4HZZA

Crystal structure of influenza neuraminidase n3-h274y complexed with oseltamivir
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
387
structure length
387
Chain Sequence
RPFKSPLPLCPFRGFFPFHKDNAIRLGENKDVIVTREPYVSCDNDNCWSFALAQGALLGTKHSNGTIKDRTPYRSLIRFPIGTAPVLGNYKEICIAWSSSSCFDGKEWMHVCMTGNDNDASAQIIYGGRMTDSIKSWRKDILRTQESECQCIDGTCVVAVTDGPAANSADYRVYWIREGKIIKYENVPKTKIQYLEECSCYVDIDVYCICRDNWKGSNRPWMRINNETILETGYVCSKFHSDTPRPADPSTMSCDSPSNVNGGPGVKGFGFKAGDDVWLGRTVSTSGRSGFEIIKVTEGWINSPNHVKSITQTLVSNNDWSGYSGSFIVKAKDCFQPCFYVELIRGRPNKNDDVSWTSNSIVTFCGLDNEPGSGNWPDGSNIGFMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Neuraminidase
publication title Functional and structural analysis of influenza virus neuraminidase N3 offers further insight into the mechanisms of oseltamivir resistance.
pubmed doi rcsb
source organism Influenza a virus
total genus 103
structure length 387
sequence length 387
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 4hzzA00
4MWXA 6NN9A 2FHRA 1A4QA 4XMIA 2HT7A 1SLLA 2F24A 3D12A 4JF7A 4B7MA 5B2CA 1SO7A 4FOQA 4WEGA 4X47A 1NMCA 1NN2A 4GJTA 1V2IA 2JKBA 2F26A 1B9TA 4NCSA 2VVZA 4X49A 3TI6A 4YZ2A 4GZWA 4CPZA 5NN9A 1F8EA 3TICA 4HZXA 1NCBN 3TIAA 1V3BA 1EUSA 1USXA 4K1IA 1MZ6A 1NSCA 1NSDA 2QWKA 3NN9A 3SLIA 2QWCA 4FPCA 1S0IA 4WEFA 4MZAA 1NCDN 1E8UA 3CL0A 4MWYA 2XZKA 1IVBA 2QWHA 1V0EA 3CKZA 4XOGA 4XMAA 1INXA 1IVFA 1WCSA 4MWJA 4FOVA 4GZPA 2YA4A 4B7JA 4B7RA 1Z4ZA 4MWLA 1INHA 4MWRA 2QWBA 1IVGA 1DIMA 4XYXA 2VK7A 4XE9A 2QWDA 4YW4A 4K1JA 1MS9A 4FOWA 5JYYA 4D8SA 4SLIA 3H71A 2HTYA 2VSMA 4XJZA 3ALXA 3TI3A 2YA5A 4MWQA 1F8DA 4XJ8A 1MS0A 3GVJA 4HZWA 1V3DA 1DILA 4CPOA 3W09A 2YA8A 4XHBA 1BJIA 2X9MA 4FPJA 4BBWA 2BZDA 4B7NA 3K38A 5HUNA 1INGA 4X6KA 4HZVA 4XJWA 4CPLA 2HTVA 2W5OA 1MWEA 4QN7A 3TI4A 3PJQA 2CMLA 4FPGA 3K36A 2XZIA 4MWVA 1MR5A 4K1KA 4I00A 2A75A 4MX0A 2QWIA 2HU4A 4YZ4A 4K1HA 4WA4A 4MJVA 4QN6A 4YW3A 1VCJA 2RKCA 2QWEA 4UF7A 2VK6A 2F12A 4NC5A 3TI5A 4FPEA 1A14N 1E8VA 2HTUA 1V3CA 4WA3A 1W1XA 4M4VA 1MZ5A 3D11A 1NNBA 5HUGA 4J9TA 2VSKA 1EURA 2ZB6A 4HZZA 1N1YA 2AGSA 7NN9A 3B7EA 1NCCN 2F25A 2AEQA 2F28A 3A72A 1INWA 1SNTA 1N1VA 1Z4XA 4KS3A 1USRA 2HTQA 4GDJA 4FPLA 2F10A 2F29A 1KITA 4K3YA 1W20A 1NNAA 2F13A 1INVA 3SANA 1A4GA 1V0FA 1N1SA 2VW1A 3BEQA 4QN4A 4FZHA 4FPKA 1NSBA 3JU4A 4XIOA 2HT8A 4MWUA 2HTWA 1NMBN 2SLIA 2HU0A 2F11A 3NSSA 1MS4A 1INFA 1EUUA 5HUMA 3H72A 4HIZA 1Z4WA 1L7HA 1MS1A 4MWWA 4QNPA 4GZXA 3GVLA 3K37A 4H52A 3O9JA 2YA7A 1NMAN 1IVDA 4FVKA 3INBA 4HZYA 2BERA 2AH2A 4QN5A 3O9KA 4FPHA 4YZ3A 1W0PA 1L7FA 1E8TA 4FP2A 4Q6KA 5F9TA 1B9SA 1WCQA 3SALA 2XZJA 4MJUA 4CPNA 1W21A 1NCAN 2QWGA 1L7GA 4YW2A 2QWJA 3A71A 4FJ6A 2HTRA 1NNCA 4GEZA 4GZSA 1Z50A 4CPYA 5HX0A 1IVCA 3OPZA 4GZOA 1V0ZA 4M4UA 4YW1A 4XILA 4M4NA 2B8HA 1S0JA 4WA5A 4XJAA 4GZQA 3B69A 2AEPA 1EUTA 2BATA 4MC7A 1B9VA 1VCUA 4GB1A 4QN3A 1W8NA 2YDTA 2VK5A 4X4AA 4XJRA 1XOEA 1XOGA 4KS5A 1INYA 4YW5A 4YZ1A 4CPMA 4FOYA 1F8CA 4KS4A 4MZEA 1N1TA 5B2DA 4GZTA 2VW0A 5HUKA 4FQ4A 1SLIA 2HT5A 1MS5A 4B7QA 2BF6A 3K39A 2VW2A 3TIBA 4XIKA 2F27A 4XHXA 4YZ5A 2W20A 2F0ZA 2VWDA 1W8OA 4FPYA 5M1ZA 2C4AA 1MS3A 4XJ9A 1W0OA 3CL2A 3SILA 2XCYA 1MS8A 3ALWA 3CYEA 3T1EA 1IVEA 2ZB5A 4KS1A 4DGRA 2YDPA 2SILA 4FPFA 4M3MA 2W38A 1V3EA 4NN9A 2QWAA 4FP3A 4XJQA 3K3AA 4FPOB 1Z4VA 3GVKA 2C4LA 3H73A 2YA6A 4GDIA 2SIMA 1F8BA 1Z4YA 4XJUA 2W5NA 4H53A 2QWFA 3H6JA 3TI8A 4KS2A
chains in the Genus database with same CATH superfamily
5EO8A 4MWXA 6NN9A 2FHRA 1ZI0A 4GNBA 4G3NA 1A4QA 4AH4A 3V64C 4XMIA 5FZNA 2HT7A 1SLLA 2F24A 3D12A 4JF7A 4B7MA 3WWAA 5FNQA 4C1YB 2VPJA 5B2CA 5GX1A 1SO7A 4FOQA 4WEGA 4X47A 1NMCA 2IARA 1NN2A 4GNCA 4GJTA 1V2IA 2DSOA 2VAQA 2IAPA 2JKBA 2F26A 1B9TA 4NCSA 4CSDA 2VVZA 4X49A 2H2NA 3TI6A 4YZ2A 3WDZA 4GZWA 4CH9A 4CPZA 5NN9A 4IYGA 4IFNX 1F8EA 1RWIA 2DG1A 3S8ZA 3TICA 4HZXA 4IFLX 1NCBN 3TIAA 1X2RA 1V3BA 1N6EA 1EUSA 1USXA 4K1IA 1MZ6A 1NSCA 1NSDA 2QWKA 3NN9A 1IJQA 2QWCA 4FPCA 3SLIA 1S0IA 4WEFA 4MZAA 1NCDN 1E8UA 1K32A 3CL0A 4MWYA 2XZKA 2GVVA 1IVBA 4HHQA 2QWHA 4O5TA 3DR2A 4N1BA 2FPBA 1V0EA 3CKZA 4XOGA 4XMAA 2Z32A 1INXA 1IVFA 1WCSA 4MWJA 4PWZA 3HLHA 4FOVA 4GZPA 2YA4A 4B7JA 3BYCA 4B7RA 1Z4ZA 1U6DX 4GN8A 4MWLA 1INHA 4MWRA 2QWBA 2OJHA 1IVGA 1DIMA 4XYXA 4HW6A 1S18A 2VK7A 4XE9A 2QWDA 5CGJA 4YW4A 1POOA 4JMLA 4K1JA 3P5BL 1MS9A 4FOWA 4A0PA 4D8SA 5JYYA 1QLGA 4SLIA 3H71A 2HTYA 4IFJA 4ZLRA 2VSMA 4XJZA 3ALXA 3TI3A 2YA5A 3G4HA 4MWQA 1F8DA 3VNHA 4XJ8A 1MS0A 2IAVA 3GVJA 3HRPA 4HZWA 1V3DA 2ZZKA 1DILA 2IATA 4GN7A 4CPOA 3W09A 2YA8A 4XHBA 1BJIA 2X9MA 4FPJA 4BBWA 5GTQA 2DG0A 2BZDA 4B7NA 3K38A 5HUNA 1INGA 3DASA 4X6KA 4HZVA 2HQSA 4GNAA 4XJWA 3KYAA 4CPLA 3S2KA 2HTVA 2W5OA 1PJXA 2ISMA 1MWEA 4O5SA 4QN7A 3TI4A 3PJQA 2CMLA 4FPGA 4L7DA 2GHSA 3SREA 3K36A 2XZIA 4MWVA 1MR5A 4K1KA 4I00A 2A75A 4MX0A 3KGGA 4ZY3A 2QWIA 3SOBB 2HU4A 3LI5A 4YZ4A 4K1HA 4WA4A 4MJVA 4QN6A 4YW3A 1VCJA 3SRGA 2RKCA 3SOQA 2QWEA 3AMSA 4UF7A 2VK6A 2F12A 4NC5A 3TI5A 4FPEA 1A14N 4IQKA 5FNSA 1E8VA 2HTUA 1V3CA 4WA3A 1OFZA 1W1XA 3HLIA 4M4VA 3G4EA 1IUCA 1MZ5A 3D11A 1NNBA 3S8VA 5HUGA 4J9TA 2VSKA 3I1CA 1EURA 2ZB6A 3UC1A 4HZZA 1CVMA 1N1YA 2AGSA 7NN9A 3B7EA 1NCCN 1SUUA 1WP5A 2F25A 1CRUA 2W8BA 2IASA 4CHBA 2AEQA 2F28A 3A72A 1INWA 3V65B 1SNTA 5H47A 2IAXA 1N1VA 1Z4XA 4KS3A 2POOA 1H6LA 4YY8A 1USRA 2HTQA 1C9UA 2H2UA 4GDJA 1C5KA 4FPLA 2F10A 2XN4A 2F29A 1NPEA 1KITA 4HHOA 4K3YA 1W20A 1NNAA 2F13A 4L7BA 2GVUA 3Q6KA 1INVA 4D4UA 3SANA 1A4GA 1V0FA 1N1SA 2VW1A 2IAQA 3BEQA 3Q6PA 4QN4A 4FZHA 3LI4A 4FPKA 1NSBA 4L7CA 4IMBA 3JU4A 4XIOA 5D9DA 1ZGKA 4UOUA 1X2JA 4AHAA 5GX5A 2HT8A 2FLUX 4MWUA 2HTWA 1NMBN 1QBIA 1S1DA 2SLIA 2HU0A 1V04A 3NO0A 2F11A 3NSSA 2P4OA 1MS4A 1N6DA 3IAXA 1INFA 1EUUA 5HUMA 3L6VA 3H72A 4HIZA 1Z4WA 2IAWA 1L7HA 3O4PA 1MS1A 4MWWA 4QNPA 2WOZA 4GZXA 5GX2A 3GVLA 3K37A 4ZGCA 4H52A 3O9JA 2YA7A 1NMAN 2W8BB 1IVDA 4FVKA 3INBA 4HZYA 2BERA 2AH2A 3TC9A 1N7DA 4QN5A 3O9KA 2GVWA 5D9CA 5F72C 4FPHA 4YZ3A 1W0PA 1L7FA 1E8TA 3S94A 4FP2A 5FNRA 4R40A 4Q6KA 5F9TA 1B9SA 2DYHA 1WCQA 3SALA 2XZJA 4MJUA 4CPNA 1W21A 2ZWAA 1NCAN 2QWGA 1L7GA 4YW2A 5FNUA 2QWJA 3E5ZA 3A71A 4FJ6A 2HTRA 1NNCA 4GEZA 3V1SA 4GZSA 5FZJA 1Z50A 4D52A 3II7A 4CPYA 2IAUA 1IVCA 3OPZA 5HX0A 4GZOA 3VNGA 1V0ZA 4M4UA 4YW1A 2V91A 4AGIA 4XILA 4M4NA 2B8HA 1S0JA 4WA5A 4XJAA 5EO7A 3A9HA 4GZQA 2IAOA 3B69A 1CRZA 1E1AA 2AEPA 1EUTA 2BATA 4MC7A 1B9VA 1VCUA 4GB1A 1N6FA 5GX4A 3A9GA 4QN3A 1W8NA 2YDTA 2VK5A 4X4AA 4XJRA 4Q1UA 1XOEA 1XOGA 4KS5A 4D52C 1INYA 4AGTA 4YW5A 4YZ1A 3ADEA 3U0SA 4CPMA 5FWWA 4FOYA 1F8CA 4KS4A 4MZEA 4IN4A 1N1TA 4XMBA 5B2DA 1Q7FA 2FP8A 4GZTA 2QE8A 2VW0A 5HUKA 4FQ4A 1SLIA 2FP9A 2HT5A 1MS5A 4B7QA 2BF6A 5GX3A 3LI3A 3K39A 2VW2A 3TIBA 4XIKA 2F27A 4XHXA 4YZ5A 3FVZA 2W20A 1IUBA 2F0ZA 1CQ1A 4C1YA 3ZGDA 2VWDA 1W8OA 4FPYA 3WW9A 3FW0A 5EX7A 4D52B 5M1ZA 2C4AA 1MS3A 4XJ9A 1W0OA 3ZGCA 3CL2A 2FPCA 3AMRA 3SILA 2XCYA 1MS8A 3ALWA 3CYEA 3T1EA 1IVEA 4DG6A 2ZB5A 4KS1A 4DGRA 2YDPA 2ZW9A 2IVZA 2SILA 4ASCA 1RWLA 4FPFA 4M3MA 5FNTA 5D9BA 2W38A 3SOVA 3WN7A 1V3EA 4NN9A 2QWAA 4FP3A 4XJQA 3K3AA 4FPOB 2GVXA 1Z4VA 3GVKA 2C4LA 3H73A 2YA6A 4GDIA 2SIMA 1F8BA 1Z4YA 4XJUA 4GN9A 2W5NA 2G8SA 4H53A 3Q6TA 2QWFA 3H6JA 3TI8A 4KS2A
chains in the Genus database with same CATH topology
4MWXA 6NN9A 2FHRA 1A4QA 4XMIA 2HT7A 1SLLA 2F24A 3D12A 4JF7A 4B7MA 5B2CA 1SO7A 4FOQA 4WEGA 4X47A 1NMCA 1NN2A 4GJTA 1V2IA 2JKBA 2F26A 1B9TA 4NCSA 2VVZA 4X49A 2H2NA 3TI6A 4YZ2A 4GZWA 4CPZA 5NN9A 1F8EA 3TICA 4HZXA 1NCBN 3TIAA 1V3BA 1EUSA 1USXA 4K1IA 1MZ6A 1NSCA 1NSDA 2QWKA 3NN9A 3SLIA 2QWCA 4FPCA 1S0IA 4WEFA 4MZAA 1NCDN 1E8UA 3CL0A 4MWYA 2XZKA 1IVBA 2QWHA 1V0EA 3CKZA 4XOGA 4XMAA 1INXA 1IVFA 1WCSA 4MWJA 4FOVA 4GZPA 2YA4A 4B7JA 4B7RA 1Z4ZA 4MWLA 1INHA 4MWRA 2QWBA 1IVGA 1DIMA 4XYXA 1S18A 2VK7A 4XE9A 2QWDA 4YW4A 4K1JA 1MS9A 4FOWA 5JYYA 4D8SA 4SLIA 3H71A 2HTYA 2VSMA 4XJZA 3ALXA 3TI3A 2YA5A 4MWQA 1F8DA 4XJ8A 1MS0A 3GVJA 4HZWA 1V3DA 1DILA 4CPOA 3W09A 2YA8A 4XHBA 1BJIA 2X9MA 4FPJA 4BBWA 2BZDA 4B7NA 3K38A 5HUNA 1INGA 4X6KA 4HZVA 4XJWA 4CPLA 2HTVA 2W5OA 1MWEA 4QN7A 3TI4A 3PJQA 2CMLA 4FPGA 3K36A 2XZIA 4MWVA 1MR5A 4K1KA 4I00A 2A75A 4MX0A 2QWIA 2HU4A 4YZ4A 4K1HA 4WA4A 4MJVA 4QN6A 4YW3A 1VCJA 2RKCA 2QWEA 4UF7A 2VK6A 2F12A 4NC5A 3TI5A 4FPEA 1A14N 1E8VA 2HTUA 1V3CA 4WA3A 1W1XA 4M4VA 1MZ5A 3D11A 1NNBA 5HUGA 4J9TA 2VSKA 1EURA 2ZB6A 4HZZA 1N1YA 2AGSA 7NN9A 3B7EA 1NCCN 2F25A 2AEQA 2F28A 3A72A 1INWA 1SNTA 1N1VA 1Z4XA 4KS3A 1USRA 2HTQA 2H2UA 4GDJA 4FPLA 2F10A 2F29A 1KITA 4K3YA 1W20A 1NNAA 2F13A 1INVA 3SANA 1A4GA 1V0FA 1N1SA 2VW1A 3BEQA 4QN4A 4FZHA 4FPKA 1NSBA 3JU4A 4XIOA 2HT8A 4MWUA 2HTWA 1NMBN 1S1DA 2SLIA 2HU0A 2F11A 3NSSA 1MS4A 1INFA 1EUUA 5HUMA 3H72A 4HIZA 1Z4WA 1L7HA 1MS1A 4MWWA 4QNPA 4GZXA 3GVLA 3K37A 4H52A 3O9JA 2YA7A 1NMAN 1IVDA 4FVKA 3INBA 4HZYA 2BERA 2AH2A 4QN5A 3O9KA 4FPHA 4YZ3A 1W0PA 1L7FA 1E8TA 4FP2A 4Q6KA 5F9TA 1B9SA 1WCQA 3SALA 2XZJA 4MJUA 4CPNA 1W21A 1NCAN 2QWGA 1L7GA 4YW2A 2QWJA 3A71A 4FJ6A 2HTRA 1NNCA 4GEZA 4GZSA 1Z50A 4CPYA 5HX0A 1IVCA 3OPZA 4GZOA 1V0ZA 4M4UA 4YW1A 4XILA 4M4NA 2B8HA 1S0JA 4WA5A 4XJAA 4GZQA 3B69A 2AEPA 1EUTA 2BATA 4MC7A 1B9VA 1VCUA 4GB1A 4QN3A 1W8NA 2YDTA 2VK5A 4X4AA 4XJRA 1XOEA 1XOGA 4KS5A 1INYA 4YW5A 4YZ1A 4CPMA 4FOYA 1F8CA 4KS4A 4MZEA 1N1TA 5B2DA 4GZTA 2VW0A 5HUKA 4FQ4A 1SLIA 2HT5A 1MS5A 4B7QA 2BF6A 3K39A 2VW2A 3TIBA 4XIKA 2F27A 4XHXA 4YZ5A 2W20A 2F0ZA 2VWDA 1W8OA 4FPYA 5M1ZA 2C4AA 1MS3A 4XJ9A 1W0OA 3CL2A 3SILA 2XCYA 1MS8A 3ALWA 3CYEA 3T1EA 1IVEA 2ZB5A 4KS1A 4DGRA 2YDPA 2SILA 4FPFA 4M3MA 2W38A 1V3EA 4NN9A 2QWAA 4FP3A 4XJQA 3K3AA 4FPOB 1Z4VA 3GVKA 2C4LA 3H73A 2YA6A 4GDIA 2SIMA 1F8BA 1Z4YA 4XJUA 2W5NA 4H53A 2QWFA 3H6JA 3TI8A 4KS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MWX A;  6NN9 A;  2FHR A;  1A4Q A;  4XMI A;  2HT7 A;  1SLL A;  2F24 A;  3D12 A;  4JF7 A;  4B7M A;  5B2C A;  1SO7 A;  4FOQ A;  4WEG A;  4X47 A;  1NMC A;  1NN2 A;  4GJT A;  1V2I A;  2JKB A;  2F26 A;  1B9T A;  4NCS A;  2VVZ A;  4X49 A;  3TI6 A;  4YZ2 A;  4GZW A;  4CPZ A;  5NN9 A;  1F8E A;  3TIC A;  4HZX A;  1NCB N;  3TIA A;  1V3B A;  1EUS A;  1USX A;  4K1I A;  1MZ6 A;  1NSC A;  1NSD A;  2QWK A;  3NN9 A;  3SLI A;  2QWC A;  4FPC A;  1S0I A;  4WEF A;  4MZA A;  1NCD N;  1E8U A;  3CL0 A;  4MWY A;  2XZK A;  1IVB A;  2QWH A;  1V0E A;  3CKZ A;  4XOG A;  4XMA A;  1INX A;  1IVF A;  1WCS A;  4MWJ A;  4FOV A;  4GZP A;  2YA4 A;  4B7J A;  4B7R A;  1Z4Z A;  4MWL A;  1INH A;  4MWR A;  2QWB A;  1IVG A;  1DIM A;  4XYX A;  2VK7 A;  4XE9 A;  2QWD A;  4YW4 A;  4K1J A;  1MS9 A;  4FOW A;  5JYY A;  4D8S A;  4SLI A;  3H71 A;  2HTY A;  2VSM A;  4XJZ A;  3ALX A;  3TI3 A;  2YA5 A;  4MWQ A;  1F8D A;  4XJ8 A;  1MS0 A;  3GVJ A;  4HZW A;  1V3D A;  1DIL A;  4CPO A;  3W09 A;  2YA8 A;  4XHB A;  1BJI A;  2X9M A;  4FPJ A;  4BBW A;  2BZD A;  4B7N A;  3K38 A;  5HUN A;  1ING A;  4X6K A;  4HZV A;  4XJW A;  4CPL A;  2HTV A;  2W5O A;  1MWE A;  4QN7 A;  3TI4 A;  3PJQ A;  2CML A;  4FPG A;  3K36 A;  2XZI A;  4MWV A;  1MR5 A;  4K1K A;  4I00 A;  2A75 A;  4MX0 A;  2QWI A;  2HU4 A;  4YZ4 A;  4K1H A;  4WA4 A;  4MJV A;  4QN6 A;  4YW3 A;  1VCJ A;  2RKC A;  2QWE A;  4UF7 A;  2VK6 A;  2F12 A;  4NC5 A;  3TI5 A;  4FPE A;  1A14 N;  1E8V A;  2HTU A;  1V3C A;  4WA3 A;  1W1X A;  4M4V A;  1MZ5 A;  3D11 A;  1NNB A;  5HUG A;  4J9T A;  2VSK A;  1EUR A;  2ZB6 A;  4HZZ A;  1N1Y A;  2AGS A;  7NN9 A;  3B7E A;  1NCC N;  2F25 A;  2AEQ A;  2F28 A;  3A72 A;  1INW A;  1SNT A;  1N1V A;  1Z4X A;  4KS3 A;  1USR A;  2HTQ A;  4GDJ A;  4FPL A;  2F10 A;  2F29 A;  1KIT A;  4K3Y A;  1W20 A;  1NNA A;  2F13 A;  1INV A;  3SAN A;  1A4G A;  1V0F A;  1N1S A;  2VW1 A;  3BEQ A;  4QN4 A;  4FZH A;  4FPK A;  1NSB A;  3JU4 A;  4XIO A;  2HT8 A;  4MWU A;  2HTW A;  1NMB N;  2SLI A;  2HU0 A;  2F11 A;  3NSS A;  1MS4 A;  1INF A;  1EUU A;  5HUM A;  3H72 A;  4HIZ A;  1Z4W A;  1L7H A;  1MS1 A;  4MWW A;  4QNP A;  4GZX A;  3GVL A;  3K37 A;  4H52 A;  3O9J A;  2YA7 A;  1NMA N;  1IVD A;  4FVK A;  3INB A;  4HZY A;  2BER A;  2AH2 A;  4QN5 A;  3O9K A;  4FPH A;  4YZ3 A;  1W0P A;  1L7F A;  1E8T A;  4FP2 A;  4Q6K A;  5F9T A;  1B9S A;  1WCQ A;  3SAL A;  2XZJ A;  4MJU A;  4CPN A;  1W21 A;  1NCA N;  2QWG A;  1L7G A;  4YW2 A;  2QWJ A;  3A71 A;  4FJ6 A;  2HTR A;  1NNC A;  4GEZ A;  4GZS A;  1Z50 A;  4CPY A;  5HX0 A;  1IVC A;  3OPZ A;  4GZO A;  1V0Z A;  4M4U A;  4YW1 A;  4XIL A;  4M4N A;  2B8H A;  1S0J A;  4WA5 A;  4XJA A;  4GZQ A;  3B69 A;  2AEP A;  1EUT A;  2BAT A;  4MC7 A;  1B9V A;  1VCU A;  4GB1 A;  4QN3 A;  1W8N A;  2YDT A;  2VK5 A;  4X4A A;  4XJR A;  1XOE A;  1XOG A;  4KS5 A;  1INY A;  4YW5 A;  4YZ1 A;  4CPM A;  4FOY A;  1F8C A;  4KS4 A;  4MZE A;  1N1T A;  5B2D A;  4GZT A;  2VW0 A;  5HUK A;  4FQ4 A;  1SLI A;  2HT5 A;  1MS5 A;  4B7Q A;  2BF6 A;  3K39 A;  2VW2 A;  3TIB A;  4XIK A;  2F27 A;  4XHX A;  4YZ5 A;  2W20 A;  2F0Z A;  2VWD A;  1W8O A;  4FPY A;  5M1Z A;  2C4A A;  1MS3 A;  4XJ9 A;  1W0O A;  3CL2 A;  3SIL A;  2XCY A;  1MS8 A;  3ALW A;  3CYE A;  3T1E A;  1IVE A;  2ZB5 A;  4KS1 A;  4DGR A;  2YDP A;  2SIL A;  4FPF A;  4M3M A;  2W38 A;  1V3E A;  4NN9 A;  2QWA A;  4FP3 A;  4XJQ A;  3K3A A;  4FPO B;  1Z4V A;  3GVK A;  2C4L A;  3H73 A;  2YA6 A;  4GDI A;  2SIM A;  1F8B A;  1Z4Y A;  4XJU A;  2W5N A;  4H53 A;  2QWF A;  3H6J A;  3TI8 A;  4KS2 A; 
#chains in the Genus database with same CATH topology
 5EO8 A;  4MWX A;  6NN9 A;  2FHR A;  1ZI0 A;  4GNB A;  4G3N A;  1A4Q A;  4AH4 A;  3V64 C;  4XMI A;  5FZN A;  2HT7 A;  1SLL A;  2F24 A;  3D12 A;  4JF7 A;  4B7M A;  3WWA A;  5FNQ A;  4C1Y B;  2VPJ A;  5B2C A;  5GX1 A;  1SO7 A;  4FOQ A;  4WEG A;  4X47 A;  1NMC A;  2IAR A;  1NN2 A;  4GNC A;  4GJT A;  1V2I A;  2DSO A;  2VAQ A;  2IAP A;  2JKB A;  2F26 A;  1B9T A;  4NCS A;  4CSD A;  2VVZ A;  4X49 A;  2H2N A;  3TI6 A;  4YZ2 A;  3WDZ A;  4GZW A;  4CH9 A;  4CPZ A;  5NN9 A;  4IYG A;  4IFN X;  1F8E A;  1RWI A;  2DG1 A;  3S8Z A;  3TIC A;  4HZX A;  4IFL X;  1NCB N;  3TIA A;  1X2R A;  1V3B A;  1N6E A;  1EUS A;  1USX A;  4K1I A;  1MZ6 A;  1NSC A;  1NSD A;  2QWK A;  3NN9 A;  1IJQ A;  2QWC A;  4FPC A;  3SLI A;  1S0I A;  4WEF A;  4MZA A;  1NCD N;  1E8U A;  1K32 A;  3CL0 A;  4MWY A;  2XZK A;  2GVV A;  1IVB A;  4HHQ A;  2QWH A;  4O5T A;  3DR2 A;  4N1B A;  2FPB A;  1V0E A;  3CKZ A;  4XOG A;  4XMA A;  2Z32 A;  1INX A;  1IVF A;  1WCS A;  4MWJ A;  4PWZ A;  3HLH A;  4FOV A;  4GZP A;  2YA4 A;  4B7J A;  3BYC A;  4B7R A;  1Z4Z A;  1U6D X;  4GN8 A;  4MWL A;  1INH A;  4MWR A;  2QWB A;  2OJH A;  1IVG A;  1DIM A;  4XYX A;  4HW6 A;  1S18 A;  2VK7 A;  4XE9 A;  2QWD A;  5CGJ A;  4YW4 A;  1POO A;  4JML A;  4K1J A;  3P5B L;  1MS9 A;  4FOW A;  4A0P A;  4D8S A;  5JYY A;  1QLG A;  4SLI A;  3H71 A;  2HTY A;  4IFJ A;  4ZLR A;  2VSM A;  4XJZ A;  3ALX A;  3TI3 A;  2YA5 A;  3G4H A;  4MWQ A;  1F8D A;  3VNH A;  4XJ8 A;  1MS0 A;  2IAV A;  3GVJ A;  3HRP A;  4HZW A;  1V3D A;  2ZZK A;  1DIL A;  2IAT A;  4GN7 A;  4CPO A;  3W09 A;  2YA8 A;  4XHB A;  1BJI A;  2X9M A;  4FPJ A;  4BBW A;  5GTQ A;  2DG0 A;  2BZD A;  4B7N A;  3K38 A;  5HUN A;  1ING A;  3DAS A;  4X6K A;  4HZV A;  2HQS A;  4GNA A;  4XJW A;  3KYA A;  4CPL A;  3S2K A;  2HTV A;  2W5O A;  1PJX A;  2ISM A;  1MWE A;  4O5S A;  4QN7 A;  3TI4 A;  3PJQ A;  2CML A;  4FPG A;  4L7D A;  2GHS A;  3SRE A;  3K36 A;  2XZI A;  4MWV A;  1MR5 A;  4K1K A;  4I00 A;  2A75 A;  4MX0 A;  3KGG A;  4ZY3 A;  2QWI A;  3SOB B;  2HU4 A;  3LI5 A;  4YZ4 A;  4K1H A;  4WA4 A;  4MJV A;  4QN6 A;  4YW3 A;  1VCJ A;  3SRG A;  2RKC A;  3SOQ A;  2QWE A;  3AMS A;  4UF7 A;  2VK6 A;  2F12 A;  4NC5 A;  3TI5 A;  4FPE A;  1A14 N;  4IQK A;  5FNS A;  1E8V A;  2HTU A;  1V3C A;  4WA3 A;  1OFZ A;  1W1X A;  3HLI A;  4M4V A;  3G4E A;  1IUC A;  1MZ5 A;  3D11 A;  1NNB A;  3S8V A;  5HUG A;  4J9T A;  2VSK A;  3I1C A;  1EUR A;  2ZB6 A;  3UC1 A;  4HZZ A;  1CVM A;  1N1Y A;  2AGS A;  7NN9 A;  3B7E A;  1NCC N;  1SUU A;  1WP5 A;  2F25 A;  1CRU A;  2W8B A;  2IAS A;  4CHB A;  2AEQ A;  2F28 A;  3A72 A;  1INW A;  3V65 B;  1SNT A;  5H47 A;  2IAX A;  1N1V A;  1Z4X A;  4KS3 A;  2POO A;  1H6L A;  4YY8 A;  1USR A;  2HTQ A;  1C9U A;  2H2U A;  4GDJ A;  1C5K A;  4FPL A;  2F10 A;  2XN4 A;  2F29 A;  1NPE A;  1KIT A;  4HHO A;  4K3Y A;  1W20 A;  1NNA A;  2F13 A;  4L7B A;  2GVU A;  3Q6K A;  1INV A;  4D4U A;  3SAN A;  1A4G A;  1V0F A;  1N1S A;  2VW1 A;  2IAQ A;  3BEQ A;  3Q6P A;  4QN4 A;  4FZH A;  3LI4 A;  4FPK A;  1NSB A;  4L7C A;  4IMB A;  3JU4 A;  4XIO A;  5D9D A;  1ZGK A;  4UOU A;  1X2J A;  4AHA A;  5GX5 A;  2HT8 A;  2FLU X;  4MWU A;  2HTW A;  1NMB N;  1QBI A;  1S1D A;  2SLI A;  2HU0 A;  1V04 A;  3NO0 A;  2F11 A;  3NSS A;  2P4O A;  1MS4 A;  1N6D A;  3IAX A;  1INF A;  1EUU A;  5HUM A;  3L6V A;  3H72 A;  4HIZ A;  1Z4W A;  2IAW A;  1L7H A;  3O4P A;  1MS1 A;  4MWW A;  4QNP A;  2WOZ A;  4GZX A;  5GX2 A;  3GVL A;  3K37 A;  4ZGC A;  4H52 A;  3O9J A;  2YA7 A;  1NMA N;  2W8B B;  1IVD A;  4FVK A;  3INB A;  4HZY A;  2BER A;  2AH2 A;  3TC9 A;  1N7D A;  4QN5 A;  3O9K A;  2GVW A;  5D9C A;  5F72 C;  4FPH A;  4YZ3 A;  1W0P A;  1L7F A;  1E8T A;  3S94 A;  4FP2 A;  5FNR A;  4R40 A;  4Q6K A;  5F9T A;  1B9S A;  2DYH A;  1WCQ A;  3SAL A;  2XZJ A;  4MJU A;  4CPN A;  1W21 A;  2ZWA A;  1NCA N;  2QWG A;  1L7G A;  4YW2 A;  5FNU A;  2QWJ A;  3E5Z A;  3A71 A;  4FJ6 A;  2HTR A;  1NNC A;  4GEZ A;  3V1S A;  4GZS A;  5FZJ A;  1Z50 A;  4D52 A;  3II7 A;  4CPY A;  2IAU A;  1IVC A;  3OPZ A;  5HX0 A;  4GZO A;  3VNG A;  1V0Z A;  4M4U A;  4YW1 A;  2V91 A;  4AGI A;  4XIL A;  4M4N A;  2B8H A;  1S0J A;  4WA5 A;  4XJA A;  5EO7 A;  3A9H A;  4GZQ A;  2IAO A;  3B69 A;  1CRZ A;  1E1A A;  2AEP A;  1EUT A;  2BAT A;  4MC7 A;  1B9V A;  1VCU A;  4GB1 A;  1N6F A;  5GX4 A;  3A9G A;  4QN3 A;  1W8N A;  2YDT A;  2VK5 A;  4X4A A;  4XJR A;  4Q1U A;  1XOE A;  1XOG A;  4KS5 A;  4D52 C;  1INY A;  4AGT A;  4YW5 A;  4YZ1 A;  3ADE A;  3U0S A;  4CPM A;  5FWW A;  4FOY A;  1F8C A;  4KS4 A;  4MZE A;  4IN4 A;  1N1T A;  4XMB A;  5B2D A;  1Q7F A;  2FP8 A;  4GZT A;  2QE8 A;  2VW0 A;  5HUK A;  4FQ4 A;  1SLI A;  2FP9 A;  2HT5 A;  1MS5 A;  4B7Q A;  2BF6 A;  5GX3 A;  3LI3 A;  3K39 A;  2VW2 A;  3TIB A;  4XIK A;  2F27 A;  4XHX A;  4YZ5 A;  3FVZ A;  2W20 A;  1IUB A;  2F0Z A;  1CQ1 A;  4C1Y A;  3ZGD A;  2VWD A;  1W8O A;  4FPY A;  3WW9 A;  3FW0 A;  5EX7 A;  4D52 B;  5M1Z A;  2C4A A;  1MS3 A;  4XJ9 A;  1W0O A;  3ZGC A;  3CL2 A;  2FPC A;  3AMR A;  3SIL A;  2XCY A;  1MS8 A;  3ALW A;  3CYE A;  3T1E A;  1IVE A;  4DG6 A;  2ZB5 A;  4KS1 A;  4DGR A;  2YDP A;  2ZW9 A;  2IVZ A;  2SIL A;  4ASC A;  1RWL A;  4FPF A;  4M3M A;  5FNT A;  5D9B A;  2W38 A;  3SOV A;  3WN7 A;  1V3E A;  4NN9 A;  2QWA A;  4FP3 A;  4XJQ A;  3K3A A;  4FPO B;  2GVX A;  1Z4V A;  3GVK A;  2C4L A;  3H73 A;  2YA6 A;  4GDI A;  2SIM A;  1F8B A;  1Z4Y A;  4XJU A;  4GN9 A;  2W5N A;  2G8S A;  4H53 A;  3Q6T A;  2QWF A;  3H6J A;  3TI8 A;  4KS2 A; 
#chains in the Genus database with same CATH homology
 4MWX A;  6NN9 A;  2FHR A;  1A4Q A;  4XMI A;  2HT7 A;  1SLL A;  2F24 A;  3D12 A;  4JF7 A;  4B7M A;  5B2C A;  1SO7 A;  4FOQ A;  4WEG A;  4X47 A;  1NMC A;  1NN2 A;  4GJT A;  1V2I A;  2JKB A;  2F26 A;  1B9T A;  4NCS A;  2VVZ A;  4X49 A;  2H2N A;  3TI6 A;  4YZ2 A;  4GZW A;  4CPZ A;  5NN9 A;  1F8E A;  3TIC A;  4HZX A;  1NCB N;  3TIA A;  1V3B A;  1EUS A;  1USX A;  4K1I A;  1MZ6 A;  1NSC A;  1NSD A;  2QWK A;  3NN9 A;  3SLI A;  2QWC A;  4FPC A;  1S0I A;  4WEF A;  4MZA A;  1NCD N;  1E8U A;  3CL0 A;  4MWY A;  2XZK A;  1IVB A;  2QWH A;  1V0E A;  3CKZ A;  4XOG A;  4XMA A;  1INX A;  1IVF A;  1WCS A;  4MWJ A;  4FOV A;  4GZP A;  2YA4 A;  4B7J A;  4B7R A;  1Z4Z A;  4MWL A;  1INH A;  4MWR A;  2QWB A;  1IVG A;  1DIM A;  4XYX A;  1S18 A;  2VK7 A;  4XE9 A;  2QWD A;  4YW4 A;  4K1J A;  1MS9 A;  4FOW A;  5JYY A;  4D8S A;  4SLI A;  3H71 A;  2HTY A;  2VSM A;  4XJZ A;  3ALX A;  3TI3 A;  2YA5 A;  4MWQ A;  1F8D A;  4XJ8 A;  1MS0 A;  3GVJ A;  4HZW A;  1V3D A;  1DIL A;  4CPO A;  3W09 A;  2YA8 A;  4XHB A;  1BJI A;  2X9M A;  4FPJ A;  4BBW A;  2BZD A;  4B7N A;  3K38 A;  5HUN A;  1ING A;  4X6K A;  4HZV A;  4XJW A;  4CPL A;  2HTV A;  2W5O A;  1MWE A;  4QN7 A;  3TI4 A;  3PJQ A;  2CML A;  4FPG A;  3K36 A;  2XZI A;  4MWV A;  1MR5 A;  4K1K A;  4I00 A;  2A75 A;  4MX0 A;  2QWI A;  2HU4 A;  4YZ4 A;  4K1H A;  4WA4 A;  4MJV A;  4QN6 A;  4YW3 A;  1VCJ A;  2RKC A;  2QWE A;  4UF7 A;  2VK6 A;  2F12 A;  4NC5 A;  3TI5 A;  4FPE A;  1A14 N;  1E8V A;  2HTU A;  1V3C A;  4WA3 A;  1W1X A;  4M4V A;  1MZ5 A;  3D11 A;  1NNB A;  5HUG A;  4J9T A;  2VSK A;  1EUR A;  2ZB6 A;  4HZZ A;  1N1Y A;  2AGS A;  7NN9 A;  3B7E A;  1NCC N;  2F25 A;  2AEQ A;  2F28 A;  3A72 A;  1INW A;  1SNT A;  1N1V A;  1Z4X A;  4KS3 A;  1USR A;  2HTQ A;  2H2U A;  4GDJ A;  4FPL A;  2F10 A;  2F29 A;  1KIT A;  4K3Y A;  1W20 A;  1NNA A;  2F13 A;  1INV A;  3SAN A;  1A4G A;  1V0F A;  1N1S A;  2VW1 A;  3BEQ A;  4QN4 A;  4FZH A;  4FPK A;  1NSB A;  3JU4 A;  4XIO A;  2HT8 A;  4MWU A;  2HTW A;  1NMB N;  1S1D A;  2SLI A;  2HU0 A;  2F11 A;  3NSS A;  1MS4 A;  1INF A;  1EUU A;  5HUM A;  3H72 A;  4HIZ A;  1Z4W A;  1L7H A;  1MS1 A;  4MWW A;  4QNP A;  4GZX A;  3GVL A;  3K37 A;  4H52 A;  3O9J A;  2YA7 A;  1NMA N;  1IVD A;  4FVK A;  3INB A;  4HZY A;  2BER A;  2AH2 A;  4QN5 A;  3O9K A;  4FPH A;  4YZ3 A;  1W0P A;  1L7F A;  1E8T A;  4FP2 A;  4Q6K A;  5F9T A;  1B9S A;  1WCQ A;  3SAL A;  2XZJ A;  4MJU A;  4CPN A;  1W21 A;  1NCA N;  2QWG A;  1L7G A;  4YW2 A;  2QWJ A;  3A71 A;  4FJ6 A;  2HTR A;  1NNC A;  4GEZ A;  4GZS A;  1Z50 A;  4CPY A;  5HX0 A;  1IVC A;  3OPZ A;  4GZO A;  1V0Z A;  4M4U A;  4YW1 A;  4XIL A;  4M4N A;  2B8H A;  1S0J A;  4WA5 A;  4XJA A;  4GZQ A;  3B69 A;  2AEP A;  1EUT A;  2BAT A;  4MC7 A;  1B9V A;  1VCU A;  4GB1 A;  4QN3 A;  1W8N A;  2YDT A;  2VK5 A;  4X4A A;  4XJR A;  1XOE A;  1XOG A;  4KS5 A;  1INY A;  4YW5 A;  4YZ1 A;  4CPM A;  4FOY A;  1F8C A;  4KS4 A;  4MZE A;  1N1T A;  5B2D A;  4GZT A;  2VW0 A;  5HUK A;  4FQ4 A;  1SLI A;  2HT5 A;  1MS5 A;  4B7Q A;  2BF6 A;  3K39 A;  2VW2 A;  3TIB A;  4XIK A;  2F27 A;  4XHX A;  4YZ5 A;  2W20 A;  2F0Z A;  2VWD A;  1W8O A;  4FPY A;  5M1Z A;  2C4A A;  1MS3 A;  4XJ9 A;  1W0O A;  3CL2 A;  3SIL A;  2XCY A;  1MS8 A;  3ALW A;  3CYE A;  3T1E A;  1IVE A;  2ZB5 A;  4KS1 A;  4DGR A;  2YDP A;  2SIL A;  4FPF A;  4M3M A;  2W38 A;  1V3E A;  4NN9 A;  2QWA A;  4FP3 A;  4XJQ A;  3K3A A;  4FPO B;  1Z4V A;  3GVK A;  2C4L A;  3H73 A;  2YA6 A;  4GDI A;  2SIM A;  1F8B A;  1Z4Y A;  4XJU A;  2W5N A;  4H53 A;  2QWF A;  3H6J A;  3TI8 A;  4KS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...