2IVZA

Structure of tolb in complex with a peptide of the colicin e9 t- domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
397
structure length
392
Chain Sequence
b'GRPIGVVPFQWAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TOLB
publication title Competitive Recruitment of the Periplasmic Translocation Portal Tolb by a Natively Disordered Domain of Colicin E9
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/hydrolase
total genus 109
structure length 392
sequence length 397
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2ivzA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2ivzA01
2DSOA 3SOVA 2IATA 1QBIA 4GNBA 3P5BL 2V91A 1C5KA 4JMLA 1V04A 5FWWA 3Q6TA 3O4PA 1QLGA 2GVUA 5GX4A 3V64C 4IMBA 3A9HA 3LI4A 2IAWA 5D9BA 1CRUA 3AMRA 5D9DA 5GX5A 3DR2A 3A9GA 1E1AA 3G4HA 4HHOA 4GNCA 3E5ZA 3HRPA 4IYGA 4GN7A 2IAVA 3LI3A 2VAQA 3Q6PA 5GX1A 2IAPA 2G8SA 1Q7FA 3SOBB 2GHSA 4HW6A 5D9CA 3SRGA 3TC9A 2QE8A 3G4EA 5EX7A 2FP8A 2GVVA 3HLIA 4Q1UA 3Q6KA 1RWIA 4A0PA 2P4OA 2POOA 5GX2A 4R40A 1NPEA 2OJHA 2FPBA 2IAQA 2DG0A 2IAOA 3SOQA 2W8BA 3KYAA 4O5SA 1H6LA 2HQSA 2GVWA 3AMSA 3S8ZA 3S94A 1IJQA 3KGGA 2DG1A 4GN8A 3FVZA 3V65B 5GTQA 1CVMA 3V1SA 2W8BB 1RWLA 5GX3A 1PJXA 3DASA 2IASA 3U0SA 2GVXA 3HLHA 3FW0A 3SREA 4ZLRA 4GN9A 3IAXA 4O5TA 4DG6A 2IAXA 1CQ1A 4PWZA 3LI5A 1C9UA 1POOA 4HHQA 2FP9A 3WW9A 3WWAA 3I1CA 3BYCA 3S2KA 2IAUA 3S8VA 1CRZA 2IARA 2ISMA 2IVZA 2FPCA 1N7DA 4GNAA
chains in the Genus database with same CATH superfamily
4FSHA 1XELA 1DG9A 3N0XA 1Q1ZA 3E53A 4BNZA 1LJ8A 3FPBA 2V59A 2D2VA 5ALRA 1CR4A 1I4EB 1OZ0A 4CKWB 5JPIA 4OHCA 3WL3A 1WXHA 1HYBA 6REQA 3TGPA 4GS5A 4L7BA 3UAOA 1SCBA 2G80A 4JB3A 4TLMB 4B4DA 4CT5A 4MRVA 2NAPA 3RSCA 1JDJA 3BQ9A 2WAXA 4D4GA 4ZPXA 1BE0A 1D4ZA 1GHTA 1T1SA 4WZZA 5JXIA 1A95A 5D7NA 1DQSA 5CNKA 3EQ2A 4DKXA 3NLLA 2GASA 3DDHA 1CEYA 3SKYA 1VB3A 3A9GA 4TT8A 3L4JA 3KR9A 1G5PA 2DQZA 2XT6A 3L6UA 3N8DA 1PG2A 3OF5A 3PGJA 5LDGA 2YRWA 3LLCA 1IVCA 1V9SA 1JAHA 3MTGA 5IZCC 4M0DA 1AMNA 5LLSA 1MB3A 2VT7A 2QLBA 3CBQA 3F8SA 4M1EA 5G0WA 5K0NA 2GN6A 3HS3A 4K2HA 3JZMA 4HLNA 4PYNA 2CUNA 4M8IA 2P6OA 4L73A 4EQ6B 4LYHA 4DN6A 3DTYA 4RLHA 2EERA 5AUOB 3PXEA 4TL7A 4N1BA 4YVFA 2VDRB 5LOVA 3LGXA 3JY6A 1W20A 1DTEA 4YN3A 4M9UA 1NM5A 3E1SA 3RAFC 2XUGA 3ENWA 3RC8A 4I4TA 4K9PA 3RS9A 2YNMD 4FNGA 1HZZC 1GA1A 1K8XB 3HLIA 5JC1A 4AICA 4LCEA 4IHJA 4LK3A 3QEJA 1NP7A 3CMMA 1OB2A 2H7XA 3TR5A 2ZGVA 1NYRA 4L4RA 3M34A 1O97D 1X1SA 4OYRA 3CB4A 2D7DA 3MIZA 2WFZA 1YHNA 3BRCA 3M6FA 3MT8A 2QJWA 3NC0C 1RLMA 3WGQA 4MYRA 4DBLC 1JT9A 2R7MA 3AF0A 2O3TA 1PX0A 2G7ZA 2B37A 1T9ZA 2HIGA 4HI0E 2BE7A 1KRHA 2ZRBA 2ZSDA 3TTWA 4PR3A 4QTYA 2QWAA 1DIHA 4WNCA 5JE8A 1WP5A 3MFYA 4AG6A 3V65B 4HH4A 3V2UA 5JRDS 3GLHE 5I7RA 5DIFA 1XHFA 2C2GA 2DF8A 2BGGA 4RAQA 3PTAA 3R8CA 3T5TA 1Z7BA 4MA4A 4PZUA 4WFQA 1KMQA 4WXPA 4HFJA 4FN5A 4X93A 5AVOA 4QZVA 5G0SA 1W48A 2BM9A 2CF6A 4LBVA 5CPFA 5F3DA 4P7JA 4BBJA 4KVFA 4C3OB 1Z13A 3OCCA 5D3MB 3L7AA 5TF0A 4X3CA 1IZ8A 4DLUA 3IR6A 3BWEA 4GR5A 4LZAA 3KLNA 3G2LA 3EC7A 1H6DA 3MCWA 4FC6A 4GDMA 4R98A 4YHBA 1MORA 1YQ9A 4HH0A 5ETJA 3T8YA 4AKGA 2CHGA 1ZD2P 2P6NA 3RCBA 1A7AA 4HY3A 1DJLA 2HGZA 2XQFA 1JHQA 2GBGA 3L9WA 3NPMA 4AKEA 4F5ZA 4YMWA 1J9ZA 4TTIA 4DZRA 3KHTA 4MX0A 5LB4A 3PE6A 5FTLA 1Y5IA 4DDTA 4CDNA 4KXWA 4JI8B 4DYVA 1IULA 3C3MA 4UM5A 3I6YA 3RSSA 2X8BA 3TMKA 4B6SA 3E7PA 2WP0A 1TEXA 4FP3A 1QUEA 1I4LD 2DULA 2RBGA 2PUGA 1XMXA 3RSLA 4EPYA 3AVTA 4X92A 3F98A 3H3XA 1D04A 1N2ZA 1NRJB 4OI0A 2HKIA 1C7QA 3LBIA 1XCGB 3NTRA 3PZRA 4LQDA 1TJNA 4E1VA 3I5AA 4IUBS 3K9NA 2HA2A 3HWWA 3QW2A 1TTTA 1ZXBA 3UTCA 2HSZA 3EIFA 3B8HA 3KKNA 4OOFA 3HUTA 3JQFA 3PV0A 1WRBA 4GOXA 3IBTA 2E7ZA 4OMUA 2EBUA 1CFZA 2GNAA 2HBZA 5FNQA 1MVOA 2A67A 2FPRA 4AF8A 3U09A 1PJ8A 1J7JA 2C2HA 2WAOA 2GJAA 2WJPA 2YCBA 3LPLA 3N7TA 3OLVA 1VI6A 4DADA 1XMQB 1SAYA 3UCEA 1EH5A 3H5AA 1IEVA 1N25A 3I4LA 3SSNA 2HLDA 2NAFA 2CZQA 5BSUA 4BEBA 1D7OA 2GJKA 3GRPA 4G1BA 1NJ5A 1CUAA 1NXSA 2F43B 1FXSA 3NU1A 3RWBA 4BB5A 1U8FO 2FPSA 5F12A 3NVKI 1NNI1 1YZ3A 5EMHA 5BV8A 1ZXXA 5C3UA 4QA9A 4I55A 4M6WB 3D8BA 3GJ7A 5KYXA 5CB4B 4A5SA 1NVDA 2Q1XA 3DVAA 3NWPA 3ZE8A 3BIWA 1BGXT 2QVYX 4GP9A 3EVGA 1JHVA 3BVPA 1LKZA 4AUEA 1UCFA 2D0IA 5CU7A 4C6SA 4J1SA 4F1KA 4H1UA 4QOJA 1MO6A 5BYAA 2NADA 1R8YA 3GVIA 3OT1A 4BV8A 2HMSA 1JIKA 2B1IA 2QN3A 4WY5A 4Q9JA 3G5UA 2VQ3A 4JOSA 4CLRB 1RXSA 1ADGA 2EZUA 2YR0A 2ZYSA 3H6GA 3O31A 4QFDA 4YT2A 5DN6D 2OK7A 4Y7DA 1ULSA 1UBTS 3AUXA 1IMOA 4FDLA 4PYMA 5IS2A 4YR9A 1UC4B 1KQFA 3IP6A 5AVYA 2B9EA 1QZ3A 3O4RA 2HO4A 1W8OA 3DZGA 4MQEB 2HWKA 3KP1A 3ZXUB 5I7HA 3E8XA 2I0FA 4P82A 3I73A 1XTQA 2PJRA 5FTKA 1NJ1A 3K09C 3GQBB 5J2UA 5PNTA 3CX3A 1P2VA 1D2GA 1S1DA 4KRXA 4UBJA 4FP9A 1UMCA 1IXZA 2PZLA 2Y1KA 3MMZA 4L7CA 1GA4A 3FAZA 4IV8A 4K6HA 4RWEA 5J2TF 1ZOIA 1TZMA 2ATXA 1VIAA 1YVUA 1B6SA 2VS1A 3G17A 5JSZB 2PQ2A 2COUA 4PX5A 3RF7A 3KXPA 1SU8A 2XKBA 1Z7YA 3HDJA 2FOXA 3WE7A 4CJXA 5EAIA 5EJ2A 2OAQ1 2V6IA 2R00A 2VSXA 2F9FA 3TI5A 2Q1TA 1RVV1 4XLZA 5JTTA 5DNEA 5F21A 1KRWA 1QC5A 1W9HA 2G04A 1UJMA 2XMPA 3FHJA 5EWJB 3BAZA 2H4ZA 1BD3A 1Y6FA 4C06A 1R0SA 1K75A 1IVGA 5LVAA 2WJYA 2IH2A 1CRZA 5GP1A 3PVCA 1P2SA 3B20A 2BR4A 2IYSA 2WWIA 3MG9A 4P83A 5AI4A 3ZE9A 4D6XA 3O8DA 4C4SA 3DB1A 5KINB 1TF5A 1ILEA 3A9UA 3L8GA 2FUG6 3EGIA 2XZDA 3ODPA 2VZ8A 4H7IA 4HZUB 3U3OA 2R4QA 3P9QA 4Q3CA 1M1YE 3UT6A 2XEXA 3X1XA 1W85A 1QANA 5LPNA 2IYOA 1KOJA 3WL6A 5F3RA 4YCDA 2PN1A 4ZI2A 3IVMA 2D5CA 4IIJB 5GONA 1PN3A 1VPDA 4ER5A 5AVTA 1DKNA 4FYYA 4NAHA 1QIIA 2XDQB 1KTVA 4F04A 2TMGA 2SECE 3LT0A 2H4HA 4K7JA 1E3WA 2J6CA 4WVLA 5CFZA 2BEWB 3IR7A 1QOZA 1CUCA 1HTWA 2C03A 2R97A 1UFQA 4YJGA 3BXFA 5BR1A 3KNZA 1Q15A 3MCVA 5GZ6A 2DTXA 3O73A 4DGQA 4Z7JA 5ICCA 3AIKA 4JJGA 3C97A 3PEYA 2HCBA 3GLIE 2VH1A 3EIUA 1DILA 4Z7OB 2ZTSA 3ISVA 1QGAA 5CEFA 3DR5A 3RUEA 4X47A 4IFJA 3SEFA 4IUCS 3ZJTA 3IA7A 5LZ4A 4WNAA 5BO5A 2AE2A 4D3FA 1A9TA 3FBWA 2VBGA 5FPQA 4ZVUA 1AO0A 2R2AA 5FFNA 1NF8A 3UMBA 3T0GA 3GD7A 1LW7A 1QIGA 3TW4A 3WLKX 5FX2A 5LDHA 3QVSA 2FMHA 3QVLA 3RAPR 1OF1A 1YZKA 4MR9A 4X1YA 2P0AA 3R2JA 4BAUA 4B31A 4EKGA 4OUKX 4HZYA 2WLSA 1RHRA 1UFRA 3JAWB 2AYXA 3N05A 2HUNA 4Q00A 4U2BA 4LSWA 3TW0A 1N3LA 1U0HC 2EVWX 1PKXA 3N7AA 4HAVA 1SR8A 3MD0A 5HMMA 5IAAA 2R6GA 3G9ZA 3PHGA 3K20A 3A3PA 1XVIA 4URUR 4OMFG 5FLXA 4C6TB 4EAQA 1R0XA 2PGDA 2HDWA 1OH6A 2E87A 4LF8B 4HDRA 3ANNA 3CSDA 1DE0A 4J9VA 3EC2A 2P40A 2Z4RA 1BC5A 3FB4A 4ZZ0A 3LT1A 4ONEA 4M8SA 3CRVA 5EJ8A 3O2NA 2FUG1 1L4KA 1MJHA 2JK1A 3N8NA 1JE0A 5AKLA 1AKVA 3BH7A 4E11A 1NT4A 5FNVA 1IEWA 1NJ6A 3PXCX 3FHCB 2BF6A 2XCYA 1DRKA 1RJFA 2MR5A 1YZYA 1SCNE 2ISSD 3EISA 1WR8A 1CQXA 4UKDA 1SHTX 1EGHA 3I2FA 1HO3A 2C7VA 2JLCA 3L5KA 1QFYA 2BATA 3MSXA 3B6EA 3B5EA 2C3OA 3ASVA 4O8ZA 1Z4KA 1U3FA 1JHXA 1PJLA 3DE5X 3BE6A 1KMHA 4P33A 4XD2A 3AL2A 2WU1A 3GZTB 5DW0A 3D6HA 1CJTC 4LF5B 1F7UA 1YQEA 2OA0A 2O4CA 3IP7A 4BNGA 2V7VA 4CKWA 1TX4B 4OATA 2ZXUA 3L8FA 4UNIA 3JQEA 4F6LA 3KXLA 2GYUA 1JJIA 2FUEA 4Y7CA 5A0TA 3H99A 4PN3A 3QNUA 4RF4A 4I4CA 4YRAA 1DCTA 3AL3A 4P31A 3VSCA 3ZE2B 3HXKA 4DEVA 4E1AA 1JFSA 2WIKA 2Y71A 4KPUA 1DBSA 4IZIA 5CGQB 4ZVOA 3HJRA 4PC1A 4V39A 3RAEC 4OJKA 2Z9BA 4TKZA 2O4UX 5ICGA 1M6NA 3O9ZA 2PZBA 3TLAA 3C5EA 4HNSA 3PWZA 1YC5A 4B7MA 3EQZA 4RIGA 3RLIA 4EP1A 3BXPA 1T1GA 2FG5A 2HLNA 5ALEA 1U0FA 4KV9A 4KPFC 4FQ5A 2F29A 3A05A 4LDPA 1GPMA 2WMNB 4QDOA 3PPYA 1E99A 5KHLB 1JXQA 5CK4A 1LZKA 3FRIA 3G0CA 1BCSA 1DAGA 3DFZA 2P3LA 3K9BA 3ZZUA 5JNTA 2OQIA 4ZYWA 2QX4A 3GCXA 4D4KA 1KH2A 2XJ4A 3BD6A 1Y3BE 2DQKA 3DYBA 4MWWA 2C4KA 4HMOA 1TUIA 4JLDA 1MQSA 2CXHA 4JHXA 1IM2A 3RTGA 3VNBA 4EQ6A 1I7LA 1VHLA 4R3UC 2GCIA 4HV4A 1EXDA 1BKYA 4G4GA 4JUBA 1EUQA 3TQCA 2BDEA 3AUUA 4GMXA 4U6NA 3EJWA 3T95A 3VO1A 4N48A 1RWBA 4ALJA 3QE0A 3T34A 3ZNPA 1G5TA 2HU2A 4BEJA 1O8CA 2RIPA 3FR8A 1R5OA 4UNQA 1DQYA 2QRJA 4L5IA 2G70A 2ODEA 2GBPA 1NBIA 2H51A 2JEOA 5LZ2A 4CKYA 3ENZA 3CUSA 5D5PA 2A0XA 1Z6QA 3D3QA 2IZ5A 3LDHA 1QH1B 3MT7A 4QN3A 3A70A 1GUAA 2DY1A 4PO3X 3ZK9A 5I7UA 1FP1D 3RRXA 1JX6A 2IZ7A 1E7SA 1IQRA 1V8BA 1PW7A 2PRZA 3KUKA 1MDBA 5FWDA 3CNNA 3KJXA 5TLSA 1WXIA 2EBHX 4BO0A 3L06A 1FA9A 3JWIA 4Z4GA 1XC7A 5LD2C 4JVNA 4URVR 3SDBA 1AUXA 5CVEA 5B64A 4C07A 3V1LA 1P5HA 5IASA 4RA6B 1THTA 4BWYA 3AKYA 2OCAA 4W7IA 4BASA 3VR5A 3O3OB 3NSSA 2ATIA 3ENQA 1K6JA 5ADUS 1LQTA 2W6NA 4QOEA 2AKEA 4GP6A 4LHYA 4QN7A 3QJYA 4G9EA 3DNMA 2WK1A 4FHDA 4YW5A 1D6NA 4J9TA 2WPNA 4XWGA 1JSXA 3PQDA 3O2QB 3JARB 2R8XA 1G1MA 5D3MA 4DRXB 1GD1O 2A3RA 1VLJA 4BLQA 3I8OA 3MUEA 3ETGA 2NSDA 5FBRB 4BECA 5EKXA 2JLWA 3FYUC 4XJUA 5B12A 5CT8A 2NSHA 3H75A 2JJ1A 5ALMA 4NN9A 3U17A 3VVLA 4LZZA 1QZXA 5C1PA 1VB5A 2EWWA 2MSLA 2HU5A 2FVYA 3LX8A 1RZVA 2HIHA 4GQBA 4Y98A 3WHIA 3GV0A 4R1TA 3IIIA 4YECA 1OR8A 3PUZA 1D6MA 1HEIA 3ROKA 2NNWB 1KYTA 2LCQA 2Q1WA 4KWHA 3TNFA 3V8NA 4W8GA 2OT3B 1ZMXA 1FJGB 4WKBA 1JSZA 3U0VA 3SQDA 5KTOA 2AZXA 1GG2A 3TSZA 3TI3A 2FDXA 3P9XA 2RI6A 3OZGA 2UV8A 5T57A 4EHDA 1G7SA 4HQ6A 1IG0A 3EZ2A 4ZDJA 2BDTA 1LNZA 2DKOA 1LU9A 2HK7A 3HPRA 4C4AA 1Z39A 3U4CA 5SZIA 4BFWA 2Q5QA 4UHEA 2OD2A 3IQFA 2VSQA 3PXXA 4G37A 4HFMA 4L3OA 2ZI5A 1A4IA 2EZ4A 3T3PB 3ZCXA 2ZKIA 4CNBA 4K88A 3OVMA 1SUSA 3I09A 4EMBA 5BUZA 2FR1A 3L5OA 4K6MA 2HCTA 4B34A 5D00A 1HDYA 1X1AA 2B6HA 1KKUA 4JSYA 1MC5A 4MA5A 3E0XA 4YP1A 4L7VA 2I4TA 2OV1A 1HOXA 3DT9A 3EBOA 5A3VA 3TN7A 4C03A 4XJZA 1M34B 4G0WA 4PPQA 2GCOB 2BMAA 3G7NA 2FW6A 1GZDA 4CTKA 2TYSB 1H5UA 1ZVVA 3T9AA 2F43A 3ELBA 1GP2A 5L3VA 4XE9A 2YVUA 3BMCA 2ATVA 2C2KA 2W22A 1OHHD 4QUGA 4BL5A 2Z32A 1IY2A 2P77A 3HCAA 3MWKA 3SVTA 2V7QD 3HHEA 3ETJA 3LXMA 4M6WA 1QDLB 1RWVA 4WKPA 4FPLA 2AUMA 1YO6A 5CB4A 1XMVA 1U1IA 4Z4CA 4OI4A 3E1GA 1YQTA 3KJHA 2YWFA 3OBIA 3PUKA 4WVFA 5LC1A 1H4VB 1A8SA 5B2FA 3NTXA 1DKQA 1NBEA 2VK2A 1CZLA 4YUVA 3EMKA 2GEKA 3OEWA 1O03A 1W6RA 1Z29A 3HVKA 1VHTA 2RAFA 1E18A 3AX6A 3LRTA 1W0JD 3RJ9A 1R50A 1ZOLA 2QI9C 4AP6A 1GCGA 5GY7A 1GPLA 4JOCA 4RS4A 1IVEA 3W7BA 5DP1A 3AXSA 3IOBA 4RVNA 5TQ0B 4CLRA 3JYQA 1CP2A 3RV4A 4UEOA 4P7GA 5C5EA 4EJMA 4ASCA 1KK2A 1ZK3A 1UADA 4MMZB 1GPDG 3FNBA 4PGMA 4XW2A 3MRSA 1YHYA 5IKOA 3V8BA 5IT0A 4EPWA 5E7IA 2NSJA 3KC2A 3QI2A 4KB5A 4RGQA 2E2WA 2O8FA 1CJKC 1Y33E 1JEEA 1QS0A 2X1MA 1L7MA 2A7QA 1BAPA 2FPOA 3VX3A 2REXB 2BSXA 1TEZA 2K6GA 3VBCA 4C04A 2XCRB 2AEPA 2IDMA 5JCZA 2QX7A 5P21A 2XTZA 1NTOA 3GQBA 3GPDG 3SOQA 3NP7A 1G64A 3HPQA 1AZLA 3K1ZA 4LDRA 1JL3A 1JDUA 3VPFA 1ANKA 1B43A 3B52X 3FA2A 4BLVA 4BHTA 2LDBA 5JASA 3S8ZA 2QUJA 3A8TA 3KGGA 4MP3A 4P5PA 1J0DA 4KI7A 3U13A 5A04A 3LUHA 3K1AB 1GZ7A 2QR2A 4CMBA 3AY3A 4N41A 5AHOA 2HREA 2PBZA 3PEUA 3MUOA 4W9NC 1I2ZA 3V8RA 5E7QA 4E33A 9ABPA 2J3JA 5E38A 2O0KA 3RSHA 1P7YA 1V8FA 4O59O 1X7DA 1SUDA 3B89A 2PUTA 1J49A 4NMHA 4RESA 4BNYA 5IJ0B 1HYEA 3PNQA 5EWJA 3KHKA 1ZRHA 1ZL2A 3B78A 3OQVA 2QYSA 4ZT6A 3RU2A 3R44A 3VOBA 1T3HA 5JRZA 4FT2A 1QBGA 4HO1X 4AW9A 1P73A 5EKUA 2BF4A 2IXAA 4QKQA 1SUAA 1T15A 4LY3A 1U98A 3C7KA 1SCDA 4MDYA 3ZK8A 4KXLA 3K35A 4HZUA 4U2GA 1A8HA 3C3WA 1CC1S 2P9JA 1OXVA 3KO8A 1FU4A 1WHSB 4O4HA 1VJ5A 1ST3A 1W49A 4EY5A 2KYRA 3I61A 2BKUA 2CFSA 3I76A 2Y1FA 1M74A 3ASZA 4HRXA 1PNTA 1U4OA 1PWEA 1VE3A 1F4PA 2XDQA 2FY8A 3A28A 3C8HA 3TI6A 1JHUA 4QWWA 2ZRMA 4RVCA 3M5WA 4M49A 2YA7A 1KEEB 2ZAGA 1SLIA 5K0BA 2XCLA 2DUUA 4FTWA 3K8OE 3TQFA 3AGPA 3E9DA 4P0TA 4EKIA 4QLBA 5FWXB 5KCZA 5F72C 4PO9A 3O74A 3B48A 5ILGA 5CA1A 4WCFC 1QPZA 3B3AA 2MMGA 2AI2A 3LCRA 4YQEA 3E05A 1R64A 3ZI7A 1L8XA 4AL4A 1GKKA 2R8YA 3WNZA 1KPHA 5HWSA 1X87A 3UUEA 3H3JA 3DR2A 2YHIB 1XAGA 4HS4A 1ABEA 3WYEA 1Q95A 4BV2A 3IBGA 3RC1A 1WDWB 5FIUA 3S29A 1NMQA 4G4SO 4PLWA 1FDOA 1XUOA 5KU1A 3AJAA 3UM9A 3NALA 4BLRA 4JLMA 5EXDA 1Z6AA 2BR3A 4L85A 5E4YA 5JNLA 4YFYA 5D84A 1BJRE 1E1RA 2C9MA 2YJZA 3EQ9A 3MN1A 4B80A 4BFSA 3O2JA 4DBZA 2AZTA 1C2TA 5BR4A 1IVFA 4RZIA 2NVOA 4W9RA 1QIHA 1K6IA 4NDZA 3MWDB 4ZP1A 5K8IA 3JAWA 1YJ8A 1MX5A 4NJOA 4F7DA 2P5TB 4P80A 4R1PA 1LTKA 5EVCA 2CWWA 1J09A 1E89A 1NGSA 2QI9F 3CG0A 3E8SA 1GARA 4MA0A 4NU6A 3W6NA 3ORHA 4G4IA 3TPCA 2ECFA 3AIOA 4BNHA 2DGDA 2H1HA 1PJAA 2J9FB 4OB8A 3K0HA 1X1EA 3II7A 2ECOA 2NO6A 3A32A 3RVRA 1M5TA 3CZMA 5AW9A 4EUEA 1CB0A 3EEIA 3KVYA 1F20A 3MMSA 4PQFA 4Q7QA 1RYNA 3NHUA 4WI1A 4RFVA 1AQ6A 2H0RA 3BGDA 4PYJA 3DR3A 1MENA 1SJ9A 2AHRA 1GPUA 3BEOA 4H52A 2IY8A 3QVJA 2HTVA 4HVAA 4ZRMA 3STWA 2X58A 1AK1A 3RKRA 3DBVO 1Y9DA 2BL4A 3N6XA 3I32A 4IH4A 3HSKA 4L27A 5GM1A 1IH8A 4E0BA 3K2IA 5ENVA 2DWQA 5HJEA 3W5HA 5DIZA 4DCOA 5I9LA 3KZKA 1KEKA 2QT0A 2PTGA 3IODA 3PC4A 3V4RA 2C92A 1U8UA 3E61A 4YCSA 4N0PA 1V0EA 4IIEA 2DWPA 4Z54A 4J4HA 1RWWA 1U5AA 3L1VA 2PT7A 3BCUA 1ZONA 1UMDA 1FTQA 3A4IA 4RVGA 5AVXA 5HUKA 1PVDA 2COKA 2Q3FA 1DC3A 3FHLA 4I5FA 3V4OA 3COYA 3CTPA 4LW8A 3SJCA 3F6CA 3PJDA 4JKIA 2O8EB 3OZWA 3ZH2A 1XLTA 2NQ8A 1USRA 2H2HA 4NARA 5G4KB 4FYVA 1KVTA 4HGYA 4YO8A 1EIWA 4RETA 1NVVR 2X76A 3U4AA 4CBVA 2X9GA 2XRZA 2CLEB 2HU4A 2N46A 1BVHA 2PIAA 2VEDA 1DKMA 2OGTA 3QRWA 2AN1A 1ZSYA 4G0PA 4BMPB 4MZXA 2CXUA 3GVHA 1GY8A 2CFCA 1BIFA 3HGQA 3PNMA 1Y9AA 3PUYA 2AK2A 1FCJA 3IQZA 2ZSFA 4I1SA 2QNBA 3TI9A 2TS1A 1Z0UA 4XVQA 1H9BA 2IPOA 3QX8A 2ZJAA 4U7PB 1UKCA 5CLQA 2NU9B 2AFIB 3FY4A 2LKDA 2YDTA 1RKXA 2O3SA 4L15A 5B7QA 1N1GA 3TLEA 3DP7A 1Z36A 4GB1A 2CFIA 4LXUA 4M55A 4W6ZA 2AJDA 4YASA 5K01A 4JZKA 3J80A 3EEYA 1QZTA 1YL7A 1E9AA 4DDWA 2X6RA 3FG9A 1IOZA 3OTHA 1WUJS 2XYRA 3HXPA 4N9WA 5IPFA 1TAUA 4CKCB 3S1AB 4O1HA 4KNYA 3FNFA 4AZVA 1H4SA 3AR4A 2CCJA 4RVOA 4PM4A 2VUSA 5AKZA 4OYYA 4D82A 1YCDA 3AP3A 4HK4A 1HKUA 3J7TA 1LSJA 4B81A 2JFOA 4UU8A 1BRMA 4BBAA 2GARA 2ZRCA 4WOJA 1AU9A 1U3DA 2C4NA 2X4IA 8OHMA 4J0EA 1SHZA 1MJ5A 2IP4A 3COPA 2BRUC 4C1NA 2B4KA 4QU9A 4HZIA 5HKKD 4R3NA 1NCDN 2TMKA 3B9PA 1QH1A 3RFFA 4HNGA 5C81A 3HFSA 4NOJA 3GP8A 3MHTA 3NKVA 3LPAA 1G0OA 2FG6C 4FPJA 3KD2A 3K73O 1CUIA 2BFEB 1YR3A 3GLFB 5FPPA 1G8PA 4NJEB 4IGEA 4NEHB 3UO8B 3VISA 2Q3CA 3BMQB 1DAOA 3PQ5A 1ACJA 5A3JA 1EFPB 3WBFA 4D2IA 4FZJA 4L8VA 3FGOA 4RK7A 2GHRA 4B2IA 2C82A 1XAIA 1SBQA 1OC2A 1J8VA 3LHIA 3W3AA 2DG2A 5IMSA 1ZGJA 2OSVA 3KM0A 1HTBA 4Y6QA 3VKUA 3AVVA 2C54A 1I1QB 2B1GA 3TB4A 2IXDA 4OXRA 1G19A 2I1QA 2X8AA 4RA6A 3OO1A 1MW8X 2ROQA 1H9AA 2COEA 1U02A 1FFAA 5F77A 2WWXA 4RZXA 3X2SA 1LBEA 1DQRA 1JFFB 1LH0A 1ZNWA 3A2KA 2GZDA 3I1YA 1NW6A 2CY0A 3JYOA 1LNQA 3LX4A 4R01A 4U0KA 4GNKA 3WKBA 1TRKA 2OKGA 2UZ1B 2W98A 3JARA 3BCHA 1WU7A 4GUDA 1HRKA 2QZPA 3PX2A 3PVZA 3KE8A 1VI5A 4NMMA 4ECAA 5G41A 4HLQB 2B8HA 4EABA 1H0HA 1Q11A 1WQ4A 3UK1A 1H3EA 4UTPA 2YMPA 3JATB 2EIXA 3WB2A 3Q2OA 1O4WA 5HA5A 4SLIA 1EFCA 3LFTA 1L5KA 4DIOA 4DLPA 2CCKA 1FLAA 4E1BA 4YMUA 1GADO 2YS6A 4U2CA 2HJWA 2Q0QA 3LRPA 1GQSA 3NHRA 4RD6A 2QNRA 1XK6A 2D5BA 3T1OA 5EY5B 2WSSA 4F92B 2AR9A 1PNVA 2EKDA 2EBWA 3CVJA 1W2HA 4G23A 3EYWA 3IP8A 3BXOA 3EGDB 3WDSA 4W4TA 1WZUA 2E0IA 1EJ6A 1S3FA 3B7GA 3D4NA 1DZIA 1RRFA 3CHYA 1AQIA 3V9AA 4DG6A 4RHXA 2VQSA 3LPCA 3MXTA 4DCTA 2NVUB 4M88A 4AG3A 1LLDA 4TLDA 3U31A 2PKQP 2PS9A 3FMGA 4JYMA 4KQFA 2V8BA 1DBIA 4LI3X 3V8VA 5A5DA 3HBLA 5T5QA 5L4SA 1LV7A 3ROFA 4EUFA 1KY4A 1VHJA 3UMJA 4CN9A 1VECA 1ENZA 4C2AA 1F6DA 3COWA 4EF4A 5I9IA 4JYPA 5IDQA 4LY9A 1OIWA 1M1NB 3R0VA 1XA3A 1KO7A 1OPXA 4Z0HO 5FORA 2QWIA 3NCHA 1E2PA 2W4MA 2GCOA 3AINA 2SKEA 5K8JB 2WJGA 2I03A 3KKLA 3QWAA 4G1FA 4OU5A 5FNSA 3RHZA 3M6AA 2A9QA 5F5LA 1W2WB 3UFXB 4UPEA 1H1DA 1UOQA 3MC1A 4BFXA 1IPEA 2CBZA 2O9JA 5ER6A 2JLRA 1EWVA 1RYFA 2ET6A 4OBXA 5JS2A 2ZYHA 3NT2A 3VR3A 2B25A 3A6HA 3VSBA 3OZ7A 3NHLA 4LDZA 4XUGB 5CMLA 2AB0A 3EAFA 3L4BA 3OMXA 2Q45A 2VK1A 4TV8F 1MR3F 3VR4H 1BHJA 3QENA 1MF7A 2F2TA 3AZPA 3I1IA 3DSRA 4LDAA 4OB7A 1RKQA 4UZEA 4WW0A 3VOSA 1MB2A 2CL7X 1ZNZA 3WK9A 4TVSA 1G8JA 2YQ4A 2YJ3A 2XYHA 3L04A 3LVRE 1D0SA 4YV2A 4A6PA 4INOA 5FPYA 2GA8A 3CX4A 5DHSA 3K9GA 3ND9A 2BD0A 3TRFA 1VTKA 5TQ0A 3NEAA 4N82A 3W77A 1R3UA 3RVMA 3CH5A 1Z33A 1YRBA 2IJGX 2PSFA 5LNK1 1K27A 3IAFA 3RSFA 2J9ZB 3G59A 1R6UA 1G3QA 1K5DA 2NXWA 3PRJA 5DBEX 4JQSA 3ROZA 5C35A 1QUFA 2QM7A 3QKTA 3RSOA 1WPXA 2C78A 2PRKA 2GD6A 1D07A 3G2KA 5H70A 2IP1A 3QU2A 1LRKA 3AQIA 3OLYA 4BJ1A 4B6PA 3BFXA 4CLHA 3U7IA 3AUYA 4MVJH 2OILA 4KR3A 3WDMA 1RCTE 4H7FA 4N6OA 1XTTA 3ZS9A 4RH3A 1U04A 4UW9A 4QJ4A 1KARA 1OFHA 4MWRA 4XX0A 5IVPA 4KXVA 4Z86A 3K1JA 4FFLA 3R4CA 4IXDA 3EA5A 2ZVDA 2OC9A 4ZCIA 1FK8A 2WQZA 1P17A 2TMDA 1P9RA 3GJ0A 3VRHA 4BFCA 1L8AA 3HKEB 2QQ0A 3CUVA 3EG9B 3ANXA 4B4VA 5K6AC 1XNGA 3K1AA 4BFTA 3N87A 3FFWA 4NE9A 2P91A 4TT3D 3DYVA 3PUIA 4BTVA 1TKAA 2R44A 2NUBA 3NNSA 5B1EA 3AQ4A 4PS0A 4Z4EA 5SZHB 3ESDA 5TB5A 4YCMA 1X7WA 1IYZA 2GETA 2P5SA 4FKMA 1S4QA 4LGVA 3AHFA 5IJ0A 3L7NA 4KR7A 1IAQA 4M54A 5IJZA 1X8XA 3I6MA 3K32A 2B3TA 1I2BA 2IVFA 3DTVB 3GHHA 5C8VA 1KR2A 4XHXA 3GUCA 3WWZA 4UXHA 3TGLA 1Q20A 2F8SA 1FTWA 1PVOA 1EI9A 2OVBA 4FSXA 4O4JA 5IDYA 3OA2A 4HB4A 4EY7A 3DP9A 3SKXA 4EWLA 1VIVA 5CFMA 2G7MC 2PWPA 4MVWA 5ERGB 3T9FA 3MOIA 3HCPA 3KYJB 3JQDA 3BOSA 1P5JA 1QV7A 4WKOA 4UC0A 3EXHC 1ZSNA 2OWEA 4KQJA 5CM2Z 5DYIA 3P0IA 2W71A 2AN5A 3BGIA 1WHSA 5FWYA 1KYYA 2OM2A 3ADCA 4U1RA 2XT0A 4F3CA 1XRRA 4EVQA 4M7PA 4YIHA 3ZNOA 1TVKB 5DNYB 2QIPA 1EGMB 3IEVA 2RKCA 4G5FA 3NHMA 1OZHA 2JGNA 3VTAA 4XLLA 1KEEA 3CB2A 4RIHA 1PZFA 1O89A 1YVPA 1RZRA 4WOCA 4WFIA 1HA3A 1HQCA 4RDIA 1JU9A 1GITA 3FOWA 2GEVA 2BERA 3ECSA 4FHCA 5DM0A 4DT1A 2Q62A 2VATA 3ITNA 1VYUA 3AFIA 2X15A 4UQPA 3ZX5A 4IVNA 4ZGGA 4QM6A 1OXBB 1AN9A 1BROA 1KFEB 3FNGA 1TCCA 2VPXA 3R8XA 5KWEA 4B3GA 3M3DA 2WJHA 1O95D 1WG8A 2PUFA 5TMDA 1NKSA 3TNYA 1JEQB 4YW1A 3M33A 3TFQA 3IUJA 4Z0PA 3TH5A 3WK7A 1C7JA 1DOAA 4CPOA 1SK8A 3ILVA 4UUAA 4CM5A 2IA5A 1C7IA 2M6SA 5ADHA 3OPMA 5JFTA 2AXEA 5KVSA 2YUTA 4HC4A 2J5KA 4MRRA 4PC7A 4KCGA 4PANA 4AYWA 4CMGA 5JBIA 1PJCA 4XD7A 2W20A 1AZTA 3LFHA 3A58B 4D4JA 3LTNC 3SIPA 3DQPA 5JARA 1KYVA 2WQ7A 4FN4A 4AMVA 4CKBB 4V1CI 1KITA 1RC0A 3DZDA 4KS3A 4OBWA 1HXHA 3ZVNA 4IYGA 1XQ1A 4G56A 3ZWWA 1NVWQ 2YA6A 1PBNA 2YYAA 2GSWA 1PZEA 4QNNA 1S7GA 5IBPA 2VSFA 1A72A 4I2VA 4AMGA 1I13A 1XD2B 1N9ZA 3W79A 3AJRA 4EOGA 2WNHA 4ZKDA 1EDZA 3PSAA 4JSRA 2N47A 2D6FA 3JCZA 3EUWA 4S1VA 3H5OA 3SMVA 5JVDF 1NMSA 4G97A 1MIHA 2HNBA 2JEZA 3QBDA 4LZJA 2GD1O 2P3OA 4WADA 3T99A 2PX0A 5FBLB 2CV2A 1INLA 1DFIA 1TVEA 2EZTA 4JXKA 3ZQKA 2VTEA 4WZAB 1W0PA 4HB3A 1L5NA 2GF0A 3RUIA 1X9GA 3UHAA 1XCMA 4MWUA 4OHOA 1JXAA 4IWNA 3WHLA 3BHJA 3WYFA 1XGKA 3UJNA 1HLGA 2Q6TA 5SY6A 3GJSA 6Q21A 2DJIA 3I34X 5E2IA 4E32A 1CRPA 3AWDA 1AOXA 1T4BA 2DEUA 4EG6A 3FCCA 3C6XA 2W6ZA 1WXQA 3ZIDA 1I51A 3QQPA 1IOWA 2AMYA 3MJVA 5ILQA 2ECPA 3N0VA 1V5EA 4BKQA 2BYTA 2O8EA 1DWPA 2ZRLA 4KBYA 3PFHA 3ZIUA 1OH5A 4RMNA 4YBZA 1PFQA 1R4MB 3ECAA 3FJYA 2CFTA 3FM9A 3DWIA 3PS9A 3ZWOA 3FTFA 2AJLI 1HBJA 1EK1A 2X8JB 2ZUWA 3O1LA 2XN4A 1JTEA 5IC5A 1JJ7A 1PE0A 1EM8B 2CVFA 3B9BA 1NBAA 4FPEA 1SC3A 3K4PA 4ZVMA 4ESOA 2ZRPA 3AVQA 3P2OA 5LQRA 2Z2IA 2LRHA 1T0PA 3DQQA 4JB8A 4HTFB 3FSRA 4N40A 4HLDA 2Y1GA 4NG5A 4ARAA 1H6AA 2X8WA 1E8MA 3DH0A 3OQ6A 3OM0A 3OTOB 2ONKA 4DR4B 4NC5A 2WAAA 2A5DA 1ICIA 2GMWA 5TPWA 4OYLA 3SY8A 3T4XA 4TMWA 5HG0A 1U5BB 1SUBA 1TQDA 1CIVA 1N9KA 1VIDA 2AFIA 5BQXA 4FYHA 4QTZA 3NT5A 4YW2A 4KRFA 3W2TA 1QJCA 1G5FA 1G20B 1VBFA 3CLSC 1J70A 3GDGA 4WUVA 3L8DA 3LWNA 3Q5EA 1ZR2A 1P4AA 3R76A 5F1YA 1ZM4A 1W4BA 4QHYA 4CKCA 3UBTA 3HO8A 4G07A 1D4OA 1SA0A 4ZTBA 2REOA 2ZUDA 1RC1A 3NI2A 3UFBA 4RAOA 3WOVA 1RPAA 3OSZA 4DZZA 3LAWA 2VVTA 1RHKA 3O4VA 4UHKA 3ONVA 4C7MA 3CVVA 1DP4A 1NY6A 2BJWA 1YI1A 4ZI3A 4UXJA 4RTQA 3D7KA 4JJFA 3G3EA 4NWIA 4W5TA 1L9KA 2JFVA 2FJPA 3NETA 3S44A 1RQNA 2OHVA 1H2FA 4DV2B 1XNRB 2V6FA 3L1IA 3G2HA 3LUJA 3D0QA 4XM1A 1VDMA 2V98A 2NPFA 1XL0A 5CIQA 1KBQA 4CDRA 1E2JA 2ZJ0A 2X9QA 3G0GA 2BFEA 2IODA 3IIEA 3PUVA 5HFJA 4NJEA 3M4NA 1P0MA 4PZZA 4EG7A 2GN9A 1K4YA 3LYAA 1M6YA 1EFPA 1OFUX 3RVQA 5C37A 3BXHA 1AB6A 3GVPA 3QIAA 1IEQA 1KZ9A 4G41A 2YNMA 2I4IA 1YS2X 4GBED 4P58A 4YJDA 4LG1A 4KO8A 1TPZA 4OHRA 5ALHA 5GQSA 4CKEA 2EKLA 3EXEB 3SVLA 3UMGA 4GC5A 1EMDA 3S2FA 3VH1A 3WLOA 4B71A 2QTVB 2ZW9A 3WGHA 2MSDB 4TZ0A 5F7ZA 1U2ZA 1MA3A 1L4MA 1JFFA 3T7SA 2QZSA 5AVZA 5JYYA 4GGPA 5AW2A 1IN6A 1VLVA 2I71A 1E9SA 3NVAA 1TK3A 2VPQA 2GM3A 3DOUA 1V0JA 4HAXA 5SYMA 1E1NA 1RPJA 3ONDA 4RKWA 1KQNA 4C6HA 4KQ9A 3TE7A 1OWPA 2C98A 4P0QB 2OZKA 3PD1A 1CQZA 4UM8B 2FNAA 1G7CA 2POOA 3QVUA 3VNUA 3R5HA 3H1TA 4GSLA 3N6RA 3WLFA 2ZZKA 4RJJA 3JATA 1N2BA 3LHKA 2IAOA 3OFJA 2ONJA 1LI7A 5KI6A 1EEXB 1B1AA 3ROEA 1DJQA 3AEZA 5ITVA 1UXOA 4EEKA 4POOA 1GYRA 4YT8A 4R05A 2Z95A 5EE0A 3UT0A 2VAMA 4GOND 5FNZA 1HDCA 2AFIE 4J0JA 4RD3A 2ZKLA 4RF2A 1G9SA 4NMLA 2CNWD 3IP3A 2QMYA 3DPIA 2O2YA 1AKWA 1LRLA 3B8EA 3MSCA 2QWHA 2XDYA 2C5EA 3R7DA 4QYXA 1A2BA 1I14A 2PZJA 1FE8A 4MWJA 2ZPTX 1K92A 1MC8A 4DCVA 2F8TA 2NVUA 5CA0F 3WB0A 4ZV9A 2FH5B 4BS9A 4EAAA 2EOAA 2P79A 2Y4NA 1O7JA 2QRNA 1ESDA 2I1VB 1D3AA 1DDGA 2DLDA 2PXAA 2RGBA 4RX1A 2EFCB 5FFFA 3DUWA 1KHTA 4O08A 3T06B 4RKEA 4QUBA 4LX8A 2IAXA 3L02A 3WN7A 1OI2A 2YFKA 1K3UB 1KE2A 2C3MA 4XASA 2Q7OE 3NGXA 2AX4A 4K26A 4P4SB 2ZT7A 1OREA 1M1NA 5EQFA 5IG2A 3OAAD 3P9KA 3M3HA 5EZQA 1C3XA 5EFZA 4FCWA 5AI6A 4JP2A 3DMGA 5DASA 5HPYB 5KOYA 1F4LA 2Q9UA 3CPEA 2ZU6A 3HM9A 2WIBA 3C5CA 3M4ZA 3NIDB 3NJ4A 4XVHA 1NSDA 3COJA 1ZRSA 2KWIA 2R48A 3M6UA 2PV7A 3GLFE 1LDGA 3QOYA 5F9FA 3OFVA 1AZSC 1I9GA 1YT5A 2MIIA 3NWBA 4MUJA 1JJVA 1QX3A 3OJEA 4O29A 4OQYA 5J2TB 2X41A 1ONNA 1VKRA 2C8JA 5AHKA 4KG7A 5BXQC 3TECE 3TZCA 5DW3A 1M6HA 1V71A 1N92A 2W38A 1P1BA 3IBYA 2A0FA 1EFVB 3IDOA 3LA6A 3UENA 3KOUA 5DF1A 1L5LA 4GDIA 2VDLB 3OZSA 4ISBA 4PLYA 3TTXA 1YXMA 3ICCA 4MUNA 1PS0A 2HTQA 3QVXA 1UWLA 3TLJA 2H00A 4M4SA 3RC2A 3WBBA 2H1IA 1XN1A 2JC3A 4BO7A 1GILA 4L0DA 2FMKA 2OSBA 5BWLA 4GAEA 5I7WA 2XOEA 4NCIA 1LF5A 4E4RA 2ZI6A 2JCXA 3O2SB 3R24A 2TSYB 2HMTA 4UULA 1DC5A 1DTWB 4P5EA 3U62A 1CNEA 2KE5A 5FV7A 2VT3A 1R6XA 3DMTC 2IK8A 3QPWA 2NSLA 1E1KA 1EBBA 3LY9A 4P7BA 5HZKA 2DETA 2I6XA 5ENZA 1QAQA 1QYVA 3PUHA 4B85A 4DSOA 4FIZA 1JFTA 2VWQA 3A0RB 1TU3A 2DFPA 3WYNA 4Q4DA 5CH8A 4XARA 3HY6A 1Q21A 5DN6A 2YXNA 3QXGA 4YJHB 4BZPA 4YX9A 4FB4A 2FHRA 3UICA 1ZK0A 4Y18A 1WS6A 3ZGZA 4JI1B 4IWYA 2C04A 2C4TA 4LMPA 3EG9A 1Q6ZA 1S8AA 3C1UA 4A8TA 4WOBA 4F11A 5SY9A 1EG2A 3FBTA 1FBNA 1YA6A 2IBTA 1CUFA 2UVPA 2JIZD 3LPMA 1WW8A 5DHRA 3AKEA 5JI2E 2Q21A 2OJHA 2BBSA 2D1RA 4IJVA 4CV1A 1N5KA 4NJMB 4XEHA 1CQWA 3CISA 1XPUA 4GDFA 3DTVA 3KQWA 1BKSB 5AXBA 3KYDA 3AW9A 3NIFB 1CT9A 1GYQA 1WA5A 1ZJJA 2AFHB 3DW3X 3MMPA 3OPNA 2CZGA 3N0TA 1JB1A 1FLDA 3CYEA 1K9VF 4KIJA 4FQ4A 1A50B 3L0SA 4YROA 1F6BA 5T3YA 4BNWA 1NUHA 4B73A 5CD9A 3A6ZA 1C9MA 2AI3A 2B4RO 2W8BB 5LR6A 4A36A 1L3BA 4MWXA 3RSGA 3U7EB 2PS1A 2XBLA 4GZMA 1VPLA 2NLOA 5ADVA 2GVXA 2BELA 2D5LA 4QDJA 3IP5A 4D3XA 1OWNA 3RS5A 4GICA 3PQ6A 1A4QA 1GDHA 16PKA 1X1BA 3EZXA 1VLZA 4MYCA 1X0VA 3H2IA 3OX2A 4IEEA 1XZMA 4TROA 2GTPA 3GG2A 1TCAA 1QNLA 5M1ZA 4L4ZA 2J3LA 3K53A 3WL7A 3N2LA 6ABPA 3GVKA 3WWAA 1E9FA 1R66A 2HSWA 3ZPXA 5JG7A 3FH0A 4FWBA 4G67A 4RZHA 3R7SA 4D9HA 3WIOA 1E1MA 2JAXA 2O5CA 1UDXA 2OCDA 3OU7A 4KH1A 4CQNA 1ND5A 2JGDB 3NAMA 3WWEA 2ZTMA 1ZVQA 4AJIA 3KS9A 1HURA 1TB4A 2PYZA 2QP9X 5K99A 1I7PA 1RYHA 1AK9A 2HLHA 3Q3JB 3O1JC 4AJLA 2QTBA 1V0ZA 1OXXK 2DPYA 4HZZA 2OGSA 5K4GA 1KWKA 3EPLA 1WB4A 5K4HA 3HJUA 1NL3A 3THRA 2O0JA 2V6JA 1GFWA 1USWA 2ZUCA 1N6OA 2O19A 4GFDA 4ARIA 2VK5A 1UJBA 4QT0A 3MJHA 3CW9A 2N9UA 5HUGA 2YY5A 1DJNA 1ZK1A 1T43A 4YR7A 4O02B 1Z8NA 3PDCA 4YCCA 2X6TA 1KAEA 1HETA 3DAYA 4ZIRB 3NM6B 4H15A 4YMHA 2ATEA 4LEIA 1J00A 2B83A 5JXHA 3PEWA 1VQ1A 4NICA 5CB8A 4YDHB 1YOVB 3GAFA 1EX1A 1XD2A 5HQ3B 2C59A 2Q4TA 2QV7A 4DCSA 1SLLA 3V4LA 3D4PA 3D6NB 4GNCA 1GSHA 1R0CA 5ELMA 1PG5A 3OFND 3HA3A 3HWSA 1Z4MA 1WMDA 3DXXA 2NU6B 3RIYA 4WINA 1C30A 1RHQA 1K0FA 2BGTA 3W2IA 4BXOB 1PT6A 3FIJA 1PFWA 4GECA 4B8YA 1ZGGA 3N39C 3TLKA 1Q5PA 3FR7A 3W5UA 3G8DA 4DC1A 1KY2A 2FX2A 3L3BA 4C4ZA 5A6SB 1A9RA 1YKFA 2BMDA 2Q8NA 4K1IA 2A1IA 4WZAA 3H8SA 4F91B 1IZZA 5E0KB 4HG2A 2QUKA 3UUWA 3LXUX 3OQNA 1DKLA 4RS3A 3OF2A 5NLLA 4E3ZA 1J2YA 1HZJA 2B0JA 2VCEA 3OM1A 2JD1A 1W29A 1AXRA 5AVJA 1WKVA 1NC3A 3CR8A 4DOMA 4EO9A 5ITWA 2IX3A 1SY7A 4MO9A 2A94A 2GCNA 2NXEA 3LCMA 5A4FS 5M04A 1AQNA 3JV7A 1O0CA 1A9YA 2W8ZA 4DLTA 2JFGA 5IVKA 4Q19A 3OCZA 4UREA 3DBHA 1INFA 3G9TA 5C4GB 1I2MA 4YP5A 5FR1A 3LXXA 3L7MA 1R4MA 4ND8A 5H8WA 2IKQA 4ZVQA 1WPQA 2NZUG 1N7JA 4YRFA 2X8JA 5EHIA 2P4QA 2KS6A 4ALMA 2WVHA 2ZRJA 2BMJA 1EM8A 4IL5A 4Q7LA 1EJ0A 4FDUA 1ADFA 3IXQA 1S0JA 3C6BA 1G18A 3OCUA 5FTJA 1K6EA 5BOVA 1F1BA 3NV7A 1QRTA 4HTFA 3HADA 1GUYA 3W6PA 3WYDA 4RU1A 3WICA 5AVQA 3F5MA 4H31A 5E4TA 4AWXA 4G8JA 3B3QA 1VM6A 1ENPA 3INTA 4Z9AA 3KX2A 1U5BA 3FW0A 2Q07A 3PNKA 4ARBA 2H2NA 2XZKA 4X85A 4Z2YA 3E9QA 4C3ZA 2JEYA 1FX1A 1QGUB 5DX0A 1OAOA 3ZJVA 1G20A 3QU7A 4I6GA 1Z83A 4IMPA 3U4MA 2H4YA 1ORVA 4N1AA 5BNIA 2ERXA 2F24A 2NO9A 2QE6A 4UEJA 1RRPA 2VG8A 2XMDA 1R0BA 4M1WA 4V0OA 4YRQA 5KAPA 1PFKA 1NPDA 4FWIB 4MW1A 4Q12A 4BQOA 1O9GA 1ADJA 1ZBQA 2MR6A 3NUZA 5JDIA 4UM9D 4TQAA 4MWLA 1Z2PX 1RQ7A 4LQCA 1QBIA 1YGYA 4B43A 5DCYA 4AT1A 1YKSA 2YWRA 2W2MA 2IYUA 4JLUA 2N3ZA 2OGWA 4MQ4A 2CSUA 2BBTA 5I5GA 4PZLA 5A62A 4ES6A 2FPGB 3T9CA 5B6JA 1JAZA 2DCMA 3Q1KA 3O9VA 4UAGA 3DAFA 4OJMX 3CF4G 4X94A 2GAIA 4LRSB 4DJJA 3HEAA 4REQB 2Q1UA 1LBIA 2PE5A 1OXMA 4Q1CA 3F49S 1NCBN 5AVRA 4GVPA 1KEUA 1T6BY 2BP7B 4W63A 3UBMA 4RJKA 5EUQB 4C7KA 4J0FA 3QBEA 3EW7A 1RAHA 1IUNA 4FPKA 1DC8A 1ONPA 3Q5DA 5H68A 3TKYA 4E5UA 2F8LA 5KZMB 2F10A 2JLQA 5E6SB 2OOSA 3H7AA 4JSTA 3UWKA 1FFGA 1H93A 1QWOA 3L4KA 3P94A 1DBPA 4UMFA 2P8JA 1KI8A 2ICAA 2IOYA 3MTQA 1ZI8A 2QTVA 2BFCA 4HGRA 4OV6B 1V7QA 5CR9A 3W9SA 3V1YA 1NNSA 1V5IA 3K2QA 2E9SA 1GLNA 4DIDA 2BM1A 2A75A 3GP5A 3WGNA 5EZYF 3HFRA 3AR6A 3FIUA 2JFFA 2IZZA 1OTYA 2VAVA 1V26A 3NTVA 5D8DA 3MWEB 3CLSD 1G3RA 3H6KA 4EEXA 5KSOA 1KK3A 3PR3A 5KSWB 3MS4A 4ZEMA 3AIMA 4XJAA 2ZDHA 3N8KA 1ZUNB 4EYGA 3UN1A 1TIBA 1XA0A 3L9XA 1PEDA 3CSSA 5F5NA 2C95A 3HC7A 4TRJA 3EQ7A 1QYRA 1WIWA 4N0DA 4XR9A 4GVLA 1Z6ZA 1HE4A 4I6EA 2XGOA 5GOTA 5K6TA 3F2VA 3H4IA 4ZQGA 1AN0A 1TYBE 1DAPA 3UH0A 3QVOA 3SHTA 1B0UA 3WR5A 2PJUA 1WZEA 1TT7A 2OWDA 2QUBA 2YIVX 3A10A 3A3OA 2QORA 1CLUA 4OIMA 5IF3A 1QG2A 1U6JA 5IZCA 5MFZA 1IBKB 5D6OA 4Q7MB 4CT4B 2E48A 4Y30A 3PTZA 2C8KA 1F51E 1Y8CA 4KK4A 3WLHA 1OROA 4FFBB 1UXHA 1Q0TA 1G20E 5KJ1A 1H1TA 4MINA 4U8HA 2RAPA 3DOFA 3U19A 3TR6A 3GLFA 4JXZA 4BLOA 3UC1A 3FVZA 3VU8A 3WV4A 2ZSHA 3L8MA 1XPJA 2W00A 3D6UA 4DR3B 2H4WA 4LBWA 2F28A 1G21B 1V39A 2G72A 4HTAA 2FOLA 1HZZA 2OD9A 2PGIA 4P53A 2BJVA 2VT2A 5JSYA 1VE9A 4PR0A 2OXFA 3JSAA 3PHIA 3IXLA 4KQWA 2XQIA 3C45A 5HF9A 1BMFD 3HJTA 1AS3A 3K4HA 4IEIA 1QZUA 1ESZA 3BBPA 2RGYA 2PGLA 2QN8A 3N59A 3K39A 3GLTA 1QMGA 5G0VA 1AHIA 5LD2B 1WNFA 1M2FA 4BQQA 3V4ZA 4TWAA 4OHFA 2IAUA 1MIOB 2FFQA 2QR5A 3C3KA 3UAZA 2WYWA 1MWEA 3QGMA 1T8RA 2UVQA 1N7DA 3HP4A 5J2TA 3QXCA 1W87A 4GWKA 5DHUA 2FWJA 2VRWA 3HWX1 4RSGA 4DLRA 2X1LA 5B3LA 4I9GA 5G2OA 1I80A 3EGVA 3NUQA 3O0DA 4UATA 5FWNA 4CMAA 4B2PA 5KJFA 1MOQA 1AM4D 1BDMA 4D0GA 1KAMA 4JYCA 2R8RA 1Z4OA 2QWFA 2OM6A 1P8AA 2VBCA 3K37A 1OHHA 2D3TA 2ZSUA 2A0UA 3WVNA 4ZCRA 1N2GA 5GVSA 4DB4A 1HTTA 2V7QA 4RZ2A 2VSMA 2WMYA 5BV0A 3CJTA 3FYUB 1NVTA 2VIIA 4X54A 5CCDA 4EJ0A 1PR6A 3KKOA 1WCSA 2C61A 2CB9A 2QPOA 3OCJA 1IUBA 3Q8WA 4P98A 4U7JA 2BZDA 4GD3Q 5DNDA 3QH4A 3W8EA 1CRUA 4EL0A 1DTWA 3PQEA 2QLMA 2IIBA 5FB3A 5KSZA 1MH9A 2RB5A 5EINA 4CLXA 1DIMA 1HQDA 1WE2A 1C1XB 3JQRA 4MJ3A 4HBZA 2WUFA 2VFAA 1P2TA 2KJQA 4Q4JA 4RZUA 4ZA2A 3HZZA 1IB6A 1ODKA 1E96A 4MMYB 3UWOA 3R74A 2IW1A 3ON5A 5JCJA 2VF5X 2W6MA 2Z8YA 1MRZA 4YJHA 3IDFA 4IIDA 1PD0A 2XX3A 3L7DA 5BN5A 1FMLA 1XTPA 3QSGA 4XJTA 3T5BA 3W3ZB 4LVNA 3ZHVA 1WZIA 3D1JA 2XWJI 1GU7A 4GYYA 4BC0A 1FY2A 1SUUA 2C9CA 2JW5A 4LXIA 1PD1A 1LPMA 3D3EA 4PX3A 3W1VA 3WXMA 5CLJA 1J5PA 3CUEF 2GNPA 1S4MA 1QHFA 3HJCA 1HE1C 1NOJA 3KLPX 4B45A 3G2PA 4ETWA 4QTTB 4AI6A 2VP4A 3GGGA 5E6UB 3DMHA 3IA2A 4IIBA 2HHJA 2AFHA 4TWZA 4EA6A 2FETA 1AF4A 3B3JA 1WUTA 3DOIA 1KS2A 1XKTA 3SQLA 3WJ7A 2DLCX 4HWRA 1CZUA 5COAA 4KQHA 5DYGA 2G08A 3T7IA 3KPUA 2CLFB 3PC2A 2W8BA 2PO5A 2REQB 4AO8A 3QOFA 4DBLE 4TQUS 3DO5A 4CGYA 3VKVA 1QHNA 4URFA 4UE6A 4AZWA 3DCIA 1JJFA 2C9OA 1JLMA 2W6JD 2Z83A 4RQUA 2ZTVA 3NO4A 3GEIA 1DUVG 1H2WA 1SIBE 1JA1A 4F4IA 3P2YA 2JZCA 1I33A 3TIIA 5AW8A 1YUMA 4KR6A 1S5PA 2D0OB 3I8SA 2F9LA 2J30A 3G2QA 4H59A 1JHRA 2ZRIA 4L8GA 4MLCA 4OKIA 3RC7A 4D1YA 5JV5A 1KORA 2WUWE 5CDHA 3KQHA 2EEZA 1GTJ1 1GGHA 2EZ8A 1OFTA 3DBRB 2O3QA 3M4JA 1QFSA 4QHTA 4GPAA 1A77A 1IVYA 4HF7A 1BN7A 2GK3A 4I46A 5KIAA 3NN9A 2NYVA 6GPBA 1CYDA 1Y37A 3FOCA 1VYTA 4QU0A 2YV5A 4ZFNA 2FW8A 5LQDA 3S2KA 4KTTE 4D8WA 3LQ4A 4XVUA 5C7LO 1XU4A 2BGJA 4J7XA 4MR8B 3ABRB 3K09A 2GLUA 4OLAA 2ISMA 4INZA 3V7UA 2Z5LA 5AJWA 2WVGA 4GZ5A 2IXTA 3TSWA 1MXHA 1UBMS 4YXFA 4W5OA 3SQXA 1U8CB 2Z4TA 2GERA 1N5RA 1V6AA 3H2GA 3E0QA 1MC1A 3N53A 3DZ8A 3W9BA 4ZAYA 3B2EA 2RCYA 2HMWA 3W2EA 3IAM6 3C6ZA 4ZIRA 1SQSA 3GDHA 4OHUA 1P0IA 1Z4JA 1INWA 2XHZA 3GROA 4PV7A 2R6AA 3NHYA 3GLGB 2ZIVB 1C8VB 1R6VA 1N36B 4B3SB 3TX6A 1SU7A 1YOVA 2YQZA 1T34A 4M0PA 2R7AA 4Y2XA 4D9EA 5T8KA 5HQ3A 2ZPAA 5EIXA 2NUPA 4LNHA 4PF1A 4DY6A 4DA4A 2OHFA 2WOZA 1ZD8A 3AUKA 5CH3A 2VWPA 3QUTA 1TQHA 3TDKA 1JAIA 3V8PA 1M6EX 3MS7A 2NU6A 2XBUA 1KDZA 5LDDC 2PRSA 5BXYA 2EQ5A 1BDBA 5FPSA 1TAQA 3L40A 4UDXX 4BXOA 2IXGA 4P36A 3DBIA 1Y81A 4MZAA 2FCAA 2G9VA 4LHZA 3HACA 4OB6A 2E4YA 1JZSA 1LSSA 2O7SA 2PWZA 4Y8VA 1USGA 1XZEA 1ZGAA 4R9SA 4YV1A 3GLVA 1YNOA 1AURA 1N8KA 4Y2UA 3UK6A 4F84A 5A6SA 2PA3A 3KZOA 2AFHE 3QA9A 5A5VA 2OVFA 4H9GA 2WHPB 2HQOA 4HRVA 1NUAA 5DRYA 5AR1A 2JARA 2PM8A 2WF9A 2CEKA 3OIDA 4RH0A 4N49A 4GGMX 5C52B 3USCS 2G4VA 1I32A 4LE2A 1S3GA 1OC4A 3ESRA 3PUWA 4OBEA 1CDEA 4MQ5A 1KRXA 1M8JA 2NPIA 2OK8A 4BJHB 4JA0A 1QK5A 2GRJA 5AQ1A 4ER7A 1DWUA 3OX4A 5AW0A 3HK2A 3L01A 4NATA 4DUYB 1GNRA 2WHEA 1E8NA 1KSJA 1XJWA 4LRQA 4HL6A 4U8GA 5EQJB 3OIWA 4WCFB 2Z6UA 2ZE5A 1SG6A 3HLTA 1Z4QA 1RBZA 2XRYA 3STYA 3U3RA 2PGAA 3IMEA 3TOVA 5KPDA 1U8YA 1QCZA 1SUPA 2WBLC 4A2CA 1HFJA 5TMEA 1AKQA 1VRVA 3VNAA 3OOSA 4KN6A 4U5QA 5CD1A 1DMRA 1GTSA 5J4HA 4BVGA 4XRGA 1QE3A 3D54D 4YGYA 2X0RA 3C3BA 4ESVA 1VZ3A 2O5VA 1N0IA 2IOQA 1AUPA 1PZXA 1E5XA 3HG7A 3E82A 1TAHA 3NHFA 5MN6A 3QNWA 3S94A 3IUPA 2MHCA 1GGKA 2GF9A 1IWPB 1QKJA 2E4AA 1NP6A 2JASA 3D4IA 4ZVLA 4TRMA 2FN3A 4FWTA 1IWBB 1I4OA 4POAA 4N5DA 3DASA 5HIMA 5MGNA 5L9AA 3TUZC 3U16A 1QGUA 2A33A 1PAUA 4NYMR 1UODA 1Q0SA 3QFTA 4MGYR 1E2NA 3E3MA 1HL7A 3O0TA 3U56A 2QTGA 2VF7A 2D13A 5LJIA 1TM3E 2VQ6A 4DQUA 1EG7A 1K5GA 4MVYA 3ISTA 4RKFA 4XIYA 1AUOA 1YRWA 3IKLA 4NY1A 1BJKA 1R0KA 3AEXA 4RK4A 3UHPA 3D1LA 1H2RS 2ZJ5A 3V3KA 1CZHA 3GEHA 3HO1A 3H84A 2VTKA 1C8LA 2PD4A 1EUTA 3W6UA 4LXQA 3WLRA 3FGNA 3ETHA 1TFRA 3ST7A 1A5ZA 1P2DA 4HAIA 3AFMA 4RIIA 4NBWA 3LT4A 2HFKA 4I4NA 1ZO8A 2FPGA 3F3KA 4FU0A 4KR0A 2XLBA 3BZWA 1PYOA 3KV3O 4FOQA 4DQKA 1KEWA 4MWBA 1ECPA 3T5PA 3KLOA 4REQA 8GPBA 3BDVA 4KPEC 4CTOA 2WA2A 4Q3OA 3OD5A 5I4BA 3TOZA 2BP7A 4ZV7A 4EENA 3MLEA 4HWPA 3NATA 2Q3LA 3OWHA 5JAQA 5CFOA 2CHEA 1X1QA 9ATCA 3P9RA 4DGRA 2JIDA 3MPOA 1FYXA 3IOMA 2W90A 4ZKEA 1SXGA 2D5IA 4OD0A 2VA8A 5E6SA 3NTLA 4QGBA 2CMDA 4K8OA 3EVTA 3ZU3A 3V4FA 3N2GB 4GM0A 2OCIA 3NIBA 2BFAA 3AOGA 3PPXA 2DQ4A 1K5HA 4AU1A 1DUSA 3KQMA 4JT8A 1P77A 2HDHA 3V55A 1BMDA 3D6MA 1LLQA 3KIPA 3TAXA 1HDXA 3MCUA 1N6LA 4KS5A 1XTVA 2UYCA 3O83A 3TJMA 3HXOA 4KE9A 4CV2A 3JQBC 3LI3A 3TZKA 3ZYZA 2QRMA 3QTBA 2R3SA 4BLTA 3OHSX 2MYUA 4G8DA 5CFRA 3DFMA 4RMHA 3E3OA 4HUQB 4NH0A 5EMJA 2MT9A 4QC2A 2IV2X 3W1EA 3I6BA 1NLMA 2QZ9A 1OT3A 2ZDQA 1KPGA 1DKRA 3DCYA 2GOYA 3K38A 1UZMA 3GA5A 2RFLA 3RPEA 3ICWA 5KNBD 1DHRA 2J85A 1TECE 3UMMA 5E4FA 1KFCB 1ZW6A 2BUAA 1ZDMA 2C5HA 1X94A 4MI3A 3TBKA 4IJKA 2IYRA 3ABSB 3OJOA 1Y1SA 1OLUB 1VJCA 2A6PA 3C15C 1PV4A 4TV8B 3QE2A 1LNSA 1G5QA 3NBZC 4URYR 2C4AA 3KXDA 4GOMD 1V25A 2IDKA 3OQPA 4TRRA 4YJ3F 5CDYA 5A2QA 2ZIZA 4HDAA 5JCOA 4D9CA 4FFBA 2V9PA 2FG7C 4L0QA 4JLKA 1E7MA 1RVDA 4YMLA 2DHDA 1HV8A 3L07A 4LJ5A 4PZ0A 3MTJA 4YI3A 1Z4ZA 4F4DA 1RWNA 3EOBI 4H7HA 4L2IB 5KWSA 2FWPA 1G21A 4Q9DA 1CV2A 2HSEA 1W1UA 3HZOA 1WQ3A 3TRJA 4HBGA 1GZHB 1C4WA 4KAJA 4F4JA 4EYOA 5L7WA 1HGXA 1KAGA 4M60A 3AMSA 2QJRA 4HSEA 4QOGA 1NVEA 4MLPA 1V43A 3RG2A 4S35A 1XRJA 3LECA 2XQVA 1B9TA 1SULA 2GM5A 1ULBA 4EKYA 2QSZA 3OQBA 5COQA 4G84A 1H65A 1GGJA 3NONA 1B73A 2HU7A 1YSCA 3B1JA 4LWZA 4RF5A 2ZRAA 5GMOA 4CCSA 4H1TA 2ANBA 5DT2A 4JEMA 3SIXA 2AZ4A 3WHKA 4K3YA 3WNCA 1AX9A 3QEOA 4WGFA 2WD7B 3RBVA 4YUZA 3U5ZB 2BFBB 1P1FA 1B8UA 4KQMA 1FQKA 4O5OA 4TYQA 3TQSA 2EGHA 1L5QA 3KPYA 3KEOA 1VPTA 2Z6AA 3OM8A 4W5JA 2IHJA 4D46A 4OPMA 5IKEA 3AVUA 3ZW7A 4Q48A 2J48A 2VNKA 1Y5LA 1VE6A 2XVXA 3BYCA 4S2UA 5DXJA 2PBLA 4NHEA 4Q02A 3M2TA 3R09A 4DMHA 2XUIA 1L7RA 1FEZA 1I3LA 1ZNQO 4GNAA 2HV8A 1FW6A 3I0NA 1X8JA 3EFOB 3SXPA 1RM4A 1Q7RA 3KQNA 5D3QA 3CEHA 1M7HA 3FETA 5T41A 2A9VA 2FZVA 1IUPA 3BUSA 3FYUA 3GVLA 2JGJA 2OP1A 2JANA 4UUQA 1LPNA 3JQAB 1OZAA 4LSZA 5FYDA 3SQOA 1L5ZA 1UH5A 5IFKA 1SOUA 2XMBA 2CLLB 3P4YA 1T4DA 1JXOA 3ZQ6A 4ZZIA 4QDXA 3E7DA 1C1XA 1J2EA 1F8YA 2B34A 2R1ZA 4PZDA 2AJCA 4BMOB 4DY4A 4DDUA 4QO8A 4L50A 2IAWA 3EIEA 3ZTTA 2HK9A 1DBQA 1EUCA 1S1MA 2PLAA 3G2NA 2YA4A 1GUDA 1BHSA 1JG4A 1ZS9A 2FK8A 2W2KB 4OL0A 4R69A 1N5JA 3N07A 4HNUA 2QDKA 3PQ4A 1IHPA 2PH5A 2QHXA 4QE3A 4WESA 3RJZA 4DJFC 3OZAA 2QYTA 1JTVA 3BIJA 3PGLA 3K3PA 4HAYA 4KFTA 5CK5A 1PIWA 4CEJB 5LQJA 3JZFA 1U8AA 2QB5A 5LWHA 1YVDA 1PGNA 1S2DA 1VXRA 4FJ1A 3DGEC 3V2GA 4B7NA 4QBHA 3J7AC 5D7BA 1C0KA 1CWUA 2IELA 3OMLA 5CHYA 5CCBA 1H05A 3TLGB 1G21E 1CUVA 9GPBA 2XUDA 3BKWA 4HEA1 2RAUA 4LDNA 2PQ0A 1R0WA 1WV0A 2PWAA 4FFOA 5G0TA 3VUFA 1P9WA 2G1UA 3ELWA 3JD3A 4EY3A 4JCOA 1UEJA 4W1RA 2C7RA 7ABPA 1SKAA 2D2EA 2GVVA 4IZOA 4CQMD 4UHJA 1UJ5A 4MUMA 4QDTA 3AFGA 4C43A 1TTHA 1M0WA 4G09A 2LR0A 3ESZA 3WGZA 4CEIB 1T9AA 2VP9A 5EG5A 3PNBA 4EGSA 2F3UA 1XAHA 1Q12A 4PSAA 1TOAA 4KO4S 4HUTA 3JASA 1XOIA 3MJ4A 2BHRA 1WEHA 3A6GA 3SF0A 1LVUA 1MOZA 4AYTA 3HBFA 4RQTA 4XB2A 5C1IA 1C1DB 2HQSA 3ER6A 3U1BA 1GFSA 1VMIA 3TLXA 3VJKA 1VBKA 4EG3A 2V0NA 1B2LA 2W37A 3A11A 3BXZA 2O2JA 3DBRA 3I2KA 4JGGA 4OFXA 2CK3D 5HZGA 3EX7C 1SU6A 4I6JA 5JVDB 3L7LA 3SBEA 4B4UA 2YKGA 3Q72A 3VHLB 4BVBA 4AB1A 5ENDA 5IXSA 2A78A 3I83A 2ZE7A 5DK4A 2C4MA 2ODAA 4P7FA 3SS7X 1T0HB 1C9EA 1OWMA 4AECA 1GSAA 1T0UA 1V16B 3CINA 3I9MA 4MTLA 2WSBA 1RIIA 3OLQA 3VHRA 1OIXA 4MWSA 3P26A 3S40A 2H1WA 5I7FA 1FP4B 3H5NA 3N8IA 4IV0A 2GBLC 3K0KA 3LLMA 1ISIA 2FLWA 4ZVVA 1Q19A 4Q6WA 1EBUA 2G5CA 4GL4A 4EY6A 1K7XB 4C2BA 1XWFA 4KVZA 1ONBA 1QRDA 5JNRA 1GO2A 1X1DA 2J4DA 3UF0A 3BFKA 2B8NA 3QI7A 3CCBA 1XKQA 3HEMA 3ADPA 1U99A 4GX0A 4J6EA 2J6IA 5K0CA 4F60A 1OE0A 4HN2A 1GTRA 1KJQA 2JIBA 2MJLA 1O95A 4CUZA 3GBSA 4ZOEA 1GL7A 2LE0A 2DAPA 3A1NA 1BWSA 3HUDA 1YB6A 4W9NA 4GE3A 1AA6A 3GMDA 4L95C 1ZGZA 3WMFA 4DANA 1Z68A 4GJTA 4WA3A 5B2CA 4BQSA 5C8XA 5LQUA 3IKMB 4X8MA 1I6LA 4EARA 3VC2A 2VHTA 2LXNA 2RGNC 1TADA 2OHOA 1NQXA 3IHTA 2W0MA 2FN8A 1SC9A 4UQOA 2AGSA 1QCYA 1QLGA 2ENUA 2YWGA 1XYVA 3COSA 3EUFA 3R5TA 1L5OA 2ZXFA 3W8NA 2QEQA 2V03A 3I6IA 1M3SA 2JGFA 1QF9A 3PGKA 4ITRC 2JFXA 2N75A 1E66A 2OGUA 4FFWA 3LOPA 4GNRA 4WEOA 2ZJ6A 3RAJA 1HMPA 2VKQA 1QTQA 4R41A 3V33A 3BEQA 4FX2A 3EXHB 3VC1A 1MH1A 4QVIA 4R9RA 2WHPA 2FFRA 4OKSA 4D4HA 4I9HA 3LS2A 1XD9A 2GJ8A 4G5OA 4XSGA 1TJ3A 1RQRA 4ZVKA 4ZAWA 1FF9A 2WWGA 1LUAA 2XMCA 1ZJ5A 2QW0X 5FULA 2AKYA 2D4HA 3G13A 1Z9BA 3K72B 1I3OA 1TT5B 3IAS6 4B3CA 4I0WB 4UPVA 3H9GA 1U0LA 1ZP6A 4ZT4A 4NC9A 4BRUA 1Q7CA 4UASA 2CYAA 4WCFA 4NLLA 2UUOA 3TTVA 4GKBA 4DMLA 3RRZA 3ICPA 5LQKA 3PNSA 2BDUA 4Z4FA 3QVVA 1VGRA 2BKVA 1OV6A 4D8TA 4JXJA 1T6ZA 2XMSA 3A3YA 4HDSA 3LO8A 2HZBA 3B2NA 5DH9A 3VOTA 3BORA 4ZO7A 2DTDA 5JQGF 1QP0A 1PK7A 2Z08A 4Y2QA 1YDHA 2BAGA 4Y6GB 1ABBA 1VA5A 4KQXA 2GHQA 2I2CA 3LA8A 2MSNA 2DXIA 3DZBA 1TJYA 4KHPB 2CLSA 2A9KA 4E5SA 1N6RA 3EWAA 4Y9DA 4YZ4A 2GXQA 4K46A 5EN4A 4CM4B 4XUCA 2P5UA 2VLBA 1J4AA 3OY7A 1Z8FA 1S8NA 1XU9A 3UH1A 3AETB 5JT1A 2WW8A 1OYOA 3R23A 4G5SA 4H4EA 4B7CA 1R4NA 4J8PA 4PC6A 4X97A 3VJMA 5DV9A 3NKFA 2QRPA 2EIHA 1RCUA 3UC5A 2UZIR 4K1XA 3TDNA 3PVSA 4DW8A 1N7IA 1N2HA 3GR6A 1J7KA 5BV1A 4MI1A 1ZVJA 2FEWB 3M8KA 1OOEA 5AYVA 2WF6A 5YASA 2CB0A 4BMYA 2JLUA 3I2HA 3PI7A 2FFHA 1QE0A 4FMDF 4G65A 5T4HA 2P7IA 4MYTA 4B3RB 3OOEA 1W1IA 2CD7A 2GYWA 2H8KA 2YC4C 2YFYA 1SZCA 3FTDA 1IQ0A 4M9XA 4J9UE 2H9AA 4PZEA 1MS3A 1RHJA 3OLZA 2Y6VA 1AKTA 3WGVA 1O94C 3SZUA 3Q6IA 3L0CA 2OL4A 5E9AA 3H16A 3IVAA 4ZRDA 1G63A 2RGWA 1OY1A 621PA 1QVRA 5KX5A 1I4DD 3KKZA 2HR1A 1R10A 2PMWB 4UM9B 1H2AS 3VU1A 2PT6A 3MELA 1AV6A 2YXEA 1IRIA 1H2EA 1V1JA 2IUYA 3U39A 3AVYA 4YRBA 1J06A 3CTMA 5JAHA 4GI3A 3HVRA 1AE1A 3T3EA 3E9CA 4IFTA 2YDXA 4EDFA 3PT9A 1YS6A 3RO7A 1SUIA 1KIFA 4JI7B 1CEEA 5JPCA 4X4AA 1EAMA 1TVCA 4DIKA 3NVDA 2W2TA 3Q7RA 5ELXA 4H3VA 4KRGA 4QG7A 3K6SA 5CA0B 1LX6A 4GZWA 3K94A 3N0RA 4LZOA 1H0SA 1T9KA 5IK2A 4BKUA 4P54A 4X64B 3NR2A 3SR0A 3WY9A 3CCCA 5DISB 3A4VA 4AS1A 2EX0A 5DLDA 2EFGA 4KAXA 2R86A 4HPJB 3SCZA 3CNOA 2XUAA 1KI3A 3WGYA 5LQNA 2UU9B 4YW3A 4IQ4A 1PDOA 1GQQA 3T1NA 3I01M 2HGSA 1UT8A 2DP4E 1QDUA 1GIAA 2J31A 4MS3B 3SK0A 3JRXA 4J1NA 1JHPA 4HUQA 3WGJA 1YZUA 4YP9A 3MWYW 1Y4ZA 3LVQE 4UFPA 1F8FA 4TS4A 4DXAA 4M0MA 4K1HA 3IKVA 2AN9A 5E2BA 3MBIA 3NFRA 2R4UA 2VAPA 3A4LA 3A1TA 4TM8A 1TO6A 3TX2A 4DR2B 2B3DA 5CXSA 4CLOB 4BTEA 2VJAA 1OLUA 1HKHA 1ZXLA 1YCFA 2ZOSA 4TV8A 3TIGA 1NATA 2V4MA 1Q84A 2HTYA 1QVAA 1SUEA 4P3XA 3Q3EA 5DSXA 3ZLTA 3H87A 1X80A 3JTEA 3L77A 4M38A 5CJ2A 2HK8A 3FZQA 3B1FA 4LYEA 2G36A 5ALVA 4ETNA 2Z30A 1NNBA 2FQQA 3BXEA 3D3WA 4KAFA 3GJYA 4F3KA 3P9PA 2YWBA 4QAQA 5SYNA 2XZOA 2Q46A 5JS7A 3PYLA 1XVUA 4WA5A 4XIOA 5H4GA 1L1FA 1CUJA 1JGTA 2QVXX 4ZCQA 2X1HA 2BRUA 4GXNA 4LCJA 2IYYA 1BRTA 4BKPA 3LBNA 4ENPA 5BW5A 4HYYA 5IN4A 4WLVA 3FF1A 1O4VA 5B1HA 2Y1DA 4YLEA 1NV9A 2FB9A 1MS1A 1FVOA 1F0KA 1S89A 3AJ9A 3OHPA 2RK3A 4FHFA 4QLOA 3NBQA 1E4VA 1N1EA 3T3DA 2EYQA 5IK2D 1G0NA 4I3FA 2WIAA 3NAQA 3NBXX 1D2NA 2BFBA 1TC2A 2BC9A 2OY0A 3NXKA 5DJ5A 1Y1LA 5AP9A 3WLAA 4NBKA 1RXVA 1XFDA 5J47A 4D8SA 5T7BA 1MZVA 1M2JA 1FC0A 1XIVA 2VAXA 4L5YA 5HUNA 4X6UA 5I9SA 3UW1A 4A23A 2HRQA 1YJBA 1O5OA 3P9ZA 5KHAA 4XYMA 1IY9A 1SVNA 4YRTA 3VR5H 2H5JA 2I8CA 2FFBA 1RMYA 2JVJA 3DD5A 3BSYA 5FUWA 4EJFA 5G4LA 4HWOA 3G0OA 4R84A 3W2HA 3AILA 1P74A 2G25A 1YA8A 3OICA 4WTOA 1XZHA 1CQ1A 4JLVA 2IZ1A 3OCXA 4YDSA 3WZLA 4F6CA 2VDNB 3P7MA 3EFOA 2B5WA 4K5QA 4ZZ3A 2DU8A 3R3XA 4FCVA 2CZCA 2QWXA 4NZPA 2CLMB 2PJZA 2BFMA 1U8TA 4RV4A 2PRYA 3GJRA 1KYZA 3EODA 4JB2A 3BRSA 4RZSA 3RHFA 3UTDA 4EIWA 1YH3A 3FDXA 4MV0A 4TKUB 5JAUA 3QG5A 4MQLA 5L7YA 4KWCA 1QGOA 3TBHA 5I5EA 2QP4A 1A69A 4ZTZB 1JVSA 5FPHA 4V0MA 2H65A 2DFTA 1H3NA 5AM5A 3DPSA 5K3OA 3UUGA 3RVLA 1BXZA 4IDCA 1IL0A 2V65A 3B2QA 1ZGCA 4WBXC 3ZGOA 3D8TA 3GRRA 3HKDB 3F67A 1F3OA 2HA4A 3K8YA 5TXGA 4C0JA 5BYKA 4NCKA 4JUDX 4WBNF 3SZ3A 4NU5A 1EFUA 3FYHA 5FL7D 1DXYA 2P4UA 2W2KA 4MYHA 5HIKA 2ORWA 2HQBA 3A06A 4CV0A 2KPOA 2FW1A 4FNAA 3U3KA 4BJ3A 4ZDIA 4IQGA 1M2KA 3W4IA 2XCSB 4CEJA 4J2HA 1Z4XA 1ZCZA 2HDNB 3PGVA 1XX6A 2FGJA 1H3FA 1B0ZA 5ARDA 4IDQA 3FKJA 1YJQA 1FVHA 2ZU0C 2EJUA 2XDAA 4KACA 5KYGA 4TUYF 3V42A 3ZCUA 3AM4A 3C2QA 1KJ9A 2NQ2C 2IRWA 5BSKA 1W4LA 3OU2A 5G53C 5HOEA 1NMXA 3ORQA 4P5DA 3BHNA 3TLGA 1B26A 4FMPA 1Z3CA 4OXIA 2YOFA 3ADDA 4S3MA 4YRDA 2QTRA 5AO9A 1KBZA 1YFLA 3ZDDA 2W9XA 1UIMA 2GBCA 3LNCA 3WLMA 2VWGA 3QTTA 4DREA 3QBVA 5E3HA 1BGVA 2MINB 2PBRA 3IJRA 1ZU4A 1DFHA 1EEHA 1TI7A 3P0JA 2X9MA 3KJZA 1POXA 4ZVTA 3WK6A 4XVCA 1GKIA 5HF6A 4WY2A 2JIZA 2O54A 2GB4A 5EO8A 3H11B 3JQ6A 3M2PA 5ICEA 4K1JA 4LF7B 1I7QB 4EJSA 5BURA 4CEIA 5FTWA 2V0CA 1GQ2A 3SF8B 2NZJA 2BTEA 1VKJA 3Q41A 4UVHA 3UGQA 4RK5A 4JVOA 4DXHA 2J9YB 3FZYA 4LMAA 5CTJA 2CLCX 1TUEA 4DJDC 1ISRA 2ZR9A 5JO9A 4UOEA 4MVJG 1NIPA 1XZPA 1RWIA 2ZAIA 5FDFA 1ZJ6A 2HU0A 4NQZA 3UWPA 2D1FA 4DV0B 1C1DA 1D2EA 3G82C 5HE9A 4UTZA 1OXKB 2Q5EA 2ZRHA 3KFXA 3A4MA 3ZHTA 4D3YA 5BYJA 4LY0A 4JDUA 5INTA 2W2LD 2R7LA 2I62A 4LK2A 2M6KA 1X42A 1WVMA 2BLLA 3AZQA 1FNNA 3RQIA 1QAMA 4A82A 1YS4A 4BJ5A 4D42A 1W0KA 3IJPA 3DXZA 3KT8A 1V16A 4Q34A 2V3VA 5KPJA 2XRMA 3O8QB 5ARBA 1L5VA 3CLUC 4IQ8A 4AFNA 3A1UA 3IBCA 1FP4A 1NASA 1W36D 4ERXA 2DJ5A 1KJJA 1QRAA 1H8ED 1T9BA 1YQGA 2PGNA 2WT8A 3DGFC 1YDWA 1QPGA 4V0ME 1RHUA 4ZOLA 3T0IA 1V96A 4Q1BA 1BFUA 3HV0A 3N2KA 5L53A 2IHUA 2F3QA 1ES9A 2ZIGA 3P9YA 5E0OA 2CMGA 3KD3A 1X3SA 1GEEA 4U00A 2AG0A 5CM9C 3T5GA 3N2YA 4D74A 1G6KA 3PC8C 5K05A 5K6AA 3WIUA 4C6RA 4RHTA 1XVAA 3LUGA 4D8UA 4DV4B 3O6VA 4R71A 3GNSA 1V95A 2C2BA 2K4MA 4BEWA 1JPJA 5AOAA 4GLBA 1KY3A 1TM5E 3NNDA 3S8VA 2DWOA 4LV8B 4H4CA 3D3NA 5FOUA 4HQRA 3KETA 4K9DA 1BE1A 4L7DA 2G8NA 3EFHA 2X5XA 4S1NA 3TVTA 4W5HA 2DSOA 2GWHA 4Q24A 3UZUA 4LWPA 4EYEA 2WE7A 3DKRA 5ITZB 1THZA 4A91A 1Z7WA 1RKVA 1R6DA 1U3CA 1KH1A 2F26A 7MHTA 2BUCA 5JNSA 4P2GA 5JXWA 3TZEA 4D9NA 3I8XA 1JEDA 1S96A 2CMFA 1E6WA 1ACLA 4I08A 4IXTA 3QYAA 3JQQA 3QMVA 1NHGA 1PJ3A 2ZLBA 2CUKA 1E8TA 2Q0SA 1OXTA 3H1AA 2E1PA 4XJVA 5EJMA 4J3NA 2I3BA 4OF4A 2PL3A 3S1LA 3SZOA 2GD2A 4CMCA 4F45A 1E3SA 2AOTB 1TYZA 4KE8A 2OQVA 5CGJA 5HDBB 3OFNA 5B2ZA 3KSUA 4M0UA 3ZWBA 3S99A 3I5UA 4IMJB 1OWOA 4ROSA 4QGSA 4KDCA 4BX0A 1DJMA 3V7NA 2WSIA 3EWNA 4NL4H 3GFFA 2RGDA 2QRUA 3IQEA 3FDJA 5B58T 1P3JA 5SICE 4LFCB 3U6BA 2GXAA 3GIDA 3Q2KA 2EGUA 4J43A 4AKSA 3NC1C 4BBZA 3PLAE 3G0HA 2HJRA 3BTOA 1T8SA 2GZ1A 2UDPA 3HCNA 3JVEA 2F27A 1E2HA 4CG3A 3W78A 2EJVA 3LIPA 4J91A 1DKOA 2G8SA 2QJFA 4F4UA 4EGFA 1JKFA 4NAVA 3K0EA 3HLYA 3G2MA 4KIWA 5ALQA 1U3TA 1OH8A 2HJ9A 4XDHA 1NW9B 3O94A 3TZHA 3I9LA 4OJQA 4I5GA 3W8RA 5AXDA 3WWPA 4YJ2B 2WOOA