2IVZA

Structure of tolb in complex with a peptide of the colicin e9 t- domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
397
structure length
392
Chain Sequence
GRPIGVVPFQWAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/hydrolase
molecule keywords PROTEIN TOLB
publication title Competitive Recruitment of the Periplasmic Translocation Portal Tolb by a Natively Disordered Domain of Colicin E9
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 392
sequence length 397
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2ivzA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2ivzA01
2IAPA 2W8BA 3KYAA 2HQSA 1H6LA 2DG0A 2FP9A 4IMBA 2ISMA 3O4PA 2GVXA 2DG1A 5GX2A 1Q7FA 1IJQA 1NPEA 4DG6A 1CRUA 5GTQA 3A9GA 3G4EA 1CRZA 5GX5A 5GX3A 3SRGA 2IAVA 4R40A 2IASA 2IAQA 3Q6KA 1PJXA 5FWWA 4HW6A 1QLGA 3DASA 3FW0A 5D9CA 3SOQA 3LI3A 4JMLA 4GN7A 3HLHA 2IVZA 4HHOA 2FPCA 2G8SA 3SREA 3S8VA 1CVMA 4A0PA 1RWIA 3S8ZA 1N7DA 2IATA 3V65B 5D9BA 2IAOA 3Q6TA 4GNAA 2POOA 3S2KA 2GVUA 2IARA 5EX7A 3U0SA 2FPBA 4GNBA 2GVWA 3SOVA 3BYCA 3IAXA 3HLIA 3WWAA 4O5TA 1V04A 2VAQA 3LI5A 4GN9A 2P4OA 2IAXA 1CQ1A 5GX4A 3S94A 2OJHA 1QBIA 3V64C 2IAUA 3KGGA 2GHSA 3DR2A 3P5BL 3E5ZA 5D9DA 3TC9A 3FVZA 3WW9A 3A9HA 2QE8A 4GN8A 3AMRA 1E1AA 3HRPA 2FP8A 4HHQA 3G4HA 1POOA 3LI4A 2IAWA 1C5KA 4GNCA 5GX1A 2V91A 4PWZA 1RWLA 4IYGA 2DSOA 2GVVA 3SOBB 3I1CA 3V1SA 2W8BB 3AMSA 4O5SA 4ZLRA 4Q1UA 3Q6PA 1C9UA
chains in the Genus database with same CATH superfamily
3PQCA 2ZAOA 4PVDA 4C4AA 1KJQA 1KEEA 5HS4A 5BWNA 1LUAA 3UXMA 3AFOA 4EFDA 3H18A 4L5AA 4E30A 2J3EA 4JXZA 2JD0A 1DUVG 3HYSA 2G5TA 4X97A 2WVAA 3L4EA 4QTZA 3UV6A 4GUDA 3U9LA 3GEBA 2OCYC 1NXOA 2Q0HA 2AF3C 4WZAA 4NIMA 4Q16A 3VKVA 4W5OA 3QNWA 3JQBC 1M74A 3LQ4A 1P1JA 5SV2A 3UQZA 1CRUA 2IW1A 3T3GA 1P4GA 4M4NA 1EAMA 3F4BA 2OM6A 2Q5OA 2J8ZA 3TW8B 3OM0A 2DHQA 4GRIA 2Z5LA 4G9GA 3LOQA 4CHBA 2XTMA 3C3BA 3QWBA 2GK4A 3QQPA 3NTLA 4WD3A 3DFFA 4XIOA 1IN6A 2ONYA 2ZS9A 2CDBA 3GBPA 5E2IA 5IMBA 3HN6A 5KOJB 4MRMB 4I8DA 3F96A 4EMUA 4MIYA 2L2QA 2G6BA 1SKYB 2AHOA 3TLZA 4GWGA 2YMPA 3B5EA 3HCOA 3KS9A 3LZ6A 2JLWA 3WNQA 1ZGHA 4LYJA 1PK9A 4XWTA 3CZPA 4G5XA 4E1BA 1YAHA 4MV4A 1LBSA 1NN3A 1BCRA 3LJKA 2Y1KA 1OX4A 1YQXA 2ZT6A 3FRHA 3ONFA 2OYRA 3GRAA 2M1XA 4JWKA 4CL2A 2J9RA 2VYCA 1F7VA 1LCIA 2NXNA 4UBIA 3AHEA 1NU6A 3W1VA 2O8EB 3UKJA 4H18A 1FX0B 2X9LA 3UCFA 4YAUA 2BGMA 1RXCA 2V0GA 2SECE 2W42A 5K0GA 1ZW6A 2YXEA 2YHUA 1J9GA 1G7RA 3RJMA 5F9TA 5M5BA 2Q0XA 3FNRA 1BHSA 3GEGA 3R8CA 3WK8A 3MYRA 1UKAA 3T52A 5KJ6A 1LI7A 3DAPA 4XJVA 5H68A 3PKJA 4BO4A 2ZM6B 1XEWX 3NDPA 3U3DA 2QR3A 4FEAA 1J97A 1OWMA 2FUKA 3OCZA 4M0LA 3F3KA 4I8XA 2C03A 1ISSA 1QIFA 2PRJA 5I8WA 4D8SA 2PLRA 3HR7A 2IFTA 1RPAA 3C3CA 3HZZA 3A2LA 1ITZA 1LH0A 4WKGA 5BV7A 5AVXA 1KKLA 3A1VA 1GOTA 1XA4A 3ABZA 4B75A 1MG0A 2JD1A 4GPTA 4URUR 5TGZA 2NSYA 4CM5A 1K98A 2Z5GA 4LG1A 5JSKA 3DDSA 4EUHA 1DTWA 2GHIA 621PA 4KLCA 2DX7A 4DIEA 4JLBA 5CG1A 1F20A 3Q5GA 3U9SA 1ABBA 3EMDA 2LCIA 3KWMA 5LSAA 2FSGA 1IY1A 2J07A 1YNSA 3EF3A 3C6XA 4MINA 4P3OA 1XJCA 2BM0A 4CIDA 4PANA 3GMDA 4OF4A 4UULA 4I36A 5JMOA 1IOWA 1GUFA 3LSYA 1SZDA 1Y42X 2C2HA 3WLFA 3M49A 1QG2A 1C4XA 4XX0A 2W2TA 2DUUA 4G1MB 2CEKA 1HE4A 1OA0A 4PO3X 1N78A 2XPCA 1YI8A 1EAYA 3OZTA 2BELA 3CRNA 5GJVC 4ZGBA 2XCTB 4C4YA 4JJIA 2YL2A 5CFLA 3A04A 2ZSFA 2Q4RA 1INFA 1QHNA 4IJ6A 4I5FA 3SE7A 5KTYA 5M04A 1YMVA 4NE7A 1ZD1A 1PHPA 2V6GA 3AUXA 3HBMA 1H0RA 3HLTA 2UUPA 4L0CA 3ZDFA 2X2FA 3C7CB 3O8LA 3K9NA 5B6PA 1AO0A 3OZFA 4TKUA 5FWDA 2DWPA 4BV2A 1OF1A 1NN1A 4R9SA 2ECPA 4MV9A 4EVIA 4YLYA 2FPRA 1GKIA 3OCJA 3GFBA 4PYLA 4BMXA 5BSUA 2FWRA 3QVMA 2BW0A 2JA2A 3FNBA 4YRDA 1WMEA 3JQAA 2HMYB 4CHTA 4GR4A 4DLUA 1P4HA 3IP5A 4IIDA 3P4UA 4FUTA 1MC5A 1BX1A 1I36A 3GXBA 3WYDA 2GILA 2I6XA 1E1YA 4LNAA 1W5EA 1W0JA 2WHQA 3GPBA 4G3NA 1X8JA 2AFIA 3WK4A 4U7TB 4KE7A 4FOVA 4FQ4A 1YB7A 2DFKB 3G0DA 3GAZA 3VVMA 1FMTA 5B2DA 2UZ1A 4JX9A 4ER7A 2ZEJA 1JFVA 3BJRA 3DBRB 3L0CA 3EVDA 1LV7A 1TLLA 2AXEA 2NU6B 1WDLA 2WT4A 4EB8A 1X86B 5A6VA 1Z3CA 1E6EA 2DWOA 4Y18A 4JCCA 5LQKA 2W43A 1ADFA 4LDJA 1TU4A 5DH9A 3PWTA 2FMTA 1E5QA 1I01A 3R7WB 1ZM7A 2BEWA 3CH7A 2C4MA 1E2EA 3MWYW 3UATA 2ZXFA 2N46A 5JSQA 1JFFA 1HK7A 2FUG6 4K87A 4RPIA 5T64A 4B3FX 1CFZA 1LVGA 1JI3A 3ZDEA 2CLIB 1XEFA 4HRXA 2HU7A 2WILA 2O7SA 2ZCUA 5AJTA 4BAGA 4F11A 5BOSB 1M2VA 3OFND 5AVRA 5CJPA 5CFZA 1USUA 2NXWA 3HKEA 5FNVF 4DZZA 1ZL0A 1T15A 1V5IA 2E4AA 1DQPA 2R44A 1QOPB 4MQEB 4P6VF 4PRZA 5DTIA 4F60A 2UYCA 4LAFA 1U9IA 1GXSA 2MU1A 2I2WA 2PMFA 2QUIA 1XLWA 2X13A 3PGKA 1E4YA 4FPEA 1OSNA 4L6IA 1VLVA 3V4LA 1RP1A 4GP9A 1Z8NA 4JQZA 1V3CA 2BMVA 2EEZA 5E9QA 5AVYA 3H8VA 3D9QX 3T94A 3A6HA 6ABPA 3HA3A 1MC8A 2AFHA 2QN7A 3AIOA 4OQQA 1TA0A 3H7AA 3NT5A 4LX0A 4RHCA 4AJKA 5JEEA 2GD1O 4MLDA 4O6VA 3ZUPA 4ZDJA 2XF8A 4IWNA 2DJ5A 5JWOA 3AUJB 1D2GA 4MJ3A 1XF1A 1SO8A 2FSIA 2IKSA 1PUJA 3E9EA 5JZSA 2QENA 3N0TA 3NEJA 3U6KA 3VA7A 3L9XA 2A5YB 3DLBA 3QF7A 3IODA 5DGHA 1P7VA 1XDZA 5JAQA 4D96A 1T5SA 3TMKA 4L85A 4BAUA 3N87A 1I6LA 1PJLA 2W2KB 2DQ4A 1MLDA 2PYIA 4FCTA 5GX1A 2G9RA 2XCQA 3D3WA 3ONWA 3PE3A 3PHHA 5A4KA 3TVYA 4XYXA 3QUBA 1M2FA 5C46F 2VFAA 4DUGA 4CIXA 2QORA 4B3BA 5IK2D 1DC8A 1LBIA 1ADJA 2IU6A 3JYNA 2Q2OA 4TQAA 3SC6A 2VHYA 5A6SA 2O23A 1JEDA 3WNBA 2HMWA 3OEEA 3L0BA 3UJ7A 4XOGA 2H07A 4NJEB 2GUGA 3P19A 3IIIA 1SIUA 2BTQA 3D4NA 3NAGA 1U2SA 3S70A 3ONDA 1ZK0A 2CE2X 2W4MA 1ZXLA 1K7CA 1CK4A 1K1EA 3HC7A 1ZI8A 3GVCA 3TQIA 3ACDA 5CFNA 4GZSA 5FKJA 3LGXA 2FE4A 3WKDA 3GIWA 4ARCA 3GVLA 3ASVA 4R54A 3TR6A 3IQXA 4P22A 3KZXA 3IELA 4FOQA 1JKJA 1V4NA 3QE2A 4U7PB 1TYCA 3H5IA 1BN6A 4L3VA 1M7BA 1NOJA 1IBKB 5K0BA 1S02A 3IMEA 3H1GA 1AGYA 1GQSA 3QYPA 2V96A 3SNHA 3T61A 2O8BA 1R0CA 1Z5GA 3K6SA 3R6TA 4Z54A 5FEUA 5SICE 3MJSA 1E9EA 3RIYA 1ZCJA 3IGFA 3RS2A 4BE4A 2Q9CA 3P0JA 3KT3A 5AMXA 5KNDH 3ADEA 5KMGA 3DMDA 2AB0A 2PDAA 3AVQA 4NJOA 2OKCA 4CGZA 3ABSB 1Y82A 3AB3A 1Y6RA 1GN9A 1A98A 2P2CA 1P9LA 4AJEA 4CKYA 2Z32A 4AY4A 1DFGA 5ICMA 2PBLA 3IAS6 3MD9A 1HT3A 1B6GA 1PKXA 2CWDA 1BG6A 2LVBA 1E4EA 2HLDD 4MQFA 2XTJA 2YXLA 1Z0DA 4UD2A 1XHLA 1ZC3A 3INYA 4Y1RB 3ZLVA 4AP5A 5LN1A 3UBTA 1E2LA 3DHVA 3KJGA 3IR5A 4CQLB 4FPJA 2ZR7A 3ON5A 5T4HA 3GT0A 2PBZA 4JT9A 3WRYC 4EKGA 3BSYA 4ZAVA 1Y48E 4SLIA 5CNMA 3HXQA 4OAOA 4NBUA 5AIBA 2P4OA 4CSDA 1KH3A 4D9FA 3GLHE 3U6BA 5KX5A 1MGPA 1BFDA 4YZ4A 4FHEA 5L51A 1VLLA 3C1AA 1IVGA 4Y9RA 3QP9A 5AJUA 3Q9SA 5AKZA 1X2BA 5EQJB 3G5LA 3TLAA 4AKTA 2EKDA 3THXA 4Y2XA 2QAJA 3JQEA 4KHZA 2FN7A 4W9NA 3RKRA 5JEDA 4KGVA 1U4OA 2CWWA 1MX9A 3R5SA 3RARA 1NVKA 5JROA 1XCMA 3HDQA 2OCBA 3G2JA 1LZKA 2SIMA 3QEMB 5K4AA 4WGFA 2HZ7A 1H6CA 1AXEA 5B2ZA 2VCHA 2J9ZB 2UYQA 1VYHA 4LWPA 4EY6A 1JLMA 2NTYC 1SBTA 3LTEA 4AXXA 4ZAGA 1MOPA 4HAZA 1VFNA 1R10A 3BA1A 5J2UA 1ST2A 3KQYA 4JP8A 3DJFA 3AHIA 3SHQA 3UIEA 4S3MA 3L05A 1IHUA 1XPUA 2YW9A 4ATNA 3M2TA 3GFVA 1FQJA 2NV6A 3ONVA 4ZOLA 3WLHA 1X14A 4U7HA 5AKYA 4YMLA 4RHEA 1RHKA 3SK0A 2XZKA 5T7BA 4B3HA 1NE2A 3TDKA 3ZDBA 2EKBA 3DM5A 1EUCB 2EYQA 4DNOA 2ZKIA 2H3EA 1W6RA 4NEQA 1J00A 2I54A 4Y2SA 3QY0A 3SQNA 1GCIA 3L02A 5FP0A 4CZ2A 4PYKA 3E3LA 4CPDA 3C1OA 1BU8A 1T10A 3UFXA 5NULA 3ZD8A 3OM8A 4MP3A 5ECYA 4BQSA 5CFOA 3MBKA 4ODIA 5F9HA 2AIRA 4FONA 4C87A 4C0KA 1V11A 3ZXXA 2ECFA 1RXVA 3U3OA 4E2ZA 4FNMA 1U3GA 2IYEA 3CJQA 2H63A 1BCSB 2O2HA 4CCYB 1KEZA 4Z4IA 5JMPA 1Q0ZA 5F9FA 2BM9A 4JCOA 4X1YB 1SXJE 4REQB 4DLYA 2ZB6A 1IM5A 3LPLA 3PF8A 2O59A 3S7TA 3I53A 4K9KA 3QBJA 4JX8A 3JALB 3ZZUA 4IRXA 2JLVA 3ADCA 3THWA 1XTZA 4G37A 2Y0CA 4KQKA 3DL0A 1VGRA 3NANA 4KQFA 4R9RA 3AY0A 1EJ0A 3QVTA 3WNZA 1XZGA 2RIRA 3L1UA 1N8KA 3NWOA 4FDAA 4EAQA 5JQGF 2JGDA 3L6RA 3TTTA 2P4EA 4AJ1A 3TNFA 2M6LA 2VP9A 3KJNA 4NJMB 4BLUA 4QOIA 1J8MF 4A0HA 1O5IA 2MSDB 4J0DA 2P27A 4K40A 2WU3A 1DADA 1XCLA 2V4UA 3E5HA 5FO0A 3WI7A 5AUNB 1XCPA 1H0SA 5JFOA 4REOA 1OLXB 2W2XA 3N0VA 3P45A 5J63A 2MINB 3F1LA 4EBBA 5E6SA 5BRAA 1NOIA 3S81A 3EJ6A 3VNGA 1XTRA 1INGA 1RJWA 1PL6A 2B9VA 3PNVA 4WCFA 3OZ7A 1EUYA 1DJMA 1HA3A 4GH5A 2WV9A 1HR0B 3DP7A 1H5UA 4LK3A 2GN6A 1J23A 4X6LA 2D4HA 3LWNA 3V1LA 3DOIA 1CEEA 1F0KA 2FV8A 4BX2A 4CKEB 1F9EA 3F78A 1T5HX 4G85A 4MW0A 5K3AA 1Q17A 1QB7A 3Q9UA 3EH1A 3V55A 3LDGA 1SXHA 3Q7EA 1MIOB 1VZ2A 3FETA 3FUTA 5C1PA 4PLTA 5DI3B 3UUWA 1VE7A 1CQJB 5BVHB 2Q6VA 4ZV4A 3KWJA 1NV8A 3KNZA 1QIEA 3A4VA 3PQ3A 5CNIA 1U99A 5ESXA 4KX5A 3I9V1 4QYSA 2EX0A 3OLCX 3UMMA 1XC7A 3AFMA 4QYIB 4OQEA 3F8TA 2XBLA 1JF8A 4PHFA 5C7LO 5I7RA 5L3SA 4DA4A 4TL7A 2VQDA 1KZ1A 4IH1A 1L1RA 3LQ2A 2FLVA 4NF2A 5FLKA 4G5HA 3JQ7B 3HBJA 4ZU1X 3LQQA 4IKPA 4K3UA 4EMBA 2H00A 2W5UA 4RZXA 1A4IA 2XDQB 5EYPA 3RAJA 3SEQA 3V4OA 1E1MA 5FDFA 1MA3A 5EUMA 2W5NA 5EWJA 3C3WA 4P4UA 4LJKA 1FRZA 2RAUA 3FWHA 3A9HA 4UMDA 2ZIFA 5DM70 2A5DA 1IZ0A 1SK9A 4G3XA 4BRSA 5TGTA 5A9TA 5TS2A 3CLSD 5CFQA 5IUNC 5JJ5A 3B6KA 1CIJA 4FFOA 3HRPA 1YACA 4JT2A 4FKMA 4GYJA 1QGUA 1X7DA 3QE4A 3PHBE 5HF6A 1YOVB 2J3DA 2GWHA 4FHZA 4NOKA 1L7VC 4CL8A 2QGNA 1UJ2A 1KE2A 2R8PA 4JQSA 1YBMA 3F8SA 1TUEA 2P9GA 4GOJA 2DG2A 2CGEA 3BD6A 4IYJA 5JOQA 1AD2A 4AZTA 2O5VA 2GZSA 3PDIA 5AKEA 1F3LA 1HE1C 4FS3A 3C1TA 2EFEB 4RPGA 4UTXA 4K9QA 5JWRA 3OETA 2QXYA 4RFLA 1GQYA 1A82A 4URVR 1JMVA 3CCFA 3ZW7A 5EKDA 2HX1A 4PE5B 3EF0A 1QFXA 1ZGGA 1GKKA 3IVCA 3CRMA 1DQNA 2C2MA 2R1UA 4NCIA 5HX7A 1M1YE 4L78A 3NDBB 1JIQA 4A82A 4Q9KA 1PFYA 1V6AA 3EBPA 4J07A 3T4PA 4W5JA 2AD5A 4AY2A 4WBNB 4IMBA 4L7BA 2AA3A 3DZCA 3G5AA 1UXOA 1RXEA 3P20A 4XM0A 1R0ZA 1IB6A 1IG0A 1Q0QA 2AV6A 4D6XA 3ELYA 4DIDA 2IP1A 4DWJA 1RJ9A 2CNBA 2FUNB 5ALWA 3WGUA 2VHJA 2OLEA 3T1YB 4AUNA 5EIBD 3WNDA 4E5SA 2Z6AA 2HH9A 3BF7A 1Q7FA 3G2MA 4FPGA 3IP7A 4J7CA 3EGOA 4FUQA 3RVLA 4NE9A 4D8VA 4KKXB 3DEKA 1B9SA 3I9FA 1SO7A 4IX9A 3H5OA 4Y9UA 5EESA 4BQNA 5H4GA 3J7AC 2QLFA 2I65A 5IJ0B 1CRPA 2C98A 4MVJE 1USIA 1Z38A 3KXIA 3LQFA 4PZZA 1JKIA 1UINA 2PYDA 2A9QA 5TVKA 3CKMA 2IBMA 1Z2NX 2EDCA 3HCRA 1NV9A 2UDPA 4INAA 3AEQB 3GEIA 1KGSA 1HH4A 1J56A 2BFPA 4LRXA 5KHAA 4PGAA 2AL7A 3D5TA 3TXAA 3T3NA 1WOMA 2PGXA 2P65A 2JHFA 2GXUA 1G21E 5CT4A 4UUAA 2QUHA 1WE2A 3NYQA 1CUFA 1NU8A 5IEJA 1WZNA 1ZR2A 2E1PA 3NEYA 1JLLB 4ZV7A 2GZ3A 5E4JA 1A8IA 4GNRA 5JAPA 5E8JA 2WUWE 3HKBB 3TQHA 3CEPB 5IVKA 5HMMA 1S8OA 2HTRA 1NDQA 1COWA 1PUIA 1SCBA 3C3KA 3R3ZA 4X20B 3EA4A 4XR4A 1PJRA 2CJWB 2PSJA 2PNJA 4RJTA 4Q4DA 4BEJA 3L9WA 4EA6A 1NI4A 3OEYA 1C8VB 1S89A 4L75A 5AVKA 1P2GA 1XK7A 3LUCA 1G4HA 4RVFA 4O5TA 1UL1X 4OLBA 5IZCA 3RC8A 1MO6A 4IDAA 3THXB 2ZANA 2FXIA 4O1IA 5LIRA 2HWXA 1E2NA 3CVUA 4DF3A 2XNHA 5DTRA 1IAQA 1UKEA 4ZY3A 2QWDA 1KY4A 1BJIA 2W2PA 1K0UA 2ZS8A 3O4IA 3PHCA 3QYAA 4B84A 4ND3A 5JBNA 2PKQP 3WXMA 2I4RA 1JHXA 5D7NA 4AJ2A 2O3QA 4EZBA 4YV7A 2Z4SA 1OH7A 3FWYA 4QDKA 1QHYA 3Q5EA 3WGGA 2CXTA 2AJDA 2WM3A 5FUWA 4MHTA 3QUAA 4EOGA 4AMZA 1NRJB 2VPXA 3ZDAA 1DGQA 4K1IA 2FH5B 1KOLA 4G1EB 4EBFA 3KR0A 2CLLB 4D79A 1M10A 3THOA 1NR7A 1YBVA 1Z7BA 2UXDB 2P1ZA 2X7XA 3ABOB 1IHYA 2XAUA 3D59A 3SAJA 1RWMA 1BW9B 4DV2B 3S55A 3STXA 4ZTZB 1RCFA 1RE0A 4IFTA 3A4TA 4L6AA 4UCFA 4S05A 3I72A 3BWCA 1VC2A 4QPDA 5CA0F 4P53A 3PNMA 3DE4X 2G25A 2O5EA 2AI1A 3PGMA 1U3VA 1ZICA 4G4GA 1NULA 1N2GA 2J3LA 3C7AA 3A1TA 3PGJA 1MVNA 3ZWPA 3USCS 4RY2A 3ZWWA 3WKBA 3BULA 4QXAA 3L5KA 1KBOA 4LJSA 3QFFA 1CDEA 2QRHA 1KR5A 2CKMA 2PWBA 1ZIYA 1GCUA 3G3EA 4WOPA 3HFJA 3RYIB 4D0RA 3DOCA 4Q1UA 3RSLA 3Q6PA 2R1VA 3RT9A 3M5WA 2DFDA 3WWCA 1MQ8B 2K2QB 4M86A 4DR3B 4Z86A 1CCWA 2FN8A 3PZRA 4HVLA 2DG0A 1D2CA 5FBLB 4BNHA 4YMVA 2D0DA 1G5IA 1JH8A 1QBKC 1MX3A 2OO5A 2VTKA 4HQNA 1C7EA 2JIBA 4JB3A 5ELMA 1EM6A 2JLBA 3R77A 1U2GC 1W93A 3PICA 4WZ6A 5F35A 2Q99A 1EIZA 4S1WA 3SEZA 1XZFA 1UKCA 2GZAA 4FYVA 3SHTA 1ORTA 2ZR9A 1GA6A 1V16B 1BS2A 5ALLA 4F04A 2LGJA 2R5WA 2ZYUX 4ZOLF 2X0RA 1RWVA 2RH4A 3A6KA 3R7AA 1JEQB 1KBQA 5HQTA 3PCTA 1PJXA 1PGPA 1NLYA 1N8NA 3FA2A 4DNPA 2G36A 4HQ6A 4BX0A 1D2NA 2XD4A 2YFQA 3MBIA 1AQUA 3UXEA 3CNEA 4IJVA 3M6WA 3QFRA 1T91A 3TLGB 3FM9A 4M1OA 1TA9A 2C1ZA 4JNCA 3K0KA 2PS3A 2P9HA 2WIFA 1RI3A 3FJ1A 5IPFA 1P62B 4F9TA 1ZIDA 4LMPA 3PYXA 4ZHQF 1Y9ZA 3HWSA 1IVNA 4CLHA 3EXIA 3CN9A 4TRMA 3R3UA 2AZDA 3I2IA 3PDJA 3SC3A 5F7XA 1JSXA 5FOVA 4UPVA 2VDRB 2F28A 4M49A 4YGXB 2H85A 2HPZA 4RHYA 3O74A 3EDRA 4JFRA 2QVLA 1R6BX 5C0OE 3RVSA 4FEGA 1UBGA 4PTZA 3E5MA 4XVQA 2GTPA 5FNUA 5DHSA 1Z73A 3CW2A 3H5AA 3D7NA 4YREA 3KHTA 2VDJA 1XZJA 3QKSB 4MRVA 1TMOA 4A8JA 2MIIA 2PD6A 1YMUA 1Y5MA 4FWTA 1MB4A 3WFJA 1NSDA 4UAJA 2WG1A 1MS0A 5CDGA 1ADBA 2IGBA 1FC0A 4B6PA 4GKJB 2AQKA 4LYDA 1EJ6A 3MJEA 5ARDA 5LDGA 3VZQA 2FMFA 2JZOA 4ZZ1A 4II7A 4HCJA 5K8IA 5CR9A 5P21A 2Q07A 1YR2A 2JGRA 1DC7A 2EKQA 3M4JA 4E5DA 1XU9A 5IJWA 4RADA 3K71B 2CV0A 2CDRA 2H2IA 3DW3X 4IIHA 3T3PB 5C5EA 3RE1A 1DKMA 1EH5A 2HTEA 3LK6A 3H83A 3ZE6A 1SBHA 1QIGA 4M1MA 2ACVA 4ZYVA 1DC5A 1ZX1A 5DXFA 4ZVRA 1E6KA 1VCJA 3GVKA 1IM8A 2DQZA 3NR2A 2ZRPA 3W3AD 1MBZA 1JWAB 4JBIA 1KIMA 2EW1A 4GBJA 3WNVA 2AOUA 2V8BA 1LPMA 4RDCA 2Y68A 1U1DA 5DK6A 1RYYA 5G02A 3GLIB 1E60A 3WIBA 1ZUD1 2PQ2A 4TRNA 2G67A 4JLAA 3WHLA 2Q2VA 1QPGA 3EAFA 1ZU5A 2FE1A 2G9VA 3GV0A 3IESA 3QELA 1YHZA 2O3RA 4HQKA 3C98A 2WZCA 4ZQIA 3UK6A 3GFSA 3UB2A 4WESA 4GYWA 2FDCA 2J32A 4XHXA 1DOHA 4WFJA 3VJRA 1Z6AA 3LC1O 3PWZA 3WJAA 5BSMA 4V0RA 3AKEA 1Z0JA 4HNRA 4R5HA 3CF2A 3P2EA 4TMFA 4B6QA 1YVPA 2Q5FA 2CF6A 1TIKA 3WKEA 3WLRA 5TNXA 4EJMA 1PT6A 2WJZB 2BFFB 4KBGA 2ZJ1A 3W05A 2CJFA 2YWRA 1EIWA 3ASZA 1EFRD 1G8AA 3D1LA 5T57A 5ICGA 5DTJA 5L4LA 3ZU3A 4JWTA 2HA5A 3BE6A 1MG5A 4NDZA 4RD2A 3TI9A 1CUCA 1Y5RA 5KNBA 5EVCA 4FJ0A 4QPPA 3RS9A 2R60A 2XYGA 5DX0A 5IM5A 2VAWA 2LV8A 1EUQA 5JNVA 5E4FA 4FGKA 2W6JD 2VTBB 3WLQA 4N48A 4WQMA 4TMVA 5CH8A 2J9FB 3U4HA 1ZMRA 2QSJA 4CMAA 4PSUA 3W8FA 2ZAIA 4OH1A 2QPOA 3PYLA 4V39A 5DP1A 2IY7A 2NX2A 1IVYA 4AIIA 1VDZA 3DKRA 3E0QA 1FFWA 2FX3A 3EGCA 3EVZA 4IIJF 4BTEA 1F48A 1DQYA 3P1JA 4RVDA 1ACLA 1TAGA 2EZ4A 2G70A 3FMPB 1QLGA 3WLEA 4R69A 4NRDA 1QSGA 1WP9A 4DR4B 4RTPA 4NCXA 5FIUA 2VK4A 3FFAA 3VR4A 5LJLA 4UNPA 3EN0A 1AUQA 4GKKB 3OWHA 1WLSA 1FP2A 2ATXA 3C15C 3QWHA 5EE0A 4P35A 5FNTA 4OHWA 3QENA 4IJUA 3RS5A 1LNSA 1KP2A 1T2DA 2G76A 4J43A 1KY2A 4OK6A 4AJ4A 1RM5A 4QFMA 3D6VA 1V37A 4JR0A 2P35A 3WYCA 1I2MA 4EVSA 3U44A 1G291 5GM2A 1E69A 2QWBA 1Z50A 1D4ZA 1W5SA 5CLJA 3GJ8A 1KEKA 1XD9A 2R68A 4NFLA 4TSKA 3SVTA 1CB0A 2BUAA 4JFAA 4E22A 1ZWKA 1VI2A 1Z4IA 2B99A 4LCBA 5FPKA 1JAIA 2PMWB 4YJHA 4PPFA 3T1VA 4QKQA 7REQB 4BQOA 4HN2A 3V7NA 3D4BA 1Z6TA 3O9ZA 3ZVKA 5D01A 1M2KA 4B5LA 3IOEA 4XJAA 1XX6A 2ZR0A 4GZ6A 1P2TA 5SYMA 2OO3A 2P9CA 4ARZB 1CJKC 4XRRA 3NOVA 4B4OA 7YASA 1KTIA 4ECAA 4TWBA 2JANA 1R6VA 2PVSA 1E0KA 3ZGZA 1CWUA 2XT0A 3DDNA 1EGVB 3GYBA 2AEJA 1E3EA 3KLNA 2GEVA 3FCSB 4QNPA 2CMHA 2VJCA 4TGLA 1G3IA 5LMUB 2CL6X 3LY5A 3ZHBA 2KM1A 4HWRA 3Q85A 4ZCTA 1T6YA 4LF9B 4JJKA 5E8RA 2IT1A 2PXXA 1G8SA 3HYNA 4QO7A 2YYZA 4MSUA 4K7JA 5EUBA 2XZIA 1RQNA 3FPGA 4BLTA 4EG8A 3L5OA 5DLYA 3UFBA 4A4DA 1UXHA 3ELBA 3DTTA 2V59A 1M6WA 1LJUA 2X3YA 2ZUCA 3FVQA 1TU0A 3GHHA 4WPGA 5JV5A 1D6NA 2G5CA 3MRXA 3RVOA 4DQ0A 3CBGA 4RJIA 3NEAA 3OE1A 2IZ5A 1V45E 2VDVE 4WZAE 1Z7EA 2OBBA 3ERCA 1Q0LA 3PLAE 3I64A 4NV1A 4GZXA 3KSRA 4MWEA 2B4RO 2C31A 4TYYA 1WD7A 1OFHA 2QD2A 3KSUA 4LSGA 3IFSA 3AERA 1EFHA 3DR3A 4NULA 3L8DA 1A9QA 3OEHA 4AT1A 4UOZA 1Y7LA 5ADWA 1DRJA 3RYTC 2D0IA 3SMQA 4UXHA 3HZRA 4IYRA 5JYYA 1G6HA 3IOYA 1M2WA 1IY2A 3HRIA 3HUDA 4L5IA 3D6FA 1W73A 4L07A 3Q3VA 4HOYA 1V5WA 4JC8A 4BX3A 3RRJA 1LPAB 3B20A 2WMDA 3MXOA 4D8TA 3AFNA 5HVNA 2AKAB 4JLJA 4ZODA 4DTCA 1M67A 6ADHA 4LXUA 4UF7A 4CPNA 1N6PA 1W44A 2QX8A 2QN8A 2Y76A 2PLWA 4XTRA 1Q1EA 4F3CA 2J6IA 3GBSA 3ULKA 1W48A 4MO2A 1MCZA 3W78A 1EX9A 2M98A 3DTVA 2RAPA 2VP2A 4EEZA 3I5MA 3TXYA 2UUBB 1DV2A 1NAIA 1JHPA 2CL0X 3CR8A 3JZIA 2II6A 2XYVA 2FP4B 1MGOA 3BIOA 3IQHX 3R7LA 2NU9B 3ORSA 5IARA 5K0SA 3VNUA 3UKOA 1WZ2A 1KNQA 2P4UA 4OXKA 1VE1A 1U2PA 2Z9DA 3UWSA 1JLSA 1O9BA 1YIAA 1M5RA 1RE1A 1T35A 1ZINA 3CRRA 1Y9EA 3KPUA 5DU2A 3SR3A 1IUKA 1HLPA 2QJTA 3W2IA 2YZKA 3X44A 1VG9B 4HDNB 1K4KA 4MZDA 2H3HA 1MA0A 4O3MA 3KEGA 3WA6A 5I9IA 13PKA 5E3IA 3K20A 3FHTA 1EVZA 2C57A 3OZEA 2JGIA 4EDHA 1MPXA 4FFBB 4FSHA 4F2GA 5HIAA 5DLDA 4E1VA 2Y6UA 1WG8A 3JYQA 1E6MA 3HP7A 4GBMA 4KO2S 4BQQA 2BMEA 4ESOA 4HVCA 1X7HA 4HFJA 4I66A 1PWYE 1LJ8A 4RMNA 1CD5A 3HJGA 4MI3A 3MC1A 3SEAA 1DUIA 2CV1A 1WZCA 1XD2B 4AHAA 1MZ6A 4FDLA 5CBPB 2X2PA 4BY9E 2ZRAA 1R4ZA 3B2NA 5LKRA 2HQBA 1CUYA 3KUKA 2XB6A 4G24A 2WYUA 3E9YA 4HMPA 4X85A 4DMLA 3RADC 3FF1A 1I3CA 3GZTB 3H2SA 2IU3A 4IKOA 3MNFA 3ESQA 4GPIB 1X2RA 1XZBA 1O95A 1Z2OX 1A14N 1YA8A 2OQ2A 2YV3A 1A9RA 5DTMA 1R64A 1RJDA 3BUSA 4QU0A 4R8SA 4MV7A 4BUJA 2QYOA 5E6UB 4ZVUA 3R0ZA 1KFJB 2CUKA 5J58A 5JZ9A 4WX2B 1Q44A 3IPLA 3R6DA 3QF4A 1JJFA 1FP7A 3OQ1A 5U4QA 3AVYA 2WNHA 5EFOA 1VLZA 2QLMA 1UBKS 1GNRA 3PTLA 4AMYA 4QDZA 1HM5A 3K6KA 1ZPDA 1HYGA 4DMCA 4S1OA 2OHJA 4J03A 1XRMA 4N8EA 4GDFA 2BEVB 2X76A 3IEUA 5TPWB 1U9YA 4MR9B 1LK7A 3ZWBA 3MTGA 1X1RA 3EWIA 3NTVA 4NZOA 1RU3A 4TSFD 4JBNA 3P0RA 4TXLA 5IC4A 3BFKA 3NVDA 4LJ7A 3INNA 4XOUA 5FJIA 3OQHA 4MTLA 1JDVA 2AMFA 2OCGA 4JVMA 4H77A 5CYFA 3T6KA 2UU9B 2OZLA 4KS3A 4G9EA 3JYLA 4IOKA 5KC9A 5K0FA 4EHJA 3TGLA 3CVOA 5C80A 4ENUA 2VP3A 2RJNA 3TZ6A 4B87A 4XYLA 2IUTA 3DFIA 2QRNA 3I23A 5CDHA 3OUTA 2WIJA 4B71A 1I2DA 2E4XA 4YP5A 4MZEA 2BZGA 5KNCD 3NBYC 2WF6A 4RTJA 2ZTHA 3RBXA 4BTLA 3BHIA 1Y8RB 4L8GA 2NPFA 2HWKA 4AO7A 4MZXA 3VC1A 2V7WA 3RUFA 5IVDA 4PG6A 2W22A 2H8KA 3TZBA 3ZE8A 1ZSYA 5CLFA 3N0WA 4PF1A 3PWKA 1YK0A 2X23A 3RUIA 3IA7A 3FYCA 2FY8A 3PNYA 3PR1A 5AVJA 3ZWCA 4KO4S 4R8VA 1DKOA 4MA0A 3LXMA 4OL0A 4LRUA 3JX9A 1VIVA 4BC1A 4G25A 1VOTA 4CVNA 3JQDA 2IPOA 3FMFA 3AUSA 2WMNB 1O5OA 4UAGA 1PFQA 4MX0A 1UC5B 2REQA 3TVTA 3F5MA 3C24A 2WIKA 4X95A 5F2OA 3WR5A 3HVKA 3OPVA 2BKAA 3C45A 4NICA 4B48A 5B4VA 4DQDA 3RAFC 1AN9A 4GR9A 4HTAA 2AOTA 5JCJA 2NZ2A 2QUZA 1PQYA 3D3KA 2EATA 4Q37A 4FBLA 1V3VA 1R5NA 3ILSA 3K30A 1T9DA 1PJQA 3O5AA 1PR5A 1EBUA 1QH8A 4NU8X 1G18A 2HF9A 4J7AA 4POAA 5EGSA 4PBRA 1GQFA 2VUHB 5E7IA 2FPXA 4EARA 5EZYF 4F56A 2QXTA 3O3CA 4EG4A 1MV5A 2XJ4A 2P11A 4BO2A 1XRJA 5LOVB 3WGIA 3HLHA 1Z17A 1OI3A 4QBKA 3ORRA 1YZ3A 2VWGA 2ORED 4MW7A 4YRIA 4RHXA 5JISA 3CLRC 3WL7A 4AICA 1THMA 4KX3A 1OXKB 2VHEA 3WMWA 3NWJA 3WGOA 3ZJ5A 3V65B 1NE7A 2V45A 5C8DA 1E0AA 2QRGA 2G9QA 4KK4A 4RK4A 5C18A 3Q6TA 2B4KA 5K0NA 1RSZA 3CA8A 2AFHE 2BAGA 1K68A 4F45A 4B6OA 4AK9A 1LI4A 2BFEB 2ECOA 1K97A 1OR8A 2X41A 4Q21A 4ZOBA 2FHPA 5JVDF 1QZXA 3BYCA 3UYLA 5E1DA 3B9RA 1DVRA 1HT0A 4JLSA 2J46A 3RVKA 1W52X 3JQ8A 4KWEA 1P77A 1E9AA 3ZVNA 5IG2A 2QY6A 1IG3A 1L7RA 3E84A 1ISGA 4AW9A 4K26A 4E51A 3DOEA 4HNAA 4HDSA 3JRWA 1T1JA 3PR3A 1MJGM 2N1BA 2GSDA 1WY7A 3F1KA 2Z6QA 2K2WA 2RGNA 5BYKA 4XWWA 1SOVA 1KZ6A 3ASYA 5IAJA 2DFPA 1FS6A 1X1BA 4KBFA 1QPZA 4URWR 1C4OA 1NBMA 3UT6A 3FUXA 4M7RA 1YZUA 1B9TA 1KFCB 4KLNA 4RJKA 2VF4X 4BNXA 3TPFA 5MGNA 5A3VA 4Z1OA 1A2KC 4NK4A 4Q9LA 4RK6A 1UP4A 3D2CA 2J48A 4DNFA 3PPXA 3UOGA 3HLYA 2J0EA 3U4GA 3SP1A 1CUUA 1GU0A 3TVDA 1T2VA 5AESA 1TD1A 3O26A 3X0DA 4C0WA 2PYZA 1VGQA 3P9RA 2XUKA 2WFZA 5EFZA 1F8GA 1EFPB 5D87A 3TZKA 4Q7KA 4NI5A 3PGXA 1GD1O 4KQGA 4PVCA 4S12A 4CKCB 1YR6A 3FB1A 1FLAA 4Q9DA 5TQVA 4QYXA 1Q6ZA 2JIDA 1K92A 4U39A 4ARSA 5JYDA 2QYTA 3TKLA 4UHCA 4K05A 3BCSA 1RYDA 3PPVA 5IDQA 4H52A 4DGSA 2ZYAA 3RUCA 1E3JA 2Q1SA 2UVQA 4NARA 1OTHA 4L6CA 2PZMA 4RPLA 1R4NB 4DCPA 3ORHA 2GZHA 2ZSUA 3OJ0A 3NHSA 3ZGVA 5CDUA 3KC2A 1IUPA 4Q02A 4UHEA 2IYYA 3BQ9A 3KZCA 3ZLTA 3MTBA 3EX7C 1BX0A 4MARA 4QVGA 5JWHA 1QNFA 2GJ4A 3RROA 5BV0A 1JZTA 1W59A 2FR8A 2MT9A 2QRZA 3K0BA 2AK2A 1SHZA 3MMSA 4RK0A 3MPUA 3VNVA 4GAEA 3FDIA 2BF6A 3T7TA 3RAEC 4XB2A 4I00A 1WUYA 1LVUA 5AWFC 3W5AA 1M2OB 1R9JA 2Z57A 1X9IA 5D3QA 1U63A 3K70C 3EQ6A 2G28A 2ODNA 1RBZA 2QB5A 1YI1A 3LLSA 1PT7A 5ED0A 5I8ZA 4F7WA 2NZVG 1QZTA 5I5EA 5LA6B 1R37A 1JJ7A 1EKXA 1SFRA 4MS1A 2HT1A 2OEPA 1VPTA 4P80A 4ZI2A 2JFVA 4EHLA 4G5OA 5CPBA 2DP4E 2H17A 4BFWA 4JJGA 1R0XA 4QGGA 4Y2RA 4C2UA 1AH2A 1OFTA 1Q7GA 3F98A 1J99A 3SCZA 1Y33E 1MAVA 3I4LA 2UZ3A 1CJCA 4AJLA 4NG4A 1TA4A 3CMMA 2H8GA 3COYA 4FIZA 5EIHA 2GKGA 3AEKB 3AMVA 2IBTA 1X80A 1V5FA 4HGNA 3ZCPA 1NQUA 1WTCA 4EFNA 2RHWA 1SQSA 1L1QA 2CFOA 3ID6C 1ENPA 5DHQA 1PYGA 2ATCA 1QHHA 2I3GA 1FBNA 3PPYA 1KERA 1WSAA 1KEPA 2VHWA 4FCCA 4IJKA 4UCWA 1ODCA 4WDQA 4QTTB 4WRRA 3IPCA 4CF4A 1GCOA 2VC2B 1AK2A 3LVQE 2XOKD 3KYCA 3HUTA 2GEJA 4LTMA 4TVKA 4KQWA 3RVNA 1KDRA 4J2OA 1LWNA 5EE5B 4E3ZA 2IEBA 1QZUA 1GSIA 2IPXA 2PT7A 3PU6A 1KK1A 4C43A 3UF0A 1CUZA 3ECSA 3UW3A 3MWFA 1QAMA 2R4QA 3K6RA 4YJFA 1WDWB 2QRPA 3OC6A 4EYKA 5ICEA 4PO9A 3W9YA 1Y7PA 4GB1A 2B8NA 3PFCA 4BLRA 2PMEA 5C53B 3T7KA 4QJBA 1Y3IA 2RGBA 1SKQA 4QG7A 3RABA 3M70A 4OCZA 1D7OA 2O2EA 4ZT6A 3A1SA 3L4BA 4RH3A 3ILVA 4FX2A 3SM3A 2HO5A 1EGHA 1B23P 5BN5B 5T6BA 1L5SA 1CJVC 3PA6A 2J7KA 3QPDA 3K0FA 4W7HA 3I34X 2R84A 5HE9A 5C2JB 5KCMA 1SQ0A 4F86A 4ERXA 3W8EA 2JJ1D 2ZE8A 2PEYA 5JQGA 5B7QA 2R1TA 1K6XA 2I4TA 1IHXA 2WJIA 3PEUA 3IYLW 5DXJA 3KUXA 5LP6F 1X7GA 1TK9A 4RW0A 2ZI3A 4US1R 3MRVA 1ZM4A 3TLEA 3I9NA 2NU7B 4OQYA 4QOFA 3STYA 1DOAA 1O4VA 1MPTA 3CUUA 5LJIA 2CB9A 1P3Y1 1YFZA 1YZQA 1AKYA 1MOQA 2IHJA 4Q00A 3D8HA 3LUFA 1P33A 2DM6A 1EB9A 1NXTA 1JQEA 2FEOA 1FYXA 2OXRA 2PX2A 5IFLA 3F4KA 5ESDA 4X3OA 4MVJI 3GQBA 4RMGA 1YQDA 4YUYA 1REQB 3JQCA 3Q3CA 2PKCA 3WB1A 4WN9B 2CLSA 3TIBA 3L7CA 1QONA 1VPVA 2W8BB 2CLHB 2FW6A 2JDIA 1Z88A 3ILYA 3VZBA 4PIPA 5JUWA 1KI9A 2RBEA 1XAIA 1YHYA 1OTXA 2PU5A 4LOJA 3QEBZ 5GM1A 1NNSA 2CHVA 4D52B 2DBVO 1C9UA 3EXG2 3EZNA 3KQOA 2O0MA 1CEQA 4EPRA 3KYBA 1YTLA 3DV0B 5AJHA 4GICA 4MIKA 2ISMA 1ND6A 3B1FA 1T1RA 2A59A 1I5EA 4F06A 4D9GA 4ITVA 1XMVA 3C6YA 1T8UA 1H0KA 4Q82A 5HEKA 4DJFC 2YQZA 4EX6A 4IL5A 4QARA 3ADKA 4B6EA 4R83A 2JIZA 1SLIA 4I6GA 3VDXA 5HQ3B 5GX5A 4W9MC 1G9TA 1WUKS 4MCAA 3PRKE 4PLPA 1V0EA 1RBMA 1BEEA 1T8TA 3BXEA 3UWPA 3P5SA 1KZGB 2CC2A 2HRCA 3TOSA 3CG4A 4NAVA 5ETJA 3VR5D 1AHNA 3T5BA 1PEYA 2YUTA 1N5IA 4M7PA 3KOZA 4YMSA 5TR9A 3DR5A 2ZUDA 3Q5DA 4MKRA 3S68A 3C3DA 4MDHA 1E89A 1Z4YA 1W0PA 4G84A 5FULA 5K8LA 4CMEC 2WPNA 4K9OA 1GGHA 1SCNE 1UFQA 1PEAA 3FOEC 2YYAA 1OX6A 1LFAA 2BISA 3LUJA 4BNLA 1RRFA 1NC1A 3UAZA 4HX9A 1JQBA 2CY0A 1NP3A 3PHGA 1FA9A 4M1ZA 2VSYA 1FY2A 1WXWA 2EJBA 1DFIA 4PHHA 4RO0A 4C3VA 1XB2A 2H65A 2P9ZA 2GBLC 3HE3A 1IPHA 2Z83A 1CR6A 1UXIA 4Z3OA 4W5QA 4OLAA 1ECBA 1OXVA 2VF7A 2R62A 5GAJA 2W93A 4QLBA 2N0SA 1KO4A 3MT0A 5KJ1A 2XB8A 3HWRA 3U56A 5IBRA 2ZRLA 4LXYA 4TQUS 3QH4A 2LUOA 3MWKA 5H0IA 2R97A 4AUKA 1ZSVA 5JAZA 3ZV5A 2PGIA 4ZO9A 5CEFA 3QVJA 3M3PA 1KXZA 2A0KA 1KHHA 2O3JA 4LNUB 5FLEX 1S7CA 3BHMA 2JKYA 4LECA 1N1DA 3OBBA 3PG5A 2DVMA 5B3LA 4E15A 2NU8B 4OVKA 4LHXA 4OHMA 3TFQA 2EJVA 1M34B 1VPLA 4TXMA 2YHBA 4WT7A 3T1QA 3NJRA 4LISA 3C4JA 3USES 1M6VA 3V1NA 4IV8A 4FOTA 4H1UA 4Y2VA 3O0TA 3KEQA 3JQFA 5DTQA 2YN2A 3D4LA 5CEJA 4C1YA 3DJYA 1J1ZA 3EVCA 4UHKA 5IASA 3FWNA 3SF8A 3DFMA 3MWDB 3RSOA 3WK6A 4Z4CA 4MR7A 1LU9A 4C01A 1A76A 3AJRA 3HYTA 4G5FA 2QAGB 1YJCA 3WMRA 1UMBA 3TIFA 3DHNA 4MUIA 4Z9XA 1Q83A 2QTVB 3NO0A 1H42A 3T3EA 1BGVA 1P2VA 4KN5A 3V8PA 2Y27A 3HCAA 4KYVA 1WW3A 3KXLA 5IHXA 1IXSB 2JLUA 1SOAA 3FMGA 4AUEA 4IEFB 1U6DX 2C7VA 1DCMA 4KKVA 4HNQA 3WRVA 5BT8A 4AYXA 1BXGA 3EGDA 3SZLA 2E21A 4H3HB 2XUFA 4WASA 4H9GA 4ZFNA 1ENYA 1BE1A 3ALXA 1HEIA 2Z43A 2QW8A 4PTLA 4Y1EA 3H4TA 1F6WA 2J7PD 4ZCIA 1F8EA 1SCIA 3TZLA 4RTMA 3WE7A 1ZCFA 2VXYA 4H60A 2FSVA 3BVPA 1OW3B 3I6ZA 4X0EA 2BSAA 4ZCLA 1D6JA 1RJEA 4KXQA 2F1RA 1JEEA 3UMRA 1SGWA 3A7EA 2QUKA 1QRDA 2JI4A 2ZRNA 1TQ6A 1CQIA 4LOHA 2D0PB 4Y6GB 4ZVOA 5AK0A 1Z9BA 2C2ZA 2VHVA 3HDVA 5EXXA 4D9KA 4YV2A 1OXBB 1WS6A 2FEAA 1XSEA 1KKMA 2Y1EA 2Q3JA 1Y9DA 2FZLA 2F43B 3A9CA 3NATA 4JELA 4Q66C 1J8VA 3COJA 3FW0A 1XVVA 3PXAA 1RAFA 3LI3A 1U28A 2V8OA 3DYVA 4Z9YA 2WAXA 5EZQA 4G0XA 2RAVA 2YNMC 1KTVA 4H6VA 1QORA 4KRXA 4QQFA 3DNMA 3V7WA 4E5PA 3JQRA 4QN6A 3SC2B 3DTNA 3D54D 3OSUA 2JFYA 5KYKA 5TQ2A 4EB6B 3GN1A 5K3OA 3TKYA 4MPRA 5CA0A 1RWIA 1OA1A 4JA0A 5KAMA 3TGPA 1ZIOA 1T3ZA 1KU0A 4LDZA 4EPXA 5DHRA 4YMGA 4DCOA 1FYFA 3GC6A 3WQSB 2ZVPX 1OIXA 2IAOA 4IDHA 2YBDA 1G6Q1 4X61A 1DC6A 3H4VA 4HEJA 3ZOKA 3P9QA 1NPTO 3H9QA 4HH4A 5AOAA 4C1BA 2IIPA 4GMFA 3I5XA 3BWVA 3QKWA 4LYFA 1H4SA 1NAHA 3GPLA 2RGUA 4MV6A 2M6RA 3OSZA 4BNYA 4EY8A 1YBAA 1QG6A 4JR2A 3ZV3A 2QWEA 4JI7B 3CHYA 4XFKA 3TUZC 3K9CA 2D59A 3MWLA 4BO5A 1BH2A 3MTDA 3Q1LA 3UPTA 1FMLA 3CKLA 2Q0SA 3J7TA 1X7WA 4RD6A 2DECA 4KDEA 5JCOC 1VIAA 3IUQA 5IKXA 3AI2A 3RCBA 2J0UA 2VQ3A 2Z2XA 2W6PA 3T7AA 2IA5A 1JKFA 2YJ6A 3A0RB 3Q12A 5EGNA 4Z4FA 1PT5A 2XMBA 2WJAA 4FDVA 5KB3A 3A9SA 2XGGA 3AVTA 2VW2A 1SB8A 1QV6A 2RJOA 3NAZA 4CG3A 1JTEA 4DQKA 4DA7A 3DR2A 5U1PA 2G7ZA 1PTKA 1ZVQA 3QG1A 4Y8VA 3GGSA 4EGFA 3UN1A 3I76A 1UM9A 1V6SA 1OC4A 3KZOA 1ZMXA 3LO5A 3O47A 1RVV1 1KMNA 1O4WA 3MXTA 2PN1A 2W2OA 4I1IA 4WY2A 5B7GA 1DWUA 3KB1A 3ANMA 1S2IA 2FPPB 3JAMA 4CM9D 3AVOA 4KYUA 4Q3BA 3GVXA 5A9SA 3O8BA 3O3NB 2RG7A 4DUPA 4XGRA 3IMKA 1M72A 4D9IA 4IBOA 3E7DA 2HSJA 3AF1A 4U0JA 5CVEA 4NK5A 1E9CA 3JAWB 4Z1MA 4AD8A 1QQ5A 1TUBB 4RD1A 4BFVA 4MYHA 4KZPA 3JPWA 2IIVA 1JMKC 4RZ3A 4YRNA 2TMDA 4ZHQA 2UUOA 4GOLD 1B93A 5JECA 3K9HA 1NOKA 3VGJA 4EFLA 2ZTVA 1GZSA 2I1VB 1AKVA 1EVIA 1MD9A 2NO7A 2Y2VA 2RHTA 3NHRA 4K9NA 5CJ2A 5D6NA 3BXFA 3EMBA 5J43A 3LNCA 1ELOA 5KO2A 2X0KA 3KT8A 1FFSA 1TCAA 1XZLA 1Z5UA 3LUGA 4KH0A 4WOKA 4AMBA 2WUVA 3AUFA 3I6YA 3UK7A 1MR5A 1J0AA 4YB8A 1RHUA 2YJGA 3ME5A 3R3WA 4RCVA 1EXVA 4D3SA 4E5MA 1E5TA 1LD3A 5KNDA 2HJGA 3DOFA 4BGVA 2OBNA 2YV5A 3HBAA 3NNNA 1OZGA 1II8A 1W9MA 4B3IA 1QQAA 3RVRA 5BSFA 3UMVA 3W0LB 4JT8A 2VP4A 3F5DA 4CCSA 3IR7A 4FVTA 1M0WA 2AR0A 4DSNA 5DX1A 2XUHA 1H93A 3LPAA 4QELA 1K7XB 4RF5A 2A78A 3NEPX 3NBMA 3OWOA 2PUFA 5MN6A 1SMKA 1XDUA 1LB1B 3BAFA 4HF7A 4QPCA 1S2NA 4HLUC 2QX4A 5LYJB 3H6JA 3JQPA 4BZZA 3AT1A 3DCIA 5JS6A 2H2FA 1PS0A 2MMCA 1F5SA 4WADA 5TB5A 3HA5A 2OHVA 1H8HD 2O1EA 3U7EB 2JBAB 5LQSA 1M6EX 4OB8A 2A7QA 4OXYA 4Q3KA 3TAUA 3D11A 3DBLB 2OBFA 1U8YA 4WUVA 5ALGA 3HXMA 5G2OA 2IXEA 3C4QA 4HPWA 2O5RA 3MEQA 3IQDB 4U9UA 4HWKA 1HC7A 1E64A 4ECEA 1N1YA 2GK6A 1M2NA 5DW3A 1ZBQA 2Z1MA 1AMOA 4ZKDA 1Q6YA 1HNWB 2B3DA 2Y93A 3GJ4A 1YJAA 1Y7TA 2XUQA 1H8ED 1L5WA 3GG9A 3B8HA 2XT9A 3UT5B 2KWIA 4HS9A 2LCQA 2WTNA 1T8YA 4IIXA 3HBLA 1XVLA 3BEDA 4E4TA 4CEJB 2C4WA 4XW2A 4CF6A 2XVXA 1G1MA 4FQ8A 1P44A 2CLEB 3RS3A 3ZDQA 5B55A 3HLIA 2FN3A 4OA5A 3RFUA 5DNUA 3BMNB 2KQUA 2BKUA 2WSSA 3EH2A 4U3JA 2PK3A 2RGCA 4UZFA 1PEKE 3SIWA 4EEKA 1MXHA 1Q2UA 3OBIA 1U1FA 5G41A 4B7AA 4INPA 4NQRA 1HURA 4HXEB 1GNQA 4NENA 1PCXA 4HZUA 5K5EA 1IVDA 4I1OA 2XVMA 2ZIXA 4LFAB 3S94A 4IJ5A 1U1CA 2F1KA 1FUUA 1FMJA 3UOAB 4A6EA 4NS1A 3FB4A 3MWEA 4L8FA 3WGZA 1DIAA 3VNQA 2IEZA 4Z0TA 3FTPA 1G6KA 2VF2A 5HF5A 3OKAA 4M0EA 3QKRB 1UBMS 4OHUA 3VYWA 2DPGA 1UAYA 3PVZA 3WIOA 3O8NA 4RGYA 3LP8A 3E05A 1W88B 2FMUA 2WWGA 4IIJA 3P2IA 1TF5A 2ZRFA 3B3QA 2AN9A 3BYZA 2V9CA 2YDXA 2ID8A 1KSFX 4GL4A 2WP0A 5EIXA 3MK31 2DWQA 3K1AA 4P4SA 5K3EA 1E7WA 2WAMA 4R3UC 2WM2A 4UAUA 1IK4A 2REOA 3JVVA 2NUAB 4LF7B 5DX8A 3OAAD 4CM8A 1GFWA 1RKUA 2O2IA 2H1CA 5A4IS 3G2KA 3AM3A 4ZZIA 4LVOA 4K9MA 2EX1A 1KE1A 1GPBA 3U7FB 1IQPA 1ORVA 2PCJA 4UE3S 3GEPA 5A4JA 5AUOB 1JA1A 3QX3A 3H5TA 1EINA 2JGKA 2ZRGA 2PL5A 3IP1A 3PFWO 4RA6A 3UZUA 5JNSA 1HFWA 3D8TA 2J5RA 5EG5A 2QOEA 1ORHA 3WKCA 4V03A 3ZBUA 1BRTA 4K0RA 5HPYB 2XCSB 2WT9A 3RS4A 4PSAA 4DMFA 3INBA 2PBRA 3EEIA 3RBZA 1IONA 1NBWB 2OHOA 4H2DA 5BMVB 1YKSA 2FP9A 3IAHA 3V3KA 4DOMA 3W5HA 4HRYA 3IP6A 1ZUNB 5JD6A 3G8DA 5DT9A 4LZJA 3NNSA 3PUYA 1O97C 3B1WA 1JBEA 2PH1A 4FP3A 3OHMA 3AEUA 1TJ3A 4JEUA 3SYNA 1C3LA 3OE7D 2X0DA 2HA7A 4Z8YA 4MRAA 3WDMA 4TOIA 4KMSA 5LMNB 4YJGB 4ZVVA 3W77A 4HB4A 4M1KA 2KX7A 4RNCA 2QMHA 3SS7X 1ZJ5A 4ZD6A 1AV7A 4RKEA 1C81A 4X5OA 4FMDB 1IQUA 1DAEA 3BN3A 2NN3C 3BZWA 4OMUA 3VPDA 4B35A 3NMUF 5FV7A 5KBYA 3TMAA 4EI2A 5CDFE 2XYRA 3O92A 4Y6SA 2PZEA 5SZKB 3CEHA 4WLEA 4RDIA 3ZVRA 1YC5A 3O91A 3Q8XB 1YKFA 1QYVA 1QUFA 2CNNA 1K9VF 3TEJA 5FWXA 3P4XA 4YT5A 4MDEA 2LWIA 1BHJA 2BE9A 2WT8A 1GV0A 4MS3A 3BCUA 1JU9A 3CIFA 3E9NA 4ROTA 1MEEA 2ESRA 3G9UA 3KQVA 3C5WP 2IATA 4TZKA 2B1JA 5FPQA 4MVWA 4LF5B 2GCEA 2VJPA 1L7NA 2Z8XA 4J3FA 3VSBA 4CU5A 3ICEA 1KP3A 4C5BA 2F17A 1WDMA 2D7CA 3IPYA 1J6UA 1C30B 3Q72A 1MJFA 4QDOA 3W6NA 1L6IA 4F72A 4LRQA 3EGIA 3PL5A 1PGOA 4UM5A 3RTEA 1JDBC 2O2DA 1B6SA 3I73A 2BGJA 4LQLA 3NM6B 1U3WA 3MGCA 4RV4A 2HQ1A 1V04A 1N2CB 3BIXA 2JAOA 4KVFA 4B3XA 4U7JA 1M0SA 2GD0A 3L77A 5HKKA 2VK1A 1TYZA 1KC3A 5KWEA 5JS2A 2MSCB 2I2AA 1GZHB 2CHUA 2PT9A 5GOZA 2ODPA 4NCNA 3FDJA 3W90A 4EITA 4F4HA 3N2LA 1L4GA 4I2NA 3AZOA 4NCBA 3ADDA 5ILQA 2OV1A 4LC9A 3TZQA 2P62A 3OIWA 3WICA 4EQ6A 4LPSA 2FVXA 3WGVA 5FA8A 2X14A 2WSYB 3UC9A 2W6MA 4MCJA 1UDXA 1YXMA 1SUUA 2O6HA 1TZBA 1Q7CA 2P40A 3LT1A 3HYRA 3MBOA 4MUBA 4UTRA 1ZN2A 5FNSA 1XK6A 2AJCA 3FVZA 3K5IA 3NTOA 2UVPB 2NPOA 3N07A 3CZ5A 1A9YA 3N8HA 3B78A 4OMFG 4PLHA 2WPDD 4JT4A 3NWPA 3KTOA 2HLDA 5EHIA 3CLHA 1U7DA 4LX8A 5A62A 5KSYA 2JFQA 5F77A 1V4BA 1HUQA 3F71A 4GDMA 2CXPA 1VMDA 5KQGA 2H5JA 2PUHA 2CFSA 2RHLA 3DUFA 2CHQA 4H7KA 3FNQA 3JD1A 3TOCA 3W2EA 4JEHA 5U4XA 4DJDC 3GT3A 1C3OA 3PD0A 4UVHA 3R7DA 3BWBA 2YV4A 4TTVA 3T5MA 1JQKA 3WLSA 1FRFS 3OQIB 1PJBA 2Z2ZA 3TLJA 2D1SA 1J7JA 5JJLA 1D09A 4GZPA 3HFRA 1X7ZB 1GZDA 1C1DB 4A6PA 1A1SA 3LFHA 4QRDA 3O94A 3SI7A 4O1HA 3ZNPA 1CZUA 1DBRA 3KQSA 3M3DA 4A91A 3E15A 5KYYA 2PSEA 1NLFA 5CAEB 4A6DA 1WHSB 1F2VA 3FUVA 5BW4A 5IAAA 1N1EA 1GUBA 4POOA 4HN9A 4YWJA 2ZR8A 5BVGB 5MF6A 3WGQA 3DM9B 4EI8A 2ZYTX 5TSDA 2CXQA 3QKTA 1NMBN 4OXQA 2O2CA 3STVA 4MUHA 3SDZA 4YCSA 2VJLA 3L8EA 4P8RA 2HWUA 4KBYA 4S24A 3PJFA 3HXOA 4C6TA 5CB4B 6AT1A 4BMNA 2WOZA 3LQKA 4K2HA 4K3YA 1MQAA 2YJ5A 4YJ3F 2QD5A 2CMFA 2A86A 2Y1FA 3I58A 5AK3A 4P7FA 3RK4A 1A5ZA 4C3OB 1MQSA 3CYFA 3OKCA 4B79A 2XMDA 2VAMA 3V8RA 2VDPB 1E79D 3LI2A 4AS2A 3I8SA 3EXEB 1Y1QA 4JHLA 2P4HX 1DELA 3AW8A 1JFRA 1JQAA 1KFBB 1ZNZA 1RC8A 4DGQA 5B4UA 3H0KA 2RG1A 3LOUA 4RMIA 1JKMA 4F97A 1NFRA 2ZJ7A 4ZRMA 4YMTA 4RY8A 1GQ2A 3ANTA 3PUVA 1PZEA 1U0HC 1XNHA 4IHJB 1PO7A 2L17A 4YO7A 1K6IA 1GGEA 3W5BA 2O52A 4RHTA 1E5DA 4YN3A 3C3MA 3W6OA 1E92A 1HLFA 3E7WA 3F3YA 5FA5A 3BIJA 3ZLUA 5GIOE 5EP3A 2FPGA 1MRNA 1DEHA 3MVEA 4XE5A 3DLHA 4BYMA 1GPAA 2RHBA 1M5UA 4ADSG 2W0SA 1VL1A 3RAPR 5CT9A 4QC2A 4D8UA 2Z2KA 5TT0A 2W2LA 3E6AA 1OPRA 1MX5A 3INRA 4JP3A 4CKZA 4X7BA 1A9XB 3WLKX 4EJ6A 2P6NA 5KI6A 5EXEA 4CM4B 1ZN8A 3PGA1 5IC6A 3QPCA 3EEQA 3QHPA 4GLLA 3FLBA 1XQXA 3DEAA 2DT5A 1YI0A 2Q49A 4NCKA 2AC7A 4H6XA 1B8OA 3H4MA 4RANA 1QRRA 4TV9F 2I55A 3BERA 1I2AA 1TFRA 3DCJA 4YRSA 4Q05A 4YASA 1YH3A 3OF2A 1N1TA 1GN8A 1MTZA 1E9SA 1U3DA 2AUMA 4O2BF 3KV1A 4J76A 3PFBA 4Q39A 1NYTA 5AW8A 2CK3A 4JLWA 3OQBA 4H7IA 1Z18A 3NKLA 5I7VA 3DZHA 3Q0IA 1OH8A 4BE9A 1H05A 4J1SA 2ZBVA 2A9JA 2JBWA 1A5AB 2WAYA 3IT1A 3OMXA 2C4TA 1D9ZA 2OTCA 3MZ0A 3TSCA 5JZBA 2NT3A 5D00A 5HUNA 1FP4A 2HTYA 3OECA 4RX1A 4EPVA 2XN4A 4YDSA 1QXSA 4M0MA 5FHQA 3SLRA 2BMWA 5EZYA 3B1YA 3VOSA 3HCEA 5HJ2A 3SXJA 3I62A 1V0FA 2NZJA 3R09A 4ME6A 4DPLA 4HUJA 4BDTA 2JASA 3AO0B 3P26A 3W2FA 4KPUB 1ZR4A 3A3NA 1GPJA 4OQXA 3IP3A 2OD9A 4PG4A 4TUYB 1UODA 1NPYA 5AH0A 3KQNA 3DZJA 1LK5A 4KTTE 1GSAA 2P7HA 2Q1TA 1WSBA 3FWKA 4FI3C 3UB3A 1ZMBA 3JY6A 1P9OA 3Q15C 4UU8A 5E2BA 3VO2A 5LPNA 3KVRA 1E8TA 1UFVA 1R0SA 5KDLA 4HQLA 4BNTA 1EGQA 4YP0A 5JVDA 2QN2A 4QUKA 3ZWKA 4A8PA 4QFBA 3VTKA 1HKHA 6PFKA 1F4VA 1RIFA 2J67A 4KR9A 2H59A 3DZFA 1RYMA 2VRBA 1THZA 2XSZD 3MMZA 3O83A 3TEFA 1O0BA 1AKNA 1T4GA 1GTZA 1SAYA 2O0KA 4W9NC 1N2XA 4IHQA 1ULSA 5JR3A 5HBGA 2INGX 4GMHA 2EBHX 4Y7DA 2C9DA 2J87A 3MUEA 5FLXA 7ADHA 5J59A 4UEKA 1I7PA 1Y1PA 1G20A 2EGHA 3GAMA 1TL7C 1ZAKA 2HY7A 1NYRA 3ZPXA 1KMCA 1S8FA 2TSYB 5FWNA 3F6CA 3P4YA 4JUIA 2IWRA 1JG3A 5M34A 5JS8A 1ZC4A 5AI0A 3GFGA 3QRWA 1SD2A 5DHUA 4AXBA 3ZLBA 1GRRA 5FL3A 1TJYA 1GCGA 3N2YA 2PMDA 4CMBA 1YMQA 3EF1A 3ZCTA 1NZJA 1CXZA 4ETIA 4W8OA 3Q6KA 1BWPA 1EVEA 3KAQA 1RYNA 4LEIA 2JLXA 3I9KA 2R85A 4F0JA 4CFZA 1OFVA 4K6GA 1VG8A 2CNOA 3DVAA 1E59A 4F85A 1DBSA 1JHMA 3KJIA 2FZ4A 2O0HA 2J3MA 3L8CA 3ZWOA 2ATEA 4MEJA 5FBQB 4B80A 1QMGA 2NT4A 1P6UA 4XKJA 1XMOB 5J23A 1K5PA 2VK2A 3I1YA 3O9JA 1KSGA 2GUWA 3NJ8A 2HSGA 3JVIA 1LF5A 5FT9A 3ZGCA 1NBME 3V80A 5TRTA 4EATA 4UTVA 3UH0A 3E8XA 4EZEA 3RJZA 1FVXA 2QM7A 2IL1A 1FYDA 5L3QA 4AY6A 1QP4A 3A9WA 1QH1A 2H57A 5K01A 1T5LA 1ZITA 3Q87B 5DNAA 1LDMA 4L7QA 3VR3D 1EDDA 3H9CA 1OHHA 3U60B 5E4YA 4BN4A 2XYPA 1M9NA 1H2BA 2VK8A 1U8FO 2XOEA 5DYGA 2XUGA 3H1TA 3GCZA 3CUVA 3L46A 1W29A 1WU8A 2O48X 1A7KA 4GX0A 3U9TA 5TLSA 4BWVA 1UAAA 2BR4A 1J9EA 1HNZB 3KWFA 4PGGA 1JFSA 1B0AA 1GNLA 2CVHA 2FW7A 3MFQA 3ND5A 3V8MA 2FFAA 3KSMA 1RYHA 1V9LA 4K6KA 4X1KA 2ZAYA 1UMCB 2CD9A 3B9QA 3LY9A 5F7OA 2BERA 3RG2A 2VSNA 2LPMA 2IY8A 3ENKA 2I4NA 3N2IA 3OT5A 2FCRA 2GHSA 1TGYA 2EKLA 2WWWA 3EIWA 4NNOA 1JAHA 5ESRA 4BXOB 5IAEA 4KPYA 2HW8A 1UPXA 5CDYA 2QKYA 4B7MA 3PE6A 3Q3EA 5KYXA 4EUNA 5C52B 4CIBA 1GZ7A 1T29A 4JR1A 3ICCA 1J2YA 1FLVA 5B64A 2HMSA 1Y8CA 1NNI1 2JLSA 1P72A 4I7EA 1OCEA 4XPZA 4INZA 5JATA 3CJTA 4BO1A 2QR2A 4HTFA 1SBIA 4XLZA 4PZPA 3OQVA 1A8UA 3EXG1 2AQ8A 2JB9A 5LYYA 1TO6A 3UH1A 4DG5A 4G56A 1IBRA 3O4HA 3SSOA 4GQAA 1RPJA 1KAOA 2D8MA 2W6IA 5C1IA 1GUDA 2ON6A 4MX8A 3UWKA 1L4BA 1E2JA 3A06A 1EWKA 2EQ5A 2WD9A 2C8KA 4EECA 3RKSA 2WF5A 3ZI7A 3AK4A 5HX0A 1V2HE 3HL4A 4J3NA 1E0SA 2QPAA 4ASUD 3K73O 3H1FA 3UK2A 2J6CA 3Q9NA 2YZ2A 2FP3A 3C3YA 5G0UA 1F17A 5IDXA 3QFTA 2C61A 4PEVA 3A8TA 1JHZA 3EXFB 3A1EA 2YA6A 3JD4A 4UVIA 5LBIA 3GJ6A 2QD1A 3LG2A 3NX4A 4I55B 3NKVA 3KJFA 1UJCA 2HHJA 2ZOSA 2VDWB 1QQ6A 3IBCA 3U4QB 3TI3A 1G41A 1PZGA 1MO5A 1EJ2A 2EEPA 3AR5A 4FFMA 3ENVA 1SUSA 3HUEA 4B4VA 1P31A 5DHFA 1VIYA 2PQMA 3EQ9A 4C7BA 2FGKA 5K51A 5K8TA 5UKDA 3QW2A 3HRHA 2HJHA 3AW9A 4N5DA 3V1TC 4F5ZA 1OLSA 3IPXA 2CDAA 1W581 1G42A 3C5VA 4P92A 3FOAA 2W4QA 4JEIA 2VKQA 5AW2A 1CX9B 1VJGA 4XMBA 4ENTA 3QPWA 5LP6A 3ZQ4A 5ECDA 1NNCA 3B8EA 4K46A 5JNUA 4IUBS 1QRAA 4DCMA 2QVXX 4DS3A 4GECA 2C9OA 4G23A 5F4BA 2FLUX 2I7CA 1DBIA 5D7BA 4ER6A 4F3NA 3D0RA 5EMMA 5JC8A 4W6QA 5ECGC 2D5CA 4LZLA 1P7PA 4ZVLA 4LKOA 3CTPA 1MENA 1XEXB 1ODIA 4YMUA 4YT2A 1U0LA 3DE7X 3BMOA 3PCXA 5IWAB 3GN2A 1T5OA 4N8DA 2JIOA 4Q1CA 2FEWB 3FG9A 3VJLA 2BTEA 1A4UA 3K9WA 3LQYA 1PQ4A 4M3MA 4ND8A 4EO4A 3ZN2A 4ZTBA 5JJKA 3R7BA 3KFVA 2YW2A 3LW8A 4JC0A 8ABPA 4XH9B 2B21A 2ZIWB 1Q91A 5KYUB 2X4IA 5FJJA 3U19A 1YQTA 4KDFA 4X1IA 3PGLA 2FEKA 1I4TD 2E4VA 3GDGA 4BLOA 4F8JA 1R9MA 1U6JA 2ZPUA 3NFYA 3C3AA 1BVUA 4M8IA 4D0SA 1GKLA 2D1QA 1MDFA 3BGDA 2F2TA 1QR2A 3VH1A 4ESHA 1I1QB 1RW4A 5LD2B 2B78A 4XYBA 2H16A 1ONBA 4QUBA 5IYZF 3H16A 4M4SA 4KGDA 4ZQEA 5ALUA 4E70A 3JZDA 2F1IA 1XRRA 3M82A 2EL7A 2W20A 2CNWD 4C89A 1COZA 3BMQA 3HYLA 4CG0A 5ERYA 2LCFA 2G4VA 1I10A 3BS4A 3DZKA 1S2GA 1WRBA 2I6SA 1EUDA 1SCUA 3GLHB 1V9CA 3CPHA 2RHHA 2ZJZA 4ZCQA 2P3OA 3KVYA 3ZXSA 1Y1TA 1TKAA 5I7AA 4RM2A 2NUTA 4D82A 2RH9B 3T35A 4V0KA 4ZI7F 2WYVA 5CA1B 3SZGA 5A4AA 2PUJA 1ZH4A 5F9MA 1UJ5A 3PFIA 3AY6A 3UVEA 1GU1A 4TTPA 4R1MA 5D5HA 1PQWA 1J2UA 4YBZA 4BZPA 5JXIA 4CLOB 3LXUX 3HGTA 5DV9A 4ZQBA 1DIGA 5DBHX 3ZHQA 3T7DA 1OAOC 3CLSC 1IVCA 3KVOA 1T2FA 1ZIXA 1UZMA 2G6TA 2AXNA 4ZLRA 1O89A 3QW4B 5F3RA 1NN0A 2AZTA 3VYTB 2FPIA 4FSDA 1JFLA 1GO2A 1GPUA 2DH6A 3B60A 3DQQA 3DYIA 2F48A 3VSDA 3WO1A 5EJ5A 1KRWA 3A11A 4X6YA 3FDZB 1Q1NA 2I7DA 4D4KA 3A25A 2F24A 1M1XB 1NW7A 3EXHB 3UANA 1CHNA 2PX5A 1E1NA 1L3IA 4Z4GA 3UAXA 1ECLA 3U1BA 1TT5B 1CG6A 2C2KA 4LGMA 4TWIA 3LCCA 4H7JA 4XCVA 1JEAA 1FYVA 1U98A 3ROZA 4BKRA 1MO3A 5LDHA 4I8IA 5CCDA 2OM2A 4NR0A 2OAP1 5THKA 4EJSA 1CRZA 1UOPA 1VYTA 1W5BA 1B8NA 4L8VA 4BNZA 4WK2B 1X70A 3W5SA 3GRZA 3SNKA 5L7TA 4MZAA 1H5NA 1KI3A 5ALNA 2X0EA 4K6FA 3AETA 1T6XA 2D3TA 3KQMA 3CPJB 3PTZA 2Q29A 1M5TA 1M83A 2B6HA 1SXJB 2H1VA 4G86A 4JSTA 5IUKC 4AN4A 1YUMA 5EIBC 2IHYA 3MOSA 4QJ3A 4PGFA 1WCV1 2X0FA 1C3XA 1PT8A 3P2YA 3HB9A 2XXAB 5IBCA 1YQ9A 3GNSA 4GUAA 2FPLA 3V4ZA 2GO1A 5FUXA 4ZEMA 3AF6A 5DMXA 3LX8A 4OJMX 5FBWB 2G5PA 2ZYWX 4HDRA 4F6RA 2F8SA 3IIJA 2PH7A 1POXA 4HMOA 4GNAA 3CNNA 1O2DA 1YVDA 1YDMA 2OCDA 4RD0A 1QQ7A 5DBIA 4BMOB 3C70A 4GMDA 4IFJA 2P79A 3ENNA 2V58A 3B1XA 4A16A 1U7TA 5FL7D 1LTKA 3KEOA 1KO1A 1YD7A 4KQ2A 3GUYA 3E03A 4IZHA 4CR7A 2GVDC 1TUIA 4NMXB 5DGTA 1AKWA 1HZZA 2HZBA 3I2FA 1U0NA 1VKNA 2ROQA 2MYTA 3DMFA 3KTDA 1XLTA 3QVLA 3VH4A 1SIBE 4O2RA 3VR6D 1FSPA 2GMWA 5CMLA 3OUZA 3K2QA 4V38A 5ADUS 1QYRA 2WD7A 1CY4A 1E8DA 2C0PA 1C8LA 2JVKA 3EGEA 4WA7A 2PJDA 3FGNA 1QV7A 3TCKA 1H1LB 1EFKA 1SQFA 2OAGA 1NMYA 3MJFA 1ZUWA 4FHGA 4MWGA 4D4IA 1J9ZA 1FDOA 1Q12A 1ZUIA 4IQKA 4GGPA 4NYMR 4XWAA 3WGLA 2VP5A 5K2MA 1YL7A 3G2PA 5AIAA 3JSXA 3I1IA 4LJ5A 5HGJA 3BMXA 2QU7A 4IVQA 4JOBA 3PWSA 3VDMA 2DRIA 4B85A 1NRIA 2O7RA 2ERCA 3UWMA 5KWSA 2AOWA 4HNVA 1WNFA 3TDNA 2I4LA 2VDMB 1XZNA 5HYVA 5D3ZA 2OAEA 3F6BX 4PAOA 2UKDA 3R7WA 5E0OA 3F7OA 3SJZA 3SJUA 2EF1A 3RYHB 3VO9A 4EGCB 3SVZA 1EUTA 4ZOEA 1YE8A 3GW8A 4FGJA 4N5IX 4LHYA 1E6CA 1RQLA 2IDMA 1MR3F 2Q2QA 3BH0A 3HXPA 1U0RA 2E6UX 1OVMA 3N70A 3AR9A 3O8QA 4KAFA 1I24A 4U2CA 2H4HA 1BMFD 5F3DA 3UTCA 2WKPA 1I4LD 3PC8C 4JENA 4AMUA 2EFHB 3THYB 1YCHA 1BQ3A 2O8NA 3MUNA 4NOJA 4TT3D 4X60A 3UT0A 5LLTA 2Q4BA 5F4ZA 5TE9A 3VKHA 1S9HA 1V7CA 4YW3A 1E3SA 4GZWA 1E4OA 1KA9H 2ZBUA 3C3EA 1TO1E 3LYAA 1I1HA 2W48A 1GL7A 5E7QA 2R66A 5DM4A 3CVXA 3IE0A 2N1MA 4L3WA 5EIEA 1S01A 3UHPA 3ND6A 2NZXA 1TIBA 2C42A 4MYUA 3GLQA 3TD6A 3IEXA 1EB8A 5EY5B 3ESRA 4J0FA 1QR6A 1KAGA 1TPZA 2XMQA 3B1KA 3GUUA 4FMCB 4YMIA 2BKVA 1V47A 4DUYB 1NM5C 4CWAA 5EIFA 1UH5A 3QFSA 1EFVA 3AV3A 3BICA 2DAPA 4G6ZA 5CGZA 4XMIA 3A3YA 5AOBA 1NMSA 1Q57A 1BJKA 3NS7A 4AI6A 3KPVA 2VK7A 3CLVA 1XDWA 5HDQA 3TLYA 3DXXA 5BWOA 1ZH8A 4QQNA 3DDCA 4D99A 2FJ0A 1M1YB 2HA6A 4RXTA 5REQA 1I1NA 2EV9A 3GGJA 5F2KA 3IQWA 4FZVA 4RACA 1NW6A 2OVFA 2YDTA 2IEDA 3LFTA 4FNAA 5T4FA 3LE8A 4YECA 4NPHA 1HDOA 4E88A 5K8UA 4BPBA 4AP6A 4M9QA 4J0IA 2Q8QA 1SXIA 2HADA 2VSKA 3CVJA 5H3CA 1AMUA 2GGSA 1A4XA 3DMNA 2V7XA 2X8LA 3GCXA 3H3XA 4RA9B 3NW9A 2V1XA 3D7SA 3B82A 4PAGA 1J70A 3RRFA 2P9BA 2PUDA 1FTWA 2G8SA 4PV7A 4CNBA 3UJ9A 4JMPA 2JAXA 1D03A 2JEZA 4Q4JA 4AGTA 1J39A 5ADHA 1MN6A 3O3MB 4E31A 3HSKA 4B46A 3MUFA 1UDBA 3L07A 4MW5A 5AM5A 5LB4A 3HEBA 4G07A 4FFSA 2WZQA 3WK7A 4DSOA 3GUVA 3GJRA 2Y66A 3QWAA 5E6RA 2WFMA 1Z13A 2Q6LA 3SALA 1LTQA 3U7IA 4F7DA 4DMGA 4OHOA 1XAGA 1WDKA 2JH8A 1NURA 2Y1WA 1WNTA 3QOWA 1NLZA 5EHNA 4PLFA 1G21B 2YHSA 5KTRA 1F06A 3IMFA 2AG5A 5EWMB 1PAUA 3PFHA 2XE6A 4Q19A 4BGUA 5ITVA 4MYDA 3WLJA 4TKVB 4TWJA 1DIBA 1XNJA 1YGPA 1XT6A 4HATA 4FPFA 4ZT4A 1O5TA 3S2EA 1ID1A 1Y98A 3E3OA 4MIOA 3EVBA 4KOEC 5CB0A 1ORWA 3OPYA 3R5KA 3PLRA 1W6UA 4TSRA 4YR7A 5B3JC 5GTDA 5C4MA 2B8JA 3WL8A 4KDRA 1Y3BE 2ZQZA 3LT0A 1I33A 3TQQA 1OGYA 3MN1A 4D45A 4LBZA 4DM3A 2FRDC 1Y4SA 4WEGA 1QAOA 2BGLA 3DBHA 3HSYA 1CQWA 4HXFB 5JH7F 4PAMA 1K9SA 3MS2A 2Z30A 1G38A 2GO7A 2ISSD 2NIPA 1ODFA 1X7XB 1S2DA 1VG1A 1R50A 5D2CA 4B6FA 5A3QA 5BUSA 2G9NA 1T9ZA 3C6MA 4XSVA 4JYAB 2J5QA 2WLSA 3AR8A 3HVHA 3KOOA 3M4ZA 521PA 5LR6A 1JWBB 4F3TA 4N1AA 4DWVA 1V2GA 4J8PA 2A3RA 1S0JA 1JTVA 1KVQA 2WW8A 1C4KA 2XXJA 4WZBA 3LKDA 3RHFA 3HM9A 3QX7A 4Q3DA 2XCOA 3DLTA 4TWZA 2DC1A 2GCPA 3ANNA 3H8SA 4E12A 1P6XA 2F7SA 1N0HA 1DIOB 3WTBA 4DJAA 3JATB 3E8SA 1P2BA 1N3LA 2DHRA 4F1JA 5JCZA 5DYNA 1QF6A 4UHJA 2YZ7A 3DVLA 1JVNA 3FBWA 3DZBA 3LUAA 5A1JA 3X1WA 2BEUB 2GBCA 3ICVA 1L8AA 2JFGA 3OJXA 3NRJA 1G3MA 1EE2A 2Q5HA 5HOQA 3TI5A 5H16A 2X5NA 1JW9B 4RC9A 4BQFA 4K6HA 1IBCA 5C3UA 2I1QA 4F1WA 3A6FA 3DQZA 2NO0A 3QU2A 1IN1A 2YH2A 2PBFA 1NVTA 3KQLA 1W19A 3EZLA 4XYGA 1AM4D 4JKOA 4MWRA 3H6KA 3OZDA 1JMYA 4HDKB 4YALA 5EP4A 1K5DA 2NTJA 2ONKA 3FPLA 1MAHA 2HIGA 4N7MA 4PSVA 3GD5A 3AU9A 3FDXA 1R0RE 2LXNA 3OX2A 1CW2B 3SX4A 2H48A 2O9JA 4IM7A 1D6SA 4TZTA 3KB8A 4NBTA 4AECA 1ZNXA 1WJGA 3MINB 2FPWA 4J0QA 1OQAA 1ZOOA 4N41A 4OJTA 3DMTC 3K09C 3JSAA 4Q4HB 5IJ9B 1OYWA 4J16C 4GFDA 1FXWF 3JD0A 4HNSA 2R6DA 1T9KA 3OOWA 2HJVA 3ZGYA 5KU1A 5CCEA 1QPBA 4BX8A 2D54A 1CNFA 2AWOA 1NT4A 2ZCVA 3K94A 3UUEA 3PJDA 3RGGA 4PYNA 4B2LA 1L3CA 2VNSA 3IIMA 1M1UA 1NA5A 2QS9A 4N3GA 1P5HA 2R8YA 3KYDA 1YZLA 4MDYA 2OFPA 4HADA 3ZZ1A 1MJ5A 2X4DA 2FQXA 2GRJA 3E3AA 3EDMA 1J0CA 2FRXA 3AH8A 4FEEA 2GN2A 3HUFA 4GD3Q 1PX2A 2GVNA 4KEAA 1ISHA 4GGOA 5ITZB 1NC3A 3NTUA 3JU4A 1DKPA 3KETA 3K2EA 3R5JA 5A7FA 2AZMA 3DQPA 5TV2A 5LQJA 1G1AA 3INTA 4I4NA 4RXUA 1WEHA 4DC9A 5HUGA 2QDKA 4YXFA 1O9GA 3IAM1 2A9KA 3WJ7A 2OORC 1PLKA 1PJSA 3IHKA 1TOAA 4R2MA 4ONEA 3UCEA 4O4LF 4K1HA 1TYEB 1NBAA 4BS9A 2HK8A 3KT0A 1XTUA 2WB2A 4NVRA 4RV5A 1W4ZA 3FOWA 4QEKA 3A3PA 2XE8A 3EASA 4WTOA 2QUJA 2CLFB 3GJYA 4BQPA 2P4QA 4D0NA 2ZU6A 5BN4A 3GH1A 1E8VA 4PTYA 4C4XA 1A9SA 6NN9A 1Q2XA 3R20A 5FAXA 1YDFA 5B6IA 1N6HA 2P9QA 1T0JB 4XDGA 3NC0C 5AVZA 2ZSHA 3D7KA 2PGLA 4HNGA 3TG8A 4H7EA 1V5EA 1SUCA 1VL0A 2BSXA 2FHSA 5KKAA 5B3KA 4XQCA 4CKEA 4AX8A 3PVCA 4P5EA 3RU9A 2LZ0A 2ZUEA 4RKWA 3TDMA 1M6HA 1D2AA 3HM2A 3FNEA 1Q0TA 1LNZA 1V39A 3MTAA 3WYAA 1DX9A 4M0KA 4M0FA 4UC0A 1SOUA 3D02A 4PCVA 1PTJA 4LTNA 1BMQA 1Z12A 3DBOB 4DJEC 4NMWA 2UXCB 2OCKA 4GXTA 3R3SA 4XUDA 4DTIA 5AHKA 2QTRA 1SVMA 4PWZA 5FZJA 1L2TA 1RWLA 2D1FA 1SA0A 1CEXA 4S1PA 3GMTA 3U37A 5EMHA 2C5EA 1KYZA 3BE4A 2QK4A 4OBXA 2MSKA 2ZB5A 4UXJA 1OKKA 2FPSA 3T54A 5IDYA 5HIMA 4Q34A 4RJLA 3QVGB 1NKTA 3ETGA 4RU1A 4C30A 3JQ9A 1PV1A 2UZ0A 3HP1A 2IAPA 2Z2IA 4N3BA 5CVTA 2VW0A 2MYPA 1DXOA 4KFTA 5EJIA 2QTAA 1ECCA 1M33A 1YUNA 3N8NA 2P9EA 4MKXA 1JHDA 1CRQA 1WV1A 2MOKA 4FJ6A 3BRQA 1USVA 2DFLA 3JPYA 4ZYLA 1LX7A 2D2EA 1UIRA 2C0CA 2RHOA 3O73A 3PC3A 1DWQA 2YYYA 1KXJA 3BGIA 1IJQA 4ZGGA 3BJEA 4O4IB 5I9LA 2MDTA 3CE6A