA

Crystal structure of processed tolb in complex with pal
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
409
structure length
409
Chain Sequence
b'EVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVLYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TOLB
publication title Allosteric Beta-Propeller Signalling in Tolb and its Manipulation by Translocating Colicins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/membrane protein
total genus 111
structure length 409
sequence length 409
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2w8bA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2w8bA01
3SREA 3LI5A 4GN8A 2W8BB 3HLHA 2GVUA 5D9DA 4O5TA 2IAOA 3BYCA 2DG0A 3V1SA 1RWIA 2G8SA 2OJHA 3SOVA 2DG1A 3SRGA 3Q6PA 2ISMA 3WW9A 4A0PA 4JMLA 3A9HA 3HLIA 2V91A 4GN9A 5FWWA 1Q7FA 5EX7A 2HQSA 2GVWA 2IAQA 3V65B 3S94A 3KGGA 4IMBA 1H6LA 2W8BA 3G4EA 3G4HA 3S2KA 3FW0A 2P4OA 5D9CA 5GX5A 1QLGA 3AMSA 4HHOA 2IARA 5GTQA 3S8VA 3LI4A 5GX3A 3FVZA 3U0SA 1C9UA 3KYAA 4GNCA 3V64C 3E5ZA 2FP8A 2VAQA 1N7DA 2GVVA 1CVMA 4Q1UA 3HRPA 3DR2A 2IAXA 1IJQA 5D9BA 3AMRA 3DASA 4R40A 4HHQA 3WWAA 2IASA 4O5SA 4GNAA 1C5KA 3A9GA 4IYGA 5GX4A 2IVZA 4GNBA 2IAVA 2FP9A 2IAUA 2FPCA 1CRUA 4DG6A 2DSOA 1POOA 1E1AA 3O4PA 4PWZA 3SOBB 2IAPA 3Q6TA 1QBIA 3P5BL 2POOA 2FPBA 1NPEA 3I1CA 3TC9A 2IAWA 5GX2A 5GX1A 2QE8A 3Q6KA 3S8ZA 1CQ1A 1CRZA 3LI3A 4HW6A 3SOQA 2GVXA 4ZLRA 1V04A 2IATA 1PJXA 1RWLA 3IAXA 2GHSA 4GN7A
chains in the Genus database with same CATH superfamily
1M9NA 1QDUA 4O4LF 3RADC 2BEWB 4F1JA 1KYXA 3IT3A 2E4UA 3RARA 1EWYA 1D6MA 3E48A 3CYEA 1XHEA 4JBXA 4U7PB 3VXKA 5D01A 3P94A 1ADJA 3IDOA 3BXZA 4N6GA 4NYMQ 1ABEA 2O2YA 5LP6C 4BO1A 3T5AA 4MPPA 3S6JA 4FKMA 3BQMB 1OIVA 5THXA 5IWAB 1J23A 4KRYA 2F25A 3F4BA 4TL7A 4IFLX 3AR8A 1VSVA 4NU6A 3DBRB 4MB0A 5TS3A 1QH8B 2AMYA 3DQQA 4ZRMA 4CTKA 2ODQA 3V4FA 4PLGA 3MW8A 4WY8A 3LRTA 3T35A 2WHRA 1O6GA 2VOEA 1FW8A 4C30A 4DCSA 1ZESA 3QSGA 5HGXA 3SS8A 3BE8A 1OWPA 1ORVA 1WUHS 4D0RA 2D1YA 1PJSA 1SCJA 1XUOA 3GJYA 2OBNA 4UQOA 4ZT7A 2QMUA 4HWRA 3CEJA 2ACKA 5JAIA 5AO9A 1FSGA 1VFPA 3WLAA 1IBSA 1RHRA 3F6PA 2DWCA 5L7YA 1YS1X 1OAOC 3V65B 5FULA 2WF7A 4QOEA 4RWZA 4PO1A 5J2UF 1ESDA 2FSUA 821PA 2EYUA 1JDUA 2VSQA 4FVTA 4JELA 4IICA 5AOAA 1NVUQ 2LRHA 1Q3KA 4EFMA 4TYNA 3VM6A 3FW0A 4X94A 5J1TB 1D4OA 2ZJ0A 1J0CA 2HQ1A 2YXEA 1HNNA 4D79A 3C4QA 4K9MA 4ZT6A 3DWGA 4NDNE 4YT2A 4BYMA 1XOIA 3HSKA 1FSPA 5K0NA 1QTRA 3NBUA 4Y67A 2I2AA 3KD2A 3IGFA 2NUPB 2ZJ4A 4G5FA 2AJCA 3W5DA 1JR4A 4N40A 3RRNA 2Z6AA 3I6YA 3QBJA 3AY7A 2YWFA 5DWVA 2Z8YA 1X13A 5JYYA 4IGEA 2FP8A 1MDFA 2HSGA 1B6RA 5DTEA 4NX2A 3FY4A 1TGYA 4JYAB 1F0YA 2WZDA 1UBEA 3L8MA 3NTLA 1YRQA 1YE3A 4FPOB 2Y4OA 4EMBA 3ZD6A 1MZVA 2XXAB 3AEKB 3P52A 3EXFB 3BSFA 1USKA 2VVZA 3HCAA 3ZIAA 3NU1A 1XZKA 5TGTA 3OPYI 1JUDA 1NBMA 1V5WA 2CMKA 4EG6A 3F46A 1BXKA 4HHEA 121PA 3TECE 1NM5C 2G9QA 3OCCA 3A28A 4NZZA 1K9VF 4XYMA 5H82A 4IMRA 3NDRA 5JLAA 4M9UA 4Z7QB 1HF3A 3QOYA 5ILQA 2HZBA 4OFWA 1ZA2A 3IQZA 5K3BA 2PX5A 3PNYA 5DH9A 3E3LA 5MN4A 1WUTA 1ZINA 4I6JA 4X8OA 3ENNA 5TQ2A 4C21A 1KDOA 1Y5RA 1UAGA 4RVGA 3SZUA 3P9ZA 2DH6A 1BOOA 3V33A 2A9KA 3GLVA 3VAAA 2AI2A 3HXMA 1O54A 2XMPA 4DQVA 3TEMA 5HWSA 2REQA 4MWDA 5FUMA 4I55B 4BIMA 1SD5A 1CQJB 1JWBB 2GM4A 1UBRS 3MFYA 2JGRA 3U26A 3QLUA 3RAFC 2XRZA 2F62A 1ZK1A 2YC2C 2Z4TA 1JT9A 1E8VA 2FHSA 2OB1A 2J45A 1RKUA 1Q0LA 4MDEA 4V2UA 1TAUA 3LYHA 4KODA 3OHPA 4NRDA 5AVOA 2D0PB 4JAVC 4LMBA 2O2SA 1Z4PX 2NNWB 4MP8A 5AOCA 2W6IA 4BE7B 3HB0A 3V4LA 3JQ8B 1NW4A 3LX4A 4FWBA 1ICIA 1IB6A 4R16A 4XLTA 3ICEA 1GG2A 2ZB7A 1Q7RA 3AHIA 3RD5A 5EUMA 4MWVA 3VPAA 2H7XA 1WZCA 5AM2A 5CEFA 1USXA 3OJLA 5FNSA 4OCZA 4BFXA 4ZD6A 2VATA 3IHLA 3SDZA 4UHEA 1H8EA 4PZ9A 4EVQA 3GRCA 4WMLA 3VTZA 3KB6A 3MAJA 2G8SA 2R6CA 1NN2A 1INFA 1IUKA 1SIWA 2F43A 5ALPA 4B8WA 4I50B 4MINA 3WXBA 1BNCA 1XGKA 4H08A 3U62A 4PNZA 2W2OA 2YYAA 1BSVA 1LPAB 1X1EA 1GFIA 2IZ7A 4U2EA 4DR3B 2I66A 5B7QA 1M2HA 1KEPA 4LOLA 4PZLA 3VVCA 3KS9A 5CVVA 4F5DA 2OHJA 3X1ZA 4IGIA 5FUYA 4ZYUA 2LWIA 1G0OA 3HYSA 5A1JA 4UEWA 3VNAA 2HL6A 4N54A 4OU5A 4BNTA 2PEZA 1U8EA 1CUXA 2Z2ZA 4XOIA 1O4WA 4F91B 1NRXA 1CY8A 3GQVA 5KMGB 5FBQB 5TMBA 4AICA 1P44A 5FOTA 5J40A 1JTEA 4BB6A 1TMOA 4DLPA 4RD4A 4LFAB 2QSYA 1BMDA 1PQYA 3MQ4A 1Z5VA 3GEMA 2L0XA 2XUJA 2EJUA 1C41A 3ESQA 3W8DA 5IN5A 4CF3A 4HADA 5GONA 5C5IA 2UZ0A 3L5KA 4URFA 2FSIA 4ZRNA 2HK6A 4PZUA 5KNLA 4U02A 2ZJ7A 1P7WA 1Z0ZA 2GS9A 2B8NA 3LVBA 4LZWA 1J4AA 2XI4A 4IOMA 1C4KA 1DPFA 1NN0A 2QPOA 3HRPA 3D12A 1USVA 4GR9A 4R9SA 1WZEA 3QUSA 1S2GA 2QWXA 2AG1A 2B7LA 3PHLA 5ITSA 4TWJA 3BMXA 4RELA 6CHYA 4MGZR 5IVPA 5LVAA 4JA0A 2EP5A 5A5FA 1ADYA 2BBSA 3CSSA 4B82A 1B8PA 1ESMA 1JEAA 2PGOA 1L5KA 2YY6A 3UCEA 4G67A 1RWWA 1P3DA 3H17A 4F1WA 3P0JA 4UMFA 5ANRB 3R4CA 1VMKA 2H51A 4JC5A 1GRRA 3IQXA 4D99A 4HX9A 2Z9CA 3JU3A 1CRPA 1EH5A 3TFQA 2EBWA 3FOFC 3NOQA 2FR8C 3H97A 3PUYA 1Y5MA 4U2GA 3FI0A 3JWHA 3N58A 1FL9A 5JATA 2Y0PA 3AKCA 1UOQA 3HVKA 1V41E 1X39A 3NAZA 4NFYA 4CQMA 2QVYX 2M6RA 4RF2A 5J5CA 4MS4A 3ZNOA 5ALYA 3DOFA 2E21A 4JJKA 3TX6A 2XIQA 4LCJA 3D3KA 4ZY3A 1CLUA 1P31A 4H18A 4LAFA 1T6YA 2YJTD 3AVOA 2HRBA 3O75A 1QHXA 4J0DA 2GN2A 4I1PA 3DE2X 1T5LA 1LJUA 5KYWA 1RADA 1V9LA 2DHQA 4DLXA 1QCDA 2EX4A 5T4BA 1R18A 3LE8A 4QLAA 2XBMA 4LDNA 2V4UA 3IQFA 3DOUA 1XDUA 2WJGA 1QRAA 5M29A 1IBLB 4IEEA 2ZRPA 5ABPA 3NBZC 2QTBA 1TUEA 4Q9NA 3TIGA 1WKCA 4LYDA 3QEOA 1A96A 5DX1A 1RJGA 4CYMA 3HDYA 1VJ0A 3GDWA 2C95A 2C8VA 1XLTC 1IRIA 1PLKA 4TRRA 4YP7A 1G8JA 4O5TA 4J9UE 1LC3A 2GN8A 3O47A 1B9TA 3A6KA 3C6MA 5ALKA 3QKRA 2FFBA 5FV7A 5HS6A 3SJZA 1DCFA 5E8JA 3TSAA 3H8WA 1YRBA 4KLZA 3W8FA 3E9CA 2XT0A 2WIFA 5KBYA 4P22A 4DZRA 2OO3A 4LVCA 5J3JA 1ZRHA 4M1EA 2ISQA 3H1BA 4ZCQA 3LDGA 2O7NA 5HMLA 3GOHA 4K9QA 1FJHA 3F6SA 1LBHA 4KXQA 3NHPA 3Q0EA 1VIYA 4X24A 3RANA 1SXJA 3VC3A 1OY1A 4H7EA 5DEIA 3HM2A 1X7XB 5IMSA 3O94A 4B09A 2ADFA 4WXHA 3CG0A 3V7WA 2ZUVA 1NMYA 4E22A 4ZEMA 5JROA 5NULA 2BRUA 3U7QB 5E38A 1N2CE 4WE3A 4J3NA 2VUTA 3ADPA 3DWIA 1QHHB 1E20A 2RHTA 1G41A 1DOHA 1ZQ1A 4KOEC 2RONA 3PPWA 4Q47A 3TVDA 4BRSA 4E2FA 1YCFA 3GJ5A 4MKFA 3ABOB 2JFHA 1GRQA 3M34A 1Q1NA 1U5BB 3GFGA 5F3RA 3UFXA 4DN6A 2V7QD 1MT3A 1UXHA 2ZRBA 2IOFA 2VRNA 4K9KA 4RV5A 4ZCLA 4C6RA 4PNEA 4GDJA 1MV8A 3BH7A 5IKOA 3TQSA 5A02A 1E5QA 1PR2A 4FMDB 1TT7A 2A2ZA 1BH6A 4HGOA 3ROFA 4OQFA 4FDUA 3WHLA 3WK7A 4WBNB 5KSPA 5EUCA 4Q19A 3SIRA 2VYNA 1Z2NX 1W8OA 2I2BA 1R88A 1SC6A 1W47A 2HMSA 3QI7A 4GBED 1K2VN 3VZSA 2LDBA 4J3FA 4F60A 3RR2A 4DT1A 5JJIA 4NMXB 1CIPA 2AE2A 1HI9A 3G0DA 3PRJA 5C32A 1EINA 2Z8XA 4WXPA 4AW9A 4I8DA 1P80A 2H08A 2YMPA 1UODA 4ODIA 1AVTA 4GX2A 3GPDG 1PAUA 1TL7C 5JD5A 4YR9A 5JANA 1WRBA 4BLPA 4LKOA 4Q16A 5EZYB 2QX9A 2UDPA 4U8GA 5A0VA 1N1YA 1HEYA 1UKCA 1DAFA 3KHKA 2FVXA 1AN9A 2VHTA 3HJRA 3KEGA 4C4AA 2JEZA 3LKDA 3C5CA 2DVMA 4CIWA 3QEMA 4O2BF 4Y0AA 3P9XA 2CE7A 1JPUA 2R60A 4NWIA 1HE3A 5EL0A 4DA4A 1B23P 5JADA 4KEAA 4MUGA 2H7VA 3Q12A 1KYZA 1YR3A 5CNIA 3KQOA 2ATVA 2Z9BA 1XQWA 4B9EA 4YCMA 1IXSB 4C7JA 3DVSX 3PR1A 4HVLA 3I12A 3ON5A 4RSRA 4V1CA 4AQYB 3D6UA 3JQBA 3KJXA 1YRLA 1G3IA 4NICA 5J4LA 3VR5A 4JS0A 3WZLA 5B3JC 4XE9A 1BG6A 3KJIA 3UJ7A 1PGQA 1FVOA 2J3LA 3PQ4A 2OM2A 2QZZA 1O89A 4MS3A 3TNLA 1MGPA 3AR4A 4AF8A 1YI1A 4B1FA 4LGVA 4B3IA 2FZ5A 2OHXA 1BFUA 4KQWA 1I4DD 1U7UA 2KHZA 1RC0A 4DZZA 2AEJA 4RGQA 1VJDA 1M8FA 2REOA 3IAFA 3E9DA 1V1MA 4UD2A 2GZ1A 3NBQA 4JYBA 1V7ZA 3W5VA 1RIIA 3TIAA 3FNQA 2O57A 3MD0A 4R3UC 3SDSA 1L5ZA 4IY1A 2ES4A 3UT6A 1R5NA 3WLLA 1Q1GA 3LMKA 4KXVA 1YFLA 3NMUF 4IUDS 3TTUA 5FEUA 4C5AA 5JCOC 4X6LA 3CMMA 1UBMS 4J1SA 4MZDA 3U7RA 4JT8A 4EUFA 4LY0A 5K0SA 5K6AA 1ZJWA 4G1FA 2JC3A 2G5PA 2Y67A 4JVOA 3SHTA 2XZPA 3LHKA 1MXFA 5LYJB 2HTVA 1L7DA 4W1QA 1T6BY 1KYYA 4OQXA 3D1VA 1M10A 4Q4AA 2WVGA 3H0EA 3BEOA 5BT9A 2OCGA 4AY5A 1KDPA 4JYMA 2EZ8A 3KZNA 3HU2A 4IFTA 4J1TC 6REQB 1CULC 3C15C 1A14N 2CMFA 5HJ2A 3AESA 5AQ1A 3OF2A 3NUQA 3LCMA 4K8OA 3PL5A 2XHEA 4YECA 5ALFA 1HLFA 1I32A 1V3UA 3P0IA 2IOYA 5JNVA 1BJKA 1V3QE 1EVIA 2AL7A 3WNBA 1DAEA 1PV2A 3C3YA 2PJRA 2WT9A 4YAWA 2RC5A 3CX4A 3N2YA 4JHXA 4P8RA 3UJAA 2RC6A 4R51A 4N48A 2VSFA 1V4VA 2MINB 4R8SA 2QT1A 1V1JA 2FPKA 1Y7TA 3TKYA 2VDVE 5HX0A 5HCNA 3NB0A 4EG0A 1IXRC 3K5HA 4M7RA 5KDDA 4TT3A 1DPGA 3E0QA 5LOVB 1LSUA 4L5JA 2PGJA 1P18A 4BNXA 4LRYA 2QMHA 5T7BA 5M2QA 1ZD1A 1LV7A 2YX1A 1EZZA 1RLTA 4NP6A 4A2PA 3C41J 4HXGA 4C4PA 2R8ZA 4YY8A 5H9WA 4J0CA 4ZVSA 1B6TA 4BVAA 3GZ4A 4WPGA 1SCQA 2ECFA 5GV7A 2JA2A 4DHWA 4AD8A 1SD2A 1QO0D 3DYBA 4FXOA 2X0KA 2QLFA 3E05A 1KSJA 1UPXA 4D43A 3PEWA 4J7CA 1TVKB 1SM4A 1RI4A 2DPYA 2HJWA 4FFOA 3DFKA 4LDJA 4XPIB 1J1UA 2CYCA 4O3FA 4NBKA 4OIMA 3B5JA 5G4KB 3TRHA 1E2BA 1U2RA 4UCQA 3ZGOA 3FDZB 1N6FA 5J4KA 4FT2A 5AW6A 4OK5A 3R7LA 4G65A 3MWGA 5JFGA 1V4NA 3TR0A 3WA7A 1IEVA 4FVKA 3RABA 1X14A 3LHDA 3GP8A 1ESNA 2FUNB 4YDQA 2O8FA 1RMTA 1PS0A 1GPAA 4B4DA 3JAKA 4XZ3A 5EP2A 4C4SA 3NASA 3B13B 5D7BA 4CN8A 4Q4DA 1MJHA 3H05A 3NDJA 3KTAA 3OE1A 4HAVA 4J49A 5AKEA 2M6KA 2VYVD 4PZDA 2ID9A 2W6OA 4ER3A 1YQEA 3OD5A 1HG1A 4A9AA 4UFOA 5AKGA 4PC2A 2BFBB 4KQ2A 3ZVRA 3HU5A 2C2HA 3JVIA 2CBZA 4GZ5A 4IXNA 1XEXB 2WD7B 2IHKA 3U1VA 3WGTA 4Y7DA 4LUCA 1XVVA 3FBGA 3ZV3A 1WM1A 3HDQA 4MROA 1RQ7A 3VPHA 3T7TA 2A4KA 1L4YA 3KLNA 2D1FA 4ZOEA 3KFLA 4KQFA 4PGAA 4CKEA 2NP7A 1E2IA 2ZWPA 3GFOA 3E61A 4JBNA 1YVPA 4MUFA 1KVUA 3ESBA 4C7OB 5G0UA 1QQAA 3NWBA 5MGBA 5JU6A 3LC0A 1Z4ZA 1U3DA 3HUEA 4TXJA 2E5WA 2QZ4A 4GSYA 1RI2A 2CV2A 4BVHA 2CLIB 1NY6A 4M0KA 4G1MB 1CUJA 3K2QA 5CX1B 2VK2A 1XXHA 4PLWA 1NQXA 3G8YA 3A9UA 1RWIA 4XGIA 4WJZA 4D3YA 1XTJA 4TTAA 1WZUA 3VOBA 2VEDA 5G40A 4I46A 1BQ3A 4KVFA 1R50A 3K7EA 3PUHA 3DC7A 1NX9A 3ROKA 3I8OA 1M1UA 4QARA 1S0JA 5F7ZA 4F93B 5EJ4A 5BQ5A 1MB3A 1Q17A 3A3NA 1SXGA 4HLUA 4HVTA 5IM5A 5TMEA 4RLFA 4WZAB 2ILVA 3OIYA 4HZIA 4KPYA 4AJIA 4M54A 3PUVA 4QATA 1JHVA 3CF4A 1NW9B 3PFNA 3R9KA 3U3XA 4Y9DA 1KI8A 4D4GA 5CIYA 5LMNB 4PBSA 1XYYA 2GZ3A 3SKXA 5LJIA 5AK5A 2XOEA 3A9VA 4HN2A 1FFGA 1FNMA 2C82A 2NYRA 1Y7IA 2O07A 1L7PA 3FDJA 2LTAA 4KH0A 4R2JA 5DOZA 1SC4A 3RFTA 4C2BA 4MR9A 5KNBD 2B8TA 1E9CA 2IDZA 2VUIB 2G9UA 2TSYB 2DPGA 4QGHA 4C04A 4GNCA 3FZYA 4XI9A 2QBYA 3ETCA 2BV3A 2CLHB 3L77A 4D9JA 3K2IA 4YRDA 2W6CX 1RYBA 3HB1A 3OECA 4F4UA 2PUFA 3KJNA 4KE7A 3G7UA 4RJTA 4AY3A 5CLQA 1RMYA 2PL5A 4N0MA 4KK4A 4PTYA 2BJWA 4JUFA 4XGKA 5ALMA 5H4GA 1NQWA 3HBLA 4IEIA 1BCRA 5JXHA 1PDVA 2CCGA 4IW3B 3REQB 1MDBA 4Q7QA 2BLLA 2LIVA 4KV9A 5F33A 3THRA 1IY2A 1KTVA 1TQ2A 2RBKA 4DV3B 1QFJA 5DM0A 3R3YA 2QV7A 4CSDA 2KWIA 2V7XA 3QMPA 3KKPA 3EYWA 3HKBB 4G3XA 4J7XA 2O7VA 3PEYA 1EKXA 2DPLA 3SE7A 4QHTA 2VJNA 3MJEA 2YVKA 1NBEA 4MUBA 3AP1A 4ZQCB 3WR5A 4NXNB 1XHLA 5IKXA 2QNBA 1XJ0A 2AF3C 4KBFA 4PLPA 4U5XA 5LJLA 3G7SA 1D8TA 3JQEA 3V1KA 4BY9E 3LV8A 3IURA 3OIFA 3N8IA 5FORA 5C53B 2KMLA 2XHZA 4RIEA 1RVDA 2H57A 4IPTA 5JS7A 2FPIA 4HN9A 4UDNA 5IEBA 4K7JA 4JBWA 4AHAA 3WWPA 3WRXA 3H87A 1NQOA 2CBXA 3A6HA 4GWKA 1DUIA 4OBWA 2Q3HA 3C1AA 4FSHA 4GDIA 2CNNA 2DRIA 2OZLA 3OJXA 4URUR 3VYSB 4YCSA 1XVLA 1NT4A 3BWXA 2RE8A 2C96A 5IZCC 1NMCA 1QZZA 1JHUA 3EDCA 3KT3A 3LAWA 5EWLA 4MVJH 4JI4B 4R68A 1BMQA 2V6FA 1WCIB 2YA5A 3RSFA 4YRQA 4G24A 1MW8X 2VCEA 4O4HF 1PHPA 1XPUA 4NK4A 2IDMA 2J46A 4PPYA 1UXJA 4ZQEA 4JR2A 5I47A 1MZPA 4GSKA 1EU1A 3D5EA 4Y7CA 1T8RA 2HHLA 1ZGZA 4MQMA 3RUEA 4TS4A 1KTIA 3W3AH 3RYTC 2ZBDA 1PKXA 2ZDQA 4HH1A 1V8BA 2ORWA 4B45A 3CX3A 3R1IA 2R6R1 3ZU3A 1L4MA 3OURA 1BYIA 3CC8A 1CVRA 3EY9A 5ICCA 1BRTA 3ZG6A 3DB1A 5EZ5A 3L6VA 1T3SA 2ZUFA 2HUNA 3GFBA 1JQ5A 3K0FB 5B6JA 4Y2GA 4MWOA 2P62A 1P91A 1OLXB 4G86A 4EHFA 2V5AA 2N9UA 3RVJA 3RNOA 1EYZA 3PXEA 4KXUA 1LLFA 4X61A 2PR7A 3T7DA 3ROGA 4XJZA 1FFEA 4A36A 5KHLB 1WB9A 3SZMA 4DR7B 5JQGF 1SURA 4DXDA 3N0RA 5HK9A 4W5RA 4O3MA 2QMOA 4E2YA 4KAFA 3OUZA 2A0UA 3ZNPA 5BNZA 1CUEA 1B8NA 3GVXA 5FL7D 1H1TA 2GKSA 3RVQA 2RGBA 3W6ZA 4E14A 4ZOLA 1M1XB 2GVWA 3HHPA 3C3DA 5CYPA 5J2TF 3WDSA 4TTJA 1O3YA 4JI1B 1UT6A 4UM7A 3CR8A 4LHVA 3FWZA 3H71A 1K7CA 2QE7A 1PEAA 2HLPA 3LBHA 3EXHB 1G7CA 1AKQA 1SUWA 2GVNA 2FA9A 1T1SA 3GD5A 3L0BA 1V3TA 1UKBA 3AFMA 4PYRA 4QPCA 1BW9B 3IDAA 3ZBPA 2DUUA 1T1GA 2P8SA 5L4LA 4INAA 2GCEA 3HG7A 5EHXA 2BN4A 2CDBA 3JQGB 2OR3A 2GK3A 2AVDA 2X7JA 3E5RA 2J3QA 2FF5A 3KOUA 3G8AA 3NHJA 4AJNA 2ZPUA 1B7GO 3VJKA 1PRYA 5AOVA 2CT8A 3V3TA 3NR2A 4UCFA 3BXXA 2OV3A 4MVYA 4CT0A 2WJ4A 2ASVA 1N1DA 2QXYA 1W581 2ZE7A 1QH9A 4TM8A 9MHTA 2JL1A 4K05A 5L6LB 4RY8A 3ZCXA 1DEOA 1ETHA 3ZZNA 4LFCB 2VQ6A 2ZYDA 4DANA 3W2FA 3L01A 5AVYA 3ZDAA 1XJCA 4EPRA 4NZNA 1I6MA 3LWBA 1B74A 5DP2A 2C3PA 3VV2A 4L8VA 3CLVA 4M0DA 3DHEA 1WDTA 5CCEA 1BAPA 4UBNA 3NHKA 2ZJBA 4NDAA 1LTQA 1OFGA 2G25A 2HDNB 3LZ6A 4GM0A 1Z13A 4H7HA 4MCJA 3T06B 3U40A 3BXPA 1T26A 4MR7A 5J43A 1NCBN 3IL2A 3OPXA 4ZPJA 3N6XA 3FOZA 4QDTA 5CAEB 3UA4A 2BF6A 2H16A 4P9NA 4OHYA 4U7GA 1VMDA 3JQ7A 2OHFA 3OPNA 3N2KB 5EEHA 4TVOA 3T9EA 4IJQA 4I9UA 4E6PA 5EIBC 1VPEA 3KRTA 4DDKA 3ENZA 4RCYA 3BXGA 2Z3ZA 3TLAA 1IY1A 1SHTX 2Y9PB 3A1VA 4FGSA 2JGKA 4WADA 5DGTA 2PSJA 1Y98A 4EZBA 2QHXA 1W25A 2XW6A 4D9EA 1YQTA 1DCMA 3PP8A 1Z6QA 2G8LA 2QUJA 3G79A 1KH2A 4QOFA 4R9NA 2JFWA 2JI7A 4KQGA 5DYWA 3O1LA 1IK4A 2G7MC 4FZ3A 5FO0A 1NUHA 3LPDA 2AW5A 4YW4A 1JWAB 1YC5A 5JCPA 1G9XA 4Y98A 1W4LA 2Q6LA 4B74A 2PLWA 2PYDA 1K7SN 1EQAA 4LJ4A 4MI3A 3GRAA 3QVTA 4Q12A 5KVCA 1OC2A 5B30A 3GLFB 2WC1A 4TTIA 4L9WA 1NQVA 1CP2A 5CT4A 4AXBA 1KU0A 3DA8A 2KSQA 4CV1A 2YQZA 3KJEA 4NY1A 4C7XA 3MCTA 3HB5X 1L7AA 2GEVA 4R1SA 1KIFA 5B2FA 4QN3A 1Z4NA 1UPAA 2C4MA 2Z6VA 4XE5A 1R1DA 2ZQZA 3FSEA 3CPHA 4DR1B 5YASA 3O9JA 1WF6A 3PJDA 5ALJA 5FADA 4ZQBA 4EITA 4UUAA 3K1AA 5I3CA 2XCSB 1RYEA 4C0BA 2J5KA 3DO5A 3UB3A 4GWLA 3SEQA 1QGAA 1NMQA 5CU7A 2IS2A 1LI7A 2PMBA 4X8LA 2W22A 4NC5A 4CM1A 1BMTA 2PBFA 3WYDA 2HRRA 2YZKA 3PQ2A 3B6MA 3IP1A 4MGIR 4QUKA 1QVAA 3LUGA 1UH5A 2K87A 3IJEB 4KN9S 4B75A 4TSFA 4OFZA 5EP3A 1RWMA 2B20A 2WMYA 3WIOA 4DDVA 2OGUA 1IUBA 2J5XA 4OVKA 4QQFA 4RJJA 2ZAIA 4RS4A 2FNAA 1QTNA 1EX1A 1H0KA 3N2NA 4LWZA 3MNFA 2XPCA 4JOCA 5CNKA 4BQPA 2PLFA 2VF8A 2XWSA 6Q21A 3CUYA 3OZ7A 1UJBA 1JLMA 4V2IA 7REQB 4HR7A 4GF5A 1SA0A 1RC1A 1SUSA 1T24A 1QB8A 2PRKA 5E95A 3RSOA 3WSVA 4E12A 4ZZ3A 2DT8A 3HFSA 5BXYA 3QFCA 3BHIA 2KB0A 4IFNX 3T99A 4F1KA 5SY6A 3BZBA 3ETEA 3WKDA 4E88A 3WRVA 3KPWA 4BP9A 1JAZA 2FLUX 2FSPA 3D5TA 3W5UA 1P9OA 1WCSA 3B6JA 3JSAA 1Y81A 3SHWA 2C3OA 2BFAA 3IB3A 4DMRA 4KCGA 2QTGA 5KVSA 1PTJC 1BN6A 1TRKA 4FX2A 4LKRA 4EJMA 1DCKA 3EIFA 1OCEA 4PG6A 1T9HA 5LIPA 2V0GA 4ZVUA 1QU3A 1LK5A 4M4NA 1M5UA 5JD3A 5K0EA 1LF5A 4FE4A 2I3BA 4PHHA 5HZMA 1P5JA 3V46A 1V1RA 3GLGE 1T25A 1GDTA 1W46A 4UF7A 3KQTA 3TQRA 2C2WA 3NEYA 4HX2A 1EEXB 3ZVMA 1PNRA 4RKWA 1PJ8A 4L0DA 1SOWA 5C31A 4XWKA 5I01A 3RUAA 3UFBA 3THXA 1EFUA 2RHBA 4N0QA 4LC9A 3QVVA 4BE9A 3DOEA 3HPRA 1Y7LA 1QE0A 4GW3A 5BY2A 4KMOA 4GOKA 3L4KA 4MW0A 4OQDA 1V0ZA 3K3PA 4M2LA 3EGOA 4TMZA 4Z9YA 3V48A 3UHJA 2HRQA 3HCDA 4CL2A 1OA1A 4JXKA 3C6ZA 4OHRA 4WVLA 1YHYA 1W59A 3V3KA 1UDCA 1WMAA 2I1QA 4CLHA 2GAFA 3UXYA 2JFNA 1GL7A 4X6KA 5LMCA 4H35A 3NP7A 5IKMA 2POOA 3KO8A 2LV8A 5AI4A 1TAHA 1J2RA 1MPTA 3DVRX 2BFPA 3ECAA 3T34A 1PU2A 3B53X 3FRJA 1RNLA 3RBXA 5MN5A 4K1LA 1CQ1A 2B0JA 2ATEA 4GEGA 1XQ1A 3D4LA 4JUIA 4ZYWA 1USUA 1NF8A 1ZGCA 4EZEA 2A9JA 2XD9A 3X2EA 5J4YA 3B9PA 5EJ2A 5EE3A 3TEJA 2XWQA 4GT1A 1DT3A 1Y4SA 1WSDA 2XCOA 2G0TA 4FLMA 4PYMA 4US1R 2RK4A 1GV0A 2G9NA 2QRNA 4PQFA 4MX0A 2P77A 3UAXA 4AUEA 5BW5A 1F8UA 2ZREA 3O4FA 4EAAA 3C8HA 4OLBA 1MB9A 3IPCA 4Q1DA 3BK7A 2H17A 2C2XA 1EFVA 3RPEA 2ZRIA 3ABQB 3RTCA 2I22A 3QYJA 1M2EA 1E98A 5AXAA 1U0OC 1DILA 3BD9A 1QAMA 1QV7A 2IEAA 2R2AA 4PC7A 3FPAA 3VC1A 1JZTA 3EJWA 4KQCA 1YASA 4MRMA 4NMLA 4WLOA 2W6JD 4WY5A 2QRGA 1UBJS 4N7JA 4KLNA 4XGQA 5KNCH 2H8GA 3E35A 1Y6FA 4Q4LA 5TPZD 1WHTA 1H0HA 2P90A 4OAPA 1OLOA 4AZTA 2W5NA 3PBKA 4LOKA 4M9QA 3O1HB 3LSTA 1Z33A 1EUQA 2RB5A 1IN6A 2CKDA 1ZP6A 1OYOA 1T1EA 3ROQA 3AGQA 1QG4A 1O6FA 2Q41A 3DDHA 3WP0A 4C7KA 2PSSA 4RF3A 3L43A 3QVLA 4NZPA 1ZH0A 5LM3A 3VKGA 4QDJA 2EERA 4OI4A 2PNFA 4CMEC 3TSWA 1UBUS 1H2AS 3SR0A 3BREA 1G20A 4RA9B 3E5HA 1YSCA 3F2VA 1FCJA 2NT4A 4GOLD 4RHEA 2WJYA 3Q6NA 5LZ9A 2IUSA 4EPWA 3FH0A 2VL7A 4Y2PA 1M1NB 4FI3C 4OA5A 5HGJA 1PJTA 1J56A 5C8YF 1M2VB 2IE0A 3ZU4A 4KR6A 1KWGA 1Z2PX 3AVXA 2VF2A 1WQ3A 2YCLA 3V9PA 2WABA 1DWQA 2GNOA 3O74A 4J0EA 3Q3VA 5GX3A 1WIWA 4I5IA 4K6KA 5G1PA 3PCRB 4NOKA 3NORA 3URMA 1IULA 4KXFB 5CVEA 3EXIA 4MUEA 4EATA 3RVDA 4AO6A 1A77A 2F90A 3Q8MA 1T2EA 3CSUA 4IQ8A 3TLGA 4BFUA 2CFSA 3WGKA 1BX0A 1PFKA 4M8LA 2ZIGA 4XLLA 4YHHB 3QXJA 3E22B 3NEAA 4L15A 1VP3A 3LCUA 1QGED 3MWEA 1BXGA 1F8FA 1I2ZA 3AC0A 4JY7A 2Q5LA 4HXEB 4J0QA 2JLAA 3QOXA 4JU8A 5M3BA 4BV3A 1UBSB 1TUBA 3QVXA 5FBKA 1QC5A 4O8ZA 5FI3A 4RM2A 1RBZA 1SELA 5LD2C 1MB2A 2C29D 3RFFA 2I3GA 2XCQA 3VHRA 4D82A 1CK4A 4HUTA 5FTLA 3VO8A 2NNLD 4FBGA 3VOTA 1FP4A 1TCUA 1JE1A 1NONA 3COVA 1VI2A 2WVAA 1KYWA 2HCTA 1J0AA 1XU4A 5A04A 1NR1A 1Z9BA 4XUEA 4XOUA 5E4YA 3AVTA 3CNQS 2DSOA 1E3WA 1FK8A 2F8MA 1QRRA 1T0HB 3QX8A 4N3GA 4OQZA 1UOOA 4I5FA 4TWBA 2FFRA 3O4RA 2ZT6A 1ZMOA 4PBRA 5C5CA 1M5RA 3U0BA 5SZJA 1RI1A 1KDYA 1G18A 2QZJA 4GVXA 4NJEB 3KQYA 4MUXA 2I4TA 2WSLA 4MDYA 4UATA 2MDTA 1EEHA 2RGWA 2OGZA 4LY3A 2B1IA 1YFJA 2IEYA 4BCBA 1NOKA 1BFKA 1ZEMA 1BYUA 4ZI7F 3O03A 1OX4A 2OHGA 2VTVA 4LNHA 3G5AA 1OIXA 4D46A 4KR0A 4OFBA 5H3LA 2PL9A 1E2EA 1VMAA 1ZXLA 1QFSA 4DARA 3PNLA 4A0GA 5CBPB 2GD2A 2GLUA 4HBGA 2DFLA 2LE0A 1D2EA 1P6QA 2D13A 2J09A 4HGZA 1U2DC 2WP0A 3LD9A 1VKZA 4OHXA 1M54A 1W30A 2R48A 1K7EB 4HNHA 1D7OA 4UU8A 4G5XA 2Q8NA 3CRMA 1WSAA 3PKJA 3R5KA 5DYIA 2MR6A 1L8OA 1EMDA 1HDIA 1UBHS 2FEAA 2IY7A 2PYIA 3G9QA 1ZUD1 3WNCA 4ETNA 5T4FA 1FNNA 1PK8A 1TYCA 3GLHA 4RK6A 3FCXA 1Y34E 2O1XA 4M99A 2ZXEA 1DX9A 1DQZA 2BTQA 2GBFA 1V8PA 1EX9A 4IVQA 3NHFA 1PZXA 3V1SA 1E6KA 1R6TA 2OJHA 3ME5A 4XARA 5J2UB 3AEUB 1ODJA 4F5WA 4BB0A 3M4YA 2X8AA 3ZV6A 3DTVD 1ZIYA 2C84A 2VYFA 3RODA 5F1KA 1JG3A 4OJYA 4YV0A 2DCUA 4KPGA 5HJ7A 4AQ7A 3M89A 1FS5A 1P7CA 1MIOA 5DN6D 4WN3A 2NSJA 1SK8A 1OZFA 3WLTA 2RB4A 2C42A 1HL3A 1R8QA 1S2LA 2AFRA 5K5EA 1N1MA 4HZGA 1RYFA 2H1SA 4L9RA 4DR6B 2JIPA 4F4FA 3NJRA 4BUCA 1I1OA 1UQTA 2IH2A 4BEWA 1J07A 2QRJA 3M3HA 1XJQA 4LYEA 1A9QA 4ITUA 1ULZA 1ZH8A 4RWEA 4A0QA 1GQRA 4N5MA 1CETA 1AQYA 3D8RA 3MWJA 2PQMA 3JV7A 5DCWA 3I8XA 4A4DA 5SY9A 1ISHA 3PS9A 4PVDA 5IX8A 5GP1A 4MV8A 2BDUA 5AM0A 5K3DA 1JIUA 4C06A 2FEMA 4QJ5A 4LWOA 4IHJB 1XRNA 2PZMA 3QVOA 4B6RA 1JXAA 5DGDA 1PS9A 1L7HA 4IN4A 5ALEA 4BC0A 1NW3A 3M5CA 2HXGA 1F9AA 2Q1TA 3EA5A 3KU1A 1ISIA 3USES 5AIBA 3O90A 1VE6A 2OHHA 4JQOA 3R2JA 4N5IX 1NJ2A 1U65A 3N0XA 4I14A 4UASA 5IARA 5K3SA 3RU3A 4DMCA 4W7HA 4ZCMA 1JBQA 1KH1A 2AMJA 4BBAA 4ZEVA 2HXYA 2XDQB 1I0ZA 1BWRA 5FR2A 1AK2A 3CKZA 1Q7GA 4HVAA 4P82A 3ICPA 3T3EA 4P32A 3GFVA 2WFLA 1R10A 3UMFA 5JNTA 1ATIA 1CF4A 4BMXA 4X00A 3S2FA 2ZTSA 4RVNA 1IUCA 4QU9A 3OWXA 4M9ZA 1GUDA 1K97A 3NHSA 3JRWA 4PXYA 1PZEA 1Z8FA 2JK0A 1UBOS 1H93A 2ZB5A 2ZSDA 5D84A 4GLOA 4YXWA 1KRWA 2CXXA 3P20A 4RXTA 4DKJA 1KERA 4E13A 1U0BB 2JIRA 4D74A 1LRLA 2ZJ2A 4O2RA 1IZ0A 4WZAE 1NYQA 2GGSA 2R25B 4OQLA 2IV2X 3MLBA 4AN1A 1U7HA 4ZYTA 4CEIA 2X9LA 2XDYA 2GJKA 3ANXA 1F5NA 1ZJZA 4MR8B 5D2CA 4EP1A 2DB3A 4HMOA 3ENVA 4H77A 4C6SA 1N6OA 1P2GA 3C6YA 5C1IA 3TW0A 4MV1A 1YJAA 2NGRA 2PQ6A 3ZGVA 5ITWA 3WBFA 2FOLA 2IIQA 1EQ2A 1AHHA 3L0SA 1IVYA 4FW9A 3HMKA 4MJXA 3DJYA 2II6A 3UQYS 2BIFA 3ZCRA 4RTRA 1Z2AA 3AWDA 1XU7A 3ONFA 1XIVA 1YF3A 3S68A 1N7JA 1V47A 2CDCA 5LP6A 4FEEA 4P4SA 2P5TB 4BNGA 1D8AA 3ZJVA 1F0NA 3F9RA 1U0JA 5AP9A 2PUHA 4GXRA 4A2QA 2PGIA 3ESZA 1L5SA 3HKDB 1RQNA 1JHYA 1F6WA 1RSZA 3HLHA 1FDWA 2WTBA 3NCHA 4BAGA 1KEEA 2KBEA 4RHYA 1UKVY 1MCZA 2IP2A 3S55A 3O0TA 4YMLA 3SZ3A 2G67A 2QRUA 1GNRA 3FTDA 4OSPA 3CRW1 3R74A 2HF2A 3JD4A 1ZZEA 2O8CA 3QYPA 2LPMA 1XCBA 5BW4A 1SU4A 3BRQA 4ILKA 1PK7A 1Z2DA 3E7XA 1GTG1 4KDEA 3W05A 4JT4A 4D8WA 3GB9A 5JVDA 1SG0A 1JTFA 4D52B 3RT9A 1JDJA 1T43A 2I3DA 2RAUA 3L3BA 3W5JA 4HH0A 3VU1A 5JLJA 2OAP1 3K71B 2IXTA 3DKIA 3DTNA 4ENSA 1QIIA 1L5FA 2DFVA 2A0XA 3RB8A 2XZOA 5IDYA 3BZWA 3RLIA 3V7FA 3SJAA 3LUKA 1KS9A 2WHXA 1RHJA 5CTJA 5GM1A 3O4VA 4G36A 3UOAB 3KQNA 2CNWA 4G5RA 4JP2A 4F6LA 1H2BA 3ICCA 1RTKA 2GRAA 4PZPA 4RUKA 5AW8A 4K0KB 3IP9A 3N3BC 5ESXA 3EN0A 1DE0A 1F20A 4DNXA 1AHNA 2QN8A 1ZSNA 1OFUX 5EKXA 5FBHA 3FCAA 2A9PA 3KTDA 4DLLA 1Z6XA 3KYBA 1I4OA 1F8XA 3F3YA 3KZCA 4DTIA 3QPWA 4FYPA 4OLFA 1EVEA 4GLFA 3P9KA 1LPPA 3QXHA 1NA5A 3LI4A 3O9VA 4HTFA 5LBUA 4EL0A 1KL7A 2OXEA 2X5OA 3R5TA 4HWPA 1WXXA 1T4DA 2IYWA 4R3WA 4RXUA 4EECA 4QREA 3KT6A 2X23A 1SQ0A 2JAHA 1NPYA 3KJZA 1Y7HA 4HN4B 5E6RA 2BL4A 5BN4A 1JX6A 3NBYC 3DOOA 1EZ1A 1ZISA 2AI1A 4P86A 5ALTA 1WB4A 3S1SA 5FNVA 1O5IA 3HKCB 3GFSA 3V7UA 3PTAA 4JYPA 1VGVA 5A9RA 4HRYA 5I7OA 5K99A 4ENQA 2DERA 2Y1EA 3N74A 3T7IA 3QSYA 2H11A 1JNXX 4N03A 5DI3B 4HX5A 1B2LA 1XDGA 5JC1A 3KAKA 1R3DA 2PFSA 1ENOA 4CR6A 3TR5A 1W1UA 1PQ4A 1COWA 2BFEB 1PNOA 2WUGA 3FNFA 4ZOCA 4CFYA 5A2QA 3FTEA 1IVEA 2AA3A 5K3FB 1U9YA 1ZH6A 4LXHA 4JWTA 1YR8A 1RBYA 1KF0A 2L19A 2AG5A 2HWUA 1R5OA 4EKDA 3LLUA 2CJYA 4XEUA 5AW9A 4AUMA 2WB2A 1O8BA 5CLGA 2CV1A 2V45A 4ZVPA 3TXYA 3BFJA 3THYB 3CLKA 4WWHA 4P0PB 4BO4A 3EWNA 3ZKWB 1IZZA 1QV6A 4F6RB 1SCUA 1IXZA 5BSHA 3L6BA 4X63A 1H66A 1SG6A 1SOAA 2CXQA 2V9ZA 4FS3A 4IRXA 1I7NA 3L4BA 4TT8A 5CDGA 4Y2HA 4C0KA 3ES9A 3TTWA 1GNLA 3LUCA 1W5FA 1AF7A 4TZTA 4EEZA 1ZRMA 1R9GA 3NT4A 2ANBA 2XKKA 3MQ2A 2NU9B 3BL6A 2FPWA 4WX2B 3KBBA 1ONBA 3GLUA 4Q93A 3VBEA 1GA1A 3C98A 3HA5A 4OBXA 3K37A 2H06A 1C9NA 4L8FA 4G6ZA 1EJ0A 4NE7A 1FJ2A 2UAGA 1DBWA 1D0IA 2FLWA 4XYGA 5IPFA 3EVEA 1VLMA 2K4MA 4P80A 4D4IA 1FFHA 1YZKA 2P27A 4YJ3A 3MJVA 1SKYB 2GXAA 2QROA 2F24A 2PL1A 4EYKA 4HDNB 2E48A 4KSYA 5LA6A 2POQX 1TTHA 1FNBA 3G2KA 1EAMA 3IP6A 4XXHA 2Y0BA 4EKIA 3W34A 1ULHA 3X1DA 2EKPA 1AQ6A 4QO8A 2ZSKA 1H9CA 1U8FO 4ENUA 2PGAA 2J4DA 2Q49A 2WIKA 2CXRA 4R9RA 1AKRA 1GKKA 3OQPA 1YB7A 4X1YA 3F0TA 1UXOA 1FFXA 3LGAA 1R6UA 1TQ6A 2Z5GA 1DL5A 2ZYGA 5T6MA 2AK3A 1Q0TA 4TV9B 1LZLA 1K8QA 3DLCA 4FOLA 3OC0A 4BNIA 5JZOA 1G291 3NVMB 5HK8A 4IV5A 3BMCB 3ML1A 1VJ1A 2WIAA 3VHXB 4F8JA 4F2PA 1JKMA 3EB9A 3QU9A 3KVOA 3L7NA 2ACWA 3N2IA 3Q7TA 4GQBA 5I3ZA 2WJZB 2C7GA 2XCIA 3ZDEA 4C20A 3UJNA 1W85A 2BI4A 1DTEA 5E8RA 3RTBA 3MJSA 4YW5A 4L1KA 4OUDA 5CCDA 1FMTA 2DQYA 2J6HA 1X1TA 2AMLA 1A2BA 2Q2NA 5EKDA 5TDHA 1FMLA 3ZCVA 1B26A 4B47A 1E2JA 2HV8A 2XZTA 2OQRA 3AY6A 3OM8A 3AF0A 4RC9A 4AH4A 1SCKA 1AK1A 5CK4A 4R8MA 4BOYA 5ERYA 4K3YA 3ILSA 1AXRA 3KQUA 2QI9C 1TKAA 1ZAYA 2H4YA 2VZ9A 3HO8A 4J4HA 4X0EA 3WBKA 4BMOB 3L05A 4EA8A 3ENQA 3GLFE 2P5YA 1L7VC 5HM8A 1FFCA 1VCMA 3BL5A 3RS8A 2C4UA 1A69A 2IYQA 1TA0A 4F4DA 2A59A 2PIAA 4TLBA 3H9CA 1CDEA 2A3RA 3JR3A 3KYDB 2IAXA 1N2OA 1WJGA 2FWIA 2F1IA 2JI4A 2WILA 5CH3A 3ZIAD 3ZDCA 1ZW1A 1NBMD 4JGIA 4NLLA 3GHYA 4XFJA 1IHDA 4OXNA 3TQQA 2FZLA 3U4AA 1G5HA 5JXJA 4YT8A 4IGFA 2FEOA 5FWYA 5CA1A 3BG5A 2ZUWA 1G1MA 4IIGA 2AX4A 3EXG2 3ICQB 2FR8A 2HF7A 1L5HA 3UVEA 1R0XA 3JQCA 1JBEA 2JDIA 4NEGA 2GPNA 3QLVC 4PY2A 3VI3B 1DQPA 4M1YA 3H9QA 3QQ5A 4EYGA 2ZSAA 5DM1A 1ZIOA 2I78A 4FBMA 1FP1D 4RVSA 3K5PA 1JYSA 4MQEB 2CXUA 1JPNA 4KS4A 2PMFA 2JJ2A 4LYJA 4CUKA 4AMVA 4TKVB 2C2GA 4LZOA 1L4LA 1AH2A 5I7SA 3FOAA 2QRZA 1E9SA 1PR3A 1OVMA 2ZI7A 1RM5A 1RXCA 1W19A 4FYXA 4WFIA 3GJ6A 3WWDA 3G2PA 4DLVA 3PFFA 2PSDA 4UULA 1TZ2A 2JBWA 2OQIA 1WTAA 2OBLA 3FN4A 4R0MA 2Q9BA 3H4IA 2BVNA 3FCSB 4Y2RA 3BAFA 2V97A 2W6ID 3JQ6A 5JDCC 5T3YA 3SLKA 3WMXA 5LNK1 4Q3AA 5EJGA 2ZWMA 1SULA 1N0IA 1XLTA 2EFEB 1OBFO 1XTSA 5BVHA 1DIRA 5DM70 4V0KA 4WZBA 1AGXA 1AQNA 1TEXA 2HRCA 3JD3A 4AKTA 3DL4A 1DKPA 3KAQA 3GVJA 1Z36A 4XIFA 3W1WA 4YAKA 1A1SA 2O2HA 4CL8A 3OU6A 3LXRA 1ELOA 4KB5A 4EI7A 2VH1A 3TCKA 3K0AA 1H8ED 4YV2A 2HU8A 3GAFA 1Z82A 621PA 5HZHA 4WZ6A 3LDFA 3TWOA 1JSRA 3AHEA 2QD5A 3GVCA 3CRNA 3VDXA 2FMUA 3WGOA 3HYTA 4YTEA 2H48A 4ZAWA 4AMYA 3CKMA 3B3JA 2VXOA 1KDVA 1P4JA 1KZ9A 3DCYA 3S81A 1OMOA 1W35A 2R6GA 1F2DA 1GDDA 5KWVA 3ONDA 3PJGA 5AT1A 4AYXA 2WKQA 4L4UA 1NRJB 1KS2A 1GPH1 1UEXC 1XD2A 2GD0A 2JGDB 2NAPA 1KI6A 1CY7A 2MMGA 1GPJA 2V58A 3EFEA 5C52B 4EJSA 3IEKA 3HYNA 3MT7A 1XKQA 1Y4ZA 5D6OA 5JQWA 3JQFC 4MWQA 2PZBA 1E4OA 4GD3Q 1F3LA 1E2PA 4XGRA 3T52A 1EXVA 3GW8A 3GA5A 4DVGA 3D2AA 2H52A 2BEWA 3OQJA 3SHFA 2Y9MB 3L7IA 2F1OA 4Y6OA 1DBSA 3HZOA 1IJBA 3IKJA 2HJ9A 5HBGA 1NLZA 1YT5A 2Q99A 4CM4B 5I8WA 3U7FB 2DT5A 2B4KA 2QUHA 1U8UA 2HGSA 5F7JA 3VKFA 3U60B 4P54A 2INGX 2QWKA 5ALLA 1U2TA 2PJZA 2ISSD 2R6AA 4M0CA 2PN1A 4HV4A 1BXZA 1UFRA 1RPTA 1VMEA 3BIWA 2ZVDA 3DBRA 3FLBA 1G38A 1P0FA 1NV9A 1QH8A 3OCUA 2HBQA 4U00A 2C4AA 3V8QA 4KO8A 1NVFA 3V1UA 5IVIA 3CPEA 2Y1OA 3RKSA 2JHAA 2BI8A 4L5BA 1U3UA 1E7WA 4GPEA 1TCCA 4BQOA 3A2MA 1JHOA 1PX0A 3KVNA 2TECE 4RTPA 1M2NA 4UNPA 1X94A 1G21B 2BGJA 2ZIWB 5CLLA 4D52C 1CY4A 3ZJYA 3VKHA 5INTA 4ZCPA 4LVUA 4M7WA 4JI8B 2EBUA 4Z53A 1E8DA 2JEOA 1SFRA 2AQIA 2G5TA 3F4LA 5K0TA 1IMOA 1L7EA 3OIGA 3SYKA 1J0EA 2J9FB 3AR3A 3EZGA 3QU4A 1ZD9A 1NN3A 2OMKA 5EJFA 2UVQA 1RKVA 1TJYA 3UC5A 1ZYUA 4EVSA 4XVRA 1FUKA 3R9XB 4UTZA 1ULTA 2GCNA 3VUEA 4CQMD 1WTCA 4JF7A 4NAVA 2XTNA 3DUFB 4IV8A 4RKEA 2JLCA 3T7SA 4W5OA 4UUNA 3W7AA 3WB9A 2P2CA 3RS2A 1SC3A 4G5QA 3L8FA 3AUXA 2NUPA 2ZSUA 1ZJ6A 4PRYA 4PIMA 4U2CA 1WSBA 5F2OA 3Q40A 2B5VA 2NVUB 2DEUA 1OXMA 3ZLVA 4C01A 2AWNA 2H8KA 3GUCA 2F27A 2O1EA 1Z56C 2V1XA 1JU3A 2GESA 1YGYA 1TDJA 4QN7A 3M4XA 3NXKA 2XXAA 1I80A 2GLTA 1TZCA 2PQ2A 2VHXA 3AEKA 4ARCA 1WDLA 4RVHA 4GWGA 5B3JA 3B3FA 3EXFA 3FUXA 4ZOAA 4YRFA 4AJHA 2H63A 4L7CA 1E2HA 4U2FA 5DSTA 2GVXA 1P0PA 4PU0A 3AF6A 1U0LA 1EWQA 1J2UA 4EGFA 4TWAA 2OOKA 3MJ4A 4AZWA 2Y6VA 3WXMA 5NN9A 3KEQA 3TQIA 2YZMA 3INGA 1Z8NA 2A5FA 3QUAA 2FZVA 1QLJA 1E64A 4IDDA 2OLEA 4KUGA 2VK5A 1EXWA 4KAJA 2DWQA 3ZJ4A 1UMDB 3ROTA 4D8SA 3A7EA 3FKQA 1H6BA 4K0RA 1WW2A 3IE0A 5JCOA 2XXJA 2VXYA 2RBGA 3RFUA 5REQB 1T9BA 2CNOA 5C8XA 4FHZA 3JAMA 4DLZA 2NZ2A 2XOXA 1W76A 1S8OA 2IBTA 4N6NA 4WCDA 4X65B 5AKXA 4FN5A 1C4OA 1F2VA 3IUMA 3V1MA 4I55A 1SXJD 1CQJA 2CL5A 3PIIA 2HR1A 2IXBA 4IDBA 4J1TA 5EX7A 2R85A 4GLLA 5TX7A 2ZB6A 4AMBA 1ZJJA 3DXFA 1NZFA 2D2EA 5BSMA 3P1JA 4OQ4A 3H84A 1GSOA 2Q45A 2CVOA 2BISA 1KO8A 2RBEA 2HPVA 2QWBA 3IP7A 3K6KA 3TL2A 4XM2A 1D03A 1KGSA 2IF2A 2WJHA 3UYLA 3KHSA 2C2KA 4MV7A 4Z4HA 2XUGA 3COWA 3JQ8A 3RYHB 4LJRA 3PTLA 3DMDA 5LZ7A 2Z8YM 5JOQA 5CVJA 1MC1A 3O84A 3WY9A 3CZPA 1GAJA 3NUGA 3O2JA 1A5ZA 4GR5A 3W2GA 4RPJA 4X3OA 2GBIA 3BSWA 3WHPA 5KTNA 1RMQA 4ON9A 3V8VA 3FYHA 5L4NA 3W09A 1CQWA 2IYVA 1QK4A 1TYDE 5JAOA 3EZFA 5A9SA 5BWOA 1ECLA 2QUBA 2VH2A 3WMEA 5AW1A 3PWTA 1E4VA 2EBFX 2P2LA 2VYND 3ZLTA 3BMQB 4ALMA 4ATNA 5BWLA 3WRYC 1M2JA 4NOJA 2LXNA 1N7DA 1XEWY 1XZLA 1KMNA 4C2UA 2TMKA 1G4UR 5D9BA 3SQLA 4I2VA 4M3MA 3LBIA 1ZICA 2I6GA 1EPUA 2CVPA 4QXOA 2XE8A 2I76A 2OMEA 2E9SA 2QB5A 1S1CA 3EH2A 5IHXA 2WZBA 3FLMA 4B7UA 5KMGA 2OV6A 4GNAA 1AZTA 3B51X 4UKDA 5FYQA 1R74A 2RG1A 3LW7A 3MVEA 1DLJA 3P32A 2OP1A 3HL4A 3TEFA 4JX9A 4NCBA 4C05A 2MSEB 4Q1CA 7ADHA 4O29A 3WOVA 1V8DA 2JVJA 3CH4B 4J0KA 8LDHA 4K81B 3RWBA 3UWPA 3K0KA 4PN7A 3RWMB 1NBOA 1MB4A 1NUPA 4N1BA 1JDSA 2Q5OA 2O5RA 1PCXA 1H4TA 3FWPA 3O95A 1X3LA 4JVMA 4OP2A 2X76A 5BWNA 1KXZA 3P2EA 1VYTA 4O4HB 2BZ1A 3RT7A 4CN9A 4Y2YA 3BDIA 4TTTS 4CMBA 1VSUA 4BO0A 4CV3A 3U19A 2OHOA 5C5EA 3VR5D 4WNAB 1JJBA 1M2OB 1U1FA 1ZBQA 4WKPA 1XDDA 3AFOA 2QEQA 4OGWA 3U56A 2C77A 1BEUB 3D59A 4TLLB 2RFLA 4MO9A 3W2IA 3U4GA 5AICA 3ONVA 3K1JA 1YVEI 5BRAA 5GIPE 1GNQA 1KQFA 4YZ4A 4EB6B 2QP3A 4H4EA 2P2SA 5C7YA 4U0JA 5BQ3A 5IBQA 1N92A 2P9GA 2ZATA 4W6ZA 2OFFA 1HNWB 4YJGB 5LXTA 2COEA 2J41A 4QDXA 1ML4A 1DKUA 4GP6A 3P2KA 2PA3A 2QMEA 3OZGA 2EFYA 4XIGS 4IZHA 3EFBA 2ZS9A 3OEEA 3BYCA 3TMAA 1MXHA 3MINB 4BVLA 2X3FA 2YWEA 4HT3B 4ZHQB 4Z0HO 4CG2A 1NUUA 1L5MA 1QPGA 4MWRA 3AB3A 2VLBA 3Q8WA 4ZQGA 1JIIA 4BQRA 4RZIA 3PKZA 1JSXA 1VSQA 2WM2A 4QWWA 4CTNA 3A6PC 1R4AA 4V0LA 4PX9A 1UK6A 4JQYA 3MA0A 1RXVA 5C1OA 2YW2A 1NATA 1KIMA 1KMIY 5CPBA 3WWOA 1S6YA 3K9WA 4PGHA 4YP6A 3B2EA 3WN7A 3FVQA 3FJOA 1BJRE 2RHWA 1G5IA 3OJ0A 1BX1A 3MBIA 4UUQA 1HE8B 4EPVA 5KJ6A 4FGZA 1Y3FE 3QKTA 5KWIA 1X7GA 4HAOA 4UU0A 1HE1C 4K1IA 4AY2A 4QPPA 3Q8LA 1N4DA 3FCEA 2H3EA 2H7YA 4BUZA 3R3WA 3ZK8A 2PPLA 4BXOB 3OT5A 3W7VA 3B8EA 1XQXA 1HSZA 3VISA 4Z7OB 4R83A 2LW7A 4FFNA 3WV5A 2GEUA 4TT3D 5EFZA 2K5UA 4JC4A 2YJZA 4M0PA 1KBZA 3D2LA 2QU7A 4IFBA 2I2FA 1OQAA 3R7BA 2J0UB 3K70D 1DBRA 1RXUA 2G7ZA 1YZHA 3LC2O 4GZOA 4ZVNA 1U7XA 2VT6A 4A8JB 4QZVA 4EYQA 4Z3DA 2VTBB 2YHUA 3JPWA 1BU5A 1O87A 1MOSA 1RKQA 1UP7A 3PWSA 2XYHA 4YYEA 4B6EA 3CF0A 4DEVA 4M83A 4LDZA 2ZSEA 4QYWA 1VKRA 5CIQA 1X7XA 1VPWA 5BQFA 2YUTA 5EXSA 1OT5A 3CUVA 4OATA 4BGVA 3U7QA 3U13A 3G59A 4HEA6 4PO8A 5FB3A 3SX0A 5JIBA 4QN4A 1N9GB 1YBHA 2WV9A 3C3MA 3E58A 4BMNA 4B76A 4DREA 1QHHA 4QM7A 1E1QA 2ZVQX 1PV1A 3IILA 1ID8A 3KSMA 3N6RA 3RYCB 2B82A 4WD3A 1GL6A 2F0ZA 3CW2A 1UKZA 2YS6A 5DNEA 4BMCA 1IN8A 4MICA 1E9EA 1YMQA 1U5BA 4XASA 1D5WA 3LFHA 5FLYA 5IH7A 5SZHB 3ZV7A 2YFHA 5L3QB 2R44A 4G41A 1ZY2A 1S0IA 2FX5A 3HN7A 2GN4A 3SOBB 3NNDA 2H0QA 4KYUA 2MYTA 4GOND 5GQSA 4JLPA 1KY5A 2IPMA 1XMSA 4HNVA 2X0IA 3PJFA 2LD4A 1RHKA 2XODA 3NKVA 4B33A 4PLZA 2Z83A 2HC9A 3C4JA 1SXIA 1GWNA 3OD1A 3TQFA 4PRLA 2PUCA 2QW8A 1YA8A 1Z7GA 3KXPA 4G5GA 1HFKA 4N01A 1GKUB 2VAPA 1E9BA 3EQZA 2EZ9A 4N7RA 3WDZA 4JJ6A 2JAXA 1JDBC 3F5SA 3PEFA 1FQWA 4RLHA 4R71A 1AOXA 1E66A 2WTNA 3AXSA 2JJ8A 4D9GA 4IOJA 1DQRA 4RL6A 4RTQA 4EGSA 2VA8A 5DHFA 5EZYA 4LBZA 4Q0MA 3WL5A 5KNBH 1BKYA 3KJQA 5AJXA 2JASA 1JTVA 4ZALA 3VVBA 3ZHRA 3B3QA 1X9IA 2GHRA 1YBMA 4E5PA 3JCZA 3X3HA 4PICA 5DYNA 5AW4A 2IPLA 2OSBA 2ECPA 1E62A 4I1IA 2GDJA 3UMYA 2A0FA 4BGEA 4QXQA 3F6CA 3VPGA 3QLJA 4RE5A 3KSBC 1EVLA 1XZIA 4WGGA 1KMHB 2DM6A 2EHDA 3AHHA 2ET6A 2Q9AA 4IINA 4K88A 4MWTA 1VJGA 4PAOA 1NG9A 1OZAA 5LQDA 1JP7A 1KK0A 3F8WA 3PR2B 1GTRA 4ME6A 2ASEA 2AZTA 3GNQA 2XTJA 1X2JA 1EXNA 3VJLA 4OQMA 4RESA 2BJVA 1BKSB 2WWXA 3NTVA 1FFBA 4II7A 1LUAA 2XE7A 4UHCA 4ZAFA 2ZZMA 2VDQB 3C8DA 3KEOA 4XFKA 3T1TA 3HWWA 1E5VA 1GARA 3P4UA 4OQNA 3V5NA 4B3DA 4IKEA 1X87A 1PFUA 1G8PA 3DCNA 4FN4A 1Q6ZA 4A5OA 1K6JA 4BKUA 4XJSA 1P0MA 2HJVA 3DVAB 3H1GA 3M5WA 4YMHA 3I9KA 3A05A 1KFEB 3KSZO 2FMHA 4U39A 2PD3A 5F3WB 2A84A 1XRQA 3ELWA 5LUAA 4F96A 2KPOA 2VP5A 1N5LA 2BFOA 1XMXA 3BTUA 4RXMA 2QT0A 4OI1A 4C0SA 1ZEJA 2J0VA 4HEQA 3AHGA 1EE2A 3OJCA 2C4NA 4U2BA 4UMVA 2VJPA 5AVRA 5KTYA 2Q4BA 1YDFA 5LYJA 4YR7A 1WBBA 2HADA 3LP8A 5DISB 4BLTA 1J25A 4YCBA 1FFAA 3ZY6A 2UYCA 1P5ZB 1Q1AA 1FDTA 2IEZA 1X7HA 1JHXA 2W48A 2CN1A 3D8NA 3MSCA 2YY5A 3P45A 1BJTA 4XJ8A 2DJ5A 3OOEA 1RYYA 3SSOA 3T3PB 3SJBA 1KJJA 6REQA 1U99A 3FPGA 3VVMA 4DAEA 1BVHA 2Q6TA 1SQFA 4AG5A 1A71A 1LDMA 1INGA 2CJXA 3C45A 5A3SA 3X2SA 4CF6A 4F9GA 1K2WA 4DSAA 3EPHA 3QMMA 1ARZA 3RWOA 2SBTA 5B7PA 4AWBA 1ZNQO 3BB4A 3A1SA 3ADEA 2F28A 1KNXA 2JIMA 3DBOB 2V3VA 4WECA 3L7CA 1E63A 2IITA 2SKEA 1ZIPA 1IMJA 4FPFA 1EFDN 2MINA 4RFSB 2VRCA 2W9XA 3EGEA 1TZJA 4JNCA 4MQ5A 1WF3A 3PHBE 3V6MA 3WLPA 4RS3A 4CGYA 3KYJB 4RZ2A 1QB7A 4QD3A 2P9QA 5LOVA 3P2JA 4PWZA 4JI6B 2F3PA 1UDBA 2PBRA 3WO1A 3QA9A 1P7VA 4XUDA 2F3RA 5CYGA 4D4KA 1FFSA 3W5AA 2HPZA 4P0TA 5EIFA 5KDLA 3CW9A 4WDQA 1P0QA 3EGCA 5KTTA 4MW9A 1AKTA 1FQJA 3OOJA 1TA4A 4L4SA 2NQ2C 1V04A 1W9MA 2D7JA 2R00C 3IOEA 3ORFA 4RSGA 3K0EA 3WQRA 4CKXA 5IJ0B 5HE8A 1T8PA 1X1DA 2LP4Y 3GARA 4LYYA 1LDGA 1TVKA 3UT0A 1UZLA 5IU6A 1T91A 4XPIA 1S8AA 4DLNA 4BRZA 3PFIA 4DSNA 5KWJA 5JZMA 4CCSA 5G4KA 1FTQA 2WE8A 3AUUA 3TZLA 2XVZA 1GGNA 4GN8A 1K3FA 2NV0A 3FDZA 3GT4A 2QP9X 2B83A 1P4HA 3LC1O 4CF5A 4E5MA 1DVRA 2EVWX 3UK2A 3QE4A 4M8KA 4RMNA 3I34X 3ASYA 3IPYA 4Z2YA 1U1EA 2A5DA 4EARA 2YXNA 1PG2A 3R23A 2ZYWX 1R9NA 2W71A 1ZOLA 3ITKA 1KEKA 2XR1A 4NBNA 1JG2A 1I1HA 2X6RA 2WUVA 3DONA 1SU8A 3P2YA 1K8ZB 4DY4A 4BGUA 2BFBA 3R3ZA 1BE8A 1INXA 1YZLA 1XDWA 5LN1A 1NBIA 1XEXA 1B6SA 2C04A 2WD7A 4BZZA 4OTZA 2XV1A 3H16A 2QE7D 4MRVA 5C8YB 4G9BA 1PGNA 3CLUD 3O3CA 5TE9A 4JB0A 1N8SA 1ZITA 3ZN2A 4BNDB 3IERA 1B8OA 1UC8A 2IU4A 4LOAA 4V0ME 2O05A 1J1IA 3ZCPA 3PFKA 1IBMB 4WINA 4C7OA 3R44A 2OD9A 3THWB 3GF4A 4WKCA 4BDSA 1Q91A 1MUUA 5C7IO 1I51A 2XUAA 2ZRHA 1B1AA 1FUEA 2X13A 4QFMA 5D6NA 1BX3A 1W2HA 1XP5A 5EJIA 5CX1A 1O95C 1KK2A 3RROA 3QX3A 4R2IA 1YTLA 1Z4KA 1CVIA 1M7BA 3D31A 3MERA 2I5PO 2WDZA 4YZ3A 4KFRA 1B8VA 3LM8A 4GGPA 3Q6IA 4R5HA 4HBZA 5EKUA 4TZ6A 2JLWA 2VW1A 4FE3A 3BHJA 4REOA 4AJJA 3I37X 4M46A 4EMTA 1DXHA 3AW8A 3I4LA 2V4ZA 4IQ4A 4C4ZA 2ADOA 4BP8A 1ZUWA 2VDNB 1FZTA 4DKXA 4ZA2A 1T8YA 3HFJA 1DJMA 1V9SA 3EAQA 1CZOA 2ALJA 2C2YA 4RCVA 4WZAA 2VQEB 1TZBA 4OI0A 3OCWA 1QYWA 2X4GA 1B3BA 3MUOA 5E1DA 3W0LB 1GUAA 1J8QA 3PLNA 5D1HA 3UMBA 3IBSA 2I71A 3STHA 1T2DA 3L7LA 1ND6A 4KI0A 1KFCB 1HT2E 2Q9UA 4NS4A 4BLRA 1WULS 5LQMA 3FWHA 2PRZA 4OKIA 1TMYA 1I9CA 4V0NA 4IXWA 3O7MA 2XZKA 5DBHX 3T38A 3ZW7A 4HDOB 4E21A 1CR4A 2GEDA 1QIDA 3NYIA 3IKMB 2KYRA 3ZIDA 3NN9A 2BZSA 2J3KA 3B52X 5FA6A 1SQSA 2CJWB 2NXCA 5LQJA 2ZB8A 3OLCX 1B0ZA 2GZRA 4ND1A 2ZPTX 4I1SA 4E5VA 1LSJA 5DHAA 2HMAA 2YYSA 3I0NA 4D0NA 1Y8RB 5DGCA 1ZM7A 1RC8A 2QD2A 3K31A 4BNWA 1NUQA 3OOHA 1Z4YA 3TPFA 3C8UA 3TTSA 5IXYA 2Q6OA 3QHQA 2IOHA 3REQA 1GOTA 4ZQHA 3UJCA 1T6NA 1TQHA 2H31A 3FGOA 3QE0A 2Q0HA 4Q21A 4WY2A 3RJ5A 4DC0A 1S2MA 1RCUA 1DB3A 2M2IA 2F2TA 3PPYA 3UUWA 1E9AA 2JGJA 4HFMA 4NH0A 3BXEA 1Q83A 2WY2D 3RRFA 3GLQA 4TSKA 3W9YA 1MR5A 1JF8A 2XE4A 3HKBA 3NTQA 4PSDA 4XX0B 5TR9A 4D8XA 3DCJA 4DB4A 1IJFA 3GZJA 4OAOA 2GR9A 3QM1A 1G21E 2VXCA 4JZYA 4MTLA 4DLBA 5AHKA 5ENZA 2ICAA 3W6UA 2W83A 4B31A 1QVVA 1TVCA 4X41A 5CX4A 4ZI2A 1RRKA 1TADA 1S9DA 2VF7A 3AG6A 3E8MA 3BQ9A 3UIEA 2QZ9A 4A10A 3ZHTA 1INYA 4WA4A 4TYQA 4MQLA 1NVKA 4IMJB 4X60A 3A1UA 1TCAA 1ZMTA 4QUEA 4YMTA 5EP4A 1E1NA 2HW8A 1A2KC 1OBOA 2H07A 1VB5A 2J5BA 3MJTA 2A8YA 4TSFD 5EFOA 1ISMA 1MS9A 4D97A 4D2IA 4ZO7A 5TC4A 4R69A 1VIDA 1CNFA 1HDRA 1WCIA 1RACA 5TQ2B 4AL4A 3N5KA 3EWAA 5G53C 2MIIA 3AF3A 4NOMA 2OQVA 1QOQB 1P2FA 2BGTA 4M8IA 3TSYA 3E81A 2H59A 4W5JA 3L7KA 2NZYA 2CSXA 3NM4A 1M8GA 3D3WB 3H3FA 2VP4A 3GCGA 1RE0A 1PJLA 2C8LA 3L2OB 5BV1A 1D2HA 2CFCA 2IXAA 1OILA 4I3FA 4KS3A 5KCMA 1PFWA 2PLAA 2IQ5A 4HSGA 2PRYA 4BNUA 5C7LO 3UWKA 2FZCA 3E1KA 2I65A 2Z5VA 3QIVA 4OSOA 2YN0A 2J0QA 3GVHA 1RPZA 3RFXA 4OGLA 4FILA 3K0FA 4IO1A 4UE3S 2OBYA 4CM7A 2RGUA 1VZ3A 1L5YA 1NVBA 1HKHA 1OLXA 3A0UA 3IJ5A 3IVMA 3ZWCA 2GZAA 3ZIUA 4D8VA 4RTNA 2J48A 3G23A 1BJIA 2RGDA 3CZRA 3V2GA 3R7WB 3U3JA 4GPIB 3UB2A 5BUQA 4EGCB 2GCIA 1L0BA 2F3QA 1NNEA 3D6HA 1WMSA 1Z62A 1CVMA 3KZVA 2VFAA 5HMMA 1BA2A 1NOIA 1R0SA 3CGWA 5CNJA 3ECCA 5JBNA 1RI3A 3K36A 1PZMA 4WACA 2DCMA 1BQ4A 1GQFA 5IAOA 1J09A 3R5HA 2X9VA 1R6AA 1WMEA 1X2BA 1HYQA 2PJDA 3N2EA 3P8ZA 1CF2O 3ZDBA 2DULA 4GX5A 4NABA 5BW6B 1RKXA 2A4MA 3RO7A 3EXHA 3RVMA 3HL0A 2JBAB 4OD0A 4WASA 1BW9A 3WNQA 2JFFA 5KSWB 4XJVA 1MMFB 5FNQA 3CTMA 5COAA 1IQPA 4XUCA 4TXMA 2VK1A 3JQGA 4F21A 5C80A 1C9YA 1CPYA 1GPKA 2CHQA 1SH7A 3TLEA 1Z17A 3GR6A 3MCAA 2JKVA 1VGRA 2AFIE 2I2DA 1XZNA 1FRVA 2PTHA 1I2AA 1ZK4A 4MB6A 1R6XA 1QOPB 3AY3A 2G8NA 4OJTA 1D2NA 3SN6A 3IV6A 4HRVA 1KFJB 3L7YA 1GVNB 2AG0A 4GZ6A 4NJOA 5HG0A 3I1IA 5KYUA 3WMGA 4LG1A 1DC6A 1SVKA 2ZRFA 3BWBA 1MZ6A 421PA 4J4BA 3V6LA 4PFQA 5I9TA 4H0NA 5DNCA 2R6ZA 3PLRA 3JYHA 1CJCA 4C78A 5DRTA 2QLLA 4K9NA 3O6VA 2D8MA 4IILA 4UVGA 4ZAXA 1T9ZA 2GTPA 2IHVA 4TQUS 5A4DA 4ZYVA 1U2DA 3S2SA 4MV6A 1QJ4A 2YMMA 1G6KA 4MZAA 3V32A 2GHSA 2EJCA 4DRZA 1MC5A 4URHA 3C0KA 4NZYA 2Z30A 3KE8A 4GXTA 5EESA 5TGDA 2ZSJA 1MKYA 5F52A 4EBFA 1K7FB 3V8PA 1T3LA 2IGTA 2OBXA 1NZJA 1S89A 1TFRA 4PO3X 4Z0PA 1UWLA 4XLZA 1XMIA 1TM3E 2WMDA 1T9GR 3PGLA 1WD7A 1P29A 2EG9A 1XVUA 3N2KA 3O3NB 4NS1A 3VYTB 4RKQA 4QA9A 3PE4A 4BVGA 2Q6VA 3BULA 3ILVA 3M6UA 3FZQA 2YJ6A 3H2BA 3F8TA 4Q6KA 3OP1A 2JIBA 3COPA 3GEIA 4KWHA 4YLGA 5EA2A 3KT8A 2ECOA 3VR4H 2ISMA 5B3KA 4INJA 2VNKA 2O50A 4OOFA 2XUIA 1A9TA 1U3FA 4MYCA 4X7MA 3S7ZA 1I7DA 1ZM3A 2WHPB 1TFUA 5CHYA 2I2CA 4XAQA 5K45A 3MB5A 1IVSA 3FBWA 3L06A 5ISMA 1BRMA 1KQOA 3IA2A 3A6LA 4MARA 4YA6A 3ZX5A 2ZWOA 4QNNA 1HDEA 3WL8A 2R1TB 1J2TA 2DHEA 3ZXXA 4BB9A 1VJCA 2IC5A 1L3CA 2AX3A 3OZVA 4WOKA 4Y8VA 1KSGA 5EINA 3GLFA 4UREA 1L4BA 1ST3A 2QTNA 4EL5A 4Z3OA 1V3CA 4FTWA 4R3NA 1H5QA 1N0UA 1AV7A 1ZD8A 1T3TA 1GEEA 4FDAA 1NNLA 3AR5A 4DG5A 3Q2KA 2APJA 2Y99A 2I34A 2W70A 3VDNB 3U61B 4EO9A 2D2XA 3WGVA 2J6IA 3P0HA 2X5XA 1SBZA 2H9AA 4BO8A 3CN9A 4DR4B 1UIMA 1J8YF 1IBRA 3NQ41 4DIDA 4BV2A 1TU3A 3OFSA 3R7FA 2GBLC 1YXMA 4IUYA 4MMXB 5H9VA 1N77A 2XJ4A 1M6HA 5AHRA 4D8TA 1OYWA 3D3NA 4E5YA 3VNBA 3B1FA 3KPJA 5F1PA 5BN1A 3QKRB 1W4RA 2J08A 4AZ3B 4WEGA 4DXHA 4RAQA 3DG9A 3UZUA 1N8KA 2V1UA 4D4JA 4NULA 2XNCA 3H73A 4MQ4A 5BV7A 1FDUA 2JLZA 3KBOA 3CVWA 4K2HA 1T2FA 4AKGA 1H2ZA 2BGMA 4E51A 5IKEA 5JO9A 3BKWA 2JIQA 2ZBEA 3K32A 1OZ0A 1X8LA 7REQA 2UUBB 2ZJ1A 4BX0A 1KOGA 4XQGA 5BR4A 1T9AA 1CIJA 5K6RA 4H0FA 4C43A 4PZEA 2VBGA 1G5TA 4NN9A 4PTZA 5JFTA 1U94A 2BGLA 1HEUA 4DZTA 1Y9ZA 4ARZB 4HGNA 5IVHA 3HY6A 4FPJA 1XZDA 3C3XA 2E55A 2XTAA 1LV8A 4YCLA 3ADCA 3V8RA 3GJQA 1ULSA 2B8HA 2PWAA 4RPKA 2R47A 4ZVOA 3OIVA 2BUBA 2C20A 4A26A 2G9VA 1FB5A 1QH1B 3FM9A 1Y37A 1Y48E 2ZYIA 2LKDA 5FPTA 3IVRA 2H2IA 3SC6A 2V6MA 5C1PA 2V0CA 2IYNA 3JZFA 2BR3A 2JCSA 3IR6A 4B6FA 2CNDA 3B5IA 5K6AC 2C00A 3ENKA 4E2WA 3UK7A 3KWFA 5KYXB 2Z5FA 1FW6A 2EX0A 4YPVA 2VH5R 4AJ2A 3LX6A 5CGZA 2PLNA 4XIKA 2CFRA 2ROQA 3L8GA 4QRHA 3N8DA 2Q8PA 4WXMA 5L4SA 1O58A 4B6PA 3K0SA 2FVYA 2WKRA 2CZGA 4B83A 1OU0A 3L1VA 3U2QA 5K8TA 2Y77A 5JWOA 2XX3A 4UQLA 2J31A 2VZ0A 1C80A 1LI5A 3SF8B 3TI6A 4IHKA 1RYNA 2XMRA 2EFDB 1RBMA 4QYMA 5DVZA 1LJ8A 4FLFA 1FP2A 5AKIA 5JH7F 2CVHA 2OSVA 2GF9A 2W20A 2NSLA 4JJFA 4EJ0A 3MWDB 2I54A 3AU9A 1X7WB 2HOQA 4JL8A 3QE9Y 1RLMA 4Q4JB 4EG3A 2CBGA 2QL7A 1PR4A 1G3RA 1TQ8A 1NNCA 4DGRA 2HMWA 1LD3A 2WNSA 3BUSA 3BX1A 3HJUA 2R62A 3PDJA 4Y2SA 5F9MA 1Z28A 1ZD3A 2GBPA 3EMDA 4YUYA 1Z4MA 1IHOA 9LDBA 2QTCA 1T9GS 3NPAA 1Q57A 3L8YA 2C3MA 2PKQP 1PGJA 3KC2A 1XG5A 4YAFA 4WOPA 2HIAA 1DV1A 5IFKA 2P9CA 1Z0UA 2C0QA 3UMMA 1RQXA 1CR2A 3ZWVA 1ZFNA 4U0KA 3QW2A 4Y9RA 1JR6A 1E1RA 1JKIA 2H1CA 3H2SA 4Q7EA 1N1SA 1GLGA 4G4GA 4N7BA 5GJBA 4UAVA 3FKSA 2IPOA 4MWWA 4I66A 5EWJB 2QN7A 3BA1A 1VE5A 2YIJA 1IVBA 3IUSA 3T94A 4E33A 1LA2A 1X77A 4B5LA 1UXKA 1N6DA 1MRSA 1WV1A 1ZNWA 2CHEA 3OE5A 3PWZA 1Y5NA 2NZXA 2WNHA 4DIKA 4Z2AA 2P11A 2PKQO 1BU8A 4H3SA 1NJGA 1ZCJA 2IXFA 1JXMA 1U8YA 1C3JA 1JZSA 2DE0X 5F5XA 2ZVPX 1IPEA 1DTWB 3CA8A 3QTBA 4ZOQI 3ZWBA 1P1CA 4MVJP 3O92A 3N87A 4DV2B 3WJAA 4IM7A 2JZCA 5J1SB 2YDXA 3OKPA 3O21A 4QU0A 3QK7A 4CLOB 1FNDA 2CHUA 3G2IA 3MGCA 2DC1A 1JE0A 2BKLA 1D5CA 1XCGB 1MQAA 1YCGA 2C9MA 2X15A 3OF3A 2WYHA 4EBBA 4YXWD 4YP0A 5FF9A 3HU1A 4R31A 4RA9A 1L5WA 4RLSA 2DGDA 2VDLB 1Y4DE 2ONYA 3CF6R 5SICE 4K40A 5DGXA 3WK9A 4KSCA 1C9MA 1N57A 2Q3CA 1M1NA 3N3AC 2NW6A 3E03A 3OY2A 5CDFA 5CB4F 2IAVA 4YRLA 4Z54A 1M2VA 3DVLA 4GJTA 1K89A 2HB6A 1Q74A 5EO8A 1VYHA 4Q4AB 5K03A 5CCBA 4CEJB 3PITA 2JHGA 4RKFA 3KP1A 4GVLA 4P98A 4REMA 3QLUC 2FPCA 2G1JA 2G82A 4J2HA 1AHPA 1RHMA 2PVPA 1EFRA 1D4FA 3GUUA 3VU8A 4PRKA 3BXOA 4N4AA 4MYTA 2ZBUA 5BSVA 1I10A 2CNLA 4FOWA 2OT3B 5GWXA 4JC0A 5FWAA 2I8AA 5FRDA 4CIVA 5B12A 2Y1KA 4JBHA 3T9BA 4J16A 3W1EA 4XIOA 3L46A 1I4TD 2FPBA 3T3NA 4PFJA 2JAWA 3TI4A 1VKOA 3CB4A 4PFSA 1Z68A 2JIZA 3E22A 4LMAA 3WGHA 2XBUA 1NP6A 3AY0A 3OFJA 5H4HA 5IC4A 4JFAA 5KYTA 2YDPA 1UAYA 1LLDA 4DM3A 2QTZA 3GUYA 5HKKA 1J00A 4KIWA 1MOQA 5G3YA 3WV4A 3EARA 3I73A 3ZZ1A 4RTOA 5C34B 2ZBGA 4YRCA 2C5AA 2RG7A 2WKSA 4YJ2F 1ZVQA 4Z6KA 3SKVA 3EGIA 3OICA 1RYDA 3NM5A 3AVWA 2NQ8A 3F6YA 4AB1A 3H5RA 1XMVA 4KJZA 1AGNA 2DUMA 2XDWA 2ZTHA 3PYMA 1G55A 3DLHA 4R2HA 3R9IA 1L7RA 3ZHCA 4AURA 3GPLA 3NCTA 1U7DA 3ZWAA 4CPLA 4FPKA 1HFJA 4XB6B 1E3LA 2VPQA 5IAEA 4I0WB 4NJEA 3HBAA 4FPEA 4QGGA 4G4IA 3A4MA 1J20A 3TI8A 4QNPA 4M1SA 4O4LA 1R8YA 1I3NA 3AX6A 3TD2A 1SHLA 1T0IA 3HVUA 5EJ8A 2ZU6A 4KSBA 4P81A 2VDMB 4W9MC 1F48A 3WGZA 2DHDA 2CNWD 4GFDA 5CVDA 3RSQA 2W0MA 4G23A 5DN9A 3SLRA 5CBPA 1RRCA 3SPXA 1P1KA 2OLJA 1ZDMA 1ZCFA 4ACAA 1DMRA 3LDAA 4FWIB 3B6KA 4BLQA 3IUPA 3B1YA 2A0WA 1AS2A 1QTIA 1NU6A 3O38A 5AHXA 3E84A 1YU6A 4M0FA 4K28A 1R0LA 2AQHA 3A2NA 4K8RB 2R84A 3GLSA 1A50B 5DPMA 4CTJA 3GA0A 4BWFB 4L72A 4QBFA 1X7ZB 3QMVA 4KVGA 5CB6A 2XQIA 1DWPA 2VWQA 2V03A 1GPMA 3EDMA 2WK1A 3LKVA 3NW9A 4X8MA 2QX8A 5FO1A 3UMRA 4BWYA 1YA6A 2EWWA 3AEUA 4YN3A 1M2WA 3JWEA 3FIUA 4CKEB 3U0SA 5J2UA 5EYPB 2JH9A 2C4TA 1TNDA 3LGXA 3V64C 3IBGA 1T2AA 1A76A 1FU8A 3DEAA 1IHYA 3INTA 3DVQX 5K0JA 5KQMA 2C7RA 4F7DA 2C7QA 4JQSA 1SAYA 5H7XA 1WS6A 1JFRA 4RNCA 1OLUB 1XN1A 3PQDA 5GONF 4XKJA 3ZXUB 3ZQ6A 3GGGA 1SUFA 3BYZA 1P1FA 1QKIA 4H17A 2F12A 2O19A 1COWD 3BXFA 4J90A 4B6OA 4EWLA 4IGKA 1WKBA 3VKUA 5JAUA 3HN6A 4U7HA 3D0OA 3WFIA 4ZEOA 3NHUA 3MOSA 4FZJA 2QNRA 1MU0A 2EG5A 4IVPA 3TTXA 5A4MS 4ZU1X 2YXPX 2JW5A 3B9QA 4I1RA 4J6EA 5KWSA 1QZXA 1KEZA 1ZVJA 1XPOA 3O9KA 5T67A 3JYQA 3BJIC 3LQRA 4UNSA 3U48A 2YC4C 4ONEA 4FKZA 1HTBA 3E5MA 2Y27A 3CFYA 3DFFA 2M1XA 4PSKA 5FJIA 2ZJAA 4C07A 1K4KA 3S44A 3L8CA 1FPMA 4LCBA 5EE1A 5KYYB 2GYYA 2ZIEA 2IP1A 2ZBQA 1HM5A 3OFNA 1CJUC 1G5FA 2WE7A 1VHWA 4J0IA 1KE1A 2QDXA 4Q7JB 2RDMA 3VYRB 1XZJA 3PB3A 1GQYA 4QN5A 1KZ6A 4LZAA 3B20A 3ZD9A 4JENA 2XDQA 1H2WA 3T12A 2YS7A 3VPSA 5CVTA 2YKGA 5FBRB 2HNBA 2RHJA 1FYWA 4S0XA 2J3IA 4OQQA 4BBZA 1KP3A 1L7OA 4YB8A 3EDYA 1B14A 1YJXA 3SXUB 3EZLA 1SCDA 3PGXA 2OVBA 3IEUA 2QK4A 2XUKA 5F9FA 4NECA 2MYUA 3WQHA 3D6JA 3P71T 5A05A 4UM8B 5EPUA 3GNSA 1T3ZA 1N3IA 4V3CA 4CTMA 2B7CA 4GMKA 1AIPA 2PUTA 1Z6YA 1Q3HA 1V25A 2XLBA 1ZGAA 1F8DA 1SXJC 3B85A 4NQRA 2BERA 5IHPA 2ID7A 2A88A 5C51B 3JWGA 4JB2A 5C18A 4D26A 4MR8A 1DADA 4FNMA 5CCXA