2BATA

The structure of the complex between influenza virus neuraminidase and sialic acid, the viral receptor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
388
structure length
388
Chain Sequence
VEYRNWSKPQCQITGFAPFSKDNSIRLSAGGDIWVTREPYVSCDPVKCYQFALGQGTTLDNKHSNDTVHDRIPHRTLLMNELGVPFHLGTRQVCIAWSSSSCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIGSWSQNILRTQESECVCINGTCTVVMTDGSASGRADTRILFIEEGKIVHISPLAGSAQHVEECSCYPRYPGVRCICRDNWKGSNRPVVDINMEDYSIDSSYVCSGLVGDTPRNDDRSSNSNCRNPNNERGTQGVKGWAFDNGNDLWMGRTISKDLRSGYETFKVIGGWSTPNSKSQINRQVIVDSDNRSGYSGIFSVEGKSCINRCFYVELIRGRKQETRVWWTSNSIVVFCGTSGTYGTGSWPDGANINFMPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords NEURAMINIDASE N2
publication title The structure of the complex between influenza virus neuraminidase and sialic acid, the viral receptor.
pubmed doi rcsb
source organism Influenza a virus (a/tokyo/3/1967(h2n2))
total genus 109
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 1992-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 2batA00
4FPEA 1N1VA 5HUMA 3H71A 4GZXA 1EUUA 4MWJA 1EUSA 1MZ5A 1NCCN 5B2DA 1MS3A 4FPGA 4FOWA 3CL0A 4K1IA 1MS5A 2AGSA 1MR5A 1MS1A 1IVCA 3INBA 4CPLA 2W5NA 1NSCA 1SLLA 3SILA 4X47A 2QWCA 2YA8A 4GEZA 4X4AA 3OPZA 3SALA 4XIKA 1NNCA 1MS9A 1MS0A 2QWHA 2BERA 4K1JA 5HUNA 1INYA 4XYXA 4FPFA 3TI4A 4HZZA 1A4QA 4GZWA 1F8EA 4I00A 2VW2A 3BEQA 4NCSA 4FQ4A 4WA5A 2BATA 4NC5A 4B7QA 1Z50A 3W09A 1MZ6A 4KS2A 1V0FA 4CPZA 4YZ1A 2VSKA 2C4AA 2HTUA 3TI8A 4DGRA 3TIAA 1L7GA 4HZYA 1V3CA 1L7HA 2ZB6A 3H72A 4HIZA 4FZHA 2F0ZA 4XJWA 4YZ3A 1F8BA 4FPKA 2VK6A 4XIOA 3TI3A 2YDPA 4QN6A 3K39A 2QWAA 1NCBN 2VK5A 4WA3A 5M1ZA 4XHXA 4CPNA 4HZWA 3O9JA 2HT8A 1XOGA 5HX0A 4XJUA 3B7EA 2YA4A 4XILA 1L7FA 3JU4A 2F10A 4X6KA 1IVDA 2RKCA 2W20A 1W0PA 2XZIA 3CKZA 3K36A 7NN9A 2QWIA 2JKBA 1V3BA 4GZTA 1E8UA 4WEGA 1S0IA 2BF6A 3B69A 2QWBA 4M4VA 4QN5A 4B7NA 3K3AA 2F12A 4NN9A 1USRA 3D12A 4FPOB 1NN2A 2F25A 2C4LA 3PJQA 3O9KA 1NCAN 4GDJA 1INXA 2VSMA 3H6JA 1S0JA 2F24A 4XE9A 1NSDA 4XOGA 1NMCA 2XCYA 4YW1A 1V3EA 4B7JA 4FPLA 4FPHA 4QN7A 3H73A 2F11A 1F8DA 4Q6KA 1EURA 1IVBA 2QWJA 1V0ZA 2VW1A 2QWDA 2F13A 1NNBA 4H53A 3D11A 4MWRA 3T1EA 1IVGA 1A14N 5F9TA 1NSBA 3TI6A 1DILA 4BBWA 4KS3A 2FHRA 1B9SA 2W5OA 1MWEA 4XJ8A 2YA7A 1W8NA 2HT5A 2YDTA 3ALXA 2VWDA 4WEFA 1Z4XA 2XZJA 2VK7A 4WA4A 4MC7A 1WCSA 2YA6A 4MWWA 1W1XA 2F28A 3SLIA 4CPYA 1V2IA 1DIMA 4XJ9A 4MWXA 3K38A 1SNTA 4XJRA 2B8HA 2X9MA 4FPJA 2CMLA 3NN9A 2HTYA 2F29A 6NN9A 3CL2A 4FOQA 2XZKA 3NSSA 4JF7A 4XMIA 4GJTA 1SLIA 1EUTA 1SO7A 4MWVA 4MZEA 1A4GA 4FP2A 1INGA 1B9TA 4YW4A 1NNAA 1W8OA 1MS8A 1MS4A 1INVA 3TIBA 1INFA 1B9VA 4FOYA 4CPMA 1BJIA 1E8VA 4MJUA 4GZPA 3K37A 2HU4A 2QWEA 1INHA 4B7RA 2AH2A 1V0EA 2W38A 4YW5A 1VCJA 4YW3A 1IVEA 5HUGA 2AEQA 4KS1A 3GVLA 3GVJA 4M4UA 2HT7A 4MX0A 1W0OA 3SANA 4FVKA 2QWFA 1N1SA 2HTWA 4J9TA 4M4NA 2F27A 2VW0A 1V3DA 4H52A 4K1HA 4KS4A 1XOEA 1INWA 4HZXA 3TI5A 1Z4WA 5NN9A 1Z4ZA 2QWKA 4YW2A 3CYEA 4X49A 4B7MA 1NMAN 4CPOA 4FP3A 1Z4VA 2VVZA 4GB1A 4XJQA 4HZVA 4KS5A 4MWLA 1WCQA 4M3MA 4GZQA 2HTRA 2ZB5A 4UF7A 2HTVA 3ALWA 4GZOA 2A75A 1IVFA 4GZSA 2F26A 2SIMA 4MWUA 4MZAA 1E8TA 2SLIA 4K3YA 4XJAA 5B2CA 4YZ2A 1NCDN 3A72A 4GDIA 4QNPA 4XHBA 4QN3A 4FPCA 4K1KA 1F8CA 4QN4A 4YZ4A 1USXA 2HTQA 4FPYA 4FJ6A 1KITA 3TICA 4SLIA 2SILA 4YZ5A 2AEPA 4XJZA 5HUKA 4FOVA 1N1TA 1N1YA 1VCUA 1W20A 2HU0A 1NMBN 2BZDA 3GVKA 4MWQA 4XMAA 4D8SA 5JYYA 4MJVA 2QWGA 4MWYA 1W21A 1Z4YA 3A71A 2YA5A
chains in the Genus database with same CATH superfamily
1SUUA 5D9CA 4FPEA 1N1VA 5HUMA 3H71A 1ZI0A 4GZXA 1EUUA 4MWJA 4IFLX 1EUSA 1MZ5A 4GNAA 1NCCN 5B2DA 1MS3A 4FPGA 4FOWA 3CL0A 4K1IA 1MS5A 3S8ZA 2AGSA 1MR5A 1MS1A 1IVCA 3INBA 4N1BA 4CPLA 2W5NA 1NSCA 1SLLA 3SILA 4X47A 2QWCA 3O4PA 2YA8A 4GEZA 3Q6PA 4X4AA 4D52B 3OPZA 3P5BL 3SALA 4XIKA 1NNCA 5GX2A 2ZW9A 1IUCA 4AHAA 1MS9A 1MS0A 2QWHA 4AGTA 2VAQA 2BERA 3ADEA 2OJHA 3DASA 4K1JA 5HUNA 1INYA 3FVZA 4XYXA 4L7CA 4FPFA 3TC9A 1CRUA 3TI4A 5GX1A 4HZZA 1A4QA 2FPBA 2IVZA 2V91A 4GZWA 1F8EA 4I00A 2VW2A 3BEQA 1NPEA 5EX7A 4NCSA 4FQ4A 4WA5A 2BATA 2IAOA 4NC5A 5FNRA 4R40A 4B7QA 1Z50A 2H2UA 3G4HA 1MZ6A 4KS2A 3W09A 4G3NA 1V0FA 3S2KA 4CPZA 4YZ1A 2VSKA 2C4AA 2HTUA 2IASA 3TI8A 4DGRA 3TIAA 1L7GA 4HZYA 3A9GA 1V3CA 1L7HA 2ZB6A 4L7BA 3WW9A 3H72A 4HIZA 4FZHA 2F0ZA 4XJWA 4YZ3A 2ISMA 1F8BA 4FPKA 2VK6A 4XIOA 1N6FA 3TI3A 2YDPA 4QN6A 3K39A 2QWAA 1NCBN 2IAQA 2W8BA 2QE8A 1RWLA 1V04A 2VK5A 3ZGDA 2G8SA 2GHSA 1WP5A 4WA3A 5M1ZA 4XHXA 4CPNA 4HZWA 3O9JA 2HT8A 1XOGA 2FPCA 4IMBA 5HX0A 3VNHA 4XJUA 3B7EA 2YA4A 4XILA 3FW0A 4IQKA 1ZGKA 1L7FA 3JU4A 2F10A 1PJXA 4JMLA 4X6KA 1IVDA 2RKCA 3WN7A 2W20A 1W0PA 5FWWA 2XZIA 4PWZA 3CKZA 3U0SA 3K36A 7NN9A 4O5SA 2QWIA 2JKBA 1V3BA 4GZTA 1E8UA 4WEGA 1S0IA 2BF6A 2WOZA 3B69A 2QWBA 4O5TA 4M4VA 2DG1A 4QN5A 4B7NA 3K3AA 2F12A 4ZGCA 4C1YB 4NN9A 4GN7A 1USRA 3NO0A 2GVVA 3D12A 4FPOB 1NN2A 2F25A 2C4LA 3PJQA 5GX5A 3O9KA 1NCAN 4GDJA 1INXA 5D9DA 2VSMA 3H6JA 4ASCA 1S0JA 2F24A 4XE9A 1E1AA 1NSDA 2ZWAA 1CVMA 4XOGA 1NMCA 2XCYA 3IAXA 4YW1A 3V64C 1V3EA 3WDZA 4B7JA 4FPLA 4FPHA 4QN7A 4D52C 4ZLRA 3H73A 2P4OA 1QLGA 2F11A 1F8DA 3LI5A 4Q6KA 3LI3A 1IVBA 1EURA 2QWJA 1V0ZA 2VW1A 4D52A 1C5KA 2QWDA 1CRZA 2F13A 4CH9A 1NNBA 4L7DA 4H53A 3D11A 4MWRA 2FLUX 3T1EA 1IVGA 2HQSA 1A14N 2IAXA 5F9TA 4UOUA 1NSBA 3TI6A 1DILA 4BBWA 1N7DA 4KS3A 2FHRA 1B9SA 2W5OA 1MWEA 4XJ8A 2YA7A 1W8NA 1X2JA 2HT5A 2YDTA 4HHQA 2H2NA 1Q7FA 2DG0A 3ALXA 2VWDA 4WEFA 1Z4XA 2XZJA 2VK7A 4WA4A 2IARA 4MC7A 1WCSA 2YA6A 2FP9A 4MWWA 5FZNA 1S18A 1W1XA 1QBIA 2F28A 3I1CA 3KYAA 3SLIA 4CPYA 1V2IA 2IATA 4D4UA 1DIMA 4XJ9A 4MWXA 3K38A 1SNTA 4XJRA 2B8HA 3E5ZA 5FNTA 2X9MA 4FPJA 2CMLA 3NN9A 4HW6A 2HTYA 4AH4A 2IAPA 3Q6TA 5EO8A 3VNGA 5CGJA 2F29A 6NN9A 1N6EA 3AMSA 3CL2A 4FOQA 2XZKA 3NSSA 4JF7A 5FNSA 4XMIA 3S8VA 4GJTA 1SLIA 3HRPA 4AGIA 3SOQA 3A9HA 1EUTA 1SO7A 4MWVA 4MZEA 1A4GA 2GVWA 4FP2A 1INGA 1B9TA 4YW4A 1NNAA 1W8OA 3II7A 1MS8A 1MS4A 5GX4A 4YY8A 1INVA 3TIBA 1INFA 5FZJA 1B9VA 4FOYA 4CPMA 1BJIA 1E8VA 4MJUA 4XMBA 4GZPA 2IAWA 3K37A 2HU4A 2QWEA 1INHA 4B7RA 2AH2A 5FNUA 1V0EA 1RWIA 2W38A 4YW5A 1VCJA 3AMRA 5FNQA 5GX3A 4YW3A 1IVEA 5HUGA 2AEQA 4KS1A 3GVLA 3GVJA 2IAVA 4M4UA 2HT7A 4MX0A 1W0OA 2IAUA 3SANA 4FVKA 4C1YA 2QWFA 1N1SA 2HTWA 4IFJA 4HHOA 4J9TA 3KGGA 2F27A 4M4NA 2VW0A 1V3DA 4H52A 4K1HA 4KS4A 1XOEA 5D9BA 1C9UA 3BYCA 1INWA 3G4EA 4HZXA 1Z4WA 3TI5A 5NN9A 5EO7A 4A0PA 1Z4ZA 2QWKA 4YW2A 1H6LA 3CYEA 4X49A 2POOA 4Q1UA 4B7MA 1NMAN 4CPOA 4GN9A 4FP3A 3Q6KA 1Z4VA 3SRGA 3DR2A 1U6DX 2VVZA 4GNBA 4GB1A 4XJQA 4HZVA 4KS5A 4MWLA 1WCQA 4M3MA 4ZY3A 4GZQA 3LI4A 2VPJA 1OFZA 2HTRA 2ZB5A 4UF7A 4CSDA 2HTVA 3V65B 3ALWA 4GZOA 2A75A 1IVFA 4GZSA 2XN4A 2GVXA 5F72C 2F26A 3WWAA 2SIMA 4MWUA 4MZAA 1E8TA 2SLIA 2FP8A 4K3YA 4XJAA 4YZ2A 1NCDN 3S94A 5B2CA 3A72A 2ZZKA 4GDIA 4QNPA 4XHBA 4QN3A 3HLHA 4FPCA 4K1KA 1F8CA 1POOA 4GN8A 4QN4A 1IUBA 4YZ4A 1USXA 2HTQA 4DG6A 2W8BB 2DSOA 4FPYA 2Z32A 4FJ6A 5H47A 1KITA 3HLIA 3TICA 4SLIA 2SILA 3L6VA 4YZ5A 2DYHA 2AEPA 3UC1A 4XJZA 5HUKA 4CHBA 4FOVA 1N1TA 1N1YA 1VCUA 1W20A 4IYGA 2HU0A 3ZGCA 3V1SA 4IN4A 4IFNX 1CQ1A 1K32A 1NMBN 5GTQA 2BZDA 3GVKA 4MWQA 4XMAA 4D8SA 5JYYA 1X2RA 3SOVA 4MJVA 2QWGA 4MWYA 1W21A 1Z4YA 4GNCA 3A71A 2YA5A 1S1DA 3SREA 3SOBB 1IJQA 2GVUA 1N6DA
chains in the Genus database with same CATH topology
4FPEA 1N1VA 5HUMA 3H71A 4GZXA 1EUUA 4MWJA 1EUSA 1MZ5A 1NCCN 5B2DA 1MS3A 4FPGA 4FOWA 3CL0A 4K1IA 1MS5A 2AGSA 1MR5A 1MS1A 1IVCA 3INBA 4CPLA 2W5NA 1NSCA 1SLLA 3SILA 4X47A 2QWCA 2YA8A 4GEZA 4X4AA 3OPZA 3SALA 4XIKA 1NNCA 1MS9A 1MS0A 2QWHA 2BERA 4K1JA 5HUNA 1INYA 4XYXA 4FPFA 3TI4A 4HZZA 1A4QA 4GZWA 1F8EA 4I00A 2VW2A 3BEQA 4NCSA 4FQ4A 4WA5A 2BATA 4NC5A 4B7QA 1Z50A 2H2UA 3W09A 1MZ6A 4KS2A 1V0FA 4CPZA 4YZ1A 2VSKA 2C4AA 2HTUA 3TI8A 4DGRA 3TIAA 1L7GA 4HZYA 1V3CA 1L7HA 2ZB6A 3H72A 4HIZA 4FZHA 2F0ZA 4XJWA 4YZ3A 1F8BA 4FPKA 2VK6A 4XIOA 3TI3A 2YDPA 4QN6A 3K39A 2QWAA 1NCBN 2VK5A 4WA3A 5M1ZA 4XHXA 4CPNA 4HZWA 3O9JA 2HT8A 1XOGA 5HX0A 4XJUA 3B7EA 2YA4A 4XILA 1L7FA 3JU4A 2F10A 4X6KA 1IVDA 2RKCA 2W20A 1W0PA 2XZIA 3CKZA 3K36A 7NN9A 2QWIA 2JKBA 1V3BA 4GZTA 1E8UA 4WEGA 1S0IA 2BF6A 3B69A 2QWBA 4M4VA 4QN5A 4B7NA 3K3AA 2F12A 4NN9A 1USRA 3D12A 4FPOB 1NN2A 2F25A 2C4LA 3PJQA 3O9KA 1NCAN 4GDJA 1INXA 2VSMA 3H6JA 1S0JA 2F24A 4XE9A 1NSDA 4XOGA 1NMCA 2XCYA 4YW1A 1V3EA 4B7JA 4FPLA 4FPHA 4QN7A 3H73A 2F11A 1F8DA 4Q6KA 1EURA 1IVBA 2QWJA 1V0ZA 2VW1A 2QWDA 2F13A 1NNBA 4H53A 3D11A 4MWRA 3T1EA 1IVGA 1A14N 5F9TA 1NSBA 3TI6A 1DILA 4BBWA 4KS3A 2FHRA 1B9SA 2W5OA 1MWEA 4XJ8A 2YA7A 1W8NA 2HT5A 2YDTA 2H2NA 3ALXA 2VWDA 4WEFA 1Z4XA 2XZJA 2VK7A 4WA4A 4MC7A 1WCSA 2YA6A 4MWWA 1S18A 1W1XA 2F28A 3SLIA 4CPYA 1V2IA 1DIMA 4XJ9A 4MWXA 3K38A 1SNTA 4XJRA 2B8HA 2X9MA 4FPJA 2CMLA 3NN9A 2HTYA 2F29A 6NN9A 3CL2A 4FOQA 2XZKA 3NSSA 4JF7A 4XMIA 4GJTA 1SLIA 1EUTA 1SO7A 4MWVA 4MZEA 1A4GA 4FP2A 1INGA 1B9TA 4YW4A 1NNAA 1W8OA 1MS8A 1MS4A 1INVA 3TIBA 1INFA 1B9VA 4FOYA 4CPMA 1BJIA 1E8VA 4MJUA 4GZPA 3K37A 2HU4A 2QWEA 1INHA 4B7RA 2AH2A 1V0EA 2W38A 4YW5A 1VCJA 4YW3A 1IVEA 5HUGA 2AEQA 4KS1A 3GVLA 3GVJA 4M4UA 2HT7A 4MX0A 1W0OA 3SANA 4FVKA 2QWFA 1N1SA 2HTWA 4J9TA 4M4NA 2F27A 2VW0A 1V3DA 4H52A 4K1HA 4KS4A 1XOEA 1INWA 4HZXA 3TI5A 1Z4WA 5NN9A 1Z4ZA 2QWKA 4YW2A 3CYEA 4X49A 4B7MA 1NMAN 4CPOA 4FP3A 1Z4VA 2VVZA 4GB1A 4XJQA 4HZVA 4KS5A 4MWLA 1WCQA 4M3MA 4GZQA 2HTRA 2ZB5A 4UF7A 2HTVA 3ALWA 4GZOA 2A75A 1IVFA 4GZSA 2F26A 2SIMA 4MWUA 4MZAA 1E8TA 2SLIA 4K3YA 4XJAA 5B2CA 4YZ2A 1NCDN 3A72A 4GDIA 4QNPA 4XHBA 4QN3A 4FPCA 4K1KA 1F8CA 4QN4A 4YZ4A 1USXA 2HTQA 4FPYA 4FJ6A 1KITA 3TICA 4SLIA 2SILA 4YZ5A 2AEPA 4XJZA 5HUKA 4FOVA 1N1TA 1N1YA 1VCUA 1W20A 2HU0A 1NMBN 2BZDA 3GVKA 4MWQA 4XMAA 4D8SA 5JYYA 4MJVA 2QWGA 4MWYA 1W21A 1Z4YA 3A71A 2YA5A 1S1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FPE A;  1N1V A;  5HUM A;  3H71 A;  4GZX A;  1EUU A;  4MWJ A;  1EUS A;  1MZ5 A;  1NCC N;  5B2D A;  1MS3 A;  4FPG A;  4FOW A;  3CL0 A;  4K1I A;  1MS5 A;  2AGS A;  1MR5 A;  1MS1 A;  1IVC A;  3INB A;  4CPL A;  2W5N A;  1NSC A;  1SLL A;  3SIL A;  4X47 A;  2QWC A;  2YA8 A;  4GEZ A;  4X4A A;  3OPZ A;  3SAL A;  4XIK A;  1NNC A;  1MS9 A;  1MS0 A;  2QWH A;  2BER A;  4K1J A;  5HUN A;  1INY A;  4XYX A;  4FPF A;  3TI4 A;  4HZZ A;  1A4Q A;  4GZW A;  1F8E A;  4I00 A;  2VW2 A;  3BEQ A;  4NCS A;  4FQ4 A;  4WA5 A;  2BAT A;  4NC5 A;  4B7Q A;  1Z50 A;  3W09 A;  1MZ6 A;  4KS2 A;  1V0F A;  4CPZ A;  4YZ1 A;  2VSK A;  2C4A A;  2HTU A;  3TI8 A;  4DGR A;  3TIA A;  1L7G A;  4HZY A;  1V3C A;  1L7H A;  2ZB6 A;  3H72 A;  4HIZ A;  4FZH A;  2F0Z A;  4XJW A;  4YZ3 A;  1F8B A;  4FPK A;  2VK6 A;  4XIO A;  3TI3 A;  2YDP A;  4QN6 A;  3K39 A;  2QWA A;  1NCB N;  2VK5 A;  4WA3 A;  5M1Z A;  4XHX A;  4CPN A;  4HZW A;  3O9J A;  2HT8 A;  1XOG A;  5HX0 A;  4XJU A;  3B7E A;  2YA4 A;  4XIL A;  1L7F A;  3JU4 A;  2F10 A;  4X6K A;  1IVD A;  2RKC A;  2W20 A;  1W0P A;  2XZI A;  3CKZ A;  3K36 A;  7NN9 A;  2QWI A;  2JKB A;  1V3B A;  4GZT A;  1E8U A;  4WEG A;  1S0I A;  2BF6 A;  3B69 A;  2QWB A;  4M4V A;  4QN5 A;  4B7N A;  3K3A A;  2F12 A;  4NN9 A;  1USR A;  3D12 A;  4FPO B;  1NN2 A;  2F25 A;  2C4L A;  3PJQ A;  3O9K A;  1NCA N;  4GDJ A;  1INX A;  2VSM A;  3H6J A;  1S0J A;  2F24 A;  4XE9 A;  1NSD A;  4XOG A;  1NMC A;  2XCY A;  4YW1 A;  1V3E A;  4B7J A;  4FPL A;  4FPH A;  4QN7 A;  3H73 A;  2F11 A;  1F8D A;  4Q6K A;  1EUR A;  1IVB A;  2QWJ A;  1V0Z A;  2VW1 A;  2QWD A;  2F13 A;  1NNB A;  4H53 A;  3D11 A;  4MWR A;  3T1E A;  1IVG A;  1A14 N;  5F9T A;  1NSB A;  3TI6 A;  1DIL A;  4BBW A;  4KS3 A;  2FHR A;  1B9S A;  2W5O A;  1MWE A;  4XJ8 A;  2YA7 A;  1W8N A;  2HT5 A;  2YDT A;  3ALX A;  2VWD A;  4WEF A;  1Z4X A;  2XZJ A;  2VK7 A;  4WA4 A;  4MC7 A;  1WCS A;  2YA6 A;  4MWW A;  1W1X A;  2F28 A;  3SLI A;  4CPY A;  1V2I A;  1DIM A;  4XJ9 A;  4MWX A;  3K38 A;  1SNT A;  4XJR A;  2B8H A;  2X9M A;  4FPJ A;  2CML A;  3NN9 A;  2HTY A;  2F29 A;  6NN9 A;  3CL2 A;  4FOQ A;  2XZK A;  3NSS A;  4JF7 A;  4XMI A;  4GJT A;  1SLI A;  1EUT A;  1SO7 A;  4MWV A;  4MZE A;  1A4G A;  4FP2 A;  1ING A;  1B9T A;  4YW4 A;  1NNA A;  1W8O A;  1MS8 A;  1MS4 A;  1INV A;  3TIB A;  1INF A;  1B9V A;  4FOY A;  4CPM A;  1BJI A;  1E8V A;  4MJU A;  4GZP A;  3K37 A;  2HU4 A;  2QWE A;  1INH A;  4B7R A;  2AH2 A;  1V0E A;  2W38 A;  4YW5 A;  1VCJ A;  4YW3 A;  1IVE A;  5HUG A;  2AEQ A;  4KS1 A;  3GVL A;  3GVJ A;  4M4U A;  2HT7 A;  4MX0 A;  1W0O A;  3SAN A;  4FVK A;  2QWF A;  1N1S A;  2HTW A;  4J9T A;  4M4N A;  2F27 A;  2VW0 A;  1V3D A;  4H52 A;  4K1H A;  4KS4 A;  1XOE A;  1INW A;  4HZX A;  3TI5 A;  1Z4W A;  5NN9 A;  1Z4Z A;  2QWK A;  4YW2 A;  3CYE A;  4X49 A;  4B7M A;  1NMA N;  4CPO A;  4FP3 A;  1Z4V A;  2VVZ A;  4GB1 A;  4XJQ A;  4HZV A;  4KS5 A;  4MWL A;  1WCQ A;  4M3M A;  4GZQ A;  2HTR A;  2ZB5 A;  4UF7 A;  2HTV A;  3ALW A;  4GZO A;  2A75 A;  1IVF A;  4GZS A;  2F26 A;  2SIM A;  4MWU A;  4MZA A;  1E8T A;  2SLI A;  4K3Y A;  4XJA A;  5B2C A;  4YZ2 A;  1NCD N;  3A72 A;  4GDI A;  4QNP A;  4XHB A;  4QN3 A;  4FPC A;  4K1K A;  1F8C A;  4QN4 A;  4YZ4 A;  1USX A;  2HTQ A;  4FPY A;  4FJ6 A;  1KIT A;  3TIC A;  4SLI A;  2SIL A;  4YZ5 A;  2AEP A;  4XJZ A;  5HUK A;  4FOV A;  1N1T A;  1N1Y A;  1VCU A;  1W20 A;  2HU0 A;  1NMB N;  2BZD A;  3GVK A;  4MWQ A;  4XMA A;  4D8S A;  5JYY A;  4MJV A;  2QWG A;  4MWY A;  1W21 A;  1Z4Y A;  3A71 A;  2YA5 A; 
#chains in the Genus database with same CATH topology
 1SUU A;  5D9C A;  4FPE A;  1N1V A;  5HUM A;  3H71 A;  1ZI0 A;  4GZX A;  1EUU A;  4MWJ A;  4IFL X;  1EUS A;  1MZ5 A;  4GNA A;  1NCC N;  5B2D A;  1MS3 A;  4FPG A;  4FOW A;  3CL0 A;  4K1I A;  1MS5 A;  3S8Z A;  2AGS A;  1MR5 A;  1MS1 A;  1IVC A;  3INB A;  4N1B A;  4CPL A;  2W5N A;  1NSC A;  1SLL A;  3SIL A;  4X47 A;  2QWC A;  3O4P A;  2YA8 A;  4GEZ A;  3Q6P A;  4X4A A;  4D52 B;  3OPZ A;  3P5B L;  3SAL A;  4XIK A;  1NNC A;  5GX2 A;  2ZW9 A;  1IUC A;  4AHA A;  1MS9 A;  1MS0 A;  2QWH A;  4AGT A;  2VAQ A;  2BER A;  3ADE A;  2OJH A;  3DAS A;  4K1J A;  5HUN A;  1INY A;  3FVZ A;  4XYX A;  4L7C A;  4FPF A;  3TC9 A;  1CRU A;  3TI4 A;  5GX1 A;  4HZZ A;  1A4Q A;  2FPB A;  2IVZ A;  2V91 A;  4GZW A;  1F8E A;  4I00 A;  2VW2 A;  3BEQ A;  1NPE A;  5EX7 A;  4NCS A;  4FQ4 A;  4WA5 A;  2BAT A;  2IAO A;  4NC5 A;  5FNR A;  4R40 A;  4B7Q A;  1Z50 A;  2H2U A;  3G4H A;  1MZ6 A;  4KS2 A;  3W09 A;  4G3N A;  1V0F A;  3S2K A;  4CPZ A;  4YZ1 A;  2VSK A;  2C4A A;  2HTU A;  2IAS A;  3TI8 A;  4DGR A;  3TIA A;  1L7G A;  4HZY A;  3A9G A;  1V3C A;  1L7H A;  2ZB6 A;  4L7B A;  3WW9 A;  3H72 A;  4HIZ A;  4FZH A;  2F0Z A;  4XJW A;  4YZ3 A;  2ISM A;  1F8B A;  4FPK A;  2VK6 A;  4XIO A;  1N6F A;  3TI3 A;  2YDP A;  4QN6 A;  3K39 A;  2QWA A;  1NCB N;  2IAQ A;  2W8B A;  2QE8 A;  1RWL A;  1V04 A;  2VK5 A;  3ZGD A;  2G8S A;  2GHS A;  1WP5 A;  4WA3 A;  5M1Z A;  4XHX A;  4CPN A;  4HZW A;  3O9J A;  2HT8 A;  1XOG A;  2FPC A;  4IMB A;  5HX0 A;  3VNH A;  4XJU A;  3B7E A;  2YA4 A;  4XIL A;  3FW0 A;  4IQK A;  1ZGK A;  1L7F A;  3JU4 A;  2F10 A;  1PJX A;  4JML A;  4X6K A;  1IVD A;  2RKC A;  3WN7 A;  2W20 A;  1W0P A;  5FWW A;  2XZI A;  4PWZ A;  3CKZ A;  3U0S A;  3K36 A;  7NN9 A;  4O5S A;  2QWI A;  2JKB A;  1V3B A;  4GZT A;  1E8U A;  4WEG A;  1S0I A;  2BF6 A;  2WOZ A;  3B69 A;  2QWB A;  4O5T A;  4M4V A;  2DG1 A;  4QN5 A;  4B7N A;  3K3A A;  2F12 A;  4ZGC A;  4C1Y B;  4NN9 A;  4GN7 A;  1USR A;  3NO0 A;  2GVV A;  3D12 A;  4FPO B;  1NN2 A;  2F25 A;  2C4L A;  3PJQ A;  5GX5 A;  3O9K A;  1NCA N;  4GDJ A;  1INX A;  5D9D A;  2VSM A;  3H6J A;  4ASC A;  1S0J A;  2F24 A;  4XE9 A;  1E1A A;  1NSD A;  2ZWA A;  1CVM A;  4XOG A;  1NMC A;  2XCY A;  3IAX A;  4YW1 A;  3V64 C;  1V3E A;  3WDZ A;  4B7J A;  4FPL A;  4FPH A;  4QN7 A;  4D52 C;  4ZLR A;  3H73 A;  2P4O A;  1QLG A;  2F11 A;  1F8D A;  3LI5 A;  4Q6K A;  3LI3 A;  1IVB A;  1EUR A;  2QWJ A;  1V0Z A;  2VW1 A;  4D52 A;  1C5K A;  2QWD A;  1CRZ A;  2F13 A;  4CH9 A;  1NNB A;  4L7D A;  4H53 A;  3D11 A;  4MWR A;  2FLU X;  3T1E A;  1IVG A;  2HQS A;  1A14 N;  2IAX A;  5F9T A;  4UOU A;  1NSB A;  3TI6 A;  1DIL A;  4BBW A;  1N7D A;  4KS3 A;  2FHR A;  1B9S A;  2W5O A;  1MWE A;  4XJ8 A;  2YA7 A;  1W8N A;  1X2J A;  2HT5 A;  2YDT A;  4HHQ A;  2H2N A;  1Q7F A;  2DG0 A;  3ALX A;  2VWD A;  4WEF A;  1Z4X A;  2XZJ A;  2VK7 A;  4WA4 A;  2IAR A;  4MC7 A;  1WCS A;  2YA6 A;  2FP9 A;  4MWW A;  5FZN A;  1S18 A;  1W1X A;  1QBI A;  2F28 A;  3I1C A;  3KYA A;  3SLI A;  4CPY A;  1V2I A;  2IAT A;  4D4U A;  1DIM A;  4XJ9 A;  4MWX A;  3K38 A;  1SNT A;  4XJR A;  2B8H A;  3E5Z A;  5FNT A;  2X9M A;  4FPJ A;  2CML A;  3NN9 A;  4HW6 A;  2HTY A;  4AH4 A;  2IAP A;  3Q6T A;  5EO8 A;  3VNG A;  5CGJ A;  2F29 A;  6NN9 A;  1N6E A;  3AMS A;  3CL2 A;  4FOQ A;  2XZK A;  3NSS A;  4JF7 A;  5FNS A;  4XMI A;  3S8V A;  4GJT A;  1SLI A;  3HRP A;  4AGI A;  3SOQ A;  3A9H A;  1EUT A;  1SO7 A;  4MWV A;  4MZE A;  1A4G A;  2GVW A;  4FP2 A;  1ING A;  1B9T A;  4YW4 A;  1NNA A;  1W8O A;  3II7 A;  1MS8 A;  1MS4 A;  5GX4 A;  4YY8 A;  1INV A;  3TIB A;  1INF A;  5FZJ A;  1B9V A;  4FOY A;  4CPM A;  1BJI A;  1E8V A;  4MJU A;  4XMB A;  4GZP A;  2IAW A;  3K37 A;  2HU4 A;  2QWE A;  1INH A;  4B7R A;  2AH2 A;  5FNU A;  1V0E A;  1RWI A;  2W38 A;  4YW5 A;  1VCJ A;  3AMR A;  5FNQ A;  5GX3 A;  4YW3 A;  1IVE A;  5HUG A;  2AEQ A;  4KS1 A;  3GVL A;  3GVJ A;  2IAV A;  4M4U A;  2HT7 A;  4MX0 A;  1W0O A;  2IAU A;  3SAN A;  4FVK A;  4C1Y A;  2QWF A;  1N1S A;  2HTW A;  4IFJ A;  4HHO A;  4J9T A;  3KGG A;  2F27 A;  4M4N A;  2VW0 A;  1V3D A;  4H52 A;  4K1H A;  4KS4 A;  1XOE A;  5D9B A;  1C9U A;  3BYC A;  1INW A;  3G4E A;  4HZX A;  1Z4W A;  3TI5 A;  5NN9 A;  5EO7 A;  4A0P A;  1Z4Z A;  2QWK A;  4YW2 A;  1H6L A;  3CYE A;  4X49 A;  2POO A;  4Q1U A;  4B7M A;  1NMA N;  4CPO A;  4GN9 A;  4FP3 A;  3Q6K A;  1Z4V A;  3SRG A;  3DR2 A;  1U6D X;  2VVZ A;  4GNB A;  4GB1 A;  4XJQ A;  4HZV A;  4KS5 A;  4MWL A;  1WCQ A;  4M3M A;  4ZY3 A;  4GZQ A;  3LI4 A;  2VPJ A;  1OFZ A;  2HTR A;  2ZB5 A;  4UF7 A;  4CSD A;  2HTV A;  3V65 B;  3ALW A;  4GZO A;  2A75 A;  1IVF A;  4GZS A;  2XN4 A;  2GVX A;  5F72 C;  2F26 A;  3WWA A;  2SIM A;  4MWU A;  4MZA A;  1E8T A;  2SLI A;  2FP8 A;  4K3Y A;  4XJA A;  4YZ2 A;  1NCD N;  3S94 A;  5B2C A;  3A72 A;  2ZZK A;  4GDI A;  4QNP A;  4XHB A;  4QN3 A;  3HLH A;  4FPC A;  4K1K A;  1F8C A;  1POO A;  4GN8 A;  4QN4 A;  1IUB A;  4YZ4 A;  1USX A;  2HTQ A;  4DG6 A;  2W8B B;  2DSO A;  4FPY A;  2Z32 A;  4FJ6 A;  5H47 A;  1KIT A;  3HLI A;  3TIC A;  4SLI A;  2SIL A;  3L6V A;  4YZ5 A;  2DYH A;  2AEP A;  3UC1 A;  4XJZ A;  5HUK A;  4CHB A;  4FOV A;  1N1T A;  1N1Y A;  1VCU A;  1W20 A;  4IYG A;  2HU0 A;  3ZGC A;  3V1S A;  4IN4 A;  4IFN X;  1CQ1 A;  1K32 A;  1NMB N;  5GTQ A;  2BZD A;  3GVK A;  4MWQ A;  4XMA A;  4D8S A;  5JYY A;  1X2R A;  3SOV A;  4MJV A;  2QWG A;  4MWY A;  1W21 A;  1Z4Y A;  4GNC A;  3A71 A;  2YA5 A;  1S1D A;  3SRE A;  3SOB B;  1IJQ A;  2GVU A;  1N6D A; 
#chains in the Genus database with same CATH homology
 4FPE A;  1N1V A;  5HUM A;  3H71 A;  4GZX A;  1EUU A;  4MWJ A;  1EUS A;  1MZ5 A;  1NCC N;  5B2D A;  1MS3 A;  4FPG A;  4FOW A;  3CL0 A;  4K1I A;  1MS5 A;  2AGS A;  1MR5 A;  1MS1 A;  1IVC A;  3INB A;  4CPL A;  2W5N A;  1NSC A;  1SLL A;  3SIL A;  4X47 A;  2QWC A;  2YA8 A;  4GEZ A;  4X4A A;  3OPZ A;  3SAL A;  4XIK A;  1NNC A;  1MS9 A;  1MS0 A;  2QWH A;  2BER A;  4K1J A;  5HUN A;  1INY A;  4XYX A;  4FPF A;  3TI4 A;  4HZZ A;  1A4Q A;  4GZW A;  1F8E A;  4I00 A;  2VW2 A;  3BEQ A;  4NCS A;  4FQ4 A;  4WA5 A;  2BAT A;  4NC5 A;  4B7Q A;  1Z50 A;  2H2U A;  3W09 A;  1MZ6 A;  4KS2 A;  1V0F A;  4CPZ A;  4YZ1 A;  2VSK A;  2C4A A;  2HTU A;  3TI8 A;  4DGR A;  3TIA A;  1L7G A;  4HZY A;  1V3C A;  1L7H A;  2ZB6 A;  3H72 A;  4HIZ A;  4FZH A;  2F0Z A;  4XJW A;  4YZ3 A;  1F8B A;  4FPK A;  2VK6 A;  4XIO A;  3TI3 A;  2YDP A;  4QN6 A;  3K39 A;  2QWA A;  1NCB N;  2VK5 A;  4WA3 A;  5M1Z A;  4XHX A;  4CPN A;  4HZW A;  3O9J A;  2HT8 A;  1XOG A;  5HX0 A;  4XJU A;  3B7E A;  2YA4 A;  4XIL A;  1L7F A;  3JU4 A;  2F10 A;  4X6K A;  1IVD A;  2RKC A;  2W20 A;  1W0P A;  2XZI A;  3CKZ A;  3K36 A;  7NN9 A;  2QWI A;  2JKB A;  1V3B A;  4GZT A;  1E8U A;  4WEG A;  1S0I A;  2BF6 A;  3B69 A;  2QWB A;  4M4V A;  4QN5 A;  4B7N A;  3K3A A;  2F12 A;  4NN9 A;  1USR A;  3D12 A;  4FPO B;  1NN2 A;  2F25 A;  2C4L A;  3PJQ A;  3O9K A;  1NCA N;  4GDJ A;  1INX A;  2VSM A;  3H6J A;  1S0J A;  2F24 A;  4XE9 A;  1NSD A;  4XOG A;  1NMC A;  2XCY A;  4YW1 A;  1V3E A;  4B7J A;  4FPL A;  4FPH A;  4QN7 A;  3H73 A;  2F11 A;  1F8D A;  4Q6K A;  1EUR A;  1IVB A;  2QWJ A;  1V0Z A;  2VW1 A;  2QWD A;  2F13 A;  1NNB A;  4H53 A;  3D11 A;  4MWR A;  3T1E A;  1IVG A;  1A14 N;  5F9T A;  1NSB A;  3TI6 A;  1DIL A;  4BBW A;  4KS3 A;  2FHR A;  1B9S A;  2W5O A;  1MWE A;  4XJ8 A;  2YA7 A;  1W8N A;  2HT5 A;  2YDT A;  2H2N A;  3ALX A;  2VWD A;  4WEF A;  1Z4X A;  2XZJ A;  2VK7 A;  4WA4 A;  4MC7 A;  1WCS A;  2YA6 A;  4MWW A;  1S18 A;  1W1X A;  2F28 A;  3SLI A;  4CPY A;  1V2I A;  1DIM A;  4XJ9 A;  4MWX A;  3K38 A;  1SNT A;  4XJR A;  2B8H A;  2X9M A;  4FPJ A;  2CML A;  3NN9 A;  2HTY A;  2F29 A;  6NN9 A;  3CL2 A;  4FOQ A;  2XZK A;  3NSS A;  4JF7 A;  4XMI A;  4GJT A;  1SLI A;  1EUT A;  1SO7 A;  4MWV A;  4MZE A;  1A4G A;  4FP2 A;  1ING A;  1B9T A;  4YW4 A;  1NNA A;  1W8O A;  1MS8 A;  1MS4 A;  1INV A;  3TIB A;  1INF A;  1B9V A;  4FOY A;  4CPM A;  1BJI A;  1E8V A;  4MJU A;  4GZP A;  3K37 A;  2HU4 A;  2QWE A;  1INH A;  4B7R A;  2AH2 A;  1V0E A;  2W38 A;  4YW5 A;  1VCJ A;  4YW3 A;  1IVE A;  5HUG A;  2AEQ A;  4KS1 A;  3GVL A;  3GVJ A;  4M4U A;  2HT7 A;  4MX0 A;  1W0O A;  3SAN A;  4FVK A;  2QWF A;  1N1S A;  2HTW A;  4J9T A;  4M4N A;  2F27 A;  2VW0 A;  1V3D A;  4H52 A;  4K1H A;  4KS4 A;  1XOE A;  1INW A;  4HZX A;  3TI5 A;  1Z4W A;  5NN9 A;  1Z4Z A;  2QWK A;  4YW2 A;  3CYE A;  4X49 A;  4B7M A;  1NMA N;  4CPO A;  4FP3 A;  1Z4V A;  2VVZ A;  4GB1 A;  4XJQ A;  4HZV A;  4KS5 A;  4MWL A;  1WCQ A;  4M3M A;  4GZQ A;  2HTR A;  2ZB5 A;  4UF7 A;  2HTV A;  3ALW A;  4GZO A;  2A75 A;  1IVF A;  4GZS A;  2F26 A;  2SIM A;  4MWU A;  4MZA A;  1E8T A;  2SLI A;  4K3Y A;  4XJA A;  5B2C A;  4YZ2 A;  1NCD N;  3A72 A;  4GDI A;  4QNP A;  4XHB A;  4QN3 A;  4FPC A;  4K1K A;  1F8C A;  4QN4 A;  4YZ4 A;  1USX A;  2HTQ A;  4FPY A;  4FJ6 A;  1KIT A;  3TIC A;  4SLI A;  2SIL A;  4YZ5 A;  2AEP A;  4XJZ A;  5HUK A;  4FOV A;  1N1T A;  1N1Y A;  1VCU A;  1W20 A;  2HU0 A;  1NMB N;  2BZD A;  3GVK A;  4MWQ A;  4XMA A;  4D8S A;  5JYY A;  4MJV A;  2QWG A;  4MWY A;  1W21 A;  1Z4Y A;  3A71 A;  2YA5 A;  1S1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...