2IVZA

Structure of tolb in complex with a peptide of the colicin e9 t- domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
397
structure length
392
Chain Sequence
GRPIGVVPFQWAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TOLB
publication title Competitive Recruitment of the Periplasmic Translocation Portal Tolb by a Natively Disordered Domain of Colicin E9
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/hydrolase
total genus 109
structure length 392
sequence length 397
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2ivzA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2ivzA01
3HLHA 2IASA 3WWAA 4HHQA 4HW6A 5GX4A 4HHOA 4GNAA 3G4HA 4ZLRA 4Q1UA 3V65B 1C9UA 3S8ZA 2DSOA 2HQSA 1N7DA 3FVZA 3HLIA 2QE8A 1E1AA 5D9BA 3E5ZA 4IYGA 1CVMA 3V64C 3SOVA 5GTQA 5GX3A 1H6LA 3LI4A 2ISMA 3Q6KA 4DG6A 5D9DA 2GVXA 2W8BA 3IAXA 3WW9A 3Q6PA 1PJXA 2V91A 4GNBA 2W8BB 1NPEA 2OJHA 1C5KA 1CRUA 5GX2A 3LI5A 5D9CA 2GVVA 1QLGA 5GX1A 4GN9A 3BYCA 3SRGA 5EX7A 3TC9A 1CQ1A 2IVZA 1POOA 1RWIA 4R40A 1CRZA 3SOQA 3A9HA 2FPBA 4GN7A 3A9GA 4O5TA 3S94A 3DASA 2FP9A 4GN8A 3FW0A 4O5SA 2IATA 2G8SA 2VAQA 2IAWA 2GVWA 2IAVA 4IMBA 3P5BL 4JMLA 3G4EA 4GNCA 1Q7FA 2IAUA 3KGGA 2DG0A 1RWLA 3V1SA 2FPCA 2IAQA 1QBIA 3Q6TA 5FWWA 1IJQA 2IAOA 3LI3A 3O4PA 4PWZA 4A0PA 2IAXA 2DG1A 3AMRA 3HRPA 2GVUA 3S8VA 3S2KA 2POOA 2GHSA 5GX5A 3U0SA 3DR2A 3KYAA 2P4OA 3SREA 3I1CA 3AMSA 3SOBB 2FP8A 2IAPA 2IARA 1V04A
chains in the Genus database with same CATH superfamily
2AE1A 4DY6A 5LIRA 2CVHA 4E5MA 4WNAB 2V7WA 1OREA 3GVPA 2IDKA 3QX9A 3ED5A 3GU3A 3FLMA 1MQAA 4OHZA 4AJ9A 1H5UA 3EZFA 2NSJA 4DN6A 1KRHA 4F46A 1NMAN 1I8TA 4ABYA 3N0RA 5IXYA 4I1PA 1F06A 3MT0A 5J23A 1O58A 2C92A 5FPQA 4XIOA 3C5VA 4C05A 3C8UA 1YR1A 4EEZA 1KAMA 1Y3HA 2Q4DA 5E7MA 5DLEA 1A95A 3IPAA 4J6EA 3PGLA 2CXUA 3A1TA 4BZXA 1J25A 3PR1A 2XYPA 1VI2A 1T36B 4G2NA 4BVKA 4EO7A 1WCQA 4ZDJA 1J1UA 4ZYXA 4MH0R 1Q74A 3FUXA 3AILA 1KI6A 3ABSB 5FOSA 1R15A 1EA7A 1KO4A 2BDTA 2C20A 2Q49A 3H9CA 1ECBA 2R4UA 3N74A 1CR6A 4MJ3A 1FFAA 1C5KA 5E0OA 3HN6A 1GEGA 1Q77A 3EJWA 4C0QC 3ONNA 3K30A 3KVYA 1N92A 3HCDA 5IW8A 4GZOA 2IF2A 1J06A 1G0OA 4BATA 3TCXB 2P9YA 3LYLA 1N2OA 3I01M 3JQ8B 1P80A 4GR4A 4ND8A 1MWEA 2QE7D 3IH5A 1FDTA 2JW5A 2YVUA 1M8PA 5PGMA 2D2VA 1U2DC 4U39A 1UWLA 3ND8A 1AZWA 1E4EA 1XRSB 4TROA 4KLAA 4CQMA 2VR1A 3AUFA 1AGYA 3U49A 4BO3A 5JDCA 4N7BA 4PZ0A 3GUVA 3NHFA 5JU6A 5F33A 3DTVD 2FWMX 4WW0A 5KOHB 3BWCA 2AR0A 5ILGA 3KEGA 4P3PA 5FQNA 3L41A 3RUEA 1HGXA 5IVDA 2OBNA 1PLLA 3A9GA 3MGBA 5HCIA 1IVDA 2L82A 2VDRB 4KZKA 4UVIA 4Y1FA 2CE7A 2PE5A 2LPMA 3NLLA 3PJFA 5AVXA 2TSYB 2YA4A 2ZB6A 4EY6A 5TQ2B 1D6MA 1KZ7B 4XMIA 4UDOA 3T3NA 3GYBA 3P27A 1EGQA 2Z43A 3VR1A 5IH3A 3VOSA 5DE3A 3ZUGA 3Q3VA 5CG2A 1WW2A 2W4IA 3C6BA 2YL2A 3FYUB 5DHRA 5EQTA 5KWJA 1L3BA 1VE6A 2H2GA 3CH4B 3EVFA 3IEKA 3UJCA 1LSOA 2ZR7A 3OQIA 4UE2A 5IDWA 1AQLA 4BB5A 3GIDA 4A8JA 4H0CA 2I3BA 3EFHA 1SY7A 4R01A 2CW5A 2JH3A 2Q4OA 2IAXA 1G8FA 3RGWS 5A2QA 3WDMA 4J9TA 3G0DA 3Q7SA 4M8NE 4XWYA 1D1TA 5A1JA 5AM1A 5FLYA 3RJMA 1YT5A 1EVKA 1L4NA 2E5WA 3THYA 1Z4PX 3N9IA 3JARA 3SJUA 5LN1A 1HO3A 3BYZA 4UXIA 4RWZA 1DAGA 2G9RA 3HY4A 1E20A 2VHJA 1IZ9A 1TTHA 1SOWA 2PX0A 2Q4BA 3AHFA 1GNTA 3ZEAA 4DJAA 3KB8A 3K9LA 3TDNA 1QG0A 2EBWA 4EFDA 3TEFA 2WSIA 3AR8A 3WRYC 1S01A 3LOQA 3GUUA 4PZPA 3PDJA 1TZJA 5JD5A 3CTPA 4ZVRA 5JQWA 3PGVA 1DBIA 5BP7A 2IHKA 1W5AA 4CCAA 2ZSHA 3TOXA 5G3ZA 4AO6A 5D01A 4NYMQ 2VK8A 4QDXA 3V1MA 5GGYA 1ZYUA 4D3SA 4EPVA 1PLKA 1SXJB 1RHJA 3ZHBA 2AZTA 3EDOA 1F20A 2HTQA 1A4IA 3O8NA 4EH1A 1UINA 2VZEA 3CY6A 3EPRA 4JC8A 4R1UA 3PXGA 1ZRSA 5BT8A 4R9RA 3O4JA 5DH9A 4DJEC 5LYJB 4HC4A 3OUZA 4I4TB 1FSPA 2NACA 3JD1A 1JQBA 4BEBA 3GDFA 4J91A 3TSYA 3VZDA 3GMSA 3ERCA 3QU4A 3QU9A 2PZFA 4QD3A 5ER9A 1NUHA 3VVLA 2ONCA 4RTSA 1F12A 5U9CA 2BEVA 3BWBA 4JVSB 4OJKA 5ENDA 1Q5PA 4A27A 4YP1A 4YCSA 1CZRA 5JXWA 3B2EA 3KPWA 4GZPA 5D9CA 1PZNA 2FR1A 3QWAA 4LAFA 2COUA 3LVQE 5AVOA 1KDVA 1VA4A 1T2UA 1WCV1 3PC8C 3IBFA 1FXSA 4YHBA 1ECCA 2FEWB 2FSVA 2Z95A 3NV9A 4EB6A 2H2HA 3BRSA 4G4JA 1Z4LA 1M72A 2JDID 1E18A 4IJKA 4O25A 5G4LA 4DDHA 5IS2A 2DT5A 4R1QA 5F1KA 4UOEA 3B6MA 3I72A 3SZ3A 3HK2A 2C59A 2Z2KA 4QODA 2H7XA 1CUHA 4HNTA 3MJSA 3KJZA 1BE6A 4G2TA 4B2LA 1EWKA 1FOEB 2BKAA 5GM1A 4GZMA 1USGA 1OWLA 1NX6A 2WJWA 5EZYF 5M34A 3ER8A 4OHYA 3O1HB 4TYWA 4YW1A 2NPIA 2VVTA 1ENYA 4TQUS 5EC8A 4CGZA 1J23A 4ZOLA 1UADA 3R0ZA 4FFPA 3UKJA 4CM8A 4MVJM 4HZWA 4TXHA 4D2IA 1JR3A 1EE9A 1TVKA 2QM8A 4U7DA 4XOUA 1GAJA 4MDEA 3Q7QA 2VXBA 1O03A 3FUCA 2QSZA 1VIDA 1LSUA 1XI2A 4ZJUA 3NBAA 1DBSA 5EHGA 2P9TA 3OUTA 1J2JA 3PDIA 5K4GA 2O0LA 5EJ5A 1EK1A 1VHDA 3UIEA 4QVKA 1Z75A 1E3SA 1NF3A 3KUDA 3ZS9A 4BNDA 5BNZA 1T8YA 3D7KA 1ZVKA 3AHIA 1YGPA 4RPHA 1Z2EA 5ED4A 2RGNC 5FWWA 1P1FA 3MS4A 2HN9A 1QGOA 3HM2A 1CUUA 2ZGVA 1AJEA 2ORWA 4RZSA 2PT6A 5BSHA 3FPCA 5EYPA 3VJKA 4DA7A 1VSBA 4G4GA 3MM4A 5JYCA 3R0JA 1KFCB 4EHKA 4CETA 3VU9B 2GLXA 4F6LA 1M2EA 3AUUA 4LGVA 1QE3A 4FQ7A 4XIFA 3EGCA 4NU5A 3AU9A 2QSUA 1Z2CA 1JJFA 2ID8A 4F4HA 4F3TA 1XCMA 3T7SA 4F9GA 1HZJA 4G8DA 4O1HA 4Y1GA 2YIJA 2QUIA 1QUFA 4UFOA 1V7QA 4HQRA 4B7AA 4Z49A 3ZGDA 5DPMA 4DLLA 2DTDA 3TI6A 1DZIA 1TAQA 4FPEA 2I4IA 2QZSA 2A6PA 2M98A 4RD1A 1KDYA 4M1EA 4ENWA 2C1XA 5C3UA 3RTBA 4QLOA 3ZZ0A 4FHCA 5H81A 2PM8A 2C3OA 1HT2E 1DTEA 2B5VA 1X6VA 2OFFA 5TNXA 3EVZA 5A05A 2O2SA 3KVVA 1RLOA 1EX1A 3UJAA 2JJ1D 4FYWA 3CO0S 1LJLA 1YVEI 1QHNA 1U5AA 2JGFA 2V9CA 3A06A 5AFSA 2COEA 2B83A 1NTRA 1RYHA 2J9ZB 1GILA 1YNSA 1QV7A 3GPCA 2RONA 4OQLA 2Z6AA 2GBCA 2X8BA 4HB0A 1XTIA 2JIRA 1IUPA 3EUAA 1D2MA 1PW7A 2QTTA 4LOLA 4U2KA 3T52A 4OK5A 4ZCTA 2QD4A 4BBZA 1CJVC 1MEEA 2OV4A 4QXPA 2IHYA 2WFAA 3CA8A 1LPBB 2C5LA 1DUVG 2I4OA 9LDBA 3E9QA 4KQJA 2OHOA 1Y8QA 4GO1A 1PO7A 4FC6A 2A5JA 5HMMA 5KYXA 2NTNA 2RGAA 1G21A 4KAJA 1RCFA 2YIMA 1NNAA 1H2HA 4CBVA 2ACWA 2GXAA 1L4LA 1TD1A 2JIQA 4PSUA 5NULA 1B74A 1MO6A 3BIOA 2O2IA 2OO5A 4J0DA 1P2GA 1XGKA 1DLIA 1CSEE 1XTJA 1I6LA 2BFFB 2GETA 4NOLA 3SRGA 4JX9A 1E0DA 3HSKA 1U2GC 5AI4A 3QY9A 4UPEA 4JXJA 5LIPA 1N33B 3WADA 4EGJA 5A7HA 4QUBA 1P1IA 3P4YA 4M8LA 5KPJA 1V4NA 1ND6A 4ZYUA 1E66A 1AIPA 1U7TA 2HBZA 1XSEA 2O1XA 5BUQA 2ZAMA 4AKGA 3I6IA 2XUKA 2J67A 4AZ0A 3KKPA 1CB7A 4ZYWA 1B7GO 3WHKA 4GPBA 5M7EA 3CWCA 3GA7A 3L82B 4NYMR 4AG6A 2WBLC 4MWVA 1OB5A 2VYCA 5JCOC 5A5FA 1DEHA 1RKBA 2DLDA 2NAFA 2CLIB 3ED1A 1JE0A 5DYGA 2FZGA 5LXTF 2IP4A 4KDFA 3SFZA 4DOMA 4PZDA 1NSDA 4AN0A 1BCSA 3A1DA 4ZOAA 2EATA 2GJ8A 2GYUA 4AJHA 3LF2A 4BRZA 5DBOA 2XT9A 3PIRA 1LDGA 5C35A 2YR0A 2PVCA 1L4GA 1TJ4A 1FTWA 1FMLA 3ME5A 4Q39A 1E1RA 1EFRD 1OZGA 4ZI5A 2JGNA 4HH3C 2OK7A 1ZIDA 3F9RA 3WL3A 1JEYB 3ZY3A 4SLIA 4K9QA 2G7ZA 1BMFD 3S8EA 2DTEA 2XYHA 3DMPA 3TQQA 5H4GA 2IYFA 2D4HA 1AXRA 1BXRB 1UUFA 4IIGA 4UNPA 4CG3A 3TAUA 4LY0A 3U56A 2DG1A 3FFBA 4IICA 5B6IA 4Q02A 3BCRA 4AKTA 4P7GA 1W8NA 1I4WA 4EI9A 3VNUA 1I32A 2HEGA 3PQFA 3ZYZA 4FOQA 4YRBA 3ECSA 2P2ZA 2YV3A 1Q50A 4LNUB 4MRVA 3X1WA 3V7YA 5EI5A 1QAQA 5FBQB 1ISFA 1TCAA 3NBXX 4WA8A 4MAAA 2ZYSA 4LBVA 5B3KA 2K5UA 1P1KA 2F9LA 1UR5A 2ZIAA 2OV6A 3MRTA 5DP2A 4FK8A 1WV0A 3D3NA 4OH7A 1GUYA 4RVSA 4FI3C 4HN2A 5I7HA 1ZG3A 2OD7A 1WP5A 1E2KA 2G04A 5CLQA 4QG7A 4EYOA 3ZLBA 2Q5LA 2P0YA 4QGAA 4RXMA 5KX5A 2GN1A 4MZAA 2Y67A 2DSOA 3E6AA 3FZQA 5HJ7A 1UF9A 5I7EA 1HQKA 4ZJZA 3KOMA 2JIMA 3PFBA 4FBLA 5CFRA 1T24A 4PZUA 1FPQA 1GNSA 3QYPA 4DM4A 2F43A 4U5XA 3PNQA 5ES4B 4FDUA 1Z68A 5BQXA 1GTRA 4BV8A 3WIEA 2DXIA 3P4UA 4OHBA 1B9SA 3OFSA 3K15A 3JVDA 2IQ5A 3W8FA 3KR1A 5K6AC 5A0VA 3HJNA 4HUTA 1R7RA 3DDOA 1NQWA 1ES9A 4JL5A 4MULA 4BNMA 2XB8A 4X7PA 5FI0B 1QZUA 3UPUA 1Z12A 1WIWA 4OA5A 1JQLB 2EP5A 1RE1A 2XMGA 3L7YA 4IJVA 2FWIA 5C37A 4HDOB 4REOA 5LMUB 1ZVVA 3IQWA 4MW9A 2WUFA 3U9LA 3ABRB 2CVQA 4BMZA 1DQNA 1WXQA 3CN9A 1ZVMA 4JCCA 4IDNA 5JJBA 3V55A 1UL1X 4L28A 4B3DA 1KQNA 1QH1A 2ORVA 3DV2A 1JRLA 3KXKA 2AKAB 1PVDA 2QM0A 4TTJA 1OV4A 1C8KA 1YZTA 3KHUA 3MWFA 3BEOA 3KKOA 5FWXA 3U7RA 3EZ9A 2Q7XA 1IEQA 3S2SA 1GCAA 3AQIA 1AB5A 1ZBDA 4OI2A 1CVLA 3DGFC 4NP6A 3GLGB 1GIAA 3K1TA 4Z2AA 4NMXB 2XUGA 2GAFA 3ZHQA 4RK5A 4BVBA 1D8TA 4Y7CA 4B87A 5HKBA 3VDRA 1VC2A 3SYLA 4B7ZA 3G5AA 4EVIA 2JZCA 2E4XA 5FWYA 1IATA 4REQA 2WHYA 5DEIA 5IC4A 1A4XA 3L8EA 3PDHA 1L7AA 1KZ4A 3NOVA 4B7NA 1SLIA 3AXTA 3F0TA 1UJNA 3MB5A 4DLXA 5BOSA 2PBLA 5BMOA 1TMYA 2EZ4A 4YMTA 5BNTA 4XYMA 4HGOA 2F4NA 3ELYA 3IHTA 1LVUA 1Y7IA 4I2VA 3AR4A 3CF0A 5DXFA 1LS6A 2A5DA 3KVOA 5KNBD 2QRMA 3DKPA 5CNJA 3TNFA 3LA6A 4BDSA 1HI9A 1YKFA 1M2NA 3TPZA 1Q11A 4MWQA 5HKLA 3GB9A 4U02A 3ENWA 3FBWA 4YI3A 2CLDX 2AFHE 4ZVSA 4KN9S 1U3TA 1K6IA 2MSCB 2JJYA 1UBMS 3GLFE 4QQ8A 4EPRA 2QP4A 1NV9A 3H5VA 1U9ZA 3IP9A 1J42A 3LOPA 4RU1A 5IJAA 1Z4NA 5CX4A 3A11A 5EJ7A 2CMDA 3H1BA 3HU5A 4YUWA 5HRUA 3G88A 1I0LA 1WSBA 4BO2A 1HXHA 5ALHA 1X94A 5SY6A 5TRTA 1USIA 4HKTA 1IHOA 3FRIA 1DWQA 2X8LA 2WD8A 3NBQA 3JYQA 3CISA 2CMLA 2HT8A 1T43A 1E3JA 2L0XA 3OJWA 1RQGA 4JENA 5AOCA 3W5CA 4M55A 5KHLB 2GT1A 2V8OA 2ZJ6A 4ODIA 1ZD8A 4A0SA 1EIZA 4B73A 2WR8A 2P4QA 4I5FA 1G20A 4K9OA 1BWSA 3IA2A 3M33A 2R87A 1T6BY 3DNPA 1Z45A 3NTLA 5ADHA 1HNZB 4UMDA 5HF5A 1YAHA 1AE1A 4MUYA 3W6PA 1YZGA 4P6VF 3C6ZA 3HABA 3IR5A 2CXTA 1PGQA 1PGPA 4D6PA 3D59A 2O52A 4OD0A 5DP1A 3VJLA 4AQYB 4FNAA 5JI2E 2BCEA 3COWA 2FEPA 1PT7A 2D1YA 1Y7LA 2HWYA 2P75A 2XYVA 1N7DA 2QWJA 2A0KA 3PBKA 3SBOA 3W2TA 3PJRA 3IDFA 1QWOA 3FI9A 1B8UA 1CQXA 2WJIA 1Q3KA 3WXBA 4LGYA 1FVOA 4D0NA 2FQWA 1PFYA 5EP2A 4DEXA 4KITB 5F9TA 2WSYB 1G9XA 2HH9A 3KKLA 2AEPA 1T1EA 2RGWA 3JASA 1YS7A 2ISMA 2ORYA 1HMPA 2FQQA 2F3PA 1S4QA 2RGUA 3DHNA 1AGXA 1VLMA 4C03A 3C6QA 3CNHA 5CT9A 1MG5A 1C29B 2IXBA 2FN8A 2HOQA 3P2IA 2HV9A 1HG1A 4FB5A 4F3NA 1JG4A 2FG5A 1U98A 4WK6A 3W3AD 1VJ1A 5TX7A 1SCKA 1R9JA 1LBEA 4MGYR 3I04M 2JHGA 2BC9A 4N41A 2JL1A 2Q6TA 1I7SB 3RS0A 1M83A 3DNMA 5DSTA 1NULA 1Z0ZA 2Z1NA 3I6BA 4F2WA 5LL6P 3DAOA 3U61B 5EX7A 3CWQA 2WOJA 4RKQA 5CGZA 1YU9A 3FUVA 1Z18A 1JU4A 2C42A 3LUCA 4BLRA 3UAGA 3IMFA 5CEFA 3KQHA 2X4GA 1RRFA 1RWNA 2Q3LA 1MB9A 1OGIA 3E7FA 5HUKA 4Q3EA 3TZBA 3SOQA 3LQYA 3FSGD 5B36A 4KSYA 1W73A 2JJQA 2Q2OA 1G4HA 1SU6A 2QSYA 3QBVA 4Q15A 1Z6YA 2FUCA 4BWFB 5CUQA 1ZCAA 4GGOA 5B57C 1N7JA 1HMYA 1YI1A 2J5KA 3P0FA 4OUDB 5A5DA 1KYZA 1BMDA 1JLLB 1NSFA 4EDFA 2O57A 3EPLA 5AW1A 2IYLD 2ZOSA 2HNAA 5DWVA 5G3YA 1YZQA 1JA0A 3KKMA 3TOCA 1NE2A 1TEHA 5REQB 1HLFA 3HCRA 5FR1A 3ADBA 1NUQA 2ETXA 3LS2A 4CFSA 3LLCA 4XJ9A 1LK5A 1XU9A 4R8KA 5BQOA 1V16B 2FR0A 2JI9A 1IAVA 3RU3A 4Z4GA 2R0QC 3S7ZA 3MGCA 1XZEA 2FW8A 2GN0A 1S2LA 4FBMA 1JZTA 1Z35A 2Y4NA 4B4WA 1UM9A 3W1EA 4K1IA 2J0UB 3ICQB 1HFWA 2BP7A 4XIGS 3RYFB 1BH2A 5DTMA 5TJ9A 3K9FC 1Z0DA 2VL7A 2ZULA 5IHXA 4FPOB 5JWOA 2PRYA 1AB6A 1NMSA 2A9OA 4UAJA 4N1AA 4BVFA 5H9VA 4I8IA 2X1LA 3URKA 1ZXXA 3O03A 4LXTA 3L6DA 5BUCA 1E1CA 1QKIA 4EG5A 1AXEA 5E9JA 2BMFA 3GELA 3IELA 4BEWA 1HZZC 5LWHA 1Q0HA 3ECCA 3FWKA 2XHZA 5F12A 3FYSA 4EL5A 4M4UA 1EQUA 1TJNA 4MYTA 4LVOA 4ZTZB 3AVYA 1IC6A 2ZIZA 5B4UA 2IDMA 3IT0A 2CNKA 4CNQA 3ACCA 2GSDA 1E6UA 3TH5A 2GBPA 1OX5A 4BTLA 3IPXA 1IQ0A 3N0TA 4I5DA 6REQA 2Q3FA 3DP9A 3RIGA 3FBTA 2FMHA 2QRGA 5FOQA 3KX2A 2BZDA 1QVAA 3C5EA 4GZXA 1AZTA 3BHJA 5B1HA 5E3HA 5BV8A 4JBIA 2JLYA 1GCGA 3HHEA 3N7UA 3N1UA 3O91A 1K97A 2B8EA 4RY2A 4D6XA 1Q1QA 3DLIA 3L1JA 4KR6A 2BFNA 3GNLA 3QYAA 4RQTA 3S27A 4LQLA 2PGOA 1G9SA 3D0QA 4HAYA 2IX3A 3CPEA 2VXOA 2ZKLA 2G72A 3V42A 4KQFA 1ZITA 2MOKA 1Q7CA 2FGKA 3EFEA 3QLTA 1NMZA 1R16A 4RX1A 5DNAA 1RYFA 1CP3A 4W9MC 5C5CA 2P5YA 1XZPA 2PMCA 1C4XA 2YWEA 1D6NA 1EAMA 2ODBA 2WOOA 3NDJA 3W8NA 1W6UA 2H2DA 5BV7A 3ITEA 3TECE 1Z4IA 2HEIA 3D6HA 2AWOA 4BX9A 1TYBE 1VQ1A 2A30A 2FZ4A 1EGAA 1UOQA 3ZHTA 4TV8A 4MV3A 2VSQA 4MUFA 2MIIA 2XGJA 2HTUA 5K0BA 5B3JC 3QVTA 3SFVA 4RFLA 2A14A 2W98A 4C4RA 4QUAA 3ZD9A 5AVTA 1ISGA 3MELA 1FE8A 3OP1A 3KL2A 5TLSA 5AXAA 1S8OA 3QLVC 4ZT6A 1IBSA 4PC3A 5IAEA 1B8PA 4DQKA 2VATA 4L7VA 3KEOA 2GZSA 1RJFA 1N6DA 1IK6A 1GNLA 3UGQA 4IFNX 2AL7A 3IS3A 3WGIA 5UKDA 1NBMD 3EZNA 3V8PA 2XXAB 3FWYA 1M34E 3RROA 3DAGA 3KS9A 3MFYA 1L9XA 2CBXA 1E3DA 3QPAA 4OQFA 3G49A 1TMOA 3DTYA 4QRHA 5CBPB 2D7DA 4QREA 1U3GA 3R3UA 3P9PA 3QA3E 4ZDKA 4QUIA 5ICGA 5DBFA 1LBQA 1SU7A 2BFDA 3G1UA 4UREA 4K1HA 5TT1A 4H3VA 3QXXA 1M8FA 4J1NA 4GKKB 4OXIA 3Q15C 4K3UA 4BBPA 1TZ2A 1DJNA 7REQB 2DGDA 2ES4A 2GZDA 1D03A 1EJ6A 4QNRA 5IVIA 2E6UX 2J4CA 2OHVA 2XDYA 3OA2A 4FEYA 4HDMB 4XB1A 4ZARA 5FOUA 2FLKA 3NHRA 1VCHA 3GBSA 2W2XA 3AR9A 4HTFA 1KGSA 3WNBA 5D3KA 1JFSA 3ELDA 1FTSA 2JH9A 5L9AA 3N2ZB 4Q7JB 3V7FA 2IAWA 2WAOA 2VYVA 4YASA 5AI0A 3C8DA 3TB6A 2CFCA 3D81A 1KEKA 4J07A 2GRUA 3W4IA 5CFQA 2AH2A 5IARA 3TQHA 4I4CA 1XVUA 3MNFA 1NFRA 1FB5A 2H57A 3NIBA 3OT1B 5AR1A 5C8YB 1MCZA 1XJQA 5CLIA 4I55F 4MWTA 4QUJA 4MVWA 1USKA 5DHPA 4CMIA 1CUCA 2IAQA 1Z5WA 2DKOA 2ZSUA 5FFNA 4ESOA 1V3EA 1WL8A 2DUWA 1K2VN 2PKYX 4UDXX 5A0FA 2GRAA 4DCTA 4E32A 3ZDCA 1ZK2A 4PHTA 2Q0HA 4Z4CA 3AUYA 1WSDA 1UMKA 1Z0UA 2B0CA 1TUEA 2F1HA 5K3FB 1X0XA 3NEYA 1QQ5A 3PEEA 4I50F 3ASZA 2P65A 3ABZA 3CYFA 3PXAA 3TZQA 2EVWX 3DS8A 4B8WA 2PSFA 4RXUA 3P9RA 4X91A 3LY5A 3AEKB 4FEEA 1TT5A 1UZAA 2Z98A 4GVXA 1TLFA 4ID9A 5FBKA 5DB4A 4MZDA 2EZ9A 3W6ZA 2X40A 1VDZA 2Z2YA 1OC4A 3LT0A 4DKJA 3KU4A 3GFSA 3TZKA 2O8CA 4UNQA 1FA9A 2A94A 2GBFA 3LQRA 4OYRA 3VPXA 1T9KA 1GKLA 1OVMA 3KCNA 5FNSA 2ZSAA 2P9BA 3BJMA 1N1YA 4U3JB 3WBFA 1WDTA 1Z22A 2EKZA 4BASA 3R3ZA 4FIZA 3RYIA 1DXHA 1WDKA 1E6KA 3IIIA 1M6YA 3L77A 4O4LA 1F9EA 2IP2A 3WLKX 4BJ5A 5IX8A 3T7KA 1IBMB 3W5BA 5A2GA 2XY4A 3RBAA 1XZQA 3EG9A 1JIUA 2DFKB 3AOGA 3DBRA 5CIYA 5JBQA 4A16A 2WTNA 4L7QA 3QXJA 3OMLA 3L43A 3CN7A 3I01A 4ECEA 2IIVA 3EMDA 3GNTA 2FWAA 3GJXC 1MDBA 1XLWA 2Q0QA 5K4AA 2V98A 3SC2B 4V0ME 2HXGA 5JCZA 1XZHA 4WY2A 4XPIA 4YYEA 5BR1A 2MYPA 5G4KB 2KW5A 5GX3A 2ZYHA 2CLOB 1WRBA 4B6RA 3OLCX 2W6IA 3PDUA 4D4HA 1JDVA 2OD2A 3V6LA 4D9KA 5ESDA 2B7LA 2C04A 4DG6A 5CHYA 5GONF 1XCPA 5CDFE 1ODKA 2JHCA 1K5HA 2FPKA 5JG7A 2WSSA 1IHUA 2CJWB 3OZGA 1JYSA 1W1IA 2B4AA 3T94A 5JZOA 2JGEA 1G0NA 2A9FA 5IK2A 5BYAA 2AQHA 3INBA 4Q1CA 1PR1A 3D4BA 2L19A 3KJQA 4MZXA 5AVWA 1U81A 3DWEX 4UTPA 2CDRA 3TRDA 4LX8A 1RIFA 3VFDA 1HBJA 1NOJA 2PZJA 3IODA 3P5BA 4FZRA 2VTBB 1QLGA 3DPUA 1KEPA 4LVCA 1SRRA 4GC9A 4HJRA 3BL5A 2BZGA 4BGEA 4Q3AA 2AXPA 4X20A 3OUUA 3PEUA 3AR5A 3EZGA 3L01A 4YZ5A 1YO6A 2V7QA 2VKTA 3B5IA 4KODA 1YRLA 2O9JA 4R84A 5T3UA 1DAOA 1J8YF 1HOTA 1JR3E 3DMHA 3L0ZA 4MQUA 2ONKA 3AC0A 4GMHA 4F86A 5FPPA 3GBVA 4OLHA 4RZUA 1N1TA 1N6HA 1SK8A 3ABIA 2FN3A 2BMAA 1KSJA 2RHDA 3JYLA 3TMAA 3ASVA 2DUUA 4XZ3A 4LQ4A 1BIFA 3TZEA 3EARA 4OLAA 4E1VA 2H2NA 3PC4A 3D1JA 4KIWA 2FF5A 2VNJA 1QYRA 5C8ZA 4JI0B 1XX6A 1L5VA 2R2AA 2XMPA 4TVOA 5JSZB 5FNTA 2MJLA 4FJ1A 4M0FA 1VIAA 1XHFA 3L4KA 2PMDA 2VAXA 3M6LA 3I0MA 1GM5A 4BX8A 4OHVA 2XNCA 1H1TA 1K06A 2UZAA 5AWFC 2IUFA 2W2TA 5COAA 3V1SA 1JAYA 1NW9B 3VX3A 3OJLA 1YQQA 3CUKA 1Z4MA 3IIEA 4YGXB 1O9GA 3OTWA 4BLOA 2W9XA 1QG2A 1FLDA 3NTQA 1RQRA 4UTOA 5DX0A 4E3WA 4K9RA 5E4TA 1E4OA 1EJ0A 2BKUA 4UCQA 3UY4A 1U2QA 3GEIA 3OC6A 3OE5A 4ZAWA 4D4IA 2HU8A 2QW8A 3ZLUA 4TQ9A 1QRRA 2VPWA 3EQ7A 4Y6SA 3M6AA 3A05A 4OTZA 5F78A 5HOQA 4TTPA 4IIHA 3TE7A 4UE6A 3GA0A 1OLSB 3HU2A 1PR4A 1RI5A 3G2MA 2IDZA 3ZE0B 3S4YA 2X9LA 3VOAA 1N5IA 2VCHA 4ZAZA 3SOBB 5A5EA 4CEHA 2BR3A 4A9AA 3JQQA 5HBRA 3MSXA 1AS0A 1VKZA 2EL9A 4DQUA 1CY8A 4HB3A 4TX1A 4Y6OA 1JHQA 4QXAA 1Y4UA 1ZOSA 3R8FA 1PFQA 1W36C 3EAFA 3K70C 1QS0A 1LI4A 4CR8A 2ENWA 1NRJB 4II2A 1V11B 3UJ3X 4CM4B 2P7HA 1LDMA 2FK8A 2OEPA 1KQGA 3G17A 3TUZC 2I67A 4KSCA 5AMXA 1U0EA 2DWCA 4D41A 3K5PA 4HXYA 3EIWA 1ZJJA 3LHKA 2DAPA 1N3YA 3O9VA 4GDFA 4A6PA 2YJZA 2QGZA 3ZY5A 5ALUA 4A6XA 3AEQA 2PUCA 1SBCA 1G2PA 1E1AA 2H5LA 4H3SA 1M2WA 1UPBA 1YCFA 5HCNA 5U4QA 1OLOA 4FN5A 1FFWA 1J97A 5JLJA 2BGNA 2WIJA 4OHWA 1V96A 2FPGB 3FOCA 3ONVA 2AEJA 3KQNA 1YBMA 3RLIA 4D3ZA 4HK4A 5C53B 4MJLA 4WVLA 4CKWB 5JS8A 3SJCA 1FSSA 4IJUA 1TA0A 1D1SA 4K9KA 3ZGOA 4LCEA 5E95A 2XPCA 1VGVA 3UJ7A 3EHDA 4JUBA 5FTJA 5K8CA 4EY5A 4CXMA 1ZNZA 3ZDAA 4C78A 3UXHA 4UULA 1I36A 5JAUA 5BWOA 3FF1A 2Z4RA 4M87A 3DVAA 2PPLA 1P5ZB 1NJFA 1T5HX 4UUOA 2V3VA 5IN4A 3JWIA 3NN9A 3AJRA 3PUIA 1TEVA 2I3AA 4U9HS 4YROA 2IYUA 1PR6A 1UOEA 1HQDA 2MTBA 2AGSA 1WUJS 4MS4B 1ISIA 1W94A 3KUUA 2BTOA 4NEHB 4B3XA 3VHLB 3IMCA 4R9VA 2ZSFA 2B3TA 1V39A 5DYYA 2IKQA 1JR6A 4B3FX 3C6XA 4Q9KA 4GZSA 2Z4SA 3ADPA 2QGFA 3OX2A 1XRQA 1Z5ZA 1IH8A 4DS3A 4E5PA 3D6JA 4BWVA 1FP6A 2JCGA 1FTGA 3CNOA 1SCIA 4MKFA 1XDDA 5I9NA 3K96A 3RUDA 1V2GA 4Z0NA 1T9GS 2QQ0A 4JEUA 4IH4A 4TS4A 4KQXA 2GBLC 1JBEA 1NI5A 2HAEA 5FUWA 2H1LA 3JQPA 1B2LA 4TRNA 5CH5A 4MV9A 3WTBA 1SVMA 2I1WA 3THSA 4WEGA 3LI2A 4LPKA 1TAHA 3BE6A 5IBRA 1IUNA 1I1OA 4XQEA 2QVLA 3E18A 3PX7A 2C2YA 4KR9A 1G8HA 3CLHA 3RTCA 2EFDB 5G0UA 3OZRA 1T9AA 3DAYA 1V4BA 4IZ6A 1NA5A 1P39A 1SOAA 3HRHA 4LN1A 5FCDA 3QOYA 1DELA 4XJTA 1JPUA 4XWOA 3NPMA 3M70A 1RD4A 4NCIA 3FWHA 3R44A 1Y6ZA 2FWJA 4NJMA 5GAJA 4D9NA 3T7EA 4ZXPA 1ZS9A 2I1VB 3U1VA 1SO8A 3RUIA 1YXMA 1EJ2A 4IMRA 4RVFA 5AVVA 4JJGA 1J7JA 3NO4A 1C0LA 4LNAA 2PKCA 4HNGA 4O3FA 3L06A 4YJFA 5AK0A 3BL6A 3T9CA 5KTNA 4UM7A 2PGJA 3CUWA 4MRRA 4UATA 3TNYA 2XNDA 1JFVA 3OZIA 3BDIA 3R24A 5LOVB 3SEFA 2VYND 2C7QA 2GN4A 3NHZA 4J6FA 2VK7A 4MROA 1RJ9B 1PJCA 4TVKA 2FOIA 3U3OA 3JYNA 5KTPA 1VG1A 5A4JA 2OKGA 2N75A 4KN8A 2AMVA 2FSIA 3E15A 3PZBA 4WNAA 2JC3A 1MVOA 1JDSA 2JBHA 2GLTA 4M21A 4NBKA 3I58A 2SNIE 1YH3A 2IFTA 4YAWA 3TLCA 3RK4A 4ACAA 1MN6A 3EYAA 1OQAA 2WHXA 4UC0A 2UYOA 1DIMA 3WX0A 1T0UA 2OYCA 2Z57A 3OM8A 1SBYA 1W581 1W0KD 4L9SA 3RYCB 1RQNA 3ZZMA 3F8TA 5IKOA 2RE8A 4IGAA 1Y6FA 1T6NA 2NU8B 4D82A 3FMOB 4XDYA 4OQMA 1XDUA 1II8B 4CM3A 4JP1A 4XXHA 1N57A 2NSLA 4ZJPA 4CHGA 3DBIA 4J9UE 1NZDA 3AIOA 3KQWA 2G28A 1YB2A 2H5IA 3K6JA 5ALIA 5BVHB 3L05A 1O77A 4DT1B 1ILEA 4UBJA 4YBRA 3CG4A 4MI9A 4ZZ3A 1V5WA 4J8PA 4LZNA 2I5PO 2EZ8A 5EY5B 1DQRA 1PE0A 1W19A 1XTSA 3SBXA 3T7CA 3TLMA 5L4NA 1IEVA 3ANSA 4R9UC 4E33A 4UBIA 1OASA 2B7CA 5TT0A 2ROQA 3VNRA 5GTDA 1XVLA 2F1RA 1MOSA 1SQGA 1FYDA 3U09A 2BERA 4MDYA 4DZRA 1BD4A 1LY1A 4OK3A 1ZUNA 4G9EA 4EGSA 2X7JA 3A6LA 1EK5A 1RWQA 2AQ8A 1PNTA 3HCPA 4S1WA 1CUYA 1WW8A 4QU0A 4XUDA 2X42A 3UHFA 3DXZA 3X1MA 1VBKA 2JFYA 4NF2A 2VWDA 4JWKA 3GUYA 4KQCA 1E3LA 1UEJA 4FILA 4EB8A 4M9SA 1OV6A 1A5SB 1GV1A 2NQTA 4IDHA 1P7YA 4U7GA 5E8JA 3TC9A 1YZ3A 3B1WA 3MAGA 5KOHA 3KAPA 3DFFA 4R1MA 4M60A 5AKYA 4L2IB 4Y9TA 4JLAA 3R0VA 5BMVB 3EMBA 4CVNA 2FPXA 3M4ZA 1TRKA 3UWDA 3O3MB 3IEMA 4CFYA 4E4TA 2XA2A 4NFHA 2BF7A 3GOHA 3VDNB 3H0KA 1P18A 1SQ6A 3A4LA 3ZH9B 3LLSA 3UB3A 1G3MA 3BSSA 1EXDA 4AUEA 5TQ2A 3GUHA 3WGZA 4WACA 1TA9A 3BRWA 2IUEA 3F1LA 4G0ZA 2WIKA 5BSVA 3V00A 1E89A 1VHTA 2PSHA 3ADOA 3UK6A 2BUBA 3BZUA 4KH0A 5AKJA 3VZRA 1KJYA 3PIDA 4IP0A 2IXGA 3USCS 2IEYA 2I87A 4YIKA 1R8XA 2NSHA 4MKIA 5I7VA 4TYPA 4EGQA 1C7RA 5LUAA 1W59A 3HFJA 2VDKB 3PC2A 3SOPA 4ER6A 1WHTA 3ITDA 5JFOA 3R7NA 3THXB 2Q07A 5KYTA 5JYEA 2P6RA 4YRFA 2JHAA 2H7YA 5FUQA 1SBIA 3W78A 1L1FA 1EDEA 1VP9A 1Y89A 4ZAGA 5JARA 4MPPA 1H9AA 2OWDA 3TW8B 5GJBA 1G20E 2O8FA 4JI3B 1RABA 3DMGA 1E9AA 2ZQZA 2POOA 3KOYA 4LBWA 2GHSA 4L4ZA 1E3IA 3JRNA 5LD2B 1MT3A 5EA2A 3B6IA 2EARA 4Y9DA 4MKXA 5TSDA 3AERB 5IC6A 3A2KA 2PXAA 2RG1A 3DE3X 2JLZA 1X1EA 4WY5A 3I1JA 3GRPA 1Z36A 3KQTA 4OU4A 2ZYUX 3TR6A 4BKOA 1Z4XA 2DX7A 3VC1A 1Q0SA 2FW7A 2OCBA 3PRKE 1SXJA 2Q41A 3NB0A 4DSUA 3X2SA 1GQSA 2YFKA 5EJEA 1CUBA 3GMDA 3T99A 1R5OA 5HDQA 2BM1A 5LQKA 2R66A 1FUUA 1R4AA 2QTCA 4ND3A 2PMBA 1NUTA 1Z39A 1ZEJA 4OKSA 5EJ9A 3T5PA 3LJKA 1LBHA 3BSFA 4PO9A 1W85B 1NCBN 3RSLA 5MDHA 4GX0A 3AL2A 1GUDA 3EISA 3FVZA 4QHTA 1YRBA 2AG6A 5LYJA 3IOBA 3ZGVA 4QHSA 1XZGA 4I4TA 4BN0A 1R74A 4D9HA 4B6PA 3ILYA 4R6XA 4G0PA 3KHSA 4C6TA 2BFWA 4BMCA 3JQBC 3OPMA 4O2AF 2VO1A 4RV4A 1TC1A 3RABA 1Q0PA 2FXVA 1U0GA 3U37A 4DXDA 2P69A 2YWDA 3HR8A 3R2JA 1RC0A 2ISQA 2RC6A 4AUKA 4BJ6A 1GUZA 4IPTA 2NU7B 3E22B 3S2IA 1XA4A 2JF0A 1V37A 2E4ZA 3R09A 2JAHA 3FY4A 3OX4A 4Y2RA 4YLGA 2UYHA 1UDRA 2GEFA 2VJYA 5A71A 1H9CA 1X1RA 1GAXA 2QE6A 4M1TA 1ZR2A 3STHA 2I54A 3JQFC 1CJUC 1KDRA 1VXRA 2BHTA 2XNSA 3PRJA 5BSGA 2VSNA 1XTTA 2PPVA 1A4GA 1DRKA 3SSMA 3CVYA 4R69A 1GTMA 1JH9A 2JGKA 2X6QA 3DL2A 4H3KB 4WBNF 1YONA 3UHJA 1XQXA 3GGDA 4J1SA 1G5RA 3L1KA 1P2SA 3KPYA 3ZIDA 1IUKA 1EP3B 1UEIA 2CB9A 2IZOA 2GGSA 1RLIA 3SYNA 3RC7A 1W20A 2XN4A 3B51X 4NFSA 1Q22A 3OCUA 3PUZA 1Y9EA 2FW0A 2NNWB 5A03A 4M1ZA 4KN6A 5KTTA 1X7GA 4MS1A 3I2YX 2DLNA 1GZ3A 3KZCA 1RYNA 4P93A 4JC4A 4RCZA 5FNVF 5JNTA 1IN8A 1EEXB 1QFSA 1XELA 1K9SA 1K1EA 2QU7A 4A1OA 2HNBA 3IQHX 4A03A 1S89A 3AJDA 3UGTA 2J1LA 2FVYA 1LD3A 4K6FA 4W5TA 1QU2A 1QIHA 4MVXA 2WHRA 5FLKA 3NHSA 3UAZA 2W2LA 1IQPA 3D2CA 4L51A 4OQYA 4UPDA 3NAQA 3HKDA 3RQIA 5FUMA 5MF6A 2Q6KA 2A3RA 1MS8A 3NZEA 4RETA 4TMKA 2FWRA 2OC4A 4PPFA 4C4SA 5HIAA 5JY6A 2AOTA 3A31A 3MT7A 1I14A 4XVRA 2CDCA 3FGOA 1E2JA 3ZXYA 4DG8A 5HFAA 1W25A 1B0ZA 2OFOA 4XYEA 5K5EA 1J7KA 2XCLA 3BORA 4KUEA 4W99A 2FWPA 1N6NA 5C1IA 2ZJ5A 4FYXA 4MGKR 3VU1A 3CT6A 5AKHA 3UKDA 3PEWA 1PSZA 3VU9A 1N2HA 3P32A 5CYPA 4FJ6A 4B7CA 4B2IA 3DLHA 1O0CA 3GLRA 2I0FA 3COYA 1KP2A 1KEUA 1JSLA 1U1GA 5L7TA 1HSZA 2GR9A 2J4FA 3H11A 3DJYA 1YRYE 3CVOA 4DR1B 1M2KA 2VHZA 4JA0A 2VAWA 4NBVA 4GR9A 4RTOA 1FLAA 4ZOQI 4NC5A 3A1UA 2CHVA 5EPUA 4DJJA 2F1IA 3K1JA 3EDMA 2ZUDA 4J0FA 3SR3A 5TS3A 2IEBA 1W36D 2BRUC 4V1CA 2G7MC 1NVBA 3ND9A 1I1HA 1SD2A 2P9QA 4KRYA 4KWCA 1GG9A 1P5RA 5EXSA 3VZBA 3QEBZ 3IL2A 1G59A 3EF3A 3GGJA 1JXMA 2XBLA 5HQ3B 2FU5C 4K8RB 1NPDA 3CKKA 3P1JA 2ZJ1A 2IEZA 4XWWA 3IERA 3K1AB 1TKBA 2OG1A 1GTJ1 3I04A 4XFJA 1IZ0A 5JSYA 3U3KA 3HUDA 2Y1KA 1VPLA 4LC0A 3BA1A 3GPDG 4PLVA 5AICA 4DLBA 3IV6A 3ER9A 1GNRA 1JZQA 3GJZA 4G0OA 1T5TA 3FCCA 4GG1A 3LBHA 5MFPA 3HP7A 1GLNA 1E92A 1VCOA 1EDBA 1ML4A 2XUZA 3TKAA 4Y2HA 2QTVB 4KLZA 5A3JA 4GS5A 1CIPA 5JANA 4WNCA 4G4IA 3LKVA 3CW9A 4YAFA 2JHPA 3UKOA 3DOCA 5HYVA 2QMUA 4QU5A 4X54A 1QFZA 4IIJB 4DSNA 2X4DA 1Y3BE 3NNSA 3CZCA 3QHAA 1KYWA 1IY9A 1QGYA 1GGEA 3WWPA 1HYQA 1HLPA 1ICIA 1PWEA 3F4BA 3RFXA 1N1DA 1VPVA 3P2MA 4KE8A 5BSWA 5FKJA 1OBHA 2XOKD 3DA8A 1X1SA 1JYEA 3EIOA 4KMSA 4GVLA 1JHXA 3TSZA 5IM5A 1QB7A 4D8XA 1IMOA 4IKEA 3AVPA 3DE0X 1PR5A 1N5KA 1EUTA 1I80A 1NYLA 1ZY2A 2B92A 3KR0A 4HLUA 5AHRA 3PGXA 3ZCRA 4J7XA 4GKJB 3ONWA 2GD0A 1ZJZA 2QX6A 3IVXA 1Z5OA 1JMVA 3L3BA 3DDZX 3QHQA 2GCOB 4PONA 1TQ8A 3C3YA 3QF7A 4WZAA 3WA6A 1PBNA 4D42A 3MG9A 1KA9H 4Y98A 2IYPA 2PS3A 3TLEA 4RZ3A 2JIDA 3HVKA 3IEPA 2GPYA 1Q0TA 1C0KA 3G0CA 5JASA 4IUBS 2BGMA 3PHHA 5KOIA 1UZLA 2VWQA 3R3WA 5K03A 1YJCA 1SEVA 5G40A 4PG5A 2ZAIA 4OG2A 5IANA 1AMNA 2F7SA 5AUPB 2BD0A 2FPUA 4AY3A 1N78A 1K88A 3NP9A 2OE2A 3KLNA 3TTYA 2JATA 9GPBA 4G1CA 1NDQA 3IDQA 2OK8A 4JI6B 2CB0A 2GM3A 4FLEA 3RTEA 4ZA2A 3SQLA 1W0PA 2ACVA 1JEYA 2GO1A 2QWCA 2EU8A 2C3UA 2JHFA 4WXEA 4UU0A 4X66B 1BJKA 4QLAA 5I47A 2R79A 4DCSA 1BXRA 4AQDA 1R4MA 5IASA 2OORC 3UV7A 5HOEA 3ZGZA 2Q1YA 1CVIA 4MIYA 2XIJA 2I6FA 4KO1S 4CLXA 1NIPA 3HL4A 2PZ8A 3C48A 1W76A 4UTVA 3BGWA 3QELB 2BF4A 3RVQA 4A0PA 4HRAA 4LCJA 2B69A 4Q1FA 3QVXA 1Q83A 2PUBA 1XQ1A 1A9SA 2B6NA 4MOWA 3S2KA 4S1NA 2ZYTX 1FRZA 5KKAA 3A6EA 2HIAA 4FPCA 4JCOA 3DT9A 5ULLA 2HMYB 2PXCA 5JDIC 3P5SA 3OY7A 3LXXA 4GFDA 3WDLA 4FU0A 2VVZA 4PZEA 2N0SA 4ZCQA 4RANA 1DDOA 1SXQA 2COKA 5IUKC 2Z2IA 4O29A 4RL4A 3UEOA 4CGYA 4BPBA 3PGMA 4MWGA 2X3UA 2G1PA 4HDKB 1F5NA 2IQIA 3GVKA 1JKMA 3PXUA 4HADA 3BD8A 1I5RA 2DPGA 2P90A 3K0EA 1E9RA 4FFBB 3ICVA 3VR3A 5I51A 5TPZD 3KTFA 4EGAA 1YOVB 1FUKA 4FYHA 4Z8YA 4WAUA 5DMXA 2A1IA 2BGLA 2FUEA 5EZSA 3VX4A 3T3MB 1JDJA 2C0QA 2FZEA 2R62A 4GECA 3ZHXA 3N3AC 3JYOA 1S0IA 1C41A 2QL7A 2HK6A 2OMKA 4FDVA 4C4OA 3E5ZA 1XTQA 2ZBDA 2UUBB 3VYUB 3GP5A 2ZJ3A 3N6VA 5J43A 1Q7EA 5A5VA 1H4SA 1TFRA 3R5TA 1BQEA 3P2JA 1YR6A 1RQLA 4X93A 4B3SB 3VO9A 1KOGA 4Q48A 3TI9A 2BH2A 5JMTA 1CJKC 4YAGA 2HK8A 2ZK7A 3K32A 5FV4A 5AESA 3JXEA 1T0HB 4IUYA 3C7AA 2K2QB 2GVXA 5AW7A 2Q3CA 4ALJA 3TUIC 2W2MA 5IZCC 2VAVA 1PJTA 1I5OA 2AUMA 3G8DA 4GGMX 1PKEA 2NT3A 1XZNA 4M6WB 3H9GA 1VLQA 2VDWB 3EF1A 1PJXA 4GNBA 1WB5A 2FFRA 2PH7A 4NCNA 4UXJA 4D9IA 1Q21A 4EFKA 2ZZNA 1CLEA 4JSTA 1QVZA 4IHJA 4HWSA 5H3CA 3TR5A 1XVAA 2M2IA 4RHTA 3HCOA 2GVVA 4YN3A 2VW0A 1RLJA 3AH8A 3GLGA 3MFQA 2QN2A 4YCAA 1B3BA 1E0JA 4KSBA 4ALLA 3OOHA 1AHHA 2VSKA 1O87A 2IU6A 4UBMA 3RVOA 3K73O 2ST1A 3H4VA 2D2XA 3GZJA 3MT8A 4YALA 3PHLA 4UEWA 4KS5A 1YACA 4XB6B 5CNMA 4HSGA 1FUIA 4CQJA 2NLOA 3MEQA 4F91B 4V03A 5KEIA 2YWBA 1A9PA 1OTXA 2HR1A 3EH1A 2RGCA 1RT9A 4S1PA 1AF4A 1NP6A 4WBSA 4ZCLA 4OYHA 4PHHA 1ZMBA 3QMWA 2Q7OE 1LK7A 1N7IA 4GI5A 4JX8A 5FOWA 3QMVA 3UUWA 1L7EA 1V25A 2AX4A 4YMVA 4L7BA 1JHOA 2C9MA 2F8MA 1RBQA 3UENA 5IRCD 4B76A 2MT9A 4QAJA 3TD9A 1UBTS 3EVNA 2DUJA 4YFYA 2YMPA 5H4HA 1I6WA 2O6LA 2KE5A 3JQGB 3KSZO 2V55B 4OJTA 5GY7A 4CU5A 2PA0A 1V71A 1UDBA 3IRUA 2EOAA 3JR7A 3WAKA 5DW0A 3EIHA 3U3MA 1NHWA 1R6DA 3UH0A 5LQSA 3LO5A 5AP9A 1U63A 1XTBA 1WZ2A 3IGFA 2EJUA 2RHMA 3G9ZA 2DFPA 4AO7A 3ZZ1A 1JKIA 1E6LA 1L7PA 1SIBE 1W8DA 1EMDA 3HJUA 5JPDA 2J5QA 4RK6A 3LRPA 2FRDA 3UNXA 5HJEA 3T38A 3JS5A 1PHRA 4C1YB 1H8HD 5A3VA 2V4ZA 1CKEA 4IQ4A 4L8LA 1K3UB 4D98A 1QFYA 3GL9A 2H8GA 1V4VA 1E98A 3B1VA 3HXPA 1KS9A 2XADA 1MGPA 4Q37A 5AKGA 4GQIA 1SA0B 3VPDA 1ENOA 3LG2A 4P58A 1U8UA 2OXCA 4OB7A 4ESVA 2DB3A 1EFVB 3N76A 2ZRNA 3PV0A 4F7WA 4B2YA 4ZVUA 2F55A 1AUPA 4N5HX 4GKAA 3EVEA 1FU4A 3FF4A 1RTTA 1Z56C 3PUHA 5A9SB 2D3TA 4IX9A 2NP7A 4NMWA 3F5DA 2VJPA 4QXMA 2OLKA 5GOTA 3A14A 3CG0A 1RPTA 4AIRA 5FL7D 3COPA 2BTEA 3M4XA 4D0LB 2OGWA 4H77A 2IGBA 1U7ZA 3FPKA 4OSOA 1JIJA 3SKXA 3CONA 3ICPA 2HB6A 4PYQA 4IF4A 3IEUA 4LMPA 5EGSA 4QFBA 4BMSA 5BWCA 5CFMA 3MLAA 4DHWA 3GEDA 4LQCA 4B4OA 1RAEA 3FOFC 1JWLA 2XZKA 4UCXA 2DBRA 5E7IA 4DR5B 3T4UA 3ONFA 4WT7A 2BMVA 1P33A 5CFNA 1ZIYA 3B36A 1KPGA 5DISB 1E4VA 1Z9BA 3HU1A 4P4TA 2P4UA 3PQDA 2WIFA 4TXLA 4EQ6B 2ZW9A 3MLBA 1N75A 4P2BA 4W6ZA 1W36B 5E6SA 1AO3A 2QLJA 2QL6A 2QTAA 2UVPB 3K70B 2IU4A 4FMCF 2RK6A 4BCDA 3V2GA 1ZGHA 3V8BA 4LZZA 4QGFA 1H2YA 3SVLA 4LC9A 3PITA 1IBLB 1XKLA 4FDTA 4N5IX 1FDVA 4XTRA 3VUEA 2GYWA 3BEDA 1R0KA 2Q3MA 3BFKA 3CNLA 1WDLA 3HUEA 1CDDA 1G19A 2P9EA 1THZA 1NXOA 3L7MA 3CX8A 3OT4A 4HQ6A 4WIAA 3IHWA 1O8CA 5AUNB 5J4KA 1JP7A 4P0PB 4S12A 3AI2A 4WZBB 1M5UA 4UPVA 4W9NC 2X0EA 2Q99A 2HV8A 4M1YA 1EEHA 4ZGBA 3VPBA 4MRMA 3UC1A 5H1YA 1FQJA 2G6BA 2YVLA 3C0KA 3FSJX 2OO3A 4MS3B 3OESA 5CEEA 4OUDA 1I4OA 4GMFA 3EOZA 3NG1A 2SIMA 4ZVNA 2OXTA 3RRXA 2XRYA 3L0OA 3NWBA 3BH6A 3O2JA 5AH0A 4MW4A 5TQVA 2IE8A 3K31A 4K5QA 2GXSA 3AUKA 1FYXA 3DFZA 4JS0A 5CVCA 1RRGA 2P5TB 4FHZA 5K0ZA 4CKBB 1E6CA 1MO5A 4LYJA 1WLSA 3L0DA 4C6HA 3GX1A 4RDIA 1SN7A 1YDEA 1JWAB 3QOFA 1G7TA 4G0NA 1U2TA 1D9ZA 7NN9A 2J0UA 4GPIB 3AFHA 4Z3KA 5DWQA 4LJKA 4H08A 3KE9A 4ZPXA 1K4KA 4DMMA 3ABOB 2FPRA 3BAFA 2J08A 1U8YA 4ZYLA 3ELWA 1Y3IA 3K9GA 5LZ8A 2QORA 5LDGA 3NASA 2PT9A 5DEOA 1INFA 3U1TA 3UT6A 4XVUA 1ZW6A 4CEIA 3E48A 1T2CA 1WTAA 2KB0A 3F5QA 3HB5X 5HKKA 3V6MA 2XVXA 3EQ2A 4GOLD 3U26A 3LRXA 2UZ4A 2WJAA 3KYCB 5HUNA 3EXHC 3V7WA 2X9QA 3RT7A 5JFGA 3KYIB 3I12A 3R5FA 2Q2WA 5BV0A 1AV7A 1J0EA 4LQDA 1ETHA 2JANA 1D8AA 3QSYA 1VCUA 3FROA 3TJRA 1M1YE 2EJWA 1SM4A 2I3GA 2OBMA 4KVZA 5HXAA 1KWKA 3ZJVA 3J7AC 3S1SA 4TT8A 1MZ5A 4QTUB 4CRWB 2J7PD 4IJ6A 3RFTA 4DADA 1E9FA 2VK6A 1EB8A 4R98A 5JQGA 2YQZA 4WCFA 1HLDA 3R3VA 3RFFA 3HA5A 3H7AA 1PLJA 3DEKA 4PY2A 5K0FA 1FYFA 4ASUA 2B99A 4NMLA 4Y2QA 4C7OB 3U48A 3M4YA 1J2EA 1VCIA 4KLRA 3EWIA 4RENA 4DRYA 4ZK2A 3OEEA 1O96A 3RRMA 3AHDA 4NYJQ 3CH5A 4KFTA 3J80A 1TIPA 5GGXA 1P4SA 3A6HA 1H6DA 3H83A 5KOYA 2R6DA 4M9QA 5DXAA 1EE1A 2VZ8A 3OE7A 2F24A 2B8TA 4DIDA 2PLWA 3GW8A 3GFFA 4CF3A 1WSWA 3OWHA 5F4BA 2Q8NA 1W4LA 1ZISA 3G0OA 1HT0A 4TMXA 2QF7A 2MYUA 2H7VA 3LYAA 1XIVA 4ETIA 4TS1A 5AKKA 2Y1EA 1D2GA 2I2BA 4P31A 4HAWA 1B26A 3JQAA 1M8KA 2Z4TA 1NTOA 1NC3A 4UJ3A 2PUJA 3CRQA 4GPEA 2PLRA 5CVTA 5AQ1A 2CL0X 4F1JA 1QP0A 1SBZA 1DDIA 4CKCA 3CX7A 4BVGA 4INZA 4C07A 1HDYA 1Z4JA 2XXAA 5F2EA 4UEJA 5CBPA 3U60B 1J9EA 3GT3A 1XJWA 3TJMA 5CVDA 5DYIA 3BH7A 2EW8A 2YV4A 4QT4A 2FFBA 1IPHA 2WNIA 2ZPTX 5I3CA 1AD2A 4FPXA 4FDLA 2ZT6A 1WD7A 2NPOA 1A5AB 1YZFA 5TF0A 1P2BA 1OF1A 2HI0A 3ZD7A 2R84A 3MAAC 3W5VA 1I0ZA 5B1DA 3SU8A 1N32B 3WLFA 4UOZA 3P19A 3OY2A 4HDMA 3PEVA 1T1IA 4MPJA 3V1LA 1N5LA 3BERA 1X80B 4JN6B 5GZ6A 3R74A 1HH4A 2H11A 1QDLB 4J0IA 1MQ9A 2JFGA 4O5TA 4OBWA 4BVLA 2RH5A 3WOVA 4ZMBA 2ZRAA 1LFDB 3EXG1 2RKBA 1HEYA 3WYBA 4LF6B 1XOGA 1IDN1 4IMJB 2DQSA 2NW6A 5EG5A 4F1WA 3QVMA 3F67A 4IV5A 2LD4A 2ZI9A 2G4CA 4OVKA 3VKVA 3ZPXA 5TJHA 2HU2A 4RNDB 4ZREA 3OT1A 5C8YA 5ADWA 2QN1A 4C4AA 1VYVA 3ZOKA 2SKEA 1G42A 3BB1A 2PH1A 3UUEA 4IRXA 2O14A 1BCRB 3JAKB 4JQZA 5AKLA 5T6BA 4C76A 4IZIA 5KQMA 4P82A 1ZRMA 4IOLA 4EPTA 1UKVY 1DT3A 2A1TS 2A67A 3T3IA 1H3NA 7YASA 5FWAA 5A4IS 5JJ5A 2XBUA 5K3FA 4YMUA 1MKYA 2IC5A 4O2BF 3QU2A 2CBZA 3GGGA 4G23A 1DC3A 1XQYA 2O1WA 4LRQA 3EW7A 2WM8A 4MQ6A 1KJ9A 1WEKA 4IMPA 1C3OA 1Z29A 3GFVA 4QTTB 3GRAA 3DO5A 1NI4B 3HDJA 4GDMA 3TCNA 1IXSB 1SD5A 4HAZA 1ZVQA 5JAMA 3B3JA 4US1R 1NQ5A 1TEZA 1IN1A 1U9YA 5E4YA 1CVRA 1PQUA 1BFDA 2HHJA 2SKDA 1W8OA 4P7KA 1OFUA 1CDOA 4N3BA 2EAUA 3WMRA 4JLJA 3BH0A 4YZ3A 2MINB 1G41A 2XJ9A 1A8HA 2WI8A 4LF5B 1ZP6A 2JIZA 1LKZA 4I00A 1MBZA 1M6VA 2AYZA 2DPXA 1CG6A 3IJRA 4UU1A 4ZI7B 3I83A 1RBZA 4W8OA 1E9BA 3TAXA 1G3RA 5JDCC 5DGDA 4IGIA 2F26A 3FPHA 2ONZA 3EG5A 4FYPA 3L5KA 4Q1EA 4ZCRA 1PJQA 3R5HA 4WEQA 4X61A 2PUDA 3DCYA 2ZIEA 1PZMA 2XWJI 3MUFA 1IHDA 1ZVJA 1PD1A 1KZ1A 1WO8A 4ISBA 3RT1A 4O8ZA 1PFVA 5IP5A 3AF2A 3SC2A 4JI8B 1A1SA 1C30B 3HWX1 4R2IA 2O2HA 4KDCA 2GXQA 2IZ1A 2WYHA 5CT4A 2Y1GA 3SYKA 4O02B 1RM4A 1GPNA 2HHCA 3VGPA 4LECA 5LKRA 1RWBA 3KJEA 4NNOA 2WTUA 1S3SA 1JHVA 1IJEA 1HK7A 2DBVO 4L22A 2H3EA 3HC7A 4WOJA 2W6QA 4ZDIA 2CJWA 5FA5A 4IDOA 1PJRA 1RAHA 3E27A 1BHO1 1E59A 2HZBA 4A0GA 2I4NA 2XJ4A 2O54A 2AEQA 2WFLB 5F35A 1M3SA 1TPZA 3K0BA 3ZIAD 3IEXA 4DBZA 4AB1A 3PWTA 2RK3A 2WWIA 4KQMA 3UYLA 4AJ1A 1ZQ9A 3JWEA 3AGPA 2VTBA 3G2HA 1CRUA 1W0CA 3O4FA 4QFMA 2WU3A 4MB2A 1WXDA 3MCTA 1BRMA 1TNDA 1DTSA 2WSLA 4CKEA 1WZEA 4NZMA 4EO4A 4ZO7A 1MJHA 2QW0X 5B6JA 1Y3DE 5CLLA 3VVMA 4COOA 2AEEA 5AK3A 4O4JB 2O5RA 4M1OA 4AY5A 3U6BA 2O2GA 1QP8A 1D3AA 3IIJA 2I6TA 4U2GA 4XJWA 4NZZA 2QP3A 4KB5A 3PEYA 1C7QA 1Y8CA 5AJTA 2ZR8A 2IBTA 3QI2A 2O4CA 3IAM1 5IXSA 3E03A 5CT6A 1E2NA 1EX9A 1YV9A 2GPAA 1Z0SA 4JZYA 4QBFA 2P1DA 2F62A 5JSZA 4WA3A 2IZZA 1NVEA 3RREA 1GGMA 2O1SA 2UAGA 2ZEJA 4FHFA 1L7RA 3V4PB 4J2TA 4G0UA 2PKXA 3LDUA 2C7GA 1FFXB 5K0LA 4C4ZA 5JXJA 4WVFA 1ANKA 4RF5A 3WMWA 4DAOA 1YDWA 5H82A 1IL0A 2OECA 1X19A 2FQYA 2VRCD 1DFIA 3S8MA 1ZCJA 3EK2A 3R9IA 3K39A 4A0FA 3DMNA 1SUDA 1T9BA 4F4JA 3UMYA 4Z1MD 2E37A 1DUIA 1U4NA 3L8ZA 1HR0B 1XLTA 3DZBA 3EHEA 4LYAA 1H66A 3HN7A 1V6CA 4I46A 4J0CA 4KX3A 4Y7DA 3Q5EA 3O4PA 2W20A 3WI7A 3ZCXA 2P6OA 4HQNA 4JIMA 3PCTA 4C06A 1SCNE 2QNRA 5EIFA 4HCJA 4Q1VA 1G98A 1OLSA 3HCFA 1JT9A 2VNAA 5U4XA 1VTKA 3DL0A 4BJ1A 4RF2A 4MWXA 1PYGA 1W5SA 3CPSA 3JYHA 4CLEA 1NLFA 3GG9A 2XCRB 3UB4A 2FSVC 3ZR4B 3GT7A 2X6RA 4OLJA 1U2RA 4TRRA 1EJBA 1KMMA 1PEKE 2J85A 4XAQA 4RHCA 2W38A 3D02A 4AX4A 2C3PA 3INTA 3P9QA 4H15A 1ESEA 1AK1A 3K7EA 1EURA 1ONBA 4XM2A 3P96A 1U80A 5ALDA 2ZZMA 4WERA 4B3HA 4I81A 5AW8A 5J4HA 3TI8A 3LCVB 5SYNA 3KK0A 5AW5A 3H6HA 4XASA 1NRXA 2A3NA 3KZNA 3ZCQA 3BMCB 4CPZA 1XQWA 2VP4A 1FTQA 3I8SA 2JGRA 4NEQA 4PSAA 5EMJA 1K63A 3TVTA 3UA3A 4AAYA 4V2IA 5B6PA 3T1YB 1Y1QA 3FCSB 1QORA 1X1DA 3N2GA 4LRXA 4OQQA 2OM6A 2IBMA 2QWIA 1SD1A 3AY7A 3WN7A 3R9KA 2WJJA 4F85A 2WYUA 4XJZA 3WLHA 1YI0A 1ZW1A 4QO8A 3SZGA 4EI2A 3OZTA 1MHTA 4PAQA 2CWWA 2H48A 4CKWA 2C4KA 1X8JA 2N46A 4I1UA 4D99A 4FKZA 1SHUX 1G2IA 1YMVA 3DT8A 1QO0D 3TSOA 4JXXA 4EENA 3H8VA 2YW9A 3PUJA 4Z9XA 2ZYVX 3BFJA 5CIQA 3WNQA 3VKUA 4DABA 1DAPA 2BL4A 2I99A 4M4VA 2OHFA 4UAVA 4C4YA 1ISJA 1UBOS 1USWA 1X2BA 2QM7A 5REQA 1P72A 5K6TA 3MS2A 3C5HA 3GXOA 2OILA 3QUTA 1CEYA 5AI8A 4RA9B 4BB0A 4WZAE 4XGKA 3T3EA 1GQYA 4YXWD 1KK2A 1QPBA 3OEHD 4L50A 2XUPA 3DCIA 4MS4A 3VOTA 1T9ZA 1RAIA 4NSNA 4O4HF 4EZEA 3ETLA 2WJHA 5AK6A 4OU5A 1WZIA 2QN8A 1REQB 1MUUA 1F8DA 1U04A 4W1RA 1FY2A 4Z7JA 5D1NA 1IM8A 4RSMA 3LTEA 4PVDA 5B7QA 1BX3A 4DDTA 3N2KB 4JYMA 4K9PA 1TX4B 3E4DA 4HNAB 4R40A 1WG8A 1YZUA 1VOTA 2H1IA 3LY7A 3MIIA 4H9GA 4HEJA 4HY3A 4MQFB 5C18A 4COKA 4DWWA 1RQ7A 3O0DA 1ZO8A 2R8ZA 3KKNA 4PLFA 5IU6A 3V4ZA 2AN3A 2ZVQX 1MHPA 4X8MA 4BMDA 5CA1B 1W6RA 2FQXA 2Q21A 1VSVA 2A9QA 4Q4DA 3H71A 5HEKA 3G8YA 2XCQA 4NEGA 2GN8A 5IEBA 1QFJA 4PZYA 4QTYA 4B47A 5J2UF 2WPDA 1MVLA 5I9TA 4E5SA 1V0FA 1TQHA 1XU7A 1Y5IA 1OYVA 1ZN2A 4PAGA 1D1QA 1JN0A 4JP2A 3A27A 1Y1PA 2JLCA 3GRVA 2QD2A 3ALWA 1EFHA 1O0SA 3RRFA 3VDQA 2ZTLA 2HJWA 4UD6A 2RH4A 2CNOA 4R2LA 4U9IS 5DM2A 2H0RA 5FRDA 4BBJA 4CJXA 2NM0A 4QL3A 2A57A 3C5WP 4C87A 2FWBA 1FK8A 5SZKB 4FX5A 3FNRA 2FEAA 3ZBPA 1OLUB 2RGBA 4BFZA 2CGEA 3EA5A 3LWZA 4BZQA 5LQAA 2BYTA 1U3VA 5LOVA 5G1PA 1GCIA 1FF9A 1T10A 1P19A 2D06A 3WL7A 1N6PA 1VE5A 1T3ZA 1A8SA 1FBTA 3OJCA 4DNXA 3RIXA 4MKZA 4V02A 2B20A 3BMOB 1U0RA 4BLUA 1P7PA 1ZRHA 2P11A 3P52A 4Z9BA 4GLFA 3DLBA 2IPLA 3KYAA 2QUKA 4ML3A 4M3MA 1EZ4A 2XXBA 1TF5A 3GQBB 3LGAA 2AVNA 5D87A 1RADA 1TYZA 1E79A 2H16A 1CTQA 1Y42X 1T8PA 2P2DA 4U6NA 3V8VA 2YJ6A 4KNVA 4E5VA 2G8NA 4MLDA 1KEWA 5D85A 1IVBA 1KXJA 1W44A 3ZXIA 1KU6A 3L7JA 3IPYA 1YE5A 3NTRA 2NU8A 2R4TA 3AQ4A 4MB6A 4B85A 1JQEA 1K7XB 1R8YA 2N9UA 3B69A 1AY0A 1OXUA 1RAFA 2XD4A 3IQFA 4I9GA 3ZHRA 2HA4A 5I8PA 3K0CA 4OQPA 3ZI4A 5BVHA 1QLHA 5EJ6A 1VFNA 4OYYA 4DT1A 3C41J 4Z6KA 3PR3A 4FPLA 2Q5EA 4M9UA 4FYJA 2K7ZA 1B9VA 2V8BA 2ZT7A 3IA7A 1L5LA 2PUWA 4HFNA 5AIAA 5JZMA 1P2VA 4YAOA 3JZMA 1D2HA 1K3TA 3K8YA 5LC1A 1XNGA 3WYAA 3H6JA 4MCIA 1BOOA 4JGBA 1V5GA 1R0RE 2VP5A 4QRIA 2HLDD 3TICA 2WIDA 1H4TA 4HUJA 4O1MA 1YUMA 4XWGA 3CH6A 4IVPA 5AXBA 4Q7LA 4KXQA 2QYHA 1A7JA 3GROA 1Q7RA 1ST3A 3N8KA 1GPDG 4IJ5A 3TK1A 3UMCA 1XD9A 3LK7A 3RFCA 2AI3A 5B1YA 2X1HA 2Z1DA 4RV5A 3UJBA 5IKXA 8AT1A 2C7RA 2C5FA 3ROKA 4YPOA 1Y6QA 1N0VC 1U1CA 2VC2B 4Q18A 1T2FA 1YGYA 4YP0A 3WIUA 2IY9A 3QTLA 1XRRA 4L2IA 4BNNA 5BMVA 4I9FA 3A9SA 1T5OA 3ID6C 3M9LA 4F2HA 3ZVMA 4O63O 2OUKA 1YQDA 1RLUA 3UO8B 1SC9A 3SS8A 3AEZA 2F90A 2ADMA 5EIXA 1QQ7A 3E3MA 2A59A 1M7BA 2WYIA 3R3XA 4W1PA 1IVSA 4LXGA 1PJ4A 1SU8A 3KZMA 3FBGA 4TS9A 4EL0A 5KSWB 1C3LA 2Q6VA 5C81A 1JJAA 5KWEA 2P9GA 3NEJA 4IG4A 1RYMA 2JLBA 4LYFA 3SY8A 5CB8A 1B9TA 1DJOA 2RB5A 2JFUA 2EERA 4AP9A 1Q19A 3D8SA 1CUGA 4B5KA 2IOFA 3ENQA 4KI7A 1RC8A 1BFUA 4TZ0A 1T9GR 3ZJYA 4HNVA 3A4MA 3DTNA 1Z0FA 1HYEA 3THXA 2H5EA 2D1FA 3FIJA 4KDEA 3ZJUA 2XYGA 1F6DA 1GVNB 3LQFA 5DV9A 4L5JA 2HPZA 2QX9A 4BUCA 3AESB 3QFSA 4EHDA 1OXTA 4MWYA 5I6DA 3C3BA 1SOVA 1AQIA 1KI8A 3EJ6A 1OLXB 2W90A 2B5WA 3QPDA 3QV1A 4YEDA 5MGBA 2YHAA 1QVRA 1PJ8A 3PQEA 3M1AA 4C2TA 3CGWA 3WMXA 4M7RA 1J33A 5EVCA 3GVCA 3MOSA 1RXSA 4DEYA 5KREA 5LQMA 3WY9A 2UKDA 2CLKB 3BQMB 3AERA 4CPMA 2G1JA 3Q2KA 4KW7A 4UU7A 4YJ2B 3U6KA 1QAMA 4MR9B 1X8LA 4CODB 2BGRA 5BWNA 2VHUA 3DOFA 1NNCA 1W48A 5KAPA 1N5RA 1AA9A 3HYRA 3JVUA 1Z8HA 4OI4A 1V8PA 4L6CA 1JPJA 3ROGA 1VXOA 3BTVA 4NR0A 1AUXA 3AKYA 1I4EB 3FDJA 5TY0A 3CSDA 1ZR4A 1E2IA 2W6PA 1LPNA 2CEKA 1JIQA 2BMWA 1IK4A 1FS5A 2DU8A 3R4VA 2C98A 2F3SA 2GZRA 1Y1RA 3CX6A 4GBMA 1W85A 2HRCA 2VPYA 1CY0A 1UPCA 1U11A 3G0IA 3PE3A 3PLRA 2XUDA 3L6BA 3BMQA 3EXAA 1KMQA 4NENA 4PX5A 2O23A 1EFPA 3ADKA 3T5TA 3SIRA 2WK1A 4G6ZA 4OQZA 5JEDA 5GPBA 2QE8A 1UJ2A 2ZIGA 1DAEA 1GRNA 3TZHA 1ZH2A 2A58A 2QWXA 4KK3A 4Q16A 4KR3A 5J5VA 2NU7A 3E22A 1TTQB 1QIIA 2RB4A 4QOIA 3VTZA 2QRHA 3DEHA 2YZ2A 1G9TA 3I2IA 1R50A 1JSRA 4EY4A 2FX2A 2XQFA 2V03A 4IS3A 3ESQA 5ELLA 1UIMA 2LVBA 4JR0A 4DIMA 3C2QA 2OESA 3KELA 4I1VA 4JR1A 3NBUA 4YXFA 2PSSA 4D74A 5B7GA 5KYNA 3OQ6A 1I3LA 3Q3CA 1RBMA 1G3IA 1FX1A 4NJOA 5BRAA 2EJBA 2O3JA 3F3SA 3Q8XB 4XJXA 1IUCA 1D0VA 2GBGA 2I6UA 1U3FA 3CVJA 3F90A 3DFIA 3EEFA 3HCWA 4QAQA 5TEWA 3CGGA 3SQDA 3IAM6 3USES 5BPHA 1V41E 2Y93A 2ODPA 3HXKA 5ECYA 2Q4TA 4XGNA 1C9YA 1Y5NA 1LRJA 1B4DA 4EVRA 1ULAA 4GZ5A 2QBYB 1V8ZA 1H2FA 3E3OA 4B1FA 4OA8A 3MINB 2YKGA 1DJPA 2QTLA 4ENQA 1RWIA 2X8AA 1Z4VA 3NO0A 2XB6A 5L3QA 1ARZA 2BI8A 3ZU2A 3NGLA 5GJWC 1ZIXA 4EECA 4EMSA 3DG9A 4FYYA 5FTMA 1QCCA 2FPBA 3FJ1A 5HF6A 4BLWA 4E6PA 1DKNA 2EJCA 1PJZA 4R7GA 2AJDA 1N6LA 4TWBA 1NSTA 3U44B 4Y2XA 3WIVA 2WTEA 2E2WA 1MG0A 1QIFA 3E3NA 5IF9A 5CJ2A 3NQ41 1XTVA 3ANNA 5LCXA 4UCWA 1RHQA 3I9NA 3VMMA 2Z5GA 3ZWXA 4C3ZA 1LDYA 1W34A 2PRIA 5EUQB 3C3EA 1JSZA 3P9YA 1QNFA 3AF5A 5ITWA 2EEPA 4LYDA 2AFHB 4HNHA 1S7CA 2IAVA 2HMVA 5FUBA 1VG0B 5LLSA 1NJ2A 4TLLB 3FYDA 1SNTA 3RW9A 2J9GA 4D8WA 2I65A 5IYZB 4RH1A 5CB4F 3KSUA 3KBBA 4NBRA 3WGLA 1CP2A 2H9YA 1XL0A 4KH1A 4GW3A 5EXPA 3JR3A 1NMXA 3PP8A 2ZR0A 1R10A 1KDOA 2J3KA 3FNHA 4YC7A 5CDYA 4UQLA 4D43A 1ZU5A 2GA9A 3OU7A 3OPVA 2C5SA 2ZYIA 3WK8A 2Y2VA 2SECE 2Q1UA 2NMVA 4QN4A 4FZHA 3QWFA 1VHWA 2GHTA 4RABA 3QITA 1M1ZA 3Q9UA 1XQVA 1SB9A 2PK3A 2C82A 2V59A 3VJMA 4IEIA 4UDNA 1KJNA 1M2JA 4R4JA 1JL3A 1RSZA 4W7IA 4FMBB 4Q3DA 4WOPA 4XA8A 3B60A 4YMSA 4YJ3B 5CCDA 1N34B 3I1CA 4ZOLF 1E5TA 2HGZA 1G16A 4HAXA 1N4DA 3FXAA 3KD3A 3BGIA 2OOKA 3JRXA 1R88A 2GVNA 1DKPA 2P9ZA 1YD7A 2FPWA 2R3SA 1DPFA 3A0UA 4QWWA 2FSPA 2C8LA 4OQXA 4HXEB 4R1SA 2ZTSA 4YDSA 3PKJA 1ECPA 4OJMX 4UHEA 1KYQA 1UANA 2QPTA 3PYLA 3K1AA 1OWPA 1N2GA 4R7ZA 1XPJA 3D4PA 4Q1UA 3THOA 4ZVTA 3NEAA 1Z16A 3W09A 2WSMA 3KXLA 1TLLA 4MEAA 1KSGA 1XMOB 1OR8A 1QVVA 4XIKA 5BVGA 1JR3D 1LRLA 4NZ9A 3S5UA 2YQ5A 3M83A 1Q0QA 3TG8A 3I5YA 5D9BA 2R6AA 4JUAA 1HL3A 2QTVA 3A6DA 1PSDA 1R5BA 1XEWX 2IPOA 2WDPA 1U9IA 3WJ1A 2YA7A 1GG5A 3K20A 4IDDA 4RPGA 2WY2D 3MS7A 2JFPA 4DBLC 1C3VA 3OX1A 2J9FB 3G0GA 3ITNA 1C9MA 4IIJA 1S4MA 2IELA 2PLNA 5FTNA 5EJ2A 2HL6A 3UBMA 2XODA 4WJZA 4ZC8A 2OHGA 5FNUA 3Q3JB 1E1KA 4RQUA 2FR8A 2PTGA 4IDEA 3SFTA 1N2JA 3E9YA 1QANA 2O05A 2PA3A 2YHIB 2I7CA 2QZ4A 4K9LA 2EC5A 2H63A 5ELMA 2JK1A 3PE6A 3QVGB 4KIGA 4NBSA 4D52A 2H2WA 1IB0A 1NL3A 3KUKA 3WGKA 3SX0A 3RKRA 3H42B 2Z2JA 3H9UA 4X6XA 5DNYB 1IXKA 2G07A 2VKQA 3HVUA 2WWYA 1B00A 2PRJA 3L4BA 2CL6X 1VPDA 1GTL1 1KP3A 4ROTA 3OIUA 1L8LA 1XRJA 2D0OB 1HG0A 1Z6ZA 1QK4A 3TLKA 2ZRQA 4KLCA 3KR9A 1QBKC 1U6IA 2ECKA 4LJ6A 1TF7A 4YV2A 5K6RA 4BO7A 3G5LA 4I3FA 1YDGA 3ORRA 5I5EA 2H17A 4F8EA 3OPYB 1LDBA 3GLHA 3DASA 3H05A 4PFJA 5GINE 1NKTA 1YCDA 2WD7B 4UQPA 3ZGYA 1MFPA 1YE3A 4IYJA 4EG0A 2BBWA 2DEUA 1LPPA 3ROMA 1V3DA 1GFZA 4DV2B 1IN4A 2Z9DA 3R41A 3JQ7B 4WN3A 1IBCA 1Q6ZA 4UTXA 3NC1C 4FFOA 3QFTA 1JIIA 4XR4A 2NVWA 3HBAA 3QKRA 5KOJA 4OX9Y 3FNIA 3KAKA 2YMLA 4YJKA 2ZBGA 4XJ8A 3H5WA 2MSEB 3M9XA 1NNEA 2QQEA 4KJZA 3J81A 2CJYA 3TI3A 4CTJA 2JAPA 1KY5A 1LNQA 2XIQA 4ZDWA 3FDZB 2AB0A 1BXZA 1L7MA 3LI3A 1JQDA 1KEVA 1K75A 3CHYA 5I8WA 3ITKA 4G0WA 3TI4A 3Q2OA 1CNEA 4IXDA 3E84A 1RR6A 1YTUA 2Z6VA 4Q4AA 1KDZA 2WYWA 2DCMA 4C7MA 4DREA 3TSAA 1MS5A 1F4VA 3GEHA 2Q8QA 1BG6A 3ND7A 4JUIA 4ND4A 1KFBB 1U0OC 2IPMA 1HQCA 2XECA 3B1XA 3A3YA 3P0RA 3DMTA 4KFSA 4D8YA 4WJLA 4RKWA 1BJTA 5G02A 3WGUA 1QH0A 1TO2E 2XDWA 2YY7A 3DXYA 3KNZA 3HGQA 4WI1A 3NJ4A 3B85A 1P4GA 1FC0A 2E1PA 4K40A 5HFNA 3BHIA 1DHRA 3I2HA 5CB0A 1MAWA 1W1UA 3N2EA 4HDKA 4L75A 4DC9A 4ITRC 4M36A 1M7HA 4YPFA 2V6MA 4FFBA 1NBEA 1A9YA 2ZI4A 2QR5A 2J6CA 5DSXA 3WKEA 5K8TA 1YOVA 3DP7A 1ZZGA 4M0LA 3E5MA 4MICA 2R6R1 2BR5A 2QX4A 4KQ6A 1US8A 5DASA 5FI5A 2H85A 4OBXA 2C4TA 3LW7A 2PR2A 1GVHA 1V95A 2LBPA 2PXHA 3OJXA 2QD5A 3H2ZA 3MK31 4J0HA 2XE6A 3W9SA 1BE0A 1DC5A 3Q3IA 2ZTMA 1TCVA 2WLTA 1YR2A 1ZD9A 2E9SA 4D3YA 4QZVA 3EZ2A 2F4VB 5IJXA 1P1HA 3EVDA 3PG5A 1LBIA 1J8VA 3AKZA 3WJ2A 1LS1A 4TL9A 1M67A 3FDFA 3ZW7A 1CVMA 4HOYA 5DT2A 2Y9PB 4DXHA 4XVQA 5B58C 4LDRA 1C1YA 4JP5A 4ND8B 4E22A 1F60A 1DV2A 1H6LA 3LBIA 2ZJZA 5T41A 5BQFA 3KQVA 1Z5GA 2AZMA 3FPLA 5L8VA 4AF8A 3WWYA 3T5AA 2J09A 2IOFK 3QBJA 4M6WA 2VI5A 3MTBA 4D7AA 3NWPA 3TRHA 2B4YA 4FCTA 1AG9A 3EVGA 3FR8A 2QMHA 4B32A 2P9HA 5KC8A 2QUBA 3SVTA 1H9BA 3IEVA 5J63A 3H87A 3VR5A 5HGXA 3BGOS 4PYKA 3IIMA 5CVVA 4NAUA 1M34B 4IX1A 2JRCA 3PF8A 2ATVA 2EKBA 1C50A 4ZV9A 3SJ7A 4E14A 3E5NA 1MAVA 3SJZA 1OH7A 4Q19A 3ZDEA 1JNYA 3NC4A 5HG0A 5LDDC 4NXMB 3DEZA 5KX5F 3GFRA 2D2EA 3RSSA 3HL0A 1CQ1A 1MQSA 3OZCA 1NAHA 3DLCA 3MTDA 1LU9A 2GCGA 1BWRA 1PG2A 4ZQIA 2ZRLA 1NF8A 3STVA 4BN5A 3RC8A 2WKSA 3OTQA 2OLJA 1L7HA 3ZX5A 2XUHA 3SG0A 3DZCA 1KQ3A 1Y0BA 3VPGA 5JRZA 1G6OA 3MBOA 1OXMA 3F5FA 3I4FA 1G8PA 1GPJA 1KEZA 4IRMA 4XEUA 3IQDB 2CVFA 2KBEA 1GUBA 1M2FA 2XZLA 3K3AA 4NE9A 4ZALA 4XVHA 2JA2A 4EY7A 1XFAA 1E5DA 2XWPA 4I2NA 3UAYA 4Y67A 1L1RA 3JQGA 4W8GA 3HJAA 1L5HA 5NN9A 1MABB 3JAWA 3THYB 2GM5A 4GI2A 4I66A 1C2YA 4J1QA 3MB8A 4WKBA 1E7YA 2WUEA 2HT5A 3LPMA 1G55A 3PX2A 1Q7FA 1CWUA 1MX5A 4DIOA 1AQYA 4K81B 2FN9A 1Q7TA 2J3EA 1QU3A 3FFAA 1G7SA 3H2KA 2QTBA 2FJ0A 3IP5A 3HKBB 3G7UA 4KRFA 4M9XA 3A4IA 2V9PA 5J4LA 4QHYA 1PL6A 1XXHE 1RMTA 1MC4A 2BM9A 4TKLA 2PSDA 4BBAA 2OSVA 1XCLA 4QBHA 1NURA 5IMBA 4KXVA 2WIBA 2VP0A 5KDDA 1W87A 4LHZA 2ZB3A 4J9VA 4YUYA 5DM60 2VXCA 1Y1LA 1FP1D 1LQ2A 2NUTA 3BKXA 4AW9A 5K20A 3QVOA 1EH5A 4GWKA 1DCTA 2Q5CA 2PLAA 4CMHA 4HEQA 2QEQA 3BE8A 1OFTA 2Q1WA 1W5FA 3LC0A 3A25A 1OU0A 3HXTA 1YQTA 2G5TA 4FYMA 5C4GB 3UAXA 3WIBA 3T1EA 4MUAA 5D5QA 5TVGA 4HW6A 3UMRA 4JJFA 1WCIB 4H7EA 1GPWB 2XTZA 4X1KB 1EX7A 1R12A 4MA4A 1TJYA 2VQFB 4EMUA 2QWGA 3BSYA 1E9EA 1J07A 2VQDA 2JFXA 3VNGA 5JCPA 1JHZA 3EXEA 1MORA 1M54A 2ZRJA 4QDKA 4ZO4A 1JHDA 4NESA 3WLQA 1BRTA 5ESXA 3OFNA 1N5JA 1PF7E 3FFWA 4PRYA 3WWZA 4EKIA 4RLQA 1E8UA 3QE3A 2YHUA 2AD1A 3G23A 1IXRC 4MW2A 2CVOA 1Q1GA 3A3OA 2R85A 3B13B 4GMXA 2A88A 3UMJA 5HZKA 3HXOA 3KP1A 3IDZA 2QAGA 2X2EA 4FFRA 4H6PA 1XB2A 5HX0A 3DULA 4EB6B 4XGQA 4B3JA 2J59A 3P0IA 2IZ6A 2FFAA 3TL2A 1KYVA 2H9AA