2IVZA

Structure of tolb in complex with a peptide of the colicin e9 t- domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
397
structure length
392
Chain Sequence
GRPIGVVPFQWAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Competitive Recruitment of the Periplasmic Translocation Portal Tolb by a Natively Disordered Domain of Colicin E9
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/hydrolase
molecule keywords PROTEIN TOLB
total genus 109
structure length 392
sequence length 397
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04052 TolB_N TolB amino-terminal domain
A PF07676 PD40 WD40-like Beta Propeller Repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2ivzA02
3.40.50.10070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TolB, N-terminal domain 2ivzA01
3SREA 2IAOA 2DG1A 4GN8A 3LI3A 4HW6A 2IAVA 4GN7A 3LI4A 3G4EA 2IASA 3Q6TA 1C5KA 4IYGA 4ZLRA 3WW9A 3S94A 1RWLA 3BYCA 1QBIA 3FW0A 3TC9A 3HLIA 4GNCA 5GTQA 3S2KA 3AMRA 5GX4A 3U0SA 4PWZA 5FWWA 3O4PA 3I1CA 3V1SA 2ISMA 3SOVA 5D9DA 4DG6A 2GVUA 2VAQA 4GNBA 2GVXA 1QLGA 3A9HA 2IAQA 2DSOA 3Q6PA 5D9BA 1RWIA 3HRPA 5GX2A 3SOQA 4A0PA 2GVWA 1IJQA 1CVMA 3DASA 2FP9A 1H6LA 2FPCA 2IATA 2W8BA 1V04A 3AMSA 3FVZA 2P4OA 5GX5A 2IARA 1NPEA 3IAXA 3HLHA 2FP8A 1C9UA 1PJXA 5D9CA 3G4HA 3KGGA 4IMBA 4GNAA 1CQ1A 3V65B 3S8ZA 1CRUA 2IAPA 3E5ZA 4JMLA 4O5TA 2HQSA 3Q6KA 2QE8A 1E1AA 4HHOA 5GX3A 3DR2A 3SRGA 4GN9A 2IAXA 2POOA 3P5BL 3LI5A 2FPBA 4HHQA 1POOA 2GVVA 2IAWA 2GHSA 3SOBB 4Q1UA 3V64C 4R40A 2IVZA 5GX1A 5EX7A 2G8SA 2OJHA 2V91A 3WWAA 1CRZA 3S8VA 1N7DA 2DG0A 3KYAA 2IAUA 3A9GA 2W8BB 4O5SA 1Q7FA
chains in the Genus database with same CATH superfamily
2WSIA 3EQ2A 2JH9A 4KS5A 1V5FA 3E03A 5EHXA 3F3SA 1EXVA 4OFXA 1ESDA 1FTYA 5SY9A 4Q1EA 1NUPA 1SD5A 3QMMA 1ZD3A 1EWYA 4WFQA 5DCWA 1Z16A 2FUNB 2P8JA 4EEZA 4O3MA 2I78A 1BXGB 5E6UB 4DFDA 1JMKC 3NRJA 3BB3A 3NNDA 1PVOA 1UBUS 2KYRA 4QG3A 3K6RA 4F71A 4FGLA 4M53A 3AQ4A 3UJCA 3RAGA 4CQLB 3AKEA 4CKWB 4G0XA 3W2GA 5D5HA 2XYGA 4FFRA 2WFAA 4L85A 3W5AA 5LA6A 4I55A 2J9ZB 4UTPA 3M2TA 1XTQA 1Q22A 4IUDS 5FWWA 1BJTA 5AK0A 3L6RA 4ZYWA 1ODIA 3RRJA 1KNQA 3JYHA 4LNUA 4NYJQ 2YRWA 4EENA 1I3KA 2ZAMA 1WMSA 1KMHA 3CLUD 2ORYA 2AN1A 3N2EA 1KS9A 2JGJA 3NFRA 4AX4A 3ZDDA 5T4EA 4W8OA 1K7FB 5BSVA 2VXCA 3VVMA 2R7LA 1KHTA 4HNHA 4F5ZA 2CXOA 2CB9A 4N54A 4XLLA 5CT4A 4PG8A 5IYZB 4P32A 3W8RA 4DQ0A 3BH6A 1W0JA 4GM4A 2ZRIA 2JFHA 3CPSA 4IIXA 1MX9A 2A9PA 2QJFA 3GUZA 1EUCA 2W37A 4HAWA 3KUDA 1NBEA 1SZJG 2BEJA 2JHGA 1N7GA 3HJNA 4FYXA 1VIYA 3OHSX 1XCOA 2V7WA 5T4FA 4B40A 1MZPA 3EODA 3DMFA 3OPMA 2HMSA 3R3SA 5A4IS 1YRBA 2ID4A 1EFCA 4EGCB 1FK8A 1JVNA 1K97A 4DG8A 5C3MA 4IFIA 3G23A 2BZSA 3KYDA 3K94A 4Q1FA 2GTHA 3IHTA 4PAOA 3UJPA 4HN4B 2FX3A 3ZY4A 4CIAA 2BFDA 1NVDA 3BL6A 1EE1A 3LP6A 3F49S 4P53A 5TLSA 1KFJB 1SCNE 5KWIA 4MW2A 3HP1A 3HI6A 1P2FA 1L5MA 4J0HA 3WIDA 4ZAZA 3TBHA 2IP2A 2YDYA 3RRNA 2EZ4A 2PN1A 2KLBA 4RNCA 3EEOA 2EX0A 3HQ4O 3KT3A 1QPGA 1XI2A 2H1OA 1CSEE 4JIGA 2FR8A 1BW9A 3HHEA 2JB9A 3PCXA 3PIDA 1L7HA 2G1UA 1Y48E 4WXHA 3GV0A 2RHBA 4PZAA 1WP4A 1F17A 1S1CA 4MCIA 2RJ3A 1VSUA 4TN1A 3HCOA 4BKQA 5HX7A 4F2DA 2O7NA 4UARA 1KOFA 3LHKA 2YN0A 4W99A 5AI6A 1FDOA 4O5AA 5KOHB 3KSBC 2J3KA 2AMLA 3DKIA 4R1PA 1YBHA 1SH7A 4K40A 2AZMA 3AEYA 5CLFA 5IKMA 4LOHA 4RXTA 2YWJA 3TFOA 4IKEA 1NFFA 1D2MA 4WJLA 4CKWA 4EPYA 3O4GA 3O9MA 1KQFA 1VLHA 5FKJA 4NABA 2GFHA 3VDMA 1MWEA 1E9SA 1MJ5A 1Y4SA 2AV6A 2OCXA 5AYVA 3GBPA 5T57A 4UKDA 3VRHA 3VZCA 1ZGZA 1S3FA 3AHGA 3K1AB 3O8OA 1TVKB 1FDVA 5GTDA 4CPNA 1AZSC 1Q1BA 4TMFA 3F8SA 4G84A 2HD4A 4OLFA 5EMKA 1FDUA 1UDAA 5FOUA 4AN4A 4D80A 2ERYA 4IQ4A 3AB7A 3SPXA 1M66A 1LWNA 1CDOA 1RKVA 5CLJA 1LBQA 1DIBA 1PNTA 3RS0A 3W4KA 5JPCA 4FNMA 2AEJA 2BP7B 5ER6A 3VO9A 3CTPA 1YJBA 2C59A 3A4MA 3PE6A 5JWOA 1P1CA 2VUSA 4OEHA 2WU0A 4D82A 5KOJA 3PUWA 2WFMA 5JSZB 3ABOB 4OSOA 1ENOA 3QVVA 3WL8A 4BTLA 3ISJA 3OOYA 1N75A 4K6GA 4B2IA 1G38A 3TRIA 1O6GA 2XVMA 1JSLA 3ESDA 3LVBA 4TS3A 3RRFA 1MNAA 2JARA 4BVGA 3HCRA 1N5RA 3H42B 5KNCD 1JIKA 3GVLA 2Q1WA 3SLGA 4M88A 5E1OA 5E4YA 5CLQA 1UT5A 2HADA 1BO6A 3CRW1 8ATCA 2PX8A 3JU3A 3MJTA 4TKZA 5F73A 3RT9A 3PZRA 1CWUA 1EAMA 1OZHA 5DXAA 3KUUA 1D2NA 2FYTA 3NAGA 2INGX 1U2TA 3WBFA 5BUSA 3U44B 4CM6A 2WT4A 4OAQA 2DSOA 3GGJA 4PO1A 1H4TA 1G2PA 4I08A 3NPMA 4JODA 4UM9B 2QQ5A 1E69A 4TMTA 4XXHA 4FMBB 3HDQA 2WQ6A 2GI4A 3VBEA 3QKSB 4QFCA 1UZLA 1X94A 1FLVA 2EZTA 3GEGA 2FXVA 1D1QA 3HUEA 2R1VA 4ALJA 1CR2A 3LWNA 1NI3A 1SG0A 4XJVA 5GONA 4QARA 5HEKA 4ERNA 1USWA 2ZREA 1YBVA 2JATA 3NHAA 4P7JA 3T5MA 2C42A 3OLYA 3K7EA 1D2RA 2PGDA 3JR3A 2O5RA 2QGZA 3MSCA 4MAAA 4NULA 5H7XA 1X2RA 1ZUIA 3O0DA 4PC2A 1Z6TA 3JALB 5I47A 1Q7TA 4MVXA 3TSOA 2DWCA 1SXPA 3NALA 3BYZA 1U7WA 3M1IA 2F28A 5CVTA 5HKKD 1PYOA 1IN7A 4YZ5A 2IUUA 1W0CA 1F8BA 2FE1A 5E3IA 1CQ1A 1ORWA 4QASA 3VR6A 1M67A 5ANRB 2Q4EA 2YW9A 1GUDA 2OPHA 1GPH1 3KQMA 1G8SA 5KTYA 3L79A 2P9GA 3GFBA 1Q0TA 4YJ3F 3TLEA 2B7CA 2ZYSA 2RI1A 5LMNB 1E1AA 3KUCA 1X77A 1NVWQ 3FPFA 1Z0FA 3GJTA 3OZRA 1WETA 5EE0A 1I6WA 1KEPA 1H8HD 1YD7A 3AUKA 3GEPA 3KQSA 5IHPA 5AVKA 3G2HA 2ZAGA 4QTYA 3BE8A 2V3CC 3C98A 4C6RA 1QWOA 3ETDA 1M6EX 3IILA 2LXNA 3FYTA 1JIXA 3MM4A 3MMSA 3K0CA 4JHLA 5TJHA 5KTMA 4DLVA 1IHXA 3VC2A 2ZBQA 3NM6B 1C7FA 4S12A 1U0BB 2UUPA 1W7AA 1OILA 4Z7NB 3B6ZA 2VZ8A 1QIGA 3PDIB 4G26A 5JDIC 2WJPA 3CF2A 3TKYA 1BCRA 5FPKA 4IH1A 5DJ5A 5IPFA 3PEUA 3V7YA 2PVPA 1YDMA 1FYVA 1XHEA 1SBCA 3ZNPA 1EWTA 1UEXC 2R8XA 4EP1A 1L7DA 1DC8A 1NG1A 1ESZA 3CWCA 3OZIA 4LE0A 1ZFNA 1OHHD 3WB9A 4ETNA 2ZJ4A 4RCZA 3IUEA 1VL5A 4F2PA 4MGKR 3PLNA 3TG8A 3RO7A 1JR3E 2I87A 2XT9A 1X6VA 3PUVA 4KZPA 3L0YA 1N3BA 2PXXA 3I9KA 5ECDA 2QMHA 3E9EA 4ZI3A 5JD4A 1UR5A 4P4SA 4P80A 1T43A 3OQJA 4X85A 1F4PA 4YW2A 4HIZA 2PO7A 4CMEA 1W5BA 4FS3A 4GI5A 5JQGB 3FDFA 4XJQA 5KX5F 1HF3A 1C3XA 3EZGA 3KYBA 3FYSA 1V3QE 3KQQA 2I7VA 2YJZA 3BRWA 3LJKA 3B5IA 4Y2GA 4WFJA 4XQ9A 3OT5A 1T9GR 2ZYTX 1A88A 3PG5A 5GONF 2C9MA 2W6QA 3LECA 3NMUF 2Y71A 3ND9A 1GV1A 1S2MA 3QOXA 3KQHA 4ZVKA 3IA7A 1VMIA 1UPFA 3SC6A 4JUFA 5BMVF 5KTSA 1W93A 3FPCA 3EC1A 5LQUA 1WOMA 2NU6B 2X5XA 3SKYA 5I7UA 1QHGA 2RJNA 3FAZA 1DILA 2CF5A 1I2AA 3DFUA 4C43A 2ZJ7A 3I5AA 2C8VA 3KXPA 1G8GA 1P0FA 1YS6A 3E22A 2E4YA 2ZIFA 4J4BA 3W3ZB 4ZCRA 2R0QC 1E6KA 3WLJA 1KDOA 2XOEA 3TZKA 1FJHA 1HG0A 1A9XA 2H4ZA 3B7EA 1ESCA 1CS4C 2CBGA 2HJHA 3EC2A 4KKXB 4OP1A 5GAJA 2O1SA 3RASA 3ZWKA 3EXAA 4ZGGA 3SIPA 2QF7A 1FQWA 3COPA 2ATEA 3LUKA 3OFNA 4ZVMA 4C9BA 2PUDA 3LYUA 4JGBA 5CX1A 3DASA 3E18A 3EXIB 3QV2A 3DZKA 4H2DA 4WJZA 5B58T 5DTMA 3TH5A 3W06A 3DA8A 3IE0A 4AJ1A 2PT6A 3GNSA 4X0EA 1AU9A 2YTZA 4MUEA 2DM6A 5BN3A 3JVEA 2X8LA 2ZT8A 3V46A 1GTZA 1NRWA 4H1VA 2LUOA 2BDUA 2W8ZA 1QM5A 1PT9A 2VJKA 3V1NA 3WL7A 4BPRA 5DP1A 3EXHA 4LSGA 5C32A 1PK7A 4TKUB 5B5SA 1XFDA 1C4OA 3DQZA 1X1BA 2JKVA 1ZOOA 2B1QA 2QD3A 2QUKA 2ROQA 2WD7B 4BVHA 5KQSA 1PE0A 3MWFA 4LOJA 3P9NA 3GLGA 3IPLA 4ZOAA 1CYEA 2X0FA 3B12A 4X1YB 4NDNE 2BFCA 2R00A 1JF8A 1R4NB 3ODGA 1W73A 3FRJA 3ZZNA 4LTMA 3FCOA 4ZTZB 4QU0A 1K75A 2QBYB 4XUEA 2VHVA 2VIIA 1LI5A 5AK4A 2ZZNA 1OYOA 2H2AA 4BN4A 4GZPA 4KH1A 4GMGA 3EE6A 4XUDA 4LXYA 4JVNA 4ROSA 2C9YA 1QHXA 1D2AA 4QN3A 3JVDA 4XIFA 1FFHA 4QOFA 3WYDA 1P2UA 5LLSA 1AV6A 1A69A 4B7RA 4KPFC 4FGWA 4YJDA 2RHDA 1JU4A 2B82A 1Q7BA 4KXWA 4PLYA 4KR2A 4X61A 4L9RA 3IYLW 4ZDKA 2VPXA 2BE9A 1GRRA 3AF2A 3DKPA 4E5NA 2J5RA 2ENWA 3Q7QA 3WIEA 2C7RA 3QFTA 2C4KA 3H6GA 1EE9A 2HAEA 4Q4LA 4IDGA 1IJBA 3I5UA 5WRFA 4CIBA 4ENVA 2A2ZA 5J23A 1NE2A 2UXDB 4TTRA 3UHAA 2XYPA 4IGAA 4ESEA 4ER5A 2M1XA 4H27A 4LJ4A 1CE8A 3BA6A 1LA2A 2BHRA 2M1ZA 5DNDA 3UK1A 5EJ9A 3LCJA 2EG9A 2CHGA 3WS7A 5JATA 1WKCA 1YQUA 3FOEC 3ZDCA 2QMQA 2FLKA 3OQHA 3S81A 1DQZA 4AJJA 4YLYA 2K4MA 4W1RA 5ERGB 4ABTA 4NYMQ 1DARA 5TMEA 1OI4A 4CT4B 3CLRD 2Q4RA 3HRKA 2FDXA 3WYNA 4BBJA 3MTIA 1F8DA 1D9XA 1QV7A 3OX4A 4TMVA 4ZYZA 5BNWA 3VR6D 2J5KA 1TF2A 2VJYA 2WABA 1BIFA 2J9XB 1NQAO 1NPYA 4Z0PA 2GBGA 2VDUE 4OQ4A 3P2KA 4IIJB 5F3DA 4LRTB 2SILA 3LS2A 4YUYA 1J00A 3EGIA 3T7IA 1SWWA 1ZJ6A 2XGMA 3UJHA 4ES6A 9LDTA 1RFGE 3EMVA 3DNPA 3FUVA 4Q3BA 3DH0A 4YRMA 3ALXA 3QVTA 3WSTA 1AMUA 1A9YA 1FYEA 3HKBB 3IXMA 4RMHA 1J1ZA 1U31A 4Q24A 1E79D 1TKAA 1IUOA 1SULA 2DZDA 4GX0A 3EEFA 2WHXA 1Z6ZA 2I4NA 3I0ZA 3A9VA 3DXXA 2RCNA 4Q19A 2WWRA 5CEEA 1ISIA 4U6NA 4KQCA 3SQNA 3IEXA 1PTKA 2UUBB 2IA5A 2I55A 3F1KA 1Z4WA 4S0XA 5LC1A 4BGUA 3BAZA 1A5SB 2CFCA 1E7QA 1OPRA 2C58A 4WXPA 1S8AA 2BEUA 2HUNA 2AZDA 2OLJA 2Q5IA 3NDIA 5JBNA 3DDSA 3IX7A 3JQ8B 3L7MA 4UVDA 3WL4A 1E7MA 1RWKA 3PA6A 4YRPA 1W94A 2J7PA 4REQB 4CG3A 2OZVA 4EG7A 4KAAA 3K0EA 3EXEA 1V1MA 1QK3A 4RD3A 4RETA 5U4XA 4YJGA 5CRIA 2JAOA 3MG9A 2WJ3A 1KZYC 3EFOA 2CNNA 1TYAE 2A9OA 5T8KC 3VX3A 2EFJA 3ZXIA 5GINE 2VP5A 3NWPA 4K9SA 4MQFA 4AL4A 3DC7A 1Z3IX 1ZIXA 3ZDQA 3RUFA 1T3GA 1SRRA 4QAJA 4J3FA 4UU7A 2IV3A 3H1GA 3A6HA 3LC2O 5LR6A 4RY0A 5DTJA 3H2ZA 5DIFA 3IOYA 4AYWA 1E8NA 5FLXA 4PPYA 4CIDA 1UP6A 4WCFB 1GA1A 1T4CB 1PN3A 3AR8A 1MOSA 3PWZA 3U3RA 5HTOA 3RFTA 2YCBA 4ZCPA 2VW0A 1DTWA 5HNKA 5M3BA 4MIOA 3OT4A 3RYFB 3V65B 1ETUA 2AH5A 2KHZA 4BLRA 1UDWA 3BCRA 3UMSA 4CGZA 1K8YB 3U4AA 3MRSA 5B2CA 4ZO9A 4RJKA 1DJOA 1SWVA 4X1KB 2V7QD 1YBAA 3SI7A 3K70C 2PZGA 3QPDA 4I19A 5JS6A 1R37A 4NH4A 3VNGA 5AJTA 1Q0UA 3VZSA 3VMMA 1TXGA 4C3ZA 3MB8A 1QYIA 3ZLJA 4AUMA 4JWKA 2OD7A 1C2TA 4UM9D 1NF8A 2DT5A 1PZFA 3SSNA 2JD0A 4Y1EA 5CFNA 2ZM6B 1QJ4A 2DCMA 1GG8A 5F64A 3PXGA 3HB0A 5JCOA 1EJ6A 1GPAA 2WNIA 1W87A 1A5BB 4FE3A 4U8GA 1ZUHA 1KOLA 1D7OA 1QP7A 3SEAA 3EDQA 5FNZA 3PUZA 5JRJA 4CFYA 1HUQA 4ZVVA 3K09A 3WSWA 2AG5A 3GA5A 1VPEA 2X6RA 1SLIA 3WGYA 4JVMA 2ODTX 2Z4RA 1K6EA 3WVNA 3N07A 2H48A 3JATA 1YE5A 3EIHA 4H60A 4LQCA 1JDPA 3ZIAD 3C48A 3TCNA 4HGOA 4BJHB 2AFIA 1ISSA 1T9BA 1GGJA 2QEQA 3AEKB 4M7RA 3ZHQA 4F93B 1DG9A 1KYVA 2HOQA 5KNDH 1UIRA 1T8YA 5AVTA 3GAFA 3WL6A 3CINA 4A0FA 3FVRA 5DHSA 1AKTA 4GR5A 4X71A 1JEJA 2ZVPX 5C8DA 1YUMA 4L16A 3DMTC 1IVSA 1KR5A 1LBIA 1JH9A 2BBWA 3AVQA 5EJGA 2LNDA 3U6KA 4POAA 1XZQA 1JILA 4KL8S 8OHMA 3BD7A 4LV6A 4RMJA 2X3UA 1Q92A 4LZNA 1Y3BE 2Z8YM 3A6GA 3UAZA 2HX1A 1N5MA 1Y8QB 3LCVB 1EA7A 2IEAA 4LGCA 4PYIA 4C0SA 1XLVA 2WP0A 2O2YA 3GY0A 1XDSA 5JJCA 3H5AA 4A27A 1C0IA 1L7GA 2JCXA 1ZD4A 4I2VA 5AIBA 1SCUB 2QJRA 1U3WA 1AUPA 1NI4A 1XAJA 1PJLA 2QTVA 5A0VA 2XCOA 4P4TA 5FWXB 3SSOA 3ZWVA 1MEEA 1VB3A 2JAUA 1U8EA 2P4SA 2GVXA 1MD9A 4HZXA 3H18A 4R2IA 3GEDA 2F4NA 3GBSA 2VSNA 3FNHA 4XSGA 3PFNA 3OHPA 4N4AA 1G7RA 4UCXA 5AUQA 4KVZA 2CL5A 5LQRA 3GDHA 2PWYA 4FEAA 1U4NA 4JQYA 1V8ZA 1ODSA 2VK4A 1DPGA 2K87A 3WIBA 1L5VA 3COSA 2Q0HA 3UWOA 1GNSA 3MAAC 3A0UA 5EE5B 4Y6PA 4G1BA 3WTBA 1N0HA 2AQ8A 4EJ0A 4YRKA 1OUMA 3Q7SA 3RSHA 1QTRA 1GGKA 4ZT5A 1KJNA 4D0GA 1KBOA 3SKXA 2D2FA 3EA0A 5CA1A 1T9KA 2C31A 2FP4B 4KYUA 2W2XA 2OHGA 5FUVA 1KVSA 1OAKA 4C2BA 5FNUA 3EW9A 1PKXA 3H9QA 4N0QA 2OHOA 4PC1A 2SHKA 1AKYA 4MDEA 4HDOB 4J94A 3HXMA 4GXRA 5DE3A 3G0IA 2PVCA 1HL7A 5BVHA 5LKAA 1KAOA 1VRWA 4M8IA 1ACMA 1Y6JA 3I52A 5F5LA 3ESYA 3RARA 1G5TA 4JP1A 4QUEA 2RAPA 2QU8A 5G3YA 4DRZA 1GVNB 5AK3A 4LIPD 5BSRA 2BFBB 3ALWA 4PZLA 3KVRA 5LQKA 4HHOA 1Z63A 1DIAA 3GGSA 3ELUA 5DSXA 4QVIA 1ZH2A 1GYPA 2CYCA 3UC5A 1IUCA 1SU7A 1C8LA 4YY8A 2QPTA 3AJRA 16PKA 4K8OA 2R96A 2NVUA 3WGGA 2Y1EA 4EW2A 2A33A 1W6RA 2RGCA 1SBZA 1SN7A 4LRWA 4F0JA 3DNMA 4YAEA 4JJKA 1TQHA 2DBYA 1SKQA 2YV5A 1YS9A 3GD5A 4PZDA 3AVYA 3I1IA 1AXEA 2JJ1D 1BXRA 2V6FA 2ZRGA 2IHBA 3E4CA 3K16A 5JHHB 4CLRA 2H9IA 4WZAB 2XCYA 1YJ5A 4LRQA 5EUBA 1MN6A 1H9CA 3ETGA 1SVUA 3L0IB 2YS7A 3C7KA 4HDMA 1M6VB 3NGMA 4G1VA 1Z2CA 3T5TA 3TW0A 1S01A 5K3SA 1IE3A 2GZRA 4H77A 4NNJA 4P4UA 3O82A 1Q7FA 1EP2B 1O03A 2B78A 3CJRA 3D4NA 4IG9A 4ZAYA 2VP0A 2A9VA 3DSRA 3T7SA 5J4VA 1DRVA 5B55A 2W11A 2A5JA 4BFZA 3TO5A 2EJBA 1W52X 1JIIA 2B4RO 4JZKA 2OWEA 3D6HA 4PGGA 4CXMA 1NTRA 2BFDB 2X1LA 1O94D 4D3YA 5LJLA 1TIKA 4IICA 3UAGA 3HLYA 2R62A 3H5LA 5KOYA 2VT7A 2XADA 3KQYA 5ALRA 1R12A 4LRUA 1PZNA 4YQYA 2VF2A 1IY1A 4YT5A 2PKQO 5IFLA 2P6RA 4H7IA 2H4FA 2D3TA 1K5DA 4HGQA 3AETA 4UNPA 4N7BA 5K0FA 3OG9A 3I2KA 3I4LA 4ENWA 5IX8A 2HJ9A 3CPHA 4HDRB 2GTIA 3UKOA 3CEMA 1ZCAA 4I9NA 4IQGA 4NKRA 2ZXEA 2W70A 3ZVKA 3RLFA 1HYEA 4W6QA 3A71A 3RI3A 2G6TA 1E4YA 4BJ5A 3FUTA 3KFVA 1UP4A 2EAUA 3ENZA 3TQTA 4N18A 5LQCA 3VXKA 2OCPA 4EJMA 5JMPA 1K0UA 5EQFA 1HDGO 4JEMA 1FSGA 4Z3DA 5K05A 2JLAA 2AI1A 4JENA 1PYGA 2F1HA 4UM8B 5AKZA 1ABBA 2IYEA 1I0LA 4E51A 1GUZA 3IAHA 1GLGA 4CCAA 4OXIA 4HWTA 5I9TA 2C00A 4QOEA 1QP8A 1ONPA 1EEXB 1TIPA 1JHRA 1JUDA 3NBZC 3NUZA 1U0TA 3IEUA 3ZU5A 3ID6C 3L8ZA 2IYAA 2WJYA 3IDOA 2UXBB 3C3JA 3SDSA 3KYCB 4LMRA 4GZSA 2QTNA 1HTWA 2RHMA 2ZYUX 4B34A 4BMDA 2KPOA 3OSUA 5ALMA 1ZMRA 1UXIA 4AULA 4HNUA 3NC4A 1OYVA 2VHUA 3MEQA 3WZ2A 2UV8A 3DQQA 3JYLA 2WWXA 3NHKA 2Z8ZA 1JGTA 3AOGA 1H2EA 3MBIA 3O4VA 2REQA 4JDPA 4M21A 3DAGA 4IXTA 4M37A 4JSYA 5DNEA 4ZAVA 2GF0A 2PSHA 3LT0A 3DV9A 1CJKC 4PM4A 4HC4A 2I6TA 2W6OA 4WBXC 5JDIA 3VPBA 1QKIA 3QY0A 2HUPA 1NR5A 4L5AA 4U9IS 3H1AA 4WACA 5I7EA 1P4AA 4P08A 3VTKA 1ZD9A 3BD9A 3ZG6A 3ABIA 1U7OA 4BQRA 2B99A 2NSHA 1PGOA 3RJ5A 5KYYB 1KRWA 3ZHYA 5D86A 2PKXA 4ENUA 3G2IA 4U8HA 3LI5A 1SCBA 3JD0A 1EM8A 4HDSA 4HMPA 1PG5A 2ZROA 4J1QA 4XPIB 3JAWB 1OVGA 3NUQA 4BLUA 4R84A 2G09A 3ITKA 4Y7DA 3WYEA 4QGHA 1JZTA 3H72A 3ZHUA 3JRXA 4DLSA 1I7DA 1EB9A 2BP7A 2V4UA 2XZDA 2XB6A 4N49A 2V6MA 4C22A 3BHMA 1XDDA 4URHA 2Q6OA 3U4GA 2H29A 1GP2A 4TXNA 3GHYA 3NIFB 4OHBA 5LP6B 5BQFA 3UJ9A 2V91A 2PS9A 4AWBA 3WDKA 3GGOA 1JSZA 2DWPA 1A4QA 2OK7A 4XTCS 3VTFA 4DV5B 3GGPA 2B4TO 3LY5A 2OBBA 4XCVA 2GAAA 5TXGA 2A3RA 3AF6A 2TMGA 4J0EA 3USES 2Q0XA 3E9DA 5JROA 1XQYA 3AONB 1DC4A 4AICA 1IVNA 4Q4AB 2A5FA 5I9MA 2ID8A 5PNTA 1O7JA 4C0JA 1NW5A 1GUYA 2VWDA 2ISQA 1X9HA 4KO8A 2LIVA 1WVIA 4WA4A 1PNOA 3WMFA 1EJBA 1E9CA 1KOJA 1NFQA 4LXIA 5HRCA 3CT6A 1DKLA 2QRUA 3ORSA 2D00A 1VE9A 1MABA 2QW8A 2QD1A 3G89A 5AK6A 4K9PA 4XMIA 1OD6A 2JC3A 3D3JA 3KVYA 3H6JA 1B3BA 1GQQA 1E1YA 1NHGA 1UT8A 1A2BA 2D7CA 1RMYA 2WUFA 3CCCA 2C98A 4X3OA 3TWOA 3W6OA 3MTBA 4QDZA 5ARCA 1IXZA 2XDQA 3VPHA 3R0VA 4MV7A 4MZEA 1FQOA 1JKJB 2WM2A 3GRVA 4UBNA 2Z2IA 3W90A 4F85A 2LWIA 4MYUA 5D9DA 5BOSB 4HDSB 5FNVF 4F6RB 4M1OA 5L3SA 1KPIA 1M0SA 1SFRA 1UFVA 1NQ5A 3GL9A 4YNBA 3QWFA 3NDRA 5IH3A 3I53A 4YDRA 3PLAE 4ER7A 5B4VA 4N6OA 2V5VA 3BORA 3L92A 5CW1A 4ND8B 3K0CC 1XCGB 3LQKA 1ODLA 1Z29A 3NHSA 5EHQA 4D52B 1KAMA 2GN1A 4MULA 4QUJA 2BAGA 1JEYB 3OUTA 5I4CA 1SPBS 4GC9A 2HTYA 5IARA 3WRVA 3D8RA 4LZWA 4P5PA 5GVRA 4U7DA 2G82A 1JXMA 3UMYA 1UMBB 3PHGA 2KLHA 4LHSA 4LJKA 2J3IA 3KEFA 5AXCA 3ZZ1A 4QHYA 3WK6A 3U61B 1L7OA 2PKRA 1A2OA 4MS4B 4XDGA 2PL1A 3L7CA 1NPEA 1Q95A 5K4GA 5NN9A 2B98A 1WP9A 3SEQA 5IDXA 4KR7A 3DPSA 3JQ6A 5IXSA 2BGMA 2Y3IA 4LRXA 2VYCA 3E5HA 2VPZA 2WTXA 4NYIQ 4QUHA 1YCFA 5FBHA 2QWXA 4MW7A 1U3GA 1TT5B 4WZ6A 3KL4A 1NN3A 4RC9A 5HUGA 1QAQA 1MO2A 4AJIA 1LX6A 3GH3A 4I4CA 3U6BA 3F46A 4EKEA 1RU3A 2RARA 3HR7A 4RESA 5EJMA 1T3SA 3NBFA 2DYKA 4GZMA 5HE8A 3SNKA 4JKOA 4WOKA 3H5IA 3QHQA 5KHOC 4QYIA 1L1QA 2C2HA 3ACBA 5K0GA 3BXXA 1OFGA 1XWWA 2Z2YA 3PRYA 4W6ZA 1LFDB 4WXEA 3TI9A 3WDLA 2PHZA 5C53B 4GYWA 1ZVQA 4Y9DA 3IMEA 3GJ5A 2HDHA 3LI2A 1P5RA 4KODA 4DLLA 1IQPA 4C0QC 3EISA 5AM1A 3B5EA 5E9AA 1GT6A 3K53A 4ACBA 4AH4A 4KR3A 3I3SR 2NVWA 3QQ5A 2QT9A 1U3VA 1L4FA 1ZD8A 4L07A 3NKLA 3U49A 2FK8A 1V7PC 4MO9A 1ZW1A 3W79A 1UUFA 3IQEA 3VNBA 2B8HA 1JQLB 1J9GA 1SKAA 3JPYA 3GT4A 1YUBA 1UODA 4PR3A 2R7KA 2ZBRA 1HKHA 1QB8A 1XCJA 4BASA 3WLSA 4OXQA 4DIFA 3MK31 1P75A 3HDGA 3SC4A 3OQBA 4C7XA 2Q4TA 3K32A 4GX5A 4WWHA 2GETA 3H13A 2Q27A 1MS5A 1JLLA 1U3DA 3CSUA 4KVFA 4CM5A 1R9GA 4I50F 1E2EA 1NC3A 3S29A 1D04A 2C3PA 4NEHB 4D3SA 1KZGB 1QG0A 2DFNA 4KN9S 4KWTA 4MKIA 5CEJA 1P1KA 1REQB 1Z15A 3EZ7A 1LZLA 4BL5A 4R2WA 3SD7A 1NTOA 2WSSD 4G9GA 3S94A 2GT1A 1Z7BA 2W48A 1HEIA 3A37A 4JJ8A 2G80A 4MIYA 4QHSA 2I1LA 4J76A 5DYIA 3KJIA 4DB2A 1ZUD1 1USXA 1SXGA 5CX1B 1Q11A 1RM0A 3EF1A 2V6BA 3NIDB 3ZGVA 3HR8A 2VQEB 2UZAA 1SVWA 4CL2A 2QN3A 4FPOB 1VJCA 1FNNA 3G0OA 3M4YA 1RRFA 3IAS1 4I7EA 3H1TA 4HVAA 5CB8A 3DYBA 3VVCA 1KMIY 3QU7A 4Q48A 1P80A 2NVUB 3W78A 1JLLB 3DGEC 3LA6A 3RC8A 4ID3A 2OC4A 2Q2QA 2HMAA 4LGVA 3V80A 4F3YA 3HXQA 2IAQA 3EARA 3Q7RA 4MVJF 4UCQA 5EAIA 3M6UA 3TRDA 1X1CA 1IVYA 2Q3FA 3ZV6A 3AVXA 2SIMA 3L82B 4BGIA 1JG1A 4KO2S 4HVCA 2HSZA 3BGOS 2I66A 1GPWB 4NFSA 1AF7A 3WY9A 2VJCA 3DE0X 2H8GA 4P4LA 4RIGA 3ZWMA 2DQZA 2JBAB 2WE7A 4C01A 4CPLA 1NW8A 3CG4A 4LJ6A 9MHTA 3QRWA 1Y1SA 4OAOA 4GOXA 2D0OB 3O5AA 4MW6A 3HKBA 2UYOA 4OL9A 5C18A 3CCFA 4OQXA 4M7WA 3UPUA 3PNSA 3LRTA 3C8HA 1E2PA 1KH3A 3X1DA 4DAOA 3K5IA 3VDNB 1G4AE 3VMFA 2ZFUA 2IDZA 1R0CA 1VLVA 3AK4A 5BMVA 3EG5A 1A8IA 4F4UA 2W90A 3HJBA 3W2EA 3QVSA 3WJ7A 5IM4A 5AW9A 4HZZA 3RTEA 3C6KA 5IAJA 4WVLA 2YNMC 4Y9TA 2A78A 3VH1A 4AJ2A 3OU6A 2EOAA 2YHUA 3P2JA 5HZGA 5JYBA 3P0RA 4R1SA 3TLGA 3UMMA 2RGNC 2B9VA 5K0CA 3L77A 2WUDA 3B7PA 3HGQA 1KZ1A 1G20A 2FMFA 2QTRA 1KBQA 3B13B 1SUCA 3LBNA 1ZGBA 3KHTA 1JIJA 3NBQA 1UKCA 2A7QA 2AUNA 1OXXK 1YA4A 2FMHA 4HEJA 4L7VA 4TL9A 3ZHRA 2Q3BA 3BWDD 1UBRS 2VQSA 4LI3X 1RAHA 3ZW7A 3WGLA 2J0SA 1L5QA 1CUIA 4P0QB 5K0NA 1ZMOA 3QXSA 4A8JB 3QIVA 1TJ4A 1R6AA 3NM4A 4ZZIA 4UVHA 5JBQA 2X5KO 1X7XB 1OLSB 4GPTA 4PIPA 3V4PB 4AVYA 3UN1A 4ZHQB 4RK0A 5KPDA 2V8BA 4ISCA 3HYLA 5LP1A 3BE6A 3KTDA 4D9MA 2IYWA 2RHLA 4HQKA 4XR9A 5DH9A 5AW1A 1Z75A 3JSAA 5EWJA 1ZO8A 2HK7A 1EA5A 5CNJA 1UJMA 3OZXA 4JGIA 4OREX 3CVUA 3ILXA 5CAEB 1QNLA 4F96A 1IBCA 4QL3A 3CJTA 3RWBA 3U4MA 1QFMA 2XUOA 5GX1A 3V48A 3TDKA 4Y2XA 3K73O 1FRNA 3WLKX 2JGIA 5CBPB 3U3JA 5F7OA 4D4MA 5IULC 3FCSB 3F4LA 2Q5HA 4H08A 3PUJA 3IUPA 3I5XA 3UT5A 1VM6A 3GA7A 3ZWDA 4KRFA 4FFOA 5DLEA 1BYUA 3MRXA 1SM4A 2GUWA 4UBKA 4QBKA 1RCTE 1SBNE 2R79A 1RYFA 1BWSA 4MINA 1DBSA 4M9ZA 2LRHA 3IR5A 5BW6B 3VR5D 4M7OA 13PKA 1E3MA 2EGGA 3GFQA 2ZKIA 1USRA 3E8SA 1WZCA 3HUTA 3KG2A 3OLVA 4PAWA 2WWYA 1ZIDA 4CCWA 2CXPA 3WNCA 2Y4OA 4CKEB 3QKRA 4YMLA 1R4NA 2YV4A 2EP5A 3WB0A 5L4SA 4IV5A 1IB0A 4L8LA 3RV3A 3QYPA 1ZR4A 3RIHA 3F6CA 1Q0QA 3RFXA 1TA4A 5CA0B 2IBSA 5MHTA 5K8VA 4PQFA 2VUIB 2RGNA 1KC1A 3IQGX 3TICA 3P9QA 2W4MA 3S1SA 3TSWA 1A4XA 4G1MB 3ZNQA 3B6EA 3M89A 2H85A 4AGTA 2ONJA 3SP1A 4CI9A 1IWPB 5ALHA 1PJTA 3E2IA 2A1IA 2XZTA 1BA2A 3WBJA 4DY4A 1J2EA 2ECQA 5JZBA 2XUKA 1Z36A 2R8OA 5E1MA 1SQGA 2Q9BA 1E2KA 2RGXA 4GMDA 2BI4A 3REFA 5AUNB 5JARA 3BIXA 1PJQA 4JBWA 3UT0A 2QRPA 4U2EA 1IL0A 1KI9A 2Y1CA 2GLXA 3TAXA 4QULA 3VR4D 1YQEA 5LZ4A 4HDAA 3J81A 3BCSA 3DT6A 3B70A 5GZ1A 2B92A 5LOVF 4BNYA 1PR3A 2BGRA 2F3RA 2F1IA 2HMTA 4PBSA 4TXMA 3DCYA 1GOTA 4Q3NA 3R7SA 1PJCA 1LNZA 3D43A 3GJRA 1H2HA 2DYHA 1X74A 3FNGA 3HC7A 4KUEA 4DCVA 1F12A 2Q4DA 4Q1CA 2Z1MA 1A98A 3ZXSA 5JSUA 1GGMA 2DBQA 2CLOB 1LDMA 1R5NA 3FJOA 4YCAA 4AZ3A 3IMFA 2CY0A 2Z3ZA 1AZLA 1XZBA 3H1EA 1YTUA 4E15A 3OM1A 4ETIA 3UYLA 1E2LA 1E18A 2FRXA 4U7PB 3SJZA 2W2KA 3USZA 1Q1AA 2IP1A 4MV5A 3JQAD 3KGGA 1S8FA 2IWHA 3PFKA 7GPBA 4D4LA 5BO5A 3Q40A 2WAOA 5IDVA 4OQLA 4AQDA 2RK3A 2DERA 2CJXA 3DEAA 3H5WA 3VDRA 4NF2A 3II7A 3V4VB 3C39A 4EOGA 1KI6B 3OO1A 4RTOA 3FETA 3N2KA 3OZCA 4JUAA 4PFSA 3M8KA 1FPMA 1H2BA 2PPVA 5A5EA 4LDPA 3RVPA 4C76A 1G64A 4PSCA 1QH0A 3LX5A 3D64A 4HB4A 1GWNA 2QLJA 1QYDA 1RZUA 1OIWA 3K1AA 3WMEA 1GAWA 1ODKA 2C9ZA 4CMIB 4C0HA 2E49A 3L4KA 1H3FA 3GVIA 3NI2A 1QZ3A 2WZQA 4JP5A 3JQAB 4KOAA 3KKLA 4GW3A 1XDWA 3AVPA 3BH0A 2R47A 1OZ0A 4N0PA 2GZ3A 1QC5A 4R9RA 2VW1A 5AVQA 3AJ9A 4J4HA 1JXOA 1D6SA 2PUTA 3M6FA 1PQUA 2ZQYA 3UG6A 1S3GA 5DSZA 1P1FA 5ER9A 1B8UA 3RVSA 3Q8XB 4EGJA 1G1MA 4P33A 3AYXB 1I4WA 1RBYA 4GSYA 4OKNA 4IIEA 1TTHA 4KQGA 1SOMA 4MRPA 2J7KA 2DPXA 4H1UA 4OKSA 2VDVE 2W9XA 3H3FA 2IAUA 4RIFA 3NORA 1QKKA 1J07A 2OHVA 4AJKA 3ZK9A 2BCJQ 1MS9A 5AVJA 9GPBA 3UPTA 1GPNA 3UMGA 5IT0A 3K35A 3BTSA 3TOVA 1QVZA 2P2GA 1V4BA 2KB0A 3C3AA 1FYFA 1D9ZA 2IU4A 3RVJA 5DNVA 1QX3A 4FPXA 2AFHE 5TGZA 5EMHA 1A27A 2H1VA 4FBLA 1RYBA 2R6JA 4B2LA 1P7WA 3Q3VA 4DJ5X 2CUTA 3GMTA 3WRWA 1JYSA 1YGPA 3DP7A 1A9QA 3I30X 2YFQA 5BWBA 4ENPA 1A9TA 1GM5A 4KSYA 4DIDA 1RI3A 1EU1A 1U9YA 1UJ6A 3QTLA 1L5KA 3G1TA 3A11A 3IQDB 4ZIRB 2DFLA 1G2QA 3EVEA 5FOVA 1T8SA 2GYVA 1O9GA 3I0MA 1E8UA 3HSSA 3I6QA 3L84A 2R8PA 3DOUA 1PO7A 3LYHA 3A4TA 4GOND 2OQVA 5EUQB 1GL6A 2Q46A 2P5YA 4KIJA 4EG5A 1HO3A 3PC4A 3FFTA 5JCJA 4CTJA 4M87A 1RHRA 1TO2E 3AIMA 2H7XA 3O4IA 2BFFA 4TLEA 3FPLA 4BFXA 4D44A 2Y77A 2HYDA 5LBIA 1G9SA 2QW1A 4C07A 3D0RA 4ZEMA 2AJCA 4EO7A 3RSCA 5BMOA 2V3WA 4X65B 4KYTA 3I5YA 4J43A 1C3EA 1WIWA 1WCIA 5DKFA 3TD2A 4JOSA 3EAFA 3WIOA 2HCBA 1G5IA 4S04A 1M2JA 3UWDA 4X6UA 3E15A 1MABB 5T6MA 1PFYA 1XC7A 2ACEA 3JYPA 4TYQA 1Y5LA 1I4DD 1E3WA 3IPAA 3RHTA 4AYXA 3EZ6A 2B5OA 1N2XA 2OL4A 1AHHA 2NV2B 1WB5A 3FB1A 5KU1A 4I5DA 2P9QA 2Q8PA 3SFTA 2A0KA 3MQFA 5FYDA 2DBZA 4FX2A 2V7VA 3JASB 3CTMA 1PG0A 5FUBA 2FQXA 4MGZR 3UMRA 3ZS9A 4PN7A 1T2CA 1K6MA 3LWBA 2YFHA 1QF7A 3U39A 7AT1A 4C5AA 2JAPA 3U44A 3VI3B 3SICE 3AY7A 1N2JA 1VBFA 4G5GA 3ROZA 5DGXA 1V45E 2EKDA 2C7GA 2OXRA 3C41J 4BRUA 4WK0B 5GZ6A 4EYKA 5EXEA 5LWHA 2Q3EA 1H1DA 4HWSA 5F1YA 2VXYA 2V4ZA 2WD8A 3PWKA 5EUCA 1MC4A 4PQGA 5AIAA 3K9WA 1CQPA 3ADDA 5SZHB 3V34A 3QNWA 5IWCA 2O05A 2P0EA 5LQJA 5FTMA 1IG0A 2PBFA 1N1VA 3PK0A 2YRXA 4K1KA 1J21A 1H4VB 1R6BX 2P2ZA 3ZU3A 3D6FA 1RQXA 1TZKA 3C85A 4DA6A 2NYUA 3AX6A 1TJNA 2Z1DA 2ALJA 3LZCA 3FDJA 4M0PA 2QWKA 3KHKA 4U5XA 4JX8A 1C3JA 1Y3IA 1R0KA 4ZVRA 3RT7A 1R0SA 4JIMA 3UXYA 3UJ6A 3QE9Y 4CEJA 1FNBA 2FFBA 3M81A 3RJ9A 3T5PA 4CBVA 4IVNA 4GF5A 5HFNA 1WB9A 1MA0A 1NUTA 2VHJA 5GPBA 5EIAA 1L4YA 2CLLB 2FCAA 1FFSA 1PJ2A 2EGUA 2QGFA 2ZPTX 1F38A 2CMDA 3WGZA 3PJEA 1FBNA 2RK4A 4RZQA 3WGTA 4GEGA 1EQUA 5F7XA 4WBNB 3N6XA 2YMLA 1T0PA 1SA0B 4BX9A 3DE7X 4RGBA 4P54A 2BY4A 2OSVA 5KYUA 4BATA 3E1SA 4QYIB 1N1EA 4RA6B 4WFIA 4CM3A 3KR0A 4HXEB 3C3YA 4RVDA 4AP9A 4BKMA 4BZXA 3IEIA 4LZZA 4YFYA 2BSQA 4IEEA 4ANFA 4DCNA 4CTMA 1GGEA 1JDNA 3NCHA 2IU6A 3ANXA 4NTZA 4RHFA 1JP7A 1KJWA 1NLYA 4OHZA 5KNDD 4TVSA 4TSKA 2QRVB 1U4SA 4Z49A 2PR2A 1YR6A 1P72A 1M83A 3QZUA 3K38A 4ENQA 1SUWA 3UB2A 4R7ZA 4CPOA 2VBFA 2ZJYA 3OJXA 3R3YA 5MN4A 1Y4DE 3R6LA 1E3DA 1J9EA 4LNAA 3ST7A 1BWPA 1T5OA 4E4TA 2XNSA 3B1XA 1LBSA 1I7NA 1UMBA 4QWMA 4BRWA 3AMRA 1JQAA 2QZPA 5K3CA 1IY8A 2AK3A 1QNFA 4IHJF 4JLUA 3UTCA 4JV5B 5C5CA 3ICEA 3TLXA 2VPJA 3A1SA 4NEQA 3ACDA 1JHXA 1EVKA 1MBZA 1E2JA 4H4CA 2FZVA 1KXZA 2FZKA 3DEIA 4PPNA 4BWFB 4GT1A 3NNSA 1TECE 4M1TA 5EJAA 2WUEA 1DWOA 1H2AS 2F17A 4RV4A 4WOPA 3IP5A 1NVKA 5IAAA 3BERA 2B34A 5BXYA 1EBUA 1ZQ9A 5A5FA 1ZJ5A 3B89A 3SR4A 3LE8A 4BAUA 1LZKA 1KYIA 1BDJA 4RSHA 5CAEA 1P6UA 5ESXA 2L18A 2VBCA 3DKVA 3ETJA 2GXAA 3IJPA 4NOLA 3R44A 3AXTA 3C7CB 1ZHFA 4FIZA 1A76A 3RHFA 4YRNA 2E2WA 4EPVA 1SGWA 4LFAB 1L3IA 5GMOA 2COKA 4AO6A 4KITB 3BAFA 3WHLA 2QTBA 2G3YA 2JZCA 2PS0A 2XDQB 3TI3A 2FSUA 2QL7A 1VKHA 2VVTA 3D6NB 4KIFA 4MRSA 2HPAA 4WLNA 1K4YA 4ND7A 3ZEAA 1HT0A 1K7XB 1P17A 4B8YA 2GN4A 5JW6A 1M54A 2GKSA 3PQ5A 1QRTA 3ZN2A 3PVZA 3DEHA 1BJRE 4FGKA 5BURA 1W2HA 3O8QA 2P4HX 3FTDA 3TLKA 1DQSA 5EJEA 5KPJA 3GJ6A 3NHLA 4QUKA 1ETHA 2HT1A 1UK8A 2BMEA 1OI2A 2J6CA 2ECOA 3P4YA 4IP0A 1EPUA 4EA9A 4DB4A 3AIIA 2C88A 2MWMA 2NU9A 3IQHX 3R1IA 5FI1B 1CHDA 3P96A 1JIUA 1SVIA 1OX4A 4QGBA 4C7MA 5SZKB 2OCAA 2BOVA 3UEOA 2WJIA 3TI8A 2H0RA 3IPCA 2I80A 2YINC 3FE2A 4UXIA 3W4IA 3EASA 1M6HA 1B43A 2JAWA 1E8DA 4LPSA 2CJPA 1UZAA 4IKOA 1W76A 2WYVA 1L6RA 3N8NA 5H3HA 4ZKDA 2P9EA 4URWR 3TEMA 1O96A 1KA9H 2BF6A 1R6UA 2PMBA 3RBZA 2OILA 4RTKA 4QDJA 3CEJA 1UM8A 3RVLA 2I8CA 1OLOA 5HQTA 3KVVA 1F4LA 1T1IA 3OJCA 3H0EA 1F3OA 3BMQB 1FLDA 2H6EA 1FZTA 2H51A 5DN6D 4TS4A 4J9VA 1MKYA 1KJZA 3F7OA 3TLMA 3JU4A 1C7EA 4KX3A 2FXIA 2RAVA 4M54A 4OFWA 3I2GA 4P84A 2IH2A 1VHJA 5CFZA 2O52A 4I9UA 1S0JA 3C3DA 5FPHA 2DXIA 1NZFA 1YRHA 4H15A 3OY7A 4OQYA 2HSJA 3BIWA 5AHRA 5DX0A 1EDDA 4B17A 1DQRA 3N58A 1XN1A 1Z08A 4WTOA 2IOYA 4AMGA 1E5XA 4DF3A 5HIKA 5DI9A 1WDWB 4W7IA 4L95C 4M3NA 3IT1A 3F7TA 1TRKA 4YJHA 4B6SA 1T4CA 5E8RA 3OHMA 5G1PA 2IEGA 4AW9A 2WKPA 1HQYE 2IFTA 3C87A 5F12A 4MWWA 1UOOA 1RZRD 3SIWA 5H9WA 3N76A 4PAGA 3ZKWA 2IV7A 2UYCA 3LX8A 1OXKB 3DR5A 4YAJA 4IRMA 5DHTA 4QN7A 2WBLC 5LYJA 5D51S 2NXCA 3SZRA 3RJZA 4P6VF 1QDLB 2DOKA 4FKBA 1JN0A 4C4YA 3CXUA 3QLEA 1V16B 1A1VA 3O26A 5FBQB 3WB2A 1RT9A 3OCXA 3V8MA 5B7GA 1O54A 3L6OO 1MAAA 1T1JA 4YJ2A 4EH1A 4ZQIA 1V4NA 3AM1A 2VKQA 4HAZA 3O74A 4B7XA 5FBVB 1WZIA 1ZOIA 4DC0A 2IZ6A 2V59A 3H4MA 3PHJA 1R1DA 2YC2C 4ZGWA 1F8EA 2GKGA 1ZNZA 3GDWA 3OFKA 3SC3A 4GI3A 4IJUA 4D4IA 2BR5A 1LPMA 2CXNA 1BEEA 1YCDA 2FWMX 5K8UA 3II6X 2GWRA 3K8YA 1UPXA 2DETA 1KQPA 2BFAA 2P5SA 3LLSA 3PGJA 2HH9A 5K3FA 4E2XA 4LFBB 3CUUA 1TEHA 1VSBA 2K5UA 4RABA 4TT3D 4X1IA 2QXUA 3PNLA 1XTIA 1QF9A 3NHWA 4HT3B 3I83A 4WIAA 3FXAA 3T35A 3ICCA 2RIRA 1YTLA 2VHEA 1ZPDA 1DSSG 1UC5B 4GD3Q 4OHUA 1H69A 2RBEA 2Z30A 4IIYA 5CT8A 1UKBA 3NV9A 3ROXA 3TJMA 1GTJ1 3K6SB 4YP0A 4R6XA 1DT5A 1S1MA 3NHPA 2DFKB 3QTBA 2WINI 4DY6A 4I1SA 1TGVA 2W38A 1RQ2A 5BQOA 3SVTA 3G7UA 4D5GA 4M1SA 2IC5A 2XUIA 5K4AA 2ZPAA 4B35A 1ZDMA 3EVCA 4A6XA 4NVRA 1BROA 4NH0A 1U5BA 4EZIA 3FOFC 3RVRA 4MCHA 1CF4A 3VNUA 3NTRA 1P73A 1PRYA 3OF2A 5ENZA 4FWTA 1XPUA 4N8DA 3S2EA 1SB8A 2XVZA 4RQBA 4ZODA 4PG5A 1RNLA 4UUNA 3DOJA 4CLOB 4JROA 4LRYA 5D3MA 1JHPA 1SK9A 3ZOZA 4RKRA 1USGA 3JQ7A 1U8AA 4ECAA 1Y8CA 1YR7A 2ST1A 3OOWA 4DW8A 4KQMA 2YVUA 1N5IA 5CG1A 1L4KA 2QLBA 4QPJC 1HOTA 2QDXA 3TKLA 1W4CA 3G6KA 3QFCA 4MRMA 2EP7A 4HH4A 4OMCA 1FS6A 2HBZA 1DTWB 3MD9A 4PRZA 3DMHA 5EJ2A 5IVIA 4CMKA 3L4JA 2JLBA 1MW8X 4CMHA 4PLTA 3PFWO 3HDJA 3OF3A 3WQQA 4YJGB 3S1AB 3UAXA 4EYSA 5J2TB 4FFBB 3PDUA 1FC0A 2J0UB 2OB1A 1CNFA 2V6IA 3QLUC 5DX8A 4OG2A 4BWYA 1HQCA 1MEJA 2FG7C 4XJXA 2RH5A 1OLUA 1K6JA 1NMBN 2A5LA 1N6NA 4R8VA 5EGSA 4C0KA 4E30A 1AY0A 3AHIA 4XJWA 4DA9A 5JXGA 2A0YA 3JZIA 2W2LA 3E7DA 2XY4A 1DBVO 3KQVA 4C20A 3OESA 3WLPA 4ZO4A 2EW8A 2IASA 4QREA 3WJ2A 2PEYA 4UHHA 1EJ0A 3WGOA 4JMPA 1ADGA 3TB4A 5CVJA 2QLLA 3EBOA 1J2TA 2Y2UA 3CLTD 4LYHA 4Q03A 2VPTA 5ALXA 4UHKA 5G02A 5CFMA 3VC7A 1BMDA 4TOIA 1HLDA 2VWQA 3NYQA 1E9FA 1TVCA 3PQ2A 4N0MA 5C31A 4ZZ0A 4FPLA 1WY7A 4BMZA 4DLUA 4N3NA 1QPZA 1XVLA 1VCIA 3KLMX 4HH0A 2J0UA 3LL4A 5AI0A 3N0WA 5GX4A 3MGBA 1JBEA 4PWZA 1YB6A 2O50A 1ECBA 1RP1A 4U3JA 4YAFA 3O4PA 2FP4A 5AM0A 3SWWA 4B82A 1IVDA 4JX9A 2GDZA 4LDRA 3HRHA 3AR4A 3EDOA 1EJ2A 3F2IA 5IUNC 1R4MA 1Z39A 2FJ0A 3NANA 4CUKA 4BZQA 4FZVA 1WQ3A 4B4KA 2YR0A 2XNJA 3VNRA 4ASUA 2ATXA 2GJAA 2PD6A 3Q6PA 1S2OA 3IUBA 4GWKA 4HMQA 3OMWA 4MRMB 5FO0A 1AQYA 4CLEA 5G0SA 1FF9A 2XLCA 3NW9A 3TF5A 3L7AA 2WSLA 1NBHA 1B1AA 4WL0A 3HVIA 4HYQA 2DFVA 3W2FA 2VSQA 2ZRLA 1DIGA 3TE7A 5B4TA 4YZ2A 1CG6A 4O2AA 4LOKA 5ARDA 5KQMA 5LKRA 3LFTA 4KPUA 2AJ8A 1Z7GA 1YVRA 1P60A 1PTJA 1RVDA 1YZGA 4R4JA 3VHLB 1I7SB 3ZDYB 1KVRA 2O8BA 1NCBN 1E2UA 2VNHA 2IE0A 3JS5A 3HJTA 2Z3WA 4MPJA 1T0JB 3NNNA 3VFDA 1YVEI 2XW6A 3BSWA 1Z06A 4FDVA 3W09A 4M0FA 4XD7D 4Z6KA 1V7ZA 3GRAA 1ZH0A 3PIRA 1DEXA 2QRHA 4DQLA 1JAZA 2PH5A 3I09A 3MJ4A 4G86A 1L3CA 4HVTA 3E81A 4FFLA 1P5HA 1J90A 3KZMA 1XNGA 4EQ6B 5G0TA 5KX5A 4H52A 3K70B 1VKJA 3P5SA 3E9YA 2B30A 4OPMA 3S7ZA 4X8LA 1YNOA 1UKVY 3TGLA 4HSEA 2Q1SA 1CUZA 1PQYA 4I5IA 2A0FA 2G83A 4QJBA 2H5EA 3SE0A 1A82A 2IOFK 2YN2A 4X3PA 4D98A 1I32A 1YQTA 1YL6A 3DHVA 3ZWOA 4BO1A 4MWUA 2ZE5A 3DZ8A 1U81A 4EFNA 1ZJJA 4GDFA 1G3MA 1PK8A 4G67A 4KN5A 3DFFA 4JLNA 1M2WA 1KH2A 2OBMA 1PLLA 2YXNA 1XD2B 3O84A 1XMPA 3RTCA 3D3NA 2HYIC 1VCUA 4LHXA 5FULA 2R4TA 2NOAA 4HXYA 3WHPA 1NNEA 5LVAA 1VSVA 1WCIB 2EIXA 3LX6A 2OV8A 1NJGA 1EUSA 3QX3A 3MS4A 4DGQA 3BGSA 1DBPA 4MUNA 4UQOA 4I55F 1Z4XA 2GO7A 4B48A 2LVBA 5HF6A 2XGJA 1LCIA 3EXIA 4Q7MB 4S1VA 4TT3A 2R6GA 2Q2NA 4UJ3A 4BQFA 4DVJA 5FT9A 2C3YA 1THGA 3EWAA 1KZ6A 2AC2A 3TDNA 4EG3A 1MJGA 1CQJB 4P1ZA 3SX4A 1XZJA 1OFZA 4LQLA 1U11A 1GSHA 4HG2A 4XD2A 3UFBA 4ZXPA 1IHOA 4M38A 4LISA 1H93A 1W4AA 2QWGA 3GX1A 4B09A 4YXWD 3ICWA 3KKKA 4BY9E 1Q3TA 1Z8HA 2EHDA 1BEUB 2QR2A 1PHPA 2VQ6A 3MJCA 2VSKA 4HFRA 3KDSE 3KQUA 1V8BA 3KE8A 1EQ2A 3RTDA 4KXFB 4E1BA 2P2NA 2DWQA 3I61A 1DKNA 1SVNA 2HCFA 5HIJA 2AI3A 5DT2A 2F13A 4LJ5A 1U0SY 4DJEC 2DLNA 3RSZA 1ZRNA 3T7AA 1IUBA 2IPLA 3CQ9A 3V4LA 1PBTA 2LBPA 3C3EA 3OCCA 4LV5B 4FU0A 4GXQA 5C1BA 2C5AA 2OCYC 5JLAA 5D8DA 3PEYA 1IWOA 1FU8A 2O1EA 4HCJA 3IP6A 4ND4A 2O19A 4XJRA 2FZEA 2PV0A 4NE7A 3U5TA 3LP8A 1V48A 2GZAA 3SS7X 4AU1A 3SOVA 3PNPA 3V7NA 1IDN1 3ZIUA 3W4JA 5IJWA 5IKPA 3H83A 4NBTA 4RPJA 4FHCA 4IFTA 3N8DA 1DRUA 1QZUA 2JCYA 5KWJA 4YRRA 1F1JA 1Z0IA 4INPA 5FWNA 4IIFA 2QN1A 3UGKA 1C7JA 3LUPA 1L9KA 3BWXA 2B1IA 2E85A 5C1PA 1A8PA 4JYZA 2E21A 2WDZA 2D13A 3OEEA 1T6ZA 4LMBA 3DXYA 3Q9NA 4FQ8A 3S27A 3UWKA 1E6CA 1Q3HA 5KJFA 1MQ8B 4M6WA 4NRDA 3EMDA 3FHLA 1J5EB 1D4ZA 1XQXA 4S1TA 3RLIA 1D6NA 5ALOA 4LK2A 3EQ8A 4IMPA 1DE0A 4MKFA 4TUYA 4W7SA 1UMCA 1WL8A 1I4OA 4BFYA 5DZSA 3E23A 2OV3A 3IIKA 3G8DA 1NXPA 3H2JA 1AB6A 2HHCA 3MOGA 3FVZA 4GOOD 4G81A 2VNSA 5HCNA 3UIEA 2UZ4A 3A1CA 4J7UA 1EM8B 5TVKA 3JWHA 4N9WA 1YQXA 3DZHA 5C4IA 4YO7A 2HMWA 3VQTA 5GJBA 1XQWA 3F8WA 5IG2A 4XARA 2NAFA 1NF2A 3H9EO 3JD1A 2VSXA 4FILA 3CZRA 3PNVA 1T1SA 1XEFA 4AKHA 4CSDA 1H9AA 1UDBA 3F5DA 4G65A 3PV0A 4HDCA 4JKIA 1JJIA 1JFFA 3KD3A 3W05A 2IYQA 3P0HA 4KXYA 2H16A 4AZTA 2QD5A 3QWHA 1U3UA 1ZU5A 2ESRA 1HE1C 4IIHA 1UFKA 2PTGA 4KRGA 1DKPA 3V8BA 4MWJA 2EERA 5IC4A 2J87A 2VYFA 1NSFA 4KXXA 2QPLA 4NLLA 1DAKA 4P31A 4ARSA 3KT0A 1J2YA 1O8CA 1Y6QA 4X20A 4LS3A 4L76A 3DMNA 4XSHA 3TKAA 3ZX5A 2WTNA 1AG9A 2OK8A 3JQCA 5JJ5A 3KU4A 4OGWA 1J23A 1X7WA 4QQKA 3LIPA 1HORA 4E70A 5JMOA 5KSWB 2ZUBA 3D4IA 1POOA 3HDVA 5CT5A 4CFSA 1MAHA 4C7OA 5G0WA 1W48A 1WUTA 6REQB 2EKZA 1WCQA 2EG5A 4EEXA 3A6JA 2DY1A 2NTJA 1O5OA 2PJDA 2QL6A 5EUMA 4DMRA 1O2DA 1GTL1 2QTLA 4BGEA 2HB6A 1L4NA 3CF6R 1OXMA 1KJ9A 2JBAA 3BB4A 3C6QA 1YACA 3LCUA 2PIDA 1PGPA 3NO4A 4NMMA 2QVZX 3AR5A 4MA0A 1DFIA 1US8B 3U3MA 2GPWA 2Z1NA 3I4FA 3ZBPA 1HQDA 4NAVA 3CUSA 3ME5A 1JBKA 3LKZA 5H83A 2P67A 1INVA 4LC1A 1Q1EA 4U2DA 1J24A 2D0PB 1ZCBA 2H8KA 4RKWA 1RW4A 1JSRA 3C2QA 3K4PA 4MJUA 4HPXB 1PWZA 3KZXA 3L3BA 4MDHA 4UOEA 1H4QA 2BKAA 3BMNA 4H9GA 5L53A 1ZIPA 2ZIVB 3FJYA 3X0DA 3E1GA 1C2YA 4BLWA 2WLSA 1UBCA 2PANA 3W0LB 2Z5GA 4FI3C 3DWEX 5EQTA 4NHOA 2CN1A 3BICA 3DWFA 4TUYF 2WWGA 1C4WA 3PENA 1U28C 2QRLA 1XR3A 2VF4X 2ZBPA 5F5NA 3TB6A 4KLRA 3E58A 2G9NA 5LWQA 5AKGA 2IIPA 2XQKA 2V7QA 4FM9A 5AI8A 2XN4A 2JEZA 4RWEA 4B7JA 2GA8A 5IKOA 3UICA 5M5BA 1J0EA 2LP4Y 1YASA 3JWEA 4FYHA 4RSRA 1BRMA 4N8EA 4TV8B 4AWXA 2E37A 1CQXA 1POXA 3QVMA 5B7QA 4V0NA 1V71A 3FW1A 1J1UA 4XYEA 4EWLA 2GK4A 4Y9RA 4MICA 2BATA 4V3BA 2PUCA 5CNKA 2CJWA 2BLNA 5HSGA 4WOCA 2DHQA 1JFFB 1E5LA 4XCQA 5TQ0B 4EECA 2IYTA 4HDMB 1RWOA 1KF0A 4OQNA 1NY5A 4UATA 1VZ3A 4H59A 4HQLA 3UM9A 2NZUG 4URZR 1C1XA 5CHYA 4HADA 3FWYA 1T2FA 4EL0A 1XZGA 2C2XA 2H4WA 2ETXA 3L1VA 4LZPA 1IVFA 3RUPA 2OYRA 3TR6A 1DDIA 1SOVA 1M73E 2F48A 4KFTA 1PEAA 1BXKA 1DB3A 1DUVG 2O2CA 3H3XA 2FEWB 3U9SA 1C14A 4C7KA 2NO6A 1L5YA 4B74A 4M7PA 5I5EA 1ORDA 4WNYA 2ZUSA 2GB4A 2P30A 1V1JA 1I2CA 4RH1A 4ZO6A 1T2DA 1G8JA 2FU5C 1FSSA 2QTHA 3OAAA 4MW0A 1P8JA 4OK3A 3VPXA 1JECA 3HKEB 2ZRHA 3QX7A 3UOWA 4BCCA 3M4NA 2DHDA 4D99A 3Q1KA 1U80A 4YAKA 2Q6TA 2FJUA 3H19A 3IVMA 2Z6QA 3PGVA 1O9BA 1T9HA 2QLFA 4WDQA 1S2NA 2GERA 4PHTA 1F6DA 4HLUC 4RMGA 4YB8A 1KORA 2AKEA 2JFGA 1XJCA 2W58A 3O9ZA 3OCZA 1QHSA 5J2UA 4EQZA 3V1YA 3MMXA 2IYSA 2O2IA 1G60A 2B21A 4LY6A 1M2NA 6ADHA 1KZ7B 1YS1X 3ZJ5A 4RPIA 1X0VA 4UZFA 4CQMB 3FUXA 3C3CA 1NAHA 3JWJA 5DGTA 5JDCC 1JQ3A 1A9ZA 4MV4A 3GRPA 4JVOA 1YKGA 1QIFA 4TXHA 5HX0A 4N0EA 2Z3VA 1SU8A 4L4YA 3VR4H 1UOEA 1XN4A 2IYNA 2VRCA 4Q1AA 1IUPA 3A2KA 1FUYB 5B4UA 3O7WA 821PA 1GNVA 1M2OB 3JQDA 2OJHA 4HWGA 2O8VA 1RPTA 5G4LA 2EP8A 1KMCA 2JAQA 3RRXA 2CV1A 2HI0A 3P0JA 4DMLA 2PNJA 5FHRA 4K6KA 5EZSA 2OMKA 2O2SA 4IZ6A 4DC1A 3GPLA 3FAKA 3G02A 3W5DA 4FFPA 1U2GC 2NU7A 2GXUA 4TV9F 4DDMA 2WYHA 1IPEA 1NQOA 3CF0A 1LVHA 3QGMA 3CISA 3R3VA 3RE1A 3HFJA 3LI3A 2CDNA 1E0AA 4Q3OA 4HW6A 2HWWA 4E7PA 2J5QA 5AKLA 4RKFA 3SJ7A 4DBZA 1WXWA 5JR3A 1QHIA 2VH5R 3T06B 4PYOA 5GGYA 3BJMA 3GG2A 5DRTA 2JA1A 1G98A 3PUIA 4TV8F 2QT1A 4E1VA 2W98A 5D84A 1P7VA 1FRQA 1Z4IA 4EB6B 2H5JA 5AW3A 4UQLA 2G70A 2X5NA 4P5EA 1WB4A 3JQEA 2UKDA 4GLFA 4I4NA 4JLWA 4YMSA 4F4FA 3H9CA 4INOA 3VHXB 1XZEA 4G5QA 3P8ZA 4GZLA 1UBOS 3ELWA 4DM4A 1LSOA 4PU0A 4YN3A 2HTEA 2YA5A 2DG2A 3PX2A 2PGXA 1A95A 2OUKA 3H11A 4K9QA 2ZRFA 1T8TA 2GSWA 1MORA 1PX0A 3OKCA 5TB5A 1VE7A 3SF8A 4ZT6A 5IMBA 1V35A 3A25A 3H2BA 1W5SA 2Z2KA 3D5TA 3DZBA 3OZEA 3EVZA 4PLGA 4IDOA 5DNUA 3AJDA 3AF5A 5J40A 2O14A 2B69A 3M4JA 3AHCA 1GN9A 4YZ4A 1RC0A 4OP3A 3L6BA 4ETMA 5AOCA 3I76A 1QC5B 4CIVA 2GVZC 4XWGA 2P4EA 4DG5A 4TYPA 5KVSA 4TLCA 3TL2A 4HZWA 2IXBA 4F9TA 1BGXT 1V37A 3EPHA 3OA0A 2WZDA 2FVXA 1JMVA 4MQEA 1XU7A 3S5JA 5HVNA 1Y9DA 1P5JA 4GNKA 2QA5A 3WO1A 3PXEA 3D81A 4UAJA 1GTVA 1SKMA 5I9NA 2H1FA 4IXWA 2AVNA 1U2EA 5CX4A 1L4LA 2VRCD 2Z56A 3ZXYA 3IIIA 3NOXA 1QQTA 4FGJA 4B6OA 3DE5X 2DHEA 6NN9A 2VJMA 4LX0A 1N7HA 4RZUA 4UHJA 5CIYA 3KXDA 2J41A 4CIYA 1XD9A 2H63A 2HZ7A 4CE6A 3AEKA 4WLUA 1I30A 3GGCA 3R7AA 4GKKB 1HNXB 2NO4A 3H2IA 4U2CA 1VPLA 2I5PO 3I9FA 1U6IA 2VXBA 3A2NA 2PWAA 2FFQA 3IHKA 5A5DA 3IP1A 4RD0A 4FGSA 3S40A 1WP5A 1IMJA 1JQJC 2FPXA 3U7IA 5J3JA 4TRMA 3ZV3A 2WJ6A 2RGAA 2PT5A 1NY6A 4IHKA 4JP2A 4RO0A 4ZT2A 4OJMX 4JS0A 4IHJB 5FR2A 621PA 4AQYB 4DGRA 1XTVA 1MC8A 3ADEA 4JMLA 2HTWA 2HDNB 3F6EX 4YGXB 2B35A 1NJFA 2RFLA 2FY8A 5E4FA 4CEIA 5K3DA 2QV7A 3BXPA 1YJXA 3FDIA 4MWLA 4MKRA 4E32A 1HTBA 4ABYA 1NLZA 2G1PA 1C9JA 1P7PA 1T5IA 2H18A 4MS3B 1PK9A 3WL5A 1Q0LA 4J7AA 3EH1A 4DUGA 1P4SA 2FUG1 4PNZA 3ZCVA 4RL6A 1INGA 4ND2A 3M3HA 2X23A 1E1QD 5H3CA 1KY4A 4UMEA 2ZAIA 2AMYA 3B1JA 5MDHA 4MV8A 5TR9A 2HXGA 3KQWA 1XEWY 2Y1LA 4O59O 4XM0A 5J2UF 3MOSA 4QUBA 4MO2A 1NVEA 3K4QA 3OOJA 1N2GA 3HWWA 4KX5A 1VGRA 2NQ8A 2YFYA 5SY4A 3QKTA 3T1VA 3ZU4A 1U0GA 5A4KA 4FP9A 1OH6A 4W8GA 5EMLA 4YFVA 2BFNA 4HV4A 2ZI3A 5AVWA 1WW8A 3FM9A 3SF8B 5MN6A 2FWJA 3EIUA 1Y1RA 2RBKA 5K51A 1M7BA 2TYSB 2I2WA 4F8EA 3CNHA 3KKZA 4OH1A 1FRVA 4Y9SA 2Y6VA 5EN4A 3IOBA 5IVPA 1UDXA 3WGVA 2QX9A 3HFRA 1JA9A 3OQOA 4KXQA 5BT9A 1O6CA 4EA7A 1GAXA 3DO5A 4INAA 4PGMA 4KQHA 5EEGA 4JT4A 3AG6A 4PCUA 3RJMA 2QD2A 3K37A 2GO1A 3JARA 3GLKA 3ZH2A 1QKJA 1I2MA 3WBBA 1FE8A 4XMBA 2QAJA 3JZDA 5THQA 3VO2A 3MYYA 2O2JA 4ZV7A 3ZU6A 3BWCA 3OZFA 1TTTA 1RXSA 2J5BA 5KYXA 1P7ZA 4QYWA 3LT4A 3ZWPA 1RE1A 3HYRA 3IQIX 1TZBA 1L1RA 1CJTC 2QYTA 5F21A 5G0UA 4RJIA 5EJ4A 2B5WA 3ZE2B 4XVQA 1F48A 3Q8MA 2GN6A 3H87A 2CE2X 3KVNA 3VPSA 1GRVA 4DREA 3WI7A 3KOXA 2REBA 4EX6A 4BUJA 4QNRA 1XMSA 1HA3A 2VCEA 1N5KA 3CL2A 2NSYA 2AYYA 1ZWKA 4ZANA 3UWMA 3B7WA 2JJ2D 4RHEA 2HRZA 3FNEA 2WOOA 1QANA 4BVEA 1UINA 3DEZA 3VYVA 1M6VA 4P7KA 4QBGB 4MV9A 1SVOA 1QHYA 4DEVA 2I67A 3OX3A 4I55B 3D8NA 4UHCA 1HURA 1P3JA 1JAIA 1QUEA 2PZBA 2XB4A 1P3DA 1J7KA 5LA6F 4W5WA 1IDOA 2JD2A 3JQAA 3VR6H 1WRBA 4I81A 1P0CA 4JWTA 4J16C 1G2OA 3DJFA 1UPUA 3DT9A 4BO7A 1Z4ZA 3KP1A 1CZKA 3BJRA 2X0NA 3G9UA 4OA5A 1FMCA 5A6SB 4NE9A 1OASA 2C77A 5DF1A 3T7TA 5B6JA 4B6GA 3OZTA 1N6IA 1YZHA 3LT1A 4RGYA 4Y3UA 2Q29A 4HWOA 3V3TA 1LF0A 1Z8FA 3MT9A 3PJDA 4HDKA 4RVGA 4D9JA 5DNCA 3GLFB 4M8KA 1MHPA 2CUZA 1RRKA 4GQAA 4F1WA 2CEKA 3B6MA 1X3LA 3HBMA 3X1XA 2B25A 3L0DA 3OKPA 4FX5A 4TL8A 4EZBA 1WUHS 3V4RA 2XCLA 2JASA 1W4ZA 2QRGA 5CVEA 3R0IA 1V16A 1QFYA 3A9SA 4WKBA 3UWPA 3QLJA 1D4FA 3MWDA 2VL7A 1R5OA 4LG1A 3O6VA 1KWKA 1FP4B 3GOQA 1U7ZA 3EULA 2DECA 2APJA 3B9QA 2XZPA 2AX4A 4S3MA 1GZ4A 3CKYA 2PFGA 1Y8ZA 1TLLA 1YRYE 1M3SA 1X9GA 3W5CA 2QRNA 2EZ8A 3QMWA 4TYNA 1Y7PA 3W8DA 3HCAA 2ADOA 4YQFA 4YRAA 3RODA 1G55A 1ONSA 2C84A 1SC3A 2V1XA 2QX8A 4P81A 4XIGS 5JV5A 2DRIA 2OD9A 4Z4QA 2AC4A 3AETB 3ORRA 3MAJA 1ISJA 3JVVA 3TPZA 4EVQA 1PVDA 4RA9A 5A02A 4BUZA 1WS6A 1R2QA 5L3VA 3E05A 1H1TA 1OH5A 3D8BA 3MWDB 3GIWA 4R2HA 1NQWA 4OI2A 4DR3B 3H7IA 2ZS9A 4LDNA 1ORRA 4EHLA 1FYWA 1J22A 3W6NA 2UAGA 4BO3A 5BSTA 4DDHA 5F77A 1U7TA 3WV5A 3KRTA 2JLRA 3CMMA 4HDKB 3GLFA 1WY5A 2OEPA 2AZXA 5EZYB 5DCYA 5LIRA 10MHA 3HWX1 1XAGA 3S2KA 2R5NA 5L95A 1L7NA 1H6DA 1SCDA 3ND6A 1FU7A 2HSEA 4EB0A 3VR3A 1Y9ZA 1C8BA 2RB4A 1Z0UA 2PJRA 1NUAA 2WU3A 5AHXA 3QPCA 3DUFA 3VZBA 3WLTA 2RH8A 4M1QA 4ER3A 1PLJA 1KHHA 1U0LA 2ZRJA 3N6VA 4G5SA 3WIUA 3E5RA 5DDIP 4TRJA 1U9CA 1CFZA 3NDJA 1P2DA 4IIDA 2O8DB 1PSDA 1R4ZA 2A9FA 3FWHA 3O2NA 2CVZA 1YCGA 3KM0A 3TQHA 4LC0A 5FEUA 1N1YA 1RPZA 3UGQA 4YCNA 1E9VA 2YJ6A 1M2FA 2PQ6A 3RVNA 5HUKA 5KSOA 1EWRA 3C6MA 2Z83A 3DBHB 2R7AA 4DBLE 6NULA 1UJ4A 4ZGCA 3OFND 3EXG1 2WM8A 1V8DA 2X8WA 4XQCA 5EE3A 5TSDA 4KG7A 3C7TA 5FOXA 2PRZA 3FF4A 2BKVA 1J6UA 3R6WA 4CMEC 1G5RA 1BFDA 4AY4A 3JAWA 4HN9A 1J2RA 4KXUA 3V4FA 1RHMA 2YQZA 2P2SA 1XPOA 4EO4A 5ENVA 1CUXA 1XLTA 2A94A 3ZHTA 1TKCA 4CVNA 1XNJA 2AMJA 3EDYA 4CLHA 1E9AA 5F72C 2O7QA 3NTUA 4RGQA 2J3MA 3GDGA 1JG3A 3JZMA 4WZBE 5EHGA 3UA3A 1JDZA 2CVQA 1TAUA 1S1DA 4R41A 2CLCX 4XYMA 1RBQA 4JA0A 1K8QA 2B1RA 5BV2P 2D2EA 5AM2A 2WTAA 2JPDA 4TTJA 1FB5A 2GRJA 1KSHA 1Z62A 3NX4A 4J1NA 3M34A 5JE8A 1WA5A 2VZ0A 3IPXA 2EL9A 4N03A 1NX6A 1HSZA 1LSUA 3EY4A 4TUYB 4A23A 4A92A 2WEKA 2X7XA 3PICA 5CB0A 4DHWA 3LH5A 1LC3A 3OURA 3RANA 1YNSA 2RKCA 2YOHA 4FKMA 3GRYA 4TSRA 3N75A 3ISVA 1B41A 3DOEA 4RAQA 4C0AC 1H23A 4MVJD 1GPYA 4QN5A 2CKDA 2OXCA 3G5UA 4ODIA 2ZVQX 1CZUA 5EPOA 3OD5A 2EKLA 1BU5A 3SJAA 1PEYA 1I9CA 2RGYA 3PB3A 1EFAA 1Y7HA 1NN5A 2X3YA 4RTQA 1DTEA 3WNZA 1TQDA 1X7YA 2FLVA 1AX9A 1DKOA 1MFZA 2I4MA 2YHIB 4X7BA 4XGRA 4L0QA 1TK2A 3M5PA 1WLSA 1PJAA 1H6AA 5CD9A 4M9RA 2FMIA 3SSMA 2F26A 1KO7A 2JGFA 4GKAA 2FWNA 3DVQX 1LVGA 2GKOA 3V2GA 1DUSA 1EGQA 5EYPB 3H75A 4Q34A 4WZBB 1RXWA 3GJZA 1LTQA 1QFZA 3OJEA 1RBMA 2R3SA 3AEXA 3RJTA 3WN7A 2Q3HA 5INTA 1HE2A 1RWNA 3ZYZA 3PNKA 3VU9A 4OB7A 1XZHA 2G77B 3DTVB 1RM5A 1PWHA 1PT6A 1A8UA 1S9HA 2VTEA 4Q21A 1XHFA 3BRWD 3JV7A 4G89A 2MMGA 2VH2A 3UKDA 1G20E 1CR4A 1K2VN 2YJ4A 3N70A 3WAGA 3CX3A 1SXHA 4MQBA 5FOTA 3TQFA 1O5IA 1R0BA 5CXXA 3B85A 4XRRA 3BN3A 3OF5A 1BWRA 4IHJA 2MCFA 2A3NA 1Z4KA 3V7UA 1X80B 3M1AA 4BGDA 4KTVE 3UENA 2OM6A 4XJSA 4BYMA 3PSAA 1Z47A 4QU5A 4XWKA 1NDUA 3SJUA 5LB4A 3MBKA 4UW9A 2G5PA 1PT8A 2YRFA 2GD0A 5SYMA 1Z88A 5KYYA 1U7PA 2WF7A 3AI7A 4D9HA 1G2IA 1IIRA 4RFSA 1NMQA 5D1HA 1OU4A 5JSKA 1DWUA 3AG5A 1UPBA 4PANA 2BWJA 3TJRA 2RAUA 3HB9A 1U8TA 5JAPA 4MX0A 1XJ5A 2R7MA 4QAQA 4Q6BA 5JSFA 1IY9A 1OYYA 5COBA 4N3BA 5F2OA 3TLAA 3ZCXA 1NNBA 1X1SA 2JGDB 1T4GA 2X0RA 1ANKA 3R4VA 5JAIA 2JI6A 3DCJA 2VQFB 1TJPB 4Y2UA 1CQWA 3ENVA 3M9LA 5L4LA 1YZNA 2ABWA 4FQ5A 5D5QA 4LUCA 1LC0A 4IL5A 4NR0A 1SXJC 1TZCA 3AY3A 1B7GO 1QDUA 3CR8A 3ZI0A 1H0KA 1U0RA 1XU9A 2UZ1B 1M1YE 1OBVA 1DCKA 1NJ2A 4KOEC 3U1BA 1Z5ZA 3JWPA 2HSDA 1HNNA 2JIQA 4Q9LA 3HA7A 4EEKA 5ALWA 5FF9A 5BPHA 5CDYA 1TW3A 3VU9B 2CEAA 1G6KA 1WO8A 2WRZA 2Q7OE 4NC5A 3I04A 3WTCA 2D62A 4JELA 5EEHA 1NRXA 4YR7A 1MXHA 5D85A 1NBOA 3VOAA 1PX2A 4GH5A 4AZSA 3NVKI 2JFVA 4H0FA 1MX3A 2WJ4A 5CB4F 1LQ2A 1LF5A 4BIMA 2IYXA 2O3JA 3HVUA 4FT2A 2NSJA 2LV8A 2QQFA 3S1AA 4G8JA 2WJVA 1PFWA 4N5HX 3TQQA 2BC9A 4E5MA 4YBZA 1AMOA 1N0UA 4BX2A 3RNOA 3ZVNA 1IXRC 2VRWA 2HSWA 3DEJA 4K6MA 2RGEA 4RZSA 3BMXA 3M83A 2ZRNA 3H9BA 3LUJA 2Q07A 3R5KA 4LY0A 5DYTA 1JHZA 1IHPA 3LPAA 3OWOA 1Z28A 3O92A 3TQRA 4DQUA 1FUKA 4FYIA 4I4TF 3TRHA 3GJ4A 1MV5A 1ZU4A 3RS2A 3IKMB 2CMLA 4G0MA 1WVMA 2QX6A 3DDUA 2GVVA 3CH6A 4GPD1 3RRBA 7YASA 2HIAA 4QU9A 4QN4A 2F10A 1G4UR 1XL1A 1LK7A 1XCLA 2P91A 3MMPA 4JQZA 4A9AA 1JYEA 1T9ZA 3VHXA 3WWPA 1PJ8A 2HCJB 4KFCA 3KUXA 1M2HA 1OPXA 4P8RA 1G20B 3LD9A 5FA6A 2W7TA 3M3PA 1RHJA 1NXXA 5LQSA 3KR2A 3E3NA 4U0JA 1M8FA 3P9PA 4UTZA 4J3JA 2RKBA 3B1VA 3FYUA 1S2GA 4OH7A 4PYQA 4XOUA 5E3HA 2QXTA 1S89A 1YJ8A 2WF5A 3ZV7A 2YJ3A 2OO3A 1QIDA 4MR7B 1K7YA 1HFWA 1OW3B 2Q45A 1C9DB 4L3OA 5AM5A 3RU9A 3FOBA 5I9BA 3TOXA 3WWDA 3E7XA 4Q18A 4Z0HO 4CKBA 5DNYB 1IK6A 3KQNA 1RHQA 2QWAA 1QPBA 2GZ2A 4Q7QA 4GL4A 5CCXA 3GRRA 2XWJI 3M6XA 1MV8A 4FHZA 1Q14A 3OM9A 4BMVA 3C3XA 1CRLA 2NXJA 4IJWA 3GYGA 2Y0PA 5ED0A 1QG2A 2FMKA 1S4QA 2XVXA 2ZRMA 3GWZA 4RORA 2YCLA 2BMDA 2IYFA 4KXNA 3C5CA 4ESHA 1L8AA 4B0OA 2R00C 2ZYIA 3WLLA 3MINA 1FOEB 4CV2A 2LTAA 4TXJA 2VDNB 3W7VA 2Q4OA 1DXOA 3H5RA 1H2XA 2GJSA 3RYCA 4ITUA 3WQBA 1B6RA 1G42A 1AK2A 1VKNA 3U81A 1DAOA 2ADMA 5FUXA 2YWGA 5BMVB 4JU8A 4XASA 2KI5A 1F2DA 3SQDA 5IZCA 1NQUA 1V9LA 3NKVA 4KW7A 4LWQA 1RJ9B 2XXJA 3F6YA 3MF4A 3NBMA 3QE0A 3A9HA 1ZL2A 2XQIA 3RM3A 1MOQA 5BYAA 3IAUA 3S2ZA 4GOJA 2AZ4A 4B3XA 2DTDA 4YDQA 4E0BA 1MZ5A 1VJ0A 2ZJBA 3GJQA 3O9VA 4G0YA 4MRAA 4PO9A 4YPFA 4LJAA 4YW5A 2NU9B 4P93A 1TU4A 4WUVA 5JZSA 1AZTA 1VXRA 4JOQA 4B79A 2G9RA 2AGVA 2DLCX 3C74A 4YI5A 4JK3A 4WINA 2OORC 1EHIA 2RBGA 4L8GA 4CEIB 3MXTA 3VNAA 4FHGA 4KGXA 5KYWA 4M1ZA 1P7YA 1YIDA 3KPJA 3WKEA 2QROA 2C3OA 3EXHC 9LDBA 3CUEF 3KWJA 3HACA 4K2AA 4EY6A 3D12A 4IOMA 4V0OA 5CB6A 5G1NA 3FYUC 3M6MD 3PE4A 5F5XA 2ZB7A 2PH1A 2O0KA 1XXLA 4C0BA 1NHWA 2OCGA 3TQOA 4Q4JA 4L78A 4JR2A 2CNWA 3OD1A 2QUZA 1NQTA 2ZU6A 5JC8A 2AIRA 3VVBA 1P33A 1VE5A 1Q5PA 3E9CA 4Q9DA 4OHYA 1BVRA 3R7BA 2RI0A 3QX9A 1P61B 1W0KA 2CDCA 2OBNA 5AJZA 5JI2E 1ZD1A 3WZLA 1F9EA 2ATIA 2QSJA 4U4AA 1PS8A 4O5TA 1LDBA 2F59A 2DHCA 1U8FO 1KDTA 5T5QA 2FF5A 4LY9A 3QUAA 5F2EA 3QOYA 5KYWB 4FOSA 2XIJA 4JJZA 3OQVA 4YUAA 4F3TA 2IZ0A 2I7DA 3C97A 5COQA 3FX2A 2FR8C 3A05A 2ZBVA 5HG0A 1CT9A 1QQBA 2QZSA 5AUPB 2ZSFA 4FOQA 3R3JA 2IE8A 1ZCFA 1JI0A 4OHPA 3K2QA 1Z4QA 3IV6A 2WIGA 5A7HA 1N4AA 2Z57A 2IHTA 4NMLA 1WF6A 1T35A 1G66A 4HX9A 4AC9A 1YC5A 3MPUA 3ONVA 4BHTA 4DLTA 1E61A 1TE2A 3EZ9A 3K5WA 4BN5A 3S8YA 1V1MB 3PE3A 1Q1ZA 1E3WB 1I6MA 1X86B 1HRKA 1U9IC 2C2MA 2GEBA 1FCJA 3E84A 2CNDA 4J0IA 4MH0R 3SLRA 1B8OA 5D5PA 1F6BA 1INWA 1OFUX 4Q4CA 3O1LA 1TYEB 2ZATA 4CF4A 1CDEA 2A5DA 4L28A 5D3ZA 4G1FA 3TQIA 1E6UA 2P5UA 3PWTA 4IDCA 1DOHA 1EGVB 5JS8A 4M1WA 4IFBA 2KQUA 1IJKA 7NN9A 5T67A 4AFNA 3KIPA 2J4CA