3O6PA

Crystal structure of peptide abc transporter, peptide-binding protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
AASTQYMELNQRDEKSPFRNANLRKAISYSIDRKALVESILGDGSIEPNGLVPADMAKDPSGGKDFAKEAGSQIEYDTKKAKEYWEKAKKELGISTLTMDILSSDADSSKKTVEFVQGSIQDALDGVKVTVSPVPFSVRLDRSNKGDFDAVIGGWSADYADPSSFLDLFASDNSYNRGRYNNAEFDKFVKAASSADATDPEKRWDDMLNAEKTIMGDMGVVPLFQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptide ABC transporter, peptide-binding protein
publication title Crystal structure of peptide ABC transporter, peptide-binding protein
rcsb
source organism Enterococcus faecalis
molecule tags Protein binding
total genus 75
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3o6pA00
1B51A 4PFWA 4PFTA 1B5HA 4ZE8A 4ZECA 4DCYA 4QFOA 2Z23A 4GF8A 3MZBA 4I8CA 4QFPA 4QFNA 1B46A 1B3HA 4JSDA 2D5WA 2NOOA 4OFJA 4ZEIA 4ZEDA 1B3GA 1B3LA 1B5JA 3DRIA 1B0HA 1B7HA 2OLBA 1ZU0A 2O7IA 4WEDA 1ZTYA 3DRGA 1B4HA 3DP8A 1B4ZA 3QIMA 4XKNA 4ONYA 1ZLQA 4OFLA 3O6PA 4PFUA 1DPPA 4RA1A 3TCHA 2GRVA 4QFKA 1XOCA 1B40A 1UIVA 4I9DA 3DRFA 2B4LA 4ZEBA 4XKPA 3MZ9A 3DRKA 4FAJA 1VR5A 5ICQA 3PAMA 3ZS6A 5ISUA 3MVWA 4OESA 1RKMA 3I5OA 4DCXA 4GFRA 4QFLA 1JEUA 3MVYA 5L8DA 1UQWA 4TOZA 3RYAA 4OFOA 4JSOA 4OETA 5KZTA 3E3KA 3MVZA 4OEVA 3RQTA 3T66A 3RY3A 2WOKA 2WOLA 3O9PA 1B52A 3MVXA 5HM4B 1B1HA 1B9JA 3TCGA 2B4MA 2RKMA 1DPEA 1B2HA 1B6HA 3TPAA 4XKRA 4GL8A 4ZEKA 3CHGA 1JEVA 1QKAA 5F1QA 3DRHA 3DRJA 4PFYA 1UIUA 3RYBA 1JETA 3MW0A 1B05A 4OERA 4OEUA 4XKQA 1OLCA 3LVUA 3TCFA 1B58A 1B32A 1B3FA 1QKBA 2WOPA 1B5IA 3FTOA 1OLAA 3M8UA 4ZE9A
chains in the Genus database with same CATH superfamily
1B51A 4PFWA 4PFTA 1B5HA 4ZE8A 4ZECA 4DCYA 4QFOA 2Z23A 4GF8A 3MZBA 4I8CA 4QFPA 4QFNA 1B46A 1B3HA 4JSDA 2D5WA 2NOOA 4OFJA 4ZEIA 4ZEDA 1B3GA 1B3LA 1B5JA 3DRIA 1B0HA 1B7HA 2OLBA 1ZU0A 2O7IA 4WEDA 1ZTYA 3DRGA 1B4HA 3DP8A 1B4ZA 3QIMA 4XKNA 4ONYA 1ZLQA 4OFLA 3O6PA 4PFUA 1DPPA 4RA1A 3TCHA 2GRVA 4QFKA 1XOCA 1B40A 1UIVA 4I9DA 3DRFA 2B4LA 4ZEBA 4XKPA 3MZ9A 3DRKA 4FAJA 1VR5A 5ICQA 3PAMA 3ZS6A 5ISUA 3MVWA 4OESA 1RKMA 3I5OA 4DCXA 4GFRA 4QFLA 1JEUA 3MVYA 5L8DA 1UQWA 4TOZA 3RYAA 4OFOA 4JSOA 4OETA 5KZTA 3E3KA 3MVZA 4OEVA 3RQTA 3T66A 3RY3A 2WOKA 2WOLA 3O9PA 1B52A 3MVXA 5HM4B 1B1HA 1B9JA 3TCGA 2B4MA 2RKMA 1DPEA 1B2HA 1B6HA 3TPAA 4XKRA 4GL8A 4ZEKA 3CHGA 1JEVA 1QKAA 5F1QA 3DRHA 3DRJA 4PFYA 1UIUA 3RYBA 1JETA 3MW0A 1B05A 4OERA 4OEUA 4XKQA 1OLCA 3LVUA 3TCFA 1B58A 1B32A 1B3FA 1QKBA 2WOPA 1B5IA 3FTOA 1OLAA 3M8UA 4ZE9A
chains in the Genus database with same CATH topology
1B51A 4PFWA 4PFTA 1B5HA 4ZE8A 4ZECA 4DCYA 4QFOA 2Z23A 4GF8A 3MZBA 4I8CA 4QFPA 4QFNA 1B46A 1B3HA 4JSDA 2D5WA 2NOOA 4OFJA 4ZEIA 4ZEDA 1B3GA 1B3LA 1B5JA 3DRIA 1B0HA 1B7HA 2OLBA 1ZU0A 2O7IA 4WEDA 1ZTYA 3DRGA 1B4HA 3DP8A 1B4ZA 3QIMA 4XKNA 4ONYA 1ZLQA 4OFLA 3O6PA 4PFUA 1DPPA 4RA1A 3TCHA 2GRVA 4QFKA 1XOCA 1B40A 1UIVA 4I9DA 3DRFA 2B4LA 4ZEBA 4XKPA 3MZ9A 3DRKA 4FAJA 1VR5A 5ICQA 3PAMA 3ZS6A 5ISUA 3MVWA 4OESA 1RKMA 3I5OA 4DCXA 4GFRA 4QFLA 1JEUA 3MVYA 5L8DA 1UQWA 4TOZA 3RYAA 4OFOA 4JSOA 4OETA 5KZTA 3E3KA 3MVZA 4OEVA 3RQTA 3T66A 3RY3A 2WOKA 2WOLA 3O9PA 1B52A 3MVXA 5HM4B 1B1HA 1B9JA 3TCGA 2B4MA 2RKMA 1DPEA 1B2HA 1B6HA 3TPAA 4XKRA 4GL8A 4ZEKA 3CHGA 1JEVA 1QKAA 5F1QA 3DRHA 3DRJA 4PFYA 1UIUA 3RYBA 1JETA 3MW0A 1B05A 4OERA 4OEUA 4XKQA 1OLCA 3LVUA 3TCFA 1B58A 1B32A 1B3FA 1QKBA 2WOPA 1B5IA 3FTOA 1OLAA 3M8UA 4ZE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B51 A;  4PFW A;  4PFT A;  1B5H A;  4ZE8 A;  4ZEC A;  4DCY A;  4QFO A;  2Z23 A;  4GF8 A;  3MZB A;  4I8C A;  4QFP A;  4QFN A;  1B46 A;  1B3H A;  4JSD A;  2D5W A;  2NOO A;  4OFJ A;  4ZEI A;  4ZED A;  1B3G A;  1B3L A;  1B5J A;  3DRI A;  1B0H A;  1B7H A;  2OLB A;  1ZU0 A;  2O7I A;  4WED A;  1ZTY A;  3DRG A;  1B4H A;  3DP8 A;  1B4Z A;  3QIM A;  4XKN A;  4ONY A;  1ZLQ A;  4OFL A;  3O6P A;  4PFU A;  1DPP A;  4RA1 A;  3TCH A;  2GRV A;  4QFK A;  1XOC A;  1B40 A;  1UIV A;  4I9D A;  3DRF A;  2B4L A;  4ZEB A;  4XKP A;  3MZ9 A;  3DRK A;  4FAJ A;  1VR5 A;  5ICQ A;  3PAM A;  3ZS6 A;  5ISU A;  3MVW A;  4OES A;  1RKM A;  3I5O A;  4DCX A;  4GFR A;  4QFL A;  1JEU A;  3MVY A;  5L8D A;  1UQW A;  4TOZ A;  3RYA A;  4OFO A;  4JSO A;  4OET A;  5KZT A;  3E3K A;  3MVZ A;  4OEV A;  3RQT A;  3T66 A;  3RY3 A;  2WOK A;  2WOL A;  3O9P A;  1B52 A;  3MVX A;  5HM4 B;  1B1H A;  1B9J A;  3TCG A;  2B4M A;  2RKM A;  1DPE A;  1B2H A;  1B6H A;  3TPA A;  4XKR A;  4GL8 A;  4ZEK A;  3CHG A;  1JEV A;  1QKA A;  5F1Q A;  3DRH A;  3DRJ A;  4PFY A;  1UIU A;  3RYB A;  1JET A;  3MW0 A;  1B05 A;  4OER A;  4OEU A;  4XKQ A;  1OLC A;  3LVU A;  3TCF A;  1B58 A;  1B32 A;  1B3F A;  1QKB A;  2WOP A;  1B5I A;  3FTO A;  1OLA A;  3M8U A;  4ZE9 A; 
#chains in the Genus database with same CATH topology
 1B51 A;  4PFW A;  4PFT A;  1B5H A;  4ZE8 A;  4ZEC A;  4DCY A;  4QFO A;  2Z23 A;  4GF8 A;  3MZB A;  4I8C A;  4QFP A;  4QFN A;  1B46 A;  1B3H A;  4JSD A;  2D5W A;  2NOO A;  4OFJ A;  4ZEI A;  4ZED A;  1B3G A;  1B3L A;  1B5J A;  3DRI A;  1B0H A;  1B7H A;  2OLB A;  1ZU0 A;  2O7I A;  4WED A;  1ZTY A;  3DRG A;  1B4H A;  3DP8 A;  1B4Z A;  3QIM A;  4XKN A;  4ONY A;  1ZLQ A;  4OFL A;  3O6P A;  4PFU A;  1DPP A;  4RA1 A;  3TCH A;  2GRV A;  4QFK A;  1XOC A;  1B40 A;  1UIV A;  4I9D A;  3DRF A;  2B4L A;  4ZEB A;  4XKP A;  3MZ9 A;  3DRK A;  4FAJ A;  1VR5 A;  5ICQ A;  3PAM A;  3ZS6 A;  5ISU A;  3MVW A;  4OES A;  1RKM A;  3I5O A;  4DCX A;  4GFR A;  4QFL A;  1JEU A;  3MVY A;  5L8D A;  1UQW A;  4TOZ A;  3RYA A;  4OFO A;  4JSO A;  4OET A;  5KZT A;  3E3K A;  3MVZ A;  4OEV A;  3RQT A;  3T66 A;  3RY3 A;  2WOK A;  2WOL A;  3O9P A;  1B52 A;  3MVX A;  5HM4 B;  1B1H A;  1B9J A;  3TCG A;  2B4M A;  2RKM A;  1DPE A;  1B2H A;  1B6H A;  3TPA A;  4XKR A;  4GL8 A;  4ZEK A;  3CHG A;  1JEV A;  1QKA A;  5F1Q A;  3DRH A;  3DRJ A;  4PFY A;  1UIU A;  3RYB A;  1JET A;  3MW0 A;  1B05 A;  4OER A;  4OEU A;  4XKQ A;  1OLC A;  3LVU A;  3TCF A;  1B58 A;  1B32 A;  1B3F A;  1QKB A;  2WOP A;  1B5I A;  3FTO A;  1OLA A;  3M8U A;  4ZE9 A; 
#chains in the Genus database with same CATH homology
 1B51 A;  4PFW A;  4PFT A;  1B5H A;  4ZE8 A;  4ZEC A;  4DCY A;  4QFO A;  2Z23 A;  4GF8 A;  3MZB A;  4I8C A;  4QFP A;  4QFN A;  1B46 A;  1B3H A;  4JSD A;  2D5W A;  2NOO A;  4OFJ A;  4ZEI A;  4ZED A;  1B3G A;  1B3L A;  1B5J A;  3DRI A;  1B0H A;  1B7H A;  2OLB A;  1ZU0 A;  2O7I A;  4WED A;  1ZTY A;  3DRG A;  1B4H A;  3DP8 A;  1B4Z A;  3QIM A;  4XKN A;  4ONY A;  1ZLQ A;  4OFL A;  3O6P A;  4PFU A;  1DPP A;  4RA1 A;  3TCH A;  2GRV A;  4QFK A;  1XOC A;  1B40 A;  1UIV A;  4I9D A;  3DRF A;  2B4L A;  4ZEB A;  4XKP A;  3MZ9 A;  3DRK A;  4FAJ A;  1VR5 A;  5ICQ A;  3PAM A;  3ZS6 A;  5ISU A;  3MVW A;  4OES A;  1RKM A;  3I5O A;  4DCX A;  4GFR A;  4QFL A;  1JEU A;  3MVY A;  5L8D A;  1UQW A;  4TOZ A;  3RYA A;  4OFO A;  4JSO A;  4OET A;  5KZT A;  3E3K A;  3MVZ A;  4OEV A;  3RQT A;  3T66 A;  3RY3 A;  2WOK A;  2WOL A;  3O9P A;  1B52 A;  3MVX A;  5HM4 B;  1B1H A;  1B9J A;  3TCG A;  2B4M A;  2RKM A;  1DPE A;  1B2H A;  1B6H A;  3TPA A;  4XKR A;  4GL8 A;  4ZEK A;  3CHG A;  1JEV A;  1QKA A;  5F1Q A;  3DRH A;  3DRJ A;  4PFY A;  1UIU A;  3RYB A;  1JET A;  3MW0 A;  1B05 A;  4OER A;  4OEU A;  4XKQ A;  1OLC A;  3LVU A;  3TCF A;  1B58 A;  1B32 A;  1B3F A;  1QKB A;  2WOP A;  1B5I A;  3FTO A;  1OLA A;  3M8U A;  4ZE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...