1B05A

Structure of oligo-peptide binding protein complexed with lys-cys-lys
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
total genus 185
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b05A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b05A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b05A02
5ISUA 1NH7A 3DRHA 3ECRA 3RUMA 4E0WA 3DRKA 2D3IA 3G3JA 1WVJA 4BLAA 1ZLQA 2Z8EA 3BKIB 3H4ZA 3KOTA 3F11A 4YAHX 3IJXB 4ELPA 1ELJA 5JTYA 2UVJA 2RKMA 3LUYA 3PPPA 1B05A 2OWTA 2H25A 4QHQA 1JEUA 2QRYA 4QFKA 2VD2A 4U4XA 1LAHE 4UACA 2I0CA 1VFDA 3CFXA 4AB5A 3RQTA 4GFRA 1A8FA 1RYOA 2E0SA 3K0VA 3K2DA 4WEPA 4Z7EA 2DOJA 1A8EA 2HAVA 2I3WA 4H5FA 3U72A 4TLLB 3TKDA 4EDPA 4ELRA 5I2NB 1RKMA 2DWAA 1QKBA 1DMBA 1MG1A 2PMSA 4PFYA 3THIA 2I0BA 1BP5A 3B7DA 1UIVA 2LAOA 4G77A 4OQOA 1FQDA 2RC8A 3VE1B 4XXUA 2HFBA 4FORA 1LSTA 4JB7A 5TU0A 3CHGA 2HXWA 1N7WA 2HZKA 1A54A 1O63A 4K3FA 4QSDA 1B0HA 3MUQA 1IEJA 4L17A 2XD3A 3ILTB 3RLFE 1JW1A 2ONRA 1M5DA 3SEYA 4I9DA 5FTHA 1UTBB 2HQ0A 3SEVA 3O6HA 1NFTA 1SYIA 3MPLA 1H44A 1NL5A 2RCBA 1EZ9A 3TCFA 3IL1B 3ZKKA 3CFZA 3EF7A 4GL0A 4QSCA 5ELVA 1OVTA 1J1NA 4DXUA 1Z7NE 3GLBA 3PGFA 5DYHA 1S50A 3BBRA 4F3SA 5I84A 1XVYA 1MPBA 3KOSA 1XHYA 2QS3A 2PBWA 4TLMB 3UORA 4ZEIA 2PYYA 1ZKBA 4WEDA 2P1SA 3DM0A 3MJNA 4KI0E 5AA2A 3CSGA 5H8HB 5M2VA 4EXKA 4KD5A 5HBCA 3K00A 5CRYA 4ISUA 3O29A 1FW0A 1D9VA 1VSOA 2OCUA 3K6VA 2OZZA 2Q88A 1B40A 4G4PA 3WAFA 4EQ9A 4EQ7A 4HW8A 1PB8A 1YTVA 1T0KA 3R6UA 5I57B 2PVUA 4JSDA 4NF8B 1N0TA 1WODA 1OVBA 2RC7A 3CSBA 3MWBA 2QS2A 1IZ1A 4EXLA 1Y3QA 3FXUA 3K6XA 3RT8A 4HS7A 1R9QA 1UTBA 2OJTA 1B32A 2QS1A 3OO6A 1UQWA 3PPQA 3VLVA 1TXFA 4H1XA 4DXCA 5BUUA 4IO3A 2PT1A 3FJGA 1XVXA 4OTEA 3RN8A 2IEEA 2XXIA 4RK9A 3UA8A 4ESWA 1MXYA 3MC2A 1CE2A 1N3WA 1MQGA 3PMVA 1N76A 4H0WA 1B51A 3T66A 3MAMA 3C31A 5H8FB 5KCJB 4H5GA 4KFQA 1I69A 1N04A 3RTWB 3QSLA 1D9YA 4EUOA 3RPWA 3PPRA 2B3BA 3DRIA 2QJEA 2VD3A 1Y20A 2XXQA 3Q27A 2PT2A 2Y84A 5DEXA 3W9VA 3I6VA 2XHDA 3RYBA 4ZS9A 4MH5A 3CVGA 4YB7A 4YKKA 2NVUB 4PE5B 3H6TA 3G3FA 2YPNA 2G93A 1QUJA 3C4MA 3CIJA 4Q8RA 4OFJA 4P0IA 4KCDA 5I59A 5AA1A 4F3BA 3O6GA 4AB6A 2QS4A 1TFDA 4GLIA 3SETA 4OZ9A 3QYTA 1Y3PA 1NKXA 4NF6A 2P2AA 3AXFA 3K01A 2D5WA 3K6WA 4X1DA 3FVOA 1B0LA 2F97A 4KQPA 1B46A 3CI8A 3EHSA 3OSQA 1B5HA 4ZE8A 3IR1A 3O28A 1FTOA 1IXIA 4EF1A 1FTJA 1POTA 1ANFA 3SDFA 3IK6B 1I6QA 1MPCA 1MY3A 3OO8A 3USDA 3UGWA 4BDMA 4DIGA 1LBBA 2DWHA 1IIWA 4BDRA 5I58A 1MY0A 2Q89A 5DEXB 1B1XA 5H8HA 3E9XA 2CZLA 1MH3A 2H5YA 2QMXA 5L8DA 3A09A 3E4RA 4YZZA 3KBRA 4Q0CA 3PV0E 2DE2A 2ZNUA 3U92A 2ZNSA 1FCKA 1MH4A 4FE8A 5J1DA 2WOPA 3OD7A 3VDFA 3MP1A 1VFEA 4R73A 2ABHA 3EHTA 1URSA 2DWJA 3ZKLA 4G8MA 4IGRA 5L9OA 4LZ5A 1DTGA 4NF5B 3T9VA 3BFUA 4R74A 4LZ8A 4QF9A 1UIUA 2Q9TA 3HSTA 2QMWA 3T9UA 3LSWA 3PD9A 5AE4A 4NF4A 1IUDA 2XXRA 4QFPA 4RA1A 3MPKA 4IO5A 4FECA 1LCTA 4ZECA 4BDOA 3G3KA 5ITOA 5KZTA 1BTJA 3FJ7A 2D21A 4MBPA 5JEIA 2B4LA 2AL5A 2A5TB 1MXVA 2ALUA 5I56A 2F7BA 3MBPA 2R9JA 3MVWA 4RK2A 3VXBA 1PDAA 1Y4TA 5HPQA 1B1HA 4ZE9A 1LAFE 1ZJLA 3I3VA 4G68B 3W9WA 3FXQA 5CM6A 1QKAA 4MF3A 4F3PA 3U8QA 1MXZA 1USYH 2Y7IA 2FA7A 2XX7A 4U21A 2VOZA 3OEKA 4O3AA 2F6PA 5DT6A 3MZ1A 2Z23A 5DVJA 2B4MA 1WDNA 1MY2A 4KR5A 5K2XA 5IAIA 1LFIA 4Z0IA 2I48A 4YB5A 4PP0A 2DVZA 3GBAA 3O2AA 1P1OA 1SVXB 3IB2A 1AH5A 3QK6A 3QUJA 3M8UA 1RYXA 3DRGA 1LBCA 4OESA 2GFEA 1A99A 4BDLA 3MQ9A 1IXHA 4XKQA 1MPDA 2UYFA 4M4GA 5JTYB 1HSEA 3WAEA 3GBBA 3T9HB 1IQ7A 3HPIA 3PUVE 4M1VA 3S9NC 3IAZA 1BIYA 1B3LA 1S7YA 1DOTA 3E3KA 4H8JA 4OWDA 5DTBA 3FV1A 3H03A 2O1LA 4FEDA 4IO7A 5AA4A 3S9EA 2V3UA 3T96B 4LVQA 3UP9A 4FIMA 3HO7A 3EN3A 2H99A 2Z22A 3KGCA 1PBPA 1NNFA 2RINA 3IOWA 3PUZE 4HCYA 5H8SA 1DTZA 1XOCA 3RTFB 4YKJA 4EF2A 2B3FA 2ZYMA 3KEIA 4PETA 4F2QA 2WOKA 2UYEA 3RYAA 1Y1ZA 2O6AA 4GXAA 1A40A 1SDXA 3A3UA 3LSLA 4RJZA 2HAUA 4X9TA 3H6VA 2OLBA 4XKNA 1JQFA 1URDA 1DPEA 4TQUQ 4QFLA 1LGBC 2Y7PA 5H8QA 2F5XA 1M5FA 5TPAB 2X7PA 1R1NA 1HSJA 1SQYA 4H65A 4R6KA 3SEXA 3TTKA 1DPPA 2VHAA 4G8HA 1IXGA 5DVIA 4KYSA 3SEWA 1DSNA 1P1WA 1TFAA 2DP8A 1HSLA 1UTHA 1I6BA 4XKPA 3EQ1A 4AQ4A 1LB8A 1FTKA 4PQJA 3S9LC 4C0RA 1SW5A 2UVIA 4ZEFA 4LA9A 3FVGA 4DLDA 2QPQA 1JVXA 1Y9UA 1JW4A 3Q28A 4NF8A 2XX8A 2Z8DA 1R9LA 4OETA 3P7IA 5LOMA 3BFTA 1ZIUA 3H7MA 3FXRA 1GGGA 4ZEDA 1H45A 2F34A 5I58B 4POWA 4Q5TA 1OIBA 5I2KA 4PFUA 3LSFB 2HEUA 2DE4A 3PUXE 3TCHA 2RCAA 2QSXA 3QUFA 4ESXA 2A5SA 4GD5A 5CMBA 2ZYKA 1N3XA 1OLAA 4OERA 1TT1A 5CMMA 3TMGA 1M5BA 3IX1A 2OBGA 5L9MA 1KWHA 1MQDA 1Y3NA 3EPEA 4NF6B 5A5XA 1H76A 2KLFA 4DCYA 5CBRA 4PFWA 3A3CA 3KN3A 5HM4B 1ZU0A 5AA2D 4DXBA 1SW2A 4ELQA 3LBSA 2XXYA 3VLWA 1YPNA 3PUWE 4OEVA 4LP2B 1LB9A 4U23A 5FTIA 3TYHA 2WKYA 4DDDA 5CC2A 3EHUA 1MM7A 1EZPA 2I49A 2FYIA 4FJPA 4H6DA 3MP6A 2AYSA 1JETA 2AIXA 2DS9A 1N7XA 5H8NB 4X1BA 2R6GE 3D4CA 1S9TA 2DXYA 4C1TA 1FTLA 3K1PA 3ONMA 3V5AA 4YMAA 3FD3A 5AA3A 4GWOA 3S2VA 3W15C 4F1UA 3UK4A 3MVYA 4KHZE 2CMOA 3RGYA 3O6IA 3PMWA 1B4HA 3G3IA 3FVNA 5KCJA 1AIVA 4ONYA 4F39A 2Y7RA 1LAXA 1XC1A 2F36A 4IGTA 4F1YA 5A5XB 4FAJA 1BKAA 3R26A 3MZ9A 3L6HA 3E13X 2GHBA 4MLQA 3B6TA 3JZJA 3OEMA 2XXWA 3SERA 1SBPA 4OHNA 3KJTA 2I4CA 3C33A 2V3TA 3FGSA 3PPNA 4LUBA 4OENA 4YKPA 3RT6B 4NE4A 4Q30B 3VLUA 3V89B 2O69A 2RF1A 4POXA 3TFLA 4I62A 1FQEA 1B3EA 4KPTA 4QSEA 4R2BA 2DVCA 1ZMGA 1MQIA 3DP6A 3IOUA 3OO9A 3LSXA 3K4UA 3S4UA 3TTLA 3K1NA 5KDTA 4F3GA 4RNSA 4LATA 1MQJA 3T9XB 3G3HA 1GVCA 1II5A 1CB6A 4I1DA 2IA4A 1B52A 1NNKA 4NF4B 5B70A 5L9SA 2Q8JA 1EU8A 5KDTB 1MDP1 3B6QA 4RXLA 4N07A 3CRBA 2F35A 3FASA 3JV9A 1FQFA 5I2KB 4R6HA 2ZYNA 2A5TA 5TPAA 5B7DA 3KN8A 1NNTA 1O7TA 4F18A 3D4GA 3OELA 3N6TA 4O3CA 4R6YA 1N84A 2DXRA 2ONKE 3IO4A 1IITA 1LFGA 3IOVA 3FUZA 1LAGE 4OXVA 3PAMA 4NWDA 1R6ZA 2Z8FA 2F78A 4GL8A 4BDQA 4JDFA 3N5LA 4JBZA 1SI1A 2H9BA 4GOTA 1VE4A 4YICA 4GXSB 4E0XA 1SI0A 4I8CA 4R2FA 1OLCA 5I59B 4DCXA 3Q26A 5EHSA 1MXXA 2O68A 3MW0A 3TUSA 1OQHA 3OOAA 4U1OA 3VVFA 1VR5A 4TOZA 4KYDA 4QRZA 3O66A 3LC8A 5FHNA 2H98A 3OXNA 1B2HA 3FVKA 1USYE 1LFHA 4THIA 1B3GA 1SW4A 1B7HA 1ATGA 3VVDA 3H6UA 3FATA 4OFOA 1MM6A 1B58A 1OMPA 5H8NA 1PEBA 4F2OA 3DP8A 3HN0A 1URGA 3TEPA 4G8NA 2XX9A 3U1OA 4ZEKA 3KG2A 3TQWA 3C9HA 2H4IA 1NNPA 2VP1A 1PC3A 5JK4A 3TCGA 2NXOA 2OWSA 3N26A 3FIRA 1QW0A 3PUYE 4IY5A 2GH9A 4OVJA 3C34A 3IO6A 1YCJA 4U2RA 3PMXA 3SEUA 5I56B 4NWCA 4R9FA 1H3DA 4LQ2A 3TODA 3DRJA 1Y1MA 2Q2AA 3OENA 3TPAA 1US4A 5FHOA 3C36A 2ESNA 3I5OA 4ZEBA 1M5EA 4H67A 3RY3A 5BWJA 3IJOB 1M5CA 2THIA 4O3BA 3DRFA 1FQCA 1QJMA 4G68A 3TTNA 4PFTA 2FNCA 2O1MA 1MS7A 3IB1A 4JSOA 3MP8A 3N94A 2ZXTA 4R72A 2G29A 1GV8A 3SESA 2E1SA 3O97A 3IB0A 3ODBA 1AL3A 4U4SA 1Q1KA 3CG3A 5H8QB 3HCQA 2UVHA 3Q25A 4LZ7A 3RNNA 4IO6A 3HV1A 5CMKA 2UVGA 4H8IA 4QFNA 5ICQA 2YLNA 2DQVA 4P11A 2GHAA 4G68C 1EZOA 1B6HA 3U93A 5F1QA 1B7ZA 1MDQA 3S9MC 2X7QA 1LCFA 2XXXA 5I57A 3GXAA 5EYFA 1SW1A 1TWYA 1Q35A 2PX1A 1XT8A 2M8CA 4JWYA 4GF8A 4ZDMA 2XXHA 2UXAA 3N6UA 4FEBA 3KN7A 2HZLA 2B65A 3QIMA 4BDNA 2ANJA 3CR9A 4ELOA 1B9JA 1I6AA 3OO7A 3OMBA 3JYRA 5AA2B 2ONSA 3TZAA 1MXWA 3KZGA 3G7WA 2O84X 1UTHB 2P0SA 1MY1A 4IY6A 3T22A 4YB6A 3KFMA 4OFLA 1AMFA 1QVSA 1SD3A 2BJJX 1ZTYA 1BLFA 4IO2A 3HHGA 4KYEA 3FJMA 3TDJA 3PU5A 2OK2A 2O7IA 1Z7ME 3H6WA 3OSRA 4XTCQ 5CBSA 5ITPA 3M3LA 4C1UA 3V83A 3H3GA 4G2ZA 1B5IA 1B5JA 4GRKA 4HCWA 1PBQA 1FQAA 4JWXA 1GTKA 1P1UA 4YMBA 4JXIA 4DZ1A 4F19A 5EHMA 5I2NA 4F31B 1D3KA 3PD8A 3CG1A 4P0GA 2ZYOA 3TAJA 1F9BA 2R71A 1A7LA 1POY1 1GR2A 1O64A 2REGA 3LR1A 4LQ5A 3FZVA 4NF5A 5CI5A 3DLNA 4R9GA 4U22A 1XS5A 3MZBA 2I4BA 4N13A 2ZMBA 2DYXA 3K1MA 2NOOA 4NMYA 2O7UA 4GVOA 2DSFA 5H8FA 1IXCA 1OQGA 1US5A 2F6GA 2I3VA 3FV2A 2Y7WA 1QULA 4WXJA 2F7CA 3KJ7A 4EQBA 3H06B 3LVUA 4MFIA 4OEUA 2XD2A 4RYAA 1MXUA 1EH3A 4LONB 4YU0A 4WKMA 4IO4A 3TQLA 3K02A 2V25A 5K2YA 1JNFA 5F7VA 4GIZA 1JVYA 3Q29A 3QAXA 1YAEA 4DE8A 4F29A 3DP4A 2Y7KA 1B3HA 2V3QA 1P1NA 2NUVA 2XXVA 3T93B 2I58A 5TP9B 3VXCA 3M3FA 2DWIA 3DELB 4IB2A 3V8XB 4F1VA 1Y4CA 4MLVA 1MRPA 3VV5A 4XIGQ 3PPOA 4FATA 2RC9A 4F22A 4OMBA 1JEVA 1L5TA 4N6PA 4JWOA 3L6GA 5ICTA 3R7XA 2DE3A 2V84A 2WOLA 3ZS6A 5DVFA 1PB7A 1AOVA 1NH8A 1B3FA 1FTMA 2V93A 2GRVA 3KSJA 4HTGA 5FHMA 3TTMA 2XXTA 1FQBA 3VFJA 1D4NA 1A55A 2REJA 3HHFA 2YJPA 3G3GA 2F7AA 3ILUB 2XXPA 2XXUA 2HCAA 1QUIA 4KCCA 3O6PA 4OYVA 5CMCA 1JW5A 3M3KA 4NTLA 2F8DA 4QFOA 3KSXA 3SKPA 4X48A 4ND9A 3TELA 2W7YA 3O9PA 1MQHA 4RPNA 3IORA 3ZSFA 2O51A 1PB9A 5IKBA 4XKRA 1H43A 1P99A 2ZNTA 3C32A 3B6WA 4YKIA 3UIFA 3MVXA 3C35A 1NMUA 1B4ZA 1B7UA 2AL4A 4UA8A 3K6UA 3U94A 3IOTA 4ZZEA 3TTRA 4ECFA 1LLSA 1SYHA 1MY4A 3MVZA 4NEDA 3CFLA 1QUKA 4RY1A 2QL3A 5TP9A 3GZGA 2Q2CA 3FTOA 3QXMA 5AA4B 1ZBMA 1P1QA 2I6EA 4GQOA 3VVEA 4ZZAA 4RPOA 3UN6A 2NWJA 4U1ZA 2VGQA 4R75A 2X26A
chains in the Genus database with same CATH superfamily
1NH7A 3DRHA 1FPLA 3RUMA 4E0WA 2D3IA 3G3JA 1WVJA 4BLAA 2Z8EA 1IMBA 2H25A 2VD2A 3MYUA 2E0SA 3K0VA 1A8FA 5IZ3A 4Z7EA 1A8EA 2HAVA 4H5FA 4EDPA 4ELRA 4TLLB 5I2NB 2DWAA 1QKBA 1DMBA 2PMSA 4PFYA 1BP5A 4G77A 2HFBA 1LSTA 2HXWA 3U65A 1B0HA 2FIEA 1SPIA 2CZHA 5FTHA 1UTBB 1SYIA 2RCBA 2WX9A 3IL1B 4QSCA 4X8RA 1NV3A 4DXUA 1XVYA 1MPBA 3KOSA 2QS3A 4ZEIA 2HHMA 2XXKA 2ZZXA 4MNPA 1K9YA 5CRYA 4ISUA 3O29A 1FW0A 1XI6A 2OZZA 2Q88A 4G4PA 4EQ7A 1YTVA 1T0KA 4JSDA 1N0TA 2RC7A 2QS2A 3FXUA 4HS7A 3VLVA 5I5PA 2QS1A 5BUUA 1TXFA 1FPKA 4PGPA 2R8TA 3RN8A 3PMVA 4QXDA 3MAMA 2Y5LA 4KFQA 4EUOA 2B3BA 1EYJA 3I6VA 1IMDA 2G93A 4OFJA 3O6GA 2QS4A 4OZ9A 1INPA 4NF6A 2P2AA 2F97A 4GX3A 3EHSA 1B5HA 3A29A 3IR1A 1IXIA 1Q9DA 1ANFA 1POTA 3SDFA 1I6QA 1MPCA 4DIGA 1MY0A 2QMXA 3A09A 3KBRA 2ZNUA 1MH4A 3OD7A 3MP1A 4R73A 2ABHA 5EQ8A 2DWJA 2CEXA 4P1EA 5L9OA 4NF5B 4LZ8A 4QF9A 1DCUA 4GX6A 4QFPA 4IO5A 3IFAA 5KZTA 1BTJA 4MBPA 2B4LA 5I56A 2R9JA 3MVWA 5HPQA 1Y4TA 1LAFE 1FPJA 1QKAA 1LBYA 3U8QA 1MXZA 2Y7IA 2XX7A 2VOZA 2F3BA 2F6PA 2Z23A 2B4MA 5IAIA 1NV4A 4QBAA 5K2XA 1LFIA 4YB5A 4PP0A 3T9UA 4JB7A 3O2AA 3M8UA 3WAEA 1IQ7A 3S9NC 2O1LA 3S9EA 3T96B 4FIMA 3HO7A 2H99A 1NNFA 3RTFB 3IOWA 5H8SA 1DTZA 3KEIA 4PETA 2UYEA 3RYAA 2WEFA 1A40A 1SDXA 2HAUA 1URDA 4QFLA 1BK4A 4G8HA 1IXGA 1DSNA 4XKPA 3EQ1A 4C0RA 1NV2A 1JVXA 1Y9UA 4NF8A 2Z8DA 4IR8A 3P7IA 1ZIUA 3FXRA 2F34A 4Q5TA 5J16A 4PFUA 3LSFB 2DE4A 3TCHA 3QUFA 2A5SA 4GD5A 1TT1A 5CMMA 5A5XA 1MQDA 1Y3NA 4PFWA 1ZU0A 1SW2A 4ELQA 2XXYA 1YPNA 4OEVA 1FTAA 3TYHA 4DDDA 1MM7A 3MP6A 2AIXA 2DS9A 1N7XA 4X1BA 3QMFA 1FTLA 3V5AA 4YMAA 2HPGA 4N81A 4GWWA 2CMOA 1B4HA 1AIVA 1XC1A 2F36A 4IGTA 5A5XB 3R26A 3MZ9A 2GHBA 3JZJA 3SERA 2XXWA 3KJTA 2V3TA 3FGSA 4YKPA 4Q30B 5ET5A 2O69A 3TFLA 2DVCA 1G0IA 1ZMGA 3OO9A 3TTLA 5IGAA 4LATA 1JP4A 3T9XB 3G3HA 5B70A 2Q8JA 1G0HA 3CRBA 5I2KB 1FQFA 4R6HA 2ZYNA 2A5TA 5B7DA 5ET7A 4GWXA 3IO4A 4OVTA 1IITA 4OXVA 4NWDA 4JBZA 1SI1A 4YICA 4GXSB 5I59B 3MW0A 3TUSA 3VVFA 4TOZA 4KYDA 4QRZA 5FHNA 3OXNA 3FXBA 3VVDA 1B58A 1PEBA 3U1OA 2XX9A 3TQWA 4GWUA 2NXOA 3N26A 3HFUA 5I56B 1H3DA 3TODA 3TPAA 2ESNA 3I5OA 4ZEBA 1M5EA 5A5LA 5DW8A 1FQCA 4G68A 2FNCA 4MHFA 3MP8A 3N94A 3ODBA 4U4SA 5CMKA 3Q25A 2KQZA 3HV1A 2YLNA 1B6HA 1FBCA 2X7QA 5I57A 4JWYA 2Q8MA 4FEBA 4BDNA 2FVZA 4ELOA 3OMBA 3JYRA 2ONSA 3G7WA 4IY6A 3T22A 4PDHA 4YB6A 1AMFA 3USDA 4KYEA 3HHGA 3PU5A 5ITPA 4G2ZA 1PBQA 4YMBA 4F31B 4P0GA 2ZYOA 4F22A 1F9BA 2R71A 1A7LA 4LQ5A 3DLNA 4U22A 4N13A 2ZMBA 4NMYA 2DSFA 1US5A 2I3VA 4O94A 4OEUA 2CEYA 1EH3A 4LONB 4X04A 4IO4A 2V25A 1FPFA 1YAEA 1B3HA 2XXVA 1P1NA 2NUVA 3VXCA 2DWIA 4FATA 1Y4CA 3PPOA 5ICTA 2WOLA 5DVFA 4HTGA 5FHMA 1D4NA 3ILUB 5CMCA 3M3KA 5F24A 4X48A 4ND9A 1MQHA 1PB9A 4XKRA 1P99A 4YKIA 3B6WA 3MVXA 1NMUA 4UA8A 1LLSA 3MVZA 4RY1A 3QXMA 3VVEA 2NWJA 2VGQA 3VLWA 3RT8A 5ISUA 4O7MA 5ET8A 3KOTA 5JTYA 2RKMA 3LUYA 3PPPA 1JEUA 2QRYA 4U4XA 4UACA 2I0CA 1VFDA 4GFRA 1RYOA 3K2DA 2DOJA 3U72A 2FBPA 4K3FA 1A54A 3SEYA 3RLFE 2ONRA 1M5DA 4MEVA 1H44A 1NL5A 3ZKKA 5ELVA 1OVTA 5DYHA 4F3SA 5I84A 4N8GA 3DM0A 4KD5A 3K00A 4EQ9A 4HW8A 5I57B 4EXLA 1R9QA 4DXCA 3RPLA 4H1XA 2IEEA 1MQGA 1LBVA 4H0WA 1B51A 4PDDA 1N04A 3RTWB 1D9YA 3DRIA 2QJEA 1Y20A 2PT2A 3W9VA 3CVGA 3H6TA 2YPNA 3C4MA 5I59A 5AA1A 3SETA 3QYTA 1Y3PA 1NKXA 1NUYA 3OSQA 4EF1A 1MY3A 4N8YA 5I58A 1B1XA 5H8HA 4PAFA 2CZLA 1MH3A 5L8DA 3E4RA 4YZZA 4HE1A 4OA4A 3PV0E 2ZNSA 1VFEA 5ET6A 4IGRA 4R74A 3HSTA 3LSWA 2V4CA 3PD9A 5AE4A 1IUDA 4RA1A 4FECA 3FJ7A 3E78A 5JEIA 2AL5A 2A5TB 1MXVA 2F7BA 1ZJLA 3I3VA 4G68B 1USYH 2FA7A 4O3AA 1WDNA 4KR5A 2I48A 4NAPA 1P1OA 1SVXB 3QK6A 1AH5A 2GFEA 1LBCA 1A99A 3MQ9A 1IXHA 2UYFA 5JTYB 1LBXA 3PUVE 4M1VA 1B3LA 1DOTA 3H03A 4FEDA 5T3JA 3TTKA 1PBPA 2XA5A 4MCOA 5K2YA 1Y1ZA 2O6AA 4X9TA 4RJZA 4DI4B 2OLBA 4TQUQ 1LGBC 5H8QA 5TPAB 1FJ6A 4R6KA 4MX6A 4KYSA 5EYGA 1TFAA 1I6BA 1SW5A 4ZEFA 4DLDA 1JW4A 1R9LA 3B50A 1H45A 5I58B 4POWA 1OIBA 1YYZA 1NV5A 2ZYKA 1N3XA 1NV1A 1OLAA 4OERA 5L9MA 1KWHA 4DCYA 4N6DA 3A3CA 5EQ9A 2WKYA 1EZPA 4FJPA 4P3LA 2R6GE 2DXYA 3KBZA 1DK4A 3S2VA 4F1UA 2OX3A 4ONYA 2Y7RA 1LAXA 3E13X 4MLQA 1SBPA 3PPNA 2I4CA 4LUBA 4I40A 2VT5A 3PTYA 3V89B 1MQIA 3IOUA 3K1NA 4OANA 4F3GA 1MQJA 4NF4B 4P56A 3MSTA 4RXLA 2F35A 5TPAA 3KN8A 1NNTA 1O7TA 3OELA 4R6YA 2DXRA 3FUZA 2F78A 1QGXA 3ISPA 3O66A 3LC8A 4GWSA 2H98A 3FVKA 1LFHA 1B3GA 1SW4A 4F2OA 4G8NA 1FJ9A 2H4IA 1NNPA 1PC3A 4OVJA 3PUYE 1QW0A 4U2RA 1IMAA 3OENA 1Y1MA 4H67A 3RY3A 5BWJA 1M5CA 3DRFA 1QJMA 3SESA 2ZXTA 2E1SA 3IB0A 1Q1KA 3CG3A 3HCQA 4P11A 2GHAA 4G68C 3U93A 5F1QA 4HE2A 3GXAA 5EYFA 1SW1A 2PX1A 4ZDMA 2M8CA 4GF8A 2UXAA 4PC9A 2ANJA 5AA2B 2P0SA 3KFMA 2BJJX 4E0XA 1BLFA 3FJMA 1Z7ME 3OSRA 4XTCQ 5FBPA 3M3LA 4C1UA 4GRKA 4PE3A 1P1UA 4DZ1A 5EHMA 3PD8A 2REGA 2GQ1A 1POY1 3VXBA 4NF5A 3FZVA 2QVRA 2I4BA 5H8FA 2DYXA 2NOOA 2O7UA 3FV2A 1RDYA 2Y7WA 4EQBA 2F7CA 3KJ7A 2XD2A 4RYAA 4YU0A 1JNFA 4PGNA 3QAXA 3E79A 4F1VA 4MLVA 1MRPA 3VV5A 1L5TA 3ZS6A 1B3FA 3TTMA 2XXTA 1FQBA 1A55A 3HHFA 2XXUA 2HCAA 4O8MA 3O6PA 1JW5A 4QFOA 4OVQA 3TELA 3O9PA 3ZSFA 2AL4A 3IOTA 3TTRA 3CFLA 2QL3A 5TP9A 1ZBMA 4GQOA 1FPDA 3UN6A 4RPOA 4U1ZA 4OVSA 3DRKA 1ZLQA 3H4ZA 4YAHX 3F11A 5EQAA 3IJXB 2UVJA 4AS4A 5IZZA 4QHQA 4QFKA 4AB5A 2XWKA 4WEPA 1NV6A 1FRPA 1RKMA 3THIA 2I0BA 3B7DA 1FQDA 3CHGA 1O63A 3MUQA 4L17A 2XD3A 1JW1A 2HQ0A 2QVUA 1NFTA 4N4UA 3TCFA 4KXPA 3CFZA 4GL0A 1Z7NE 3GLBA 4P1LA 3BBRA 1XHYA 2PBWA 1FPEA 2PYYA 4KI0E 2P1SA 5AA2A 3CSGA 5M2VA 4EXKA 3K6VA 1D9VA 1VSOA 3WAFA 1PB8A 3R6UA 2PVUA 1WODA 1OVBA 3CSBA 3MWBA 1IZ1A 1Y3QA 3K6XA 3OO6A 1UQWA 4IO3A 2PT1A 3FJGA 1XVXA 4OTEA 4ESWA 2XXIA 4RK9A 1MXYA 3MC2A 1N3WA 1N76A 5H8FB 5ESYA 4H5GA 1I69A 5IZ1A 3RPWA 3Q27A 3GYYA 2Y84A 2XHDA 4YKKA 4PE5B 3G3FA 1QUJA 3CIJA 4KCDA 4JVCA 4F3BA 1TFDA 4GLIA 2WYKA 3AXFA 3K6WA 3K01A 3FVOA 1B0LA 1KA0A 4KQPA 1FTJA 3UGWA 3T1BA 1LBBA 3E9XA 3BIHA 2H5YA 4FBPA 4Q0CA 4N15A 3U92A 3KC1A 3VDFA 4JVIA 3EHTA 1URSA 4LZ5A 4MIJA 2QMWA 4NF4A 4MNIA 4JVDA 1LCTA 3G3KA 5ITOA 3MBPA 4RK2A 1B1HA 3D1RA 3FXQA 4F39A 3OEKA 3MZ1A 1MY2A 4Z0IA 3QUJA 4BDLA 4MNCA 3T9HB 4OVPA 3IAZA 1S7YA 4OWDA 5DTBA 3FV1A 4IO7A 4LVQA 2FHYA 3PUZE 4HCYA 1XOCA 4EF2A 4YKJA 4F2QA 2ZYMA 2PCRA 2FIXA 1LEVA 4GXAA 2Y7PA 2F5XA 3SEXA 4H65A 1DPPA 1NV0A 2VHAA 5DVIA 1LB8A 4PQJA 4H45A 3IFCA 3FVGA 5EQ7A 5LOMA 4ZEDA 4GBWA 3PUXE 4H46A 2QSXA 4ESXA 5CMBA 4GBVA 2F3DA 4PBHA 1M5BA 4MMPA 3SZPA 2OBGA 4NF6B 2KLFA 1KZ8A 3KN3A 4I3YA 3PUWE 4U23A 1LB9A 5CC2A 3EHUA 2I49A 4H6DA 1JETA 5H8NB 1S9TA 4C1TA 3K1PA 3FD3A 2DDKA 3UK4A 3MVYA 4KHZE 3RGYA 3O6IA 3PMWA 3G3IA 2WBDA 4F1YA 4P9KA 4FAJA 3L6HA 3B6TA 3OEMA 3RT6B 4NE4A 4POXA 4KPTA 1FQEA 4QSEA 1KA1A 3DP6A 3LSXA 3K4UA 5KDTA 4LN5A 1GVCA 4I1DA 2IA4A 1NNKA 5KDTB 3B6QA 4PFBA 4N07A 3JV9A 4F18A 4O3CA 3N6TA 1N84A 2ONKE 3IOVA 1LFGA 3PAMA 4GL8A 4BDQA 2H9BA 4GOTA 1VE4A 1SI0A 4I8CA 4R2FA 3Q26A 4NG7A 1OQHA 3LUZA 1USYE 4THIA 1B7HA 3H6UA 3FATA 1MM6A 3HN0A 1URGA 2L5VA 5IZ3B 2VP1A 4MAGA 4BDMA 1AOVA 4IY5A 3SEUA 3IO6A 3PMXA 4NWCA 4R9FA 3DRJA 5FHOA 2Q74A 2THIA 4O3BA 3TTNA 2O1MA 1MS7A 1GV8A 2G29A 5H8QB 2UVHA 4LZ7A 4IO6A 1FPIA 1B7ZA 3S9MC 1LCFA 1FPGA 2XXXA 1TWYA 1FBHA 2XXHA 3N6UA 2HZLA 3QIMA 1B9JA 3OO7A 3T0JA 3TZAA 1MXWA 1MY1A 4MJOA 4PAKA 1QVSA 2CZKA 3TDJA 3V83A 1B5IA 1B5JA 1GTKA 3B8BA 1RDXA 4F19A 5I2NA 1D3KA 3CG1A 3S4UA 1O64A 5IM2A 2P3VA 5CI5A 4R9GA 1XS5A 3MZBA 2WYPA 1IXCA 2F6GA 2Y5KA 4WXJA 3H06B 4MFIA 1MXUA 2XWVA 4PAIA 4N17A 5F7VA 3Q29A 4GX4A 1NV7A 4DE8A 4F29A 3DP4A 1FBEA 2Y7KA 2I58A 5TP9B 4XIGQ 2RC9A 4OMBA 1JEVA 4JWOA 4NN3A 1NH8A 2MKZA 2V93A 2GRVA 3VFJA 2REJA 2F7AA 2XXPA 3LV0A 4OVRA 4KCCA 1NUZA 4OYVA 4NTLA 3KSXA 2W7YA 4RPNA 1NUXA 3IORA 3C32A 1H43A 3UIFA 3C35A 1YZ0A 1B7UA 1DBZA 3K6UA 3U94A 4ECFA 1SYHA 1MY4A 4NEDA 2Q2CA 3FTOA 3KC0A 1P1QA 4ZZAA 5IKBA 2X26A 3ECRA 3BKIB 4ELPA 1ELJA 1B05A 2OWTA 1LAHE 3CFXA 3EKIA 3RQTA 2I3WA 3TKDA 1MG1A 5I7IA 4OQOA 1UIVA 2LAOA 4NGUA 2RC8A 3VE1B 4XXUA 4FORA 5TU0A 1N7WA 2HZKA 4QSDA 1IEJA 3ILTB 4I9DA 3SEVA 3O6HA 3MPLA 1EZ9A 3EF7A 4P47A 1J1NA 3PGFA 4DI3D 1FBPA 1S50A 4TLMB 4UABA 2OWZA 2QFLA 3UORA 1ZKBA 4WEDA 3MJNA 5H8HB 5HBCA 2OCUA 1B40A 4NF8B 2PFYA 1UTBA 2OJTA 3PPQA 1B32A 3UA8A 4HXVA 1CE2A 3T66A 3C31A 3QSLA 3PPRA 2VD3A 5EYHA 2XXQA 5DEXA 3RYBA 4ZS9A 4MH5A 4YB7A 2NVUB 4Q8RA 4P0IA 4N6KA 4XEQA 4AB6A 2D5WA 4X1DA 5LTCA 1B46A 1FBFA 3CI8A 1FBGA 4ZE8A 2VPOA 3O28A 1FTOA 3IK6B 3OO8A 2DWHA 1IIWA 4BDRA 2Q89A 1FSAA 5DEXB 2DE2A 1K9ZA 1FCKA 4FE8A 5J1DA 4PBQA 2WOPA 3ZKLA 4G8MA 1DTGA 3T9VA 3BFUA 1UIUA 2Q9TA 3RPLB 4NX1A 2XXRA 3MPKA 4ZECA 3NOHA 4BDOA 2D21A 2ALUA 1PDAA 4ZE9A 3W9WA 5CM6A 4MF3A 5DT6A 5DVJA 4U21A 3RYDA 2DVZA 3GBAA 4LP2B 3IB2A 1RYXA 3DRGA 4G61A 4OESA 1MPDA 4XKQA 4M4GA 1HSEA 3GBBA 4N91A 3HPIA 1BIYA 3E3KA 4H8JA 5AA4A 2V3UA 3UP9A 4I3EA 2JJKA 3EN3A 2Z22A 3KGCA 2RINA 2B3FA 1FPBA 2WOKA 3A3UA 1VDWA 3LSLA 3H6VA 1JQFA 4XKNA 1DPEA 1M5FA 2X7PA 1R1NA 1HSJA 1SQYA 3SEWA 2DP8A 1LBWA 1P1WA 1HSLA 1UTHA 4AQ4A 1FTKA 3S9LC 2KR0A 2UVIA 4LA9A 2QPQA 3Q28A 2XX8A 3FBPA 4OETA 3BFTA 3H7MA 1GGGA 5I2KA 1LBZA 2HEUA 2RCAA 1D9QA 3TMGA 3IX1A 3EPEA 1H76A 1YXIA 1IMCA 5HM4B 5AA2D 4DXBA 2QVVA 3LBSA 5FTIA 2FYIA 2AYSA 4O7IA 3D4CA 3ONMA 1IMFA 5AA3A 4GWOA 2XWOA 3W15C 4GWZA 3FVNA 5KCJA 1EYKA 1BKAA 4NQ8A 4OHNA 4OENA 3C33A 2P3NA 3VLUA 2RF1A 5I3SA 4I62A 4R2BA 1B3EA 4RNSA 1II5A 1CB6A 4GWYA 5L9SA 1B52A 5LDZA 1IMEA 1EU8A 1MDP1 4PF6A 4P8BA 3FASA 1NI9A 3D4GA 4PFRA 1LAGE 1R6ZA 2Z8FA 4JDFA 3N5LA 4PTKA 1OLCA 4DCXA 5EHSA 1MXXA 2O68A 3OOAA 4U1OA 1VR5A 1EYIA 1B2HA 2CZIA 2ZZVA 1ATGA 5H8NA 4OFOA 1OMPA 3TEPA 3DP8A 4ZEKA 3KG2A 3C9HA 4NF0A 2VPNA 5JK4A 3TCGA 2OWSA 2BJIA 3FIRA 2GH9A 3C34A 1YCJA 4LQ2A 2Q2AA 3BIGA 1US4A 3C36A 3IJOB 5KCJB 4PFTA 3IB1A 4R72A 4JSOA 3ROJA 4F3PA 3O97A 1AL3A 3RNNA 4AS5A 2ZZWA 2UVGA 4H8IA 4QFNA 5ICQA 2DQVA 1EZOA 1MDQA 1Q35A 1XT8A 1FBDA 2XWIA 2B65A 1RDZA 3KN7A 3CR9A 1I6AA 2PFZA 1AWBA 3KZGA 2O84X 1UTHB 4OFLA 1SD3A 1ZTYA 4IO2A 2OK2A 2O7IA 3H6WA 5CBSA 3H3GA 4HCWA 1FQAA 4JWXA 4JXIA 3TAJA 1GR2A 3LR1A 3K1MA 4GVOA 4PCDA 1OQGA 1QULA 1NUWA 2HXRA 3LVUA 4WKMA 3TQLA 4PFIA 3K02A 4GIZA 1JVYA 2V3QA 3T93B 3M3FA 3V8XB 3DELB 4IB2A 1CNQA 4N6PA 3L6GA 3R7XA 2DE3A 2V84A 1PB7A 1FTMA 3KSJA 5CBRA 2YJPA 3G3GA 1QUIA 4NHBA 2F8DA 3SKPA 2O51A 2WBBA 4XF5A 2ZNTA 1B4ZA 4PF8A 4HE0A 4ZZEA 1QUKA 3GZGA 5AA4B 2I6EA 4XFEA 4R75A
chains in the Genus database with same CATH topology
5ISUA 1NH7A 3DRHA 3ECRA 3RUMA 4E0WA 3DRKA 2D3IA 3G3JA 1WVJA 4BLAA 1ZLQA 2Z8EA 3BKIB 3H4ZA 3KOTA 3F11A 4YAHX 3IJXB 4ELPA 1ELJA 5JTYA 2UVJA 2RKMA 3LUYA 3PPPA 1B05A 2OWTA 2H25A 4QHQA 1JEUA 2QRYA 4QFKA 2VD2A 4U4XA 1LAHE 4UACA 2I0CA 1VFDA 3CFXA 4AB5A 3RQTA 4GFRA 1A8FA 1RYOA 2E0SA 3K0VA 3K2DA 4WEPA 4Z7EA 2DOJA 1A8EA 2HAVA 2I3WA 4H5FA 3U72A 4TLLB 3TKDA 4EDPA 4ELRA 5I2NB 1RKMA 2DWAA 1QKBA 1DMBA 1MG1A 2PMSA 4PFYA 3THIA 2I0BA 1BP5A 3B7DA 1UIVA 2LAOA 4G77A 4OQOA 1FQDA 2RC8A 3VE1B 4XXUA 2HFBA 4FORA 1LSTA 4JB7A 5TU0A 3CHGA 2HXWA 1N7WA 2HZKA 1A54A 1O63A 4K3FA 4QSDA 1B0HA 3MUQA 1IEJA 4L17A 2XD3A 3ILTB 3RLFE 1JW1A 2ONRA 1M5DA 3SEYA 4I9DA 5FTHA 1UTBB 2HQ0A 3SEVA 3O6HA 1NFTA 1SYIA 3MPLA 1H44A 1NL5A 2RCBA 1EZ9A 3TCFA 3IL1B 3ZKKA 3CFZA 3EF7A 4GL0A 4QSCA 5ELVA 1OVTA 1J1NA 4DXUA 1Z7NE 3GLBA 3PGFA 5DYHA 1S50A 3BBRA 4F3SA 5I84A 1XVYA 1MPBA 3KOSA 1XHYA 2QS3A 2PBWA 4TLMB 3UORA 4ZEIA 2PYYA 1ZKBA 4WEDA 2P1SA 3DM0A 3MJNA 4KI0E 5AA2A 3CSGA 5H8HB 5M2VA 4EXKA 4KD5A 5HBCA 3K00A 5CRYA 4ISUA 3O29A 1FW0A 1D9VA 1VSOA 2OCUA 3K6VA 2OZZA 2Q88A 1B40A 4G4PA 3WAFA 4EQ9A 4EQ7A 4HW8A 1PB8A 1YTVA 1T0KA 3R6UA 5I57B 2PVUA 4JSDA 4NF8B 1N0TA 1WODA 1OVBA 2RC7A 3CSBA 3MWBA 2QS2A 1IZ1A 4EXLA 1Y3QA 3FXUA 3K6XA 3RT8A 4HS7A 1R9QA 1UTBA 2OJTA 1B32A 2QS1A 3OO6A 1UQWA 3PPQA 3VLVA 1TXFA 4H1XA 4DXCA 5BUUA 4IO3A 2PT1A 3FJGA 1XVXA 4OTEA 3RN8A 2IEEA 2XXIA 4RK9A 3UA8A 4ESWA 1MXYA 3MC2A 1CE2A 1N3WA 1MQGA 3PMVA 1N76A 4H0WA 1B51A 3T66A 3MAMA 3C31A 5H8FB 5KCJB 4H5GA 4KFQA 1I69A 1N04A 3RTWB 3QSLA 1D9YA 4EUOA 3RPWA 3PPRA 2B3BA 3DRIA 2QJEA 2VD3A 1Y20A 2XXQA 3Q27A 2PT2A 2Y84A 5DEXA 3W9VA 3I6VA 2XHDA 3RYBA 4ZS9A 4MH5A 3CVGA 4YB7A 4YKKA 2NVUB 4PE5B 3H6TA 3G3FA 2YPNA 2G93A 1QUJA 3C4MA 3CIJA 4Q8RA 4OFJA 4P0IA 4KCDA 5I59A 5AA1A 4F3BA 3O6GA 4AB6A 2QS4A 1TFDA 4GLIA 3SETA 4OZ9A 3QYTA 1Y3PA 1NKXA 4NF6A 2P2AA 3AXFA 3K01A 2D5WA 3K6WA 4X1DA 3FVOA 1B0LA 2F97A 4KQPA 1B46A 3CI8A 3EHSA 3OSQA 1B5HA 4ZE8A 3IR1A 3O28A 1FTOA 1IXIA 4EF1A 1FTJA 1POTA 1ANFA 3SDFA 3IK6B 1I6QA 1MPCA 1MY3A 3OO8A 3USDA 3UGWA 4BDMA 4DIGA 1LBBA 2DWHA 1IIWA 4BDRA 5I58A 1MY0A 2Q89A 5DEXB 1B1XA 5H8HA 3E9XA 2CZLA 1MH3A 2H5YA 2QMXA 5L8DA 3A09A 3E4RA 4YZZA 3KBRA 4Q0CA 3PV0E 2DE2A 2ZNUA 3U92A 2ZNSA 1FCKA 1MH4A 4FE8A 5J1DA 2WOPA 3OD7A 3VDFA 3MP1A 1VFEA 4R73A 2ABHA 3EHTA 1URSA 2DWJA 3ZKLA 4G8MA 4IGRA 5L9OA 4LZ5A 1DTGA 4NF5B 3T9VA 3BFUA 4R74A 4LZ8A 4QF9A 1UIUA 2Q9TA 3HSTA 2QMWA 3T9UA 3LSWA 3PD9A 5AE4A 4NF4A 1IUDA 2XXRA 4QFPA 4RA1A 3MPKA 4IO5A 4FECA 1LCTA 4ZECA 4BDOA 3G3KA 5ITOA 5KZTA 1BTJA 3FJ7A 2D21A 4MBPA 5JEIA 2B4LA 2AL5A 2A5TB 1MXVA 2ALUA 5I56A 2F7BA 3MBPA 2R9JA 3MVWA 4RK2A 3VXBA 1PDAA 1Y4TA 5HPQA 1B1HA 4ZE9A 1LAFE 1ZJLA 3I3VA 4G68B 3W9WA 3FXQA 5CM6A 1QKAA 4MF3A 4F3PA 3U8QA 1MXZA 1USYH 2Y7IA 2FA7A 2XX7A 4U21A 2VOZA 3OEKA 4O3AA 2F6PA 5DT6A 3MZ1A 2Z23A 5DVJA 2B4MA 1WDNA 1MY2A 4KR5A 5K2XA 5IAIA 1LFIA 4Z0IA 2I48A 4YB5A 4PP0A 2DVZA 3GBAA 3O2AA 1P1OA 1SVXB 3IB2A 1AH5A 3QK6A 3QUJA 3M8UA 1RYXA 3DRGA 1LBCA 4OESA 2GFEA 1A99A 4BDLA 3MQ9A 1IXHA 4XKQA 1MPDA 2UYFA 4M4GA 5JTYB 1HSEA 3WAEA 3GBBA 3T9HB 1IQ7A 3HPIA 3PUVE 4M1VA 3S9NC 3IAZA 1BIYA 1B3LA 1S7YA 1DOTA 3E3KA 4H8JA 4OWDA 5DTBA 3FV1A 3H03A 2O1LA 4FEDA 4IO7A 5AA4A 3S9EA 2V3UA 3T96B 4LVQA 3UP9A 4FIMA 3HO7A 3EN3A 2H99A 2Z22A 3KGCA 1PBPA 1NNFA 2RINA 3IOWA 3PUZE 4HCYA 5H8SA 1DTZA 1XOCA 3RTFB 4YKJA 4EF2A 2B3FA 2ZYMA 3KEIA 4PETA 4F2QA 2WOKA 2UYEA 3RYAA 1Y1ZA 2O6AA 4GXAA 1A40A 1SDXA 3A3UA 3LSLA 4RJZA 2HAUA 4X9TA 3H6VA 2OLBA 4XKNA 1JQFA 1URDA 1DPEA 4TQUQ 4QFLA 1LGBC 2Y7PA 5H8QA 2F5XA 1M5FA 5TPAB 2X7PA 1R1NA 1HSJA 1SQYA 4H65A 4R6KA 3SEXA 3TTKA 1DPPA 2VHAA 4G8HA 1IXGA 5DVIA 4KYSA 3SEWA 1DSNA 1P1WA 1TFAA 2DP8A 1HSLA 1UTHA 1I6BA 4XKPA 3EQ1A 4AQ4A 1LB8A 1FTKA 4PQJA 3S9LC 4C0RA 1SW5A 2UVIA 4ZEFA 4LA9A 3FVGA 4DLDA 2QPQA 1JVXA 1Y9UA 1JW4A 3Q28A 4NF8A 2XX8A 2Z8DA 1R9LA 4OETA 3P7IA 5LOMA 3BFTA 1ZIUA 3H7MA 3FXRA 1GGGA 4ZEDA 1H45A 2F34A 5I58B 4POWA 4Q5TA 1OIBA 5I2KA 4PFUA 3LSFB 2HEUA 2DE4A 3PUXE 3TCHA 2RCAA 2QSXA 3QUFA 4ESXA 2A5SA 4GD5A 5CMBA 2ZYKA 1N3XA 1OLAA 4OERA 1TT1A 5CMMA 3TMGA 1M5BA 3IX1A 2OBGA 5L9MA 1KWHA 1MQDA 1Y3NA 3EPEA 4NF6B 5A5XA 1H76A 2KLFA 4DCYA 5CBRA 4PFWA 3A3CA 3KN3A 5HM4B 1ZU0A 5AA2D 4DXBA 1SW2A 4ELQA 3LBSA 2XXYA 3VLWA 1YPNA 3PUWE 4OEVA 4LP2B 1LB9A 4U23A 5FTIA 3TYHA 2WKYA 4DDDA 5CC2A 3EHUA 1MM7A 1EZPA 2I49A 2FYIA 4FJPA 4H6DA 3MP6A 2AYSA 1JETA 2AIXA 2DS9A 1N7XA 5H8NB 4X1BA 2R6GE 3D4CA 1S9TA 2DXYA 4C1TA 1FTLA 3K1PA 3ONMA 3V5AA 4YMAA 3FD3A 5AA3A 4GWOA 3S2VA 3W15C 4F1UA 3UK4A 3MVYA 4KHZE 2CMOA 3RGYA 3O6IA 3PMWA 1B4HA 3G3IA 3FVNA 5KCJA 1AIVA 4ONYA 4F39A 2Y7RA 1LAXA 1XC1A 2F36A 4IGTA 4F1YA 5A5XB 4FAJA 1BKAA 3R26A 3MZ9A 3L6HA 3E13X 2GHBA 4MLQA 3B6TA 3JZJA 3OEMA 2XXWA 3SERA 1SBPA 4OHNA 3KJTA 2I4CA 3C33A 2V3TA 3FGSA 3PPNA 4LUBA 4OENA 4YKPA 3RT6B 4NE4A 4Q30B 3VLUA 3V89B 2O69A 2RF1A 4POXA 3TFLA 4I62A 1FQEA 1B3EA 4KPTA 4QSEA 4R2BA 2DVCA 1ZMGA 1MQIA 3DP6A 3IOUA 3OO9A 3LSXA 3K4UA 3S4UA 3TTLA 3K1NA 5KDTA 4F3GA 4RNSA 4LATA 1MQJA 3T9XB 3G3HA 1GVCA 1II5A 1CB6A 4I1DA 2IA4A 1B52A 1NNKA 4NF4B 5B70A 5L9SA 2Q8JA 1EU8A 5KDTB 1MDP1 3B6QA 4RXLA 4N07A 3CRBA 2F35A 3FASA 3JV9A 1FQFA 5I2KB 4R6HA 2ZYNA 2A5TA 5TPAA 5B7DA 3KN8A 1NNTA 1O7TA 4F18A 3D4GA 3OELA 3N6TA 4O3CA 4R6YA 1N84A 2DXRA 2ONKE 3IO4A 1IITA 1LFGA 3IOVA 3FUZA 1LAGE 4OXVA 3PAMA 4NWDA 1R6ZA 2Z8FA 2F78A 4GL8A 4BDQA 4JDFA 3N5LA 4JBZA 1SI1A 2H9BA 4GOTA 1VE4A 4YICA 4GXSB 4E0XA 1SI0A 4I8CA 4R2FA 1OLCA 5I59B 4DCXA 3Q26A 5EHSA 1MXXA 2O68A 3MW0A 3TUSA 1OQHA 3OOAA 4U1OA 3VVFA 1VR5A 4TOZA 4KYDA 4QRZA 3O66A 3LC8A 5FHNA 2H98A 3OXNA 1B2HA 3FVKA 1USYE 1LFHA 4THIA 1B3GA 1SW4A 1B7HA 1ATGA 3VVDA 3H6UA 3FATA 4OFOA 1MM6A 1B58A 1OMPA 5H8NA 1PEBA 4F2OA 3DP8A 3HN0A 1URGA 3TEPA 4G8NA 2XX9A 3U1OA 4ZEKA 3KG2A 3TQWA 3C9HA 2H4IA 1NNPA 2VP1A 1PC3A 5JK4A 3TCGA 2NXOA 2OWSA 3N26A 3FIRA 1QW0A 3PUYE 4IY5A 2GH9A 4OVJA 3C34A 3IO6A 1YCJA 4U2RA 3PMXA 3SEUA 5I56B 4NWCA 4R9FA 1H3DA 4LQ2A 3TODA 3DRJA 1Y1MA 2Q2AA 3OENA 3TPAA 1US4A 5FHOA 3C36A 2ESNA 3I5OA 4ZEBA 1M5EA 4H67A 3RY3A 5BWJA 3IJOB 1M5CA 2THIA 4O3BA 3DRFA 1FQCA 1QJMA 4G68A 3TTNA 4PFTA 2FNCA 2O1MA 1MS7A 3IB1A 4JSOA 3MP8A 3N94A 2ZXTA 4R72A 2G29A 1GV8A 3SESA 2E1SA 3O97A 3IB0A 3ODBA 1AL3A 4U4SA 1Q1KA 3CG3A 5H8QB 3HCQA 2UVHA 3Q25A 4LZ7A 3RNNA 4IO6A 3HV1A 5CMKA 2UVGA 4H8IA 4QFNA 5ICQA 2YLNA 2DQVA 4P11A 2GHAA 4G68C 1EZOA 1B6HA 3U93A 5F1QA 1B7ZA 1MDQA 3S9MC 2X7QA 1LCFA 2XXXA 5I57A 3GXAA 5EYFA 1SW1A 1TWYA 1Q35A 2PX1A 1XT8A 2M8CA 4JWYA 4GF8A 4ZDMA 2XXHA 2UXAA 3N6UA 4FEBA 3KN7A 2HZLA 2B65A 3QIMA 4BDNA 2ANJA 3CR9A 4ELOA 1B9JA 1I6AA 3OO7A 3OMBA 3JYRA 5AA2B 2ONSA 3TZAA 1MXWA 3KZGA 3G7WA 2O84X 1UTHB 2P0SA 1MY1A 4IY6A 3T22A 4YB6A 3KFMA 4OFLA 1AMFA 1QVSA 1SD3A 2BJJX 1ZTYA 1BLFA 4IO2A 3HHGA 4KYEA 3FJMA 3TDJA 3PU5A 2OK2A 2O7IA 1Z7ME 3H6WA 3OSRA 4XTCQ 5CBSA 5ITPA 3M3LA 4C1UA 3V83A 3H3GA 4G2ZA 1B5IA 1B5JA 4GRKA 4HCWA 1PBQA 1FQAA 4JWXA 1GTKA 1P1UA 4YMBA 4JXIA 4DZ1A 4F19A 5EHMA 5I2NA 4F31B 1D3KA 3PD8A 3CG1A 4P0GA 2ZYOA 3TAJA 1F9BA 2R71A 1A7LA 1POY1 1GR2A 1O64A 2REGA 3LR1A 4LQ5A 3FZVA 4NF5A 5CI5A 3DLNA 4R9GA 4U22A 1XS5A 3MZBA 2I4BA 4N13A 2ZMBA 2DYXA 3K1MA 2NOOA 4NMYA 2O7UA 4GVOA 2DSFA 5H8FA 1IXCA 1OQGA 1US5A 2F6GA 2I3VA 3FV2A 2Y7WA 1QULA 4WXJA 2F7CA 3KJ7A 4EQBA 3H06B 3LVUA 4MFIA 4OEUA 2XD2A 4RYAA 1MXUA 1EH3A 4LONB 4YU0A 4WKMA 4IO4A 3TQLA 3K02A 2V25A 5K2YA 1JNFA 5F7VA 4GIZA 1JVYA 3Q29A 3QAXA 1YAEA 4DE8A 4F29A 3DP4A 2Y7KA 1B3HA 2V3QA 1P1NA 2NUVA 2XXVA 3T93B 2I58A 5TP9B 3VXCA 3M3FA 2DWIA 3DELB 4IB2A 3V8XB 4F1VA 1Y4CA 4MLVA 1MRPA 3VV5A 4XIGQ 3PPOA 4FATA 2RC9A 4F22A 4OMBA 1JEVA 1L5TA 4N6PA 4JWOA 3L6GA 5ICTA 3R7XA 2DE3A 2V84A 2WOLA 3ZS6A 5DVFA 1PB7A 1AOVA 1NH8A 1B3FA 1FTMA 2V93A 2GRVA 3KSJA 4HTGA 5FHMA 3TTMA 2XXTA 1FQBA 3VFJA 1D4NA 1A55A 2REJA 3HHFA 2YJPA 3G3GA 2F7AA 3ILUB 2XXPA 2XXUA 2HCAA 1QUIA 4KCCA 3O6PA 4OYVA 5CMCA 1JW5A 3M3KA 4NTLA 2F8DA 4QFOA 3KSXA 3SKPA 4X48A 4ND9A 3TELA 2W7YA 3O9PA 1MQHA 4RPNA 3IORA 3ZSFA 2O51A 1PB9A 5IKBA 4XKRA 1H43A 1P99A 2ZNTA 3C32A 3B6WA 4YKIA 3UIFA 3MVXA 3C35A 1NMUA 1B4ZA 1B7UA 2AL4A 4UA8A 3K6UA 3U94A 3IOTA 4ZZEA 3TTRA 4ECFA 1LLSA 1SYHA 1MY4A 3MVZA 4NEDA 3CFLA 1QUKA 4RY1A 2QL3A 5TP9A 3GZGA 2Q2CA 3FTOA 3QXMA 5AA4B 1ZBMA 1P1QA 2I6EA 4GQOA 3VVEA 4ZZAA 4RPOA 3UN6A 2NWJA 4U1ZA 2VGQA 4R75A 2X26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ISU A;  1NH7 A;  3DRH A;  3ECR A;  3RUM A;  4E0W A;  3DRK A;  2D3I A;  3G3J A;  1WVJ A;  4BLA A;  1ZLQ A;  2Z8E A;  3BKI B;  3H4Z A;  3KOT A;  3F11 A;  4YAH X;  3IJX B;  4ELP A;  1ELJ A;  5JTY A;  2UVJ A;  2RKM A;  3LUY A;  3PPP A;  1B05 A;  2OWT A;  2H25 A;  4QHQ A;  1JEU A;  2QRY A;  4QFK A;  2VD2 A;  4U4X A;  1LAH E;  4UAC A;  2I0C A;  1VFD A;  3CFX A;  4AB5 A;  3RQT A;  4GFR A;  1A8F A;  1RYO A;  2E0S A;  3K0V A;  3K2D A;  4WEP A;  4Z7E A;  2DOJ A;  1A8E A;  2HAV A;  2I3W A;  4H5F A;  3U72 A;  4TLL B;  3TKD A;  4EDP A;  4ELR A;  5I2N B;  1RKM A;  2DWA A;  1QKB A;  1DMB A;  1MG1 A;  2PMS A;  4PFY A;  3THI A;  2I0B A;  1BP5 A;  3B7D A;  1UIV A;  2LAO A;  4G77 A;  4OQO A;  1FQD A;  2RC8 A;  3VE1 B;  4XXU A;  2HFB A;  4FOR A;  1LST A;  4JB7 A;  5TU0 A;  3CHG A;  2HXW A;  1N7W A;  2HZK A;  1A54 A;  1O63 A;  4K3F A;  4QSD A;  1B0H A;  3MUQ A;  1IEJ A;  4L17 A;  2XD3 A;  3ILT B;  3RLF E;  1JW1 A;  2ONR A;  1M5D A;  3SEY A;  4I9D A;  5FTH A;  1UTB B;  2HQ0 A;  3SEV A;  3O6H A;  1NFT A;  1SYI A;  3MPL A;  1H44 A;  1NL5 A;  2RCB A;  1EZ9 A;  3TCF A;  3IL1 B;  3ZKK A;  3CFZ A;  3EF7 A;  4GL0 A;  4QSC A;  5ELV A;  1OVT A;  1J1N A;  4DXU A;  1Z7N E;  3GLB A;  3PGF A;  5DYH A;  1S50 A;  3BBR A;  4F3S A;  5I84 A;  1XVY A;  1MPB A;  3KOS A;  1XHY A;  2QS3 A;  2PBW A;  4TLM B;  3UOR A;  4ZEI A;  2PYY A;  1ZKB A;  4WED A;  2P1S A;  3DM0 A;  3MJN A;  4KI0 E;  5AA2 A;  3CSG A;  5H8H B;  5M2V A;  4EXK A;  4KD5 A;  5HBC A;  3K00 A;  5CRY A;  4ISU A;  3O29 A;  1FW0 A;  1D9V A;  1VSO A;  2OCU A;  3K6V A;  2OZZ A;  2Q88 A;  1B40 A;  4G4P A;  3WAF A;  4EQ9 A;  4EQ7 A;  4HW8 A;  1PB8 A;  1YTV A;  1T0K A;  3R6U A;  5I57 B;  2PVU A;  4JSD A;  4NF8 B;  1N0T A;  1WOD A;  1OVB A;  2RC7 A;  3CSB A;  3MWB A;  2QS2 A;  1IZ1 A;  4EXL A;  1Y3Q A;  3FXU A;  3K6X A;  3RT8 A;  4HS7 A;  1R9Q A;  1UTB A;  2OJT A;  1B32 A;  2QS1 A;  3OO6 A;  1UQW A;  3PPQ A;  3VLV A;  1TXF A;  4H1X A;  4DXC A;  5BUU A;  4IO3 A;  2PT1 A;  3FJG A;  1XVX A;  4OTE A;  3RN8 A;  2IEE A;  2XXI A;  4RK9 A;  3UA8 A;  4ESW A;  1MXY A;  3MC2 A;  1CE2 A;  1N3W A;  1MQG A;  3PMV A;  1N76 A;  4H0W A;  1B51 A;  3T66 A;  3MAM A;  3C31 A;  5H8F B;  5KCJ B;  4H5G A;  4KFQ A;  1I69 A;  1N04 A;  3RTW B;  3QSL A;  1D9Y A;  4EUO A;  3RPW A;  3PPR A;  2B3B A;  3DRI A;  2QJE A;  2VD3 A;  1Y20 A;  2XXQ A;  3Q27 A;  2PT2 A;  2Y84 A;  5DEX A;  3W9V A;  3I6V A;  2XHD A;  3RYB A;  4ZS9 A;  4MH5 A;  3CVG A;  4YB7 A;  4YKK A;  2NVU B;  4PE5 B;  3H6T A;  3G3F A;  2YPN A;  2G93 A;  1QUJ A;  3C4M A;  3CIJ A;  4Q8R A;  4OFJ A;  4P0I A;  4KCD A;  5I59 A;  5AA1 A;  4F3B A;  3O6G A;  4AB6 A;  2QS4 A;  1TFD A;  4GLI A;  3SET A;  4OZ9 A;  3QYT A;  1Y3P A;  1NKX A;  4NF6 A;  2P2A A;  3AXF A;  3K01 A;  2D5W A;  3K6W A;  4X1D A;  3FVO A;  1B0L A;  2F97 A;  4KQP A;  1B46 A;  3CI8 A;  3EHS A;  3OSQ A;  1B5H A;  4ZE8 A;  3IR1 A;  3O28 A;  1FTO A;  1IXI A;  4EF1 A;  1FTJ A;  1POT A;  1ANF A;  3SDF A;  3IK6 B;  1I6Q A;  1MPC A;  1MY3 A;  3OO8 A;  3USD A;  3UGW A;  4BDM A;  4DIG A;  1LBB A;  2DWH A;  1IIW A;  4BDR A;  5I58 A;  1MY0 A;  2Q89 A;  5DEX B;  1B1X A;  5H8H A;  3E9X A;  2CZL A;  1MH3 A;  2H5Y A;  2QMX A;  5L8D A;  3A09 A;  3E4R A;  4YZZ A;  3KBR A;  4Q0C A;  3PV0 E;  2DE2 A;  2ZNU A;  3U92 A;  2ZNS A;  1FCK A;  1MH4 A;  4FE8 A;  5J1D A;  2WOP A;  3OD7 A;  3VDF A;  3MP1 A;  1VFE A;  4R73 A;  2ABH A;  3EHT A;  1URS A;  2DWJ A;  3ZKL A;  4G8M A;  4IGR A;  5L9O A;  4LZ5 A;  1DTG A;  4NF5 B;  3T9V A;  3BFU A;  4R74 A;  4LZ8 A;  4QF9 A;  1UIU A;  2Q9T A;  3HST A;  2QMW A;  3T9U A;  3LSW A;  3PD9 A;  5AE4 A;  4NF4 A;  1IUD A;  2XXR A;  4QFP A;  4RA1 A;  3MPK A;  4IO5 A;  4FEC A;  1LCT A;  4ZEC A;  4BDO A;  3G3K A;  5ITO A;  5KZT A;  1BTJ A;  3FJ7 A;  2D21 A;  4MBP A;  5JEI A;  2B4L A;  2AL5 A;  2A5T B;  1MXV A;  2ALU A;  5I56 A;  2F7B A;  3MBP A;  2R9J A;  3MVW A;  4RK2 A;  3VXB A;  1PDA A;  1Y4T A;  5HPQ A;  1B1H A;  4ZE9 A;  1LAF E;  1ZJL A;  3I3V A;  4G68 B;  3W9W A;  3FXQ A;  5CM6 A;  1QKA A;  4MF3 A;  4F3P A;  3U8Q A;  1MXZ A;  1USY H;  2Y7I A;  2FA7 A;  2XX7 A;  4U21 A;  2VOZ A;  3OEK A;  4O3A A;  2F6P A;  5DT6 A;  3MZ1 A;  2Z23 A;  5DVJ A;  2B4M A;  1WDN A;  1MY2 A;  4KR5 A;  5K2X A;  5IAI A;  1LFI A;  4Z0I A;  2I48 A;  4YB5 A;  4PP0 A;  2DVZ A;  3GBA A;  3O2A A;  1P1O A;  1SVX B;  3IB2 A;  1AH5 A;  3QK6 A;  3QUJ A;  3M8U A;  1RYX A;  3DRG A;  1LBC A;  4OES A;  2GFE A;  1A99 A;  4BDL A;  3MQ9 A;  1IXH A;  4XKQ A;  1MPD A;  2UYF A;  4M4G A;  5JTY B;  1HSE A;  3WAE A;  3GBB A;  3T9H B;  1IQ7 A;  3HPI A;  3PUV E;  4M1V A;  3S9N C;  3IAZ A;  1BIY A;  1B3L A;  1S7Y A;  1DOT A;  3E3K A;  4H8J A;  4OWD A;  5DTB A;  3FV1 A;  3H03 A;  2O1L A;  4FED A;  4IO7 A;  5AA4 A;  3S9E A;  2V3U A;  3T96 B;  4LVQ A;  3UP9 A;  4FIM A;  3HO7 A;  3EN3 A;  2H99 A;  2Z22 A;  3KGC A;  1PBP A;  1NNF A;  2RIN A;  3IOW A;  3PUZ E;  4HCY A;  5H8S A;  1DTZ A;  1XOC A;  3RTF B;  4YKJ A;  4EF2 A;  2B3F A;  2ZYM A;  3KEI A;  4PET A;  4F2Q A;  2WOK A;  2UYE A;  3RYA A;  1Y1Z A;  2O6A A;  4GXA A;  1A40 A;  1SDX A;  3A3U A;  3LSL A;  4RJZ A;  2HAU A;  4X9T A;  3H6V A;  2OLB A;  4XKN A;  1JQF A;  1URD A;  1DPE A;  4TQU Q;  4QFL A;  1LGB C;  2Y7P A;  5H8Q A;  2F5X A;  1M5F A;  5TPA B;  2X7P A;  1R1N A;  1HSJ A;  1SQY A;  4H65 A;  4R6K A;  3SEX A;  3TTK A;  1DPP A;  2VHA A;  4G8H A;  1IXG A;  5DVI A;  4KYS A;  3SEW A;  1DSN A;  1P1W A;  1TFA A;  2DP8 A;  1HSL A;  1UTH A;  1I6B A;  4XKP A;  3EQ1 A;  4AQ4 A;  1LB8 A;  1FTK A;  4PQJ A;  3S9L C;  4C0R A;  1SW5 A;  2UVI A;  4ZEF A;  4LA9 A;  3FVG A;  4DLD A;  2QPQ A;  1JVX A;  1Y9U A;  1JW4 A;  3Q28 A;  4NF8 A;  2XX8 A;  2Z8D A;  1R9L A;  4OET A;  3P7I A;  5LOM A;  3BFT A;  1ZIU A;  3H7M A;  3FXR A;  1GGG A;  4ZED A;  1H45 A;  2F34 A;  5I58 B;  4POW A;  4Q5T A;  1OIB A;  5I2K A;  4PFU A;  3LSF B;  2HEU A;  2DE4 A;  3PUX E;  3TCH A;  2RCA A;  2QSX A;  3QUF A;  4ESX A;  2A5S A;  4GD5 A;  5CMB A;  2ZYK A;  1N3X A;  1OLA A;  4OER A;  1TT1 A;  5CMM A;  3TMG A;  1M5B A;  3IX1 A;  2OBG A;  5L9M A;  1KWH A;  1MQD A;  1Y3N A;  3EPE A;  4NF6 B;  5A5X A;  1H76 A;  2KLF A;  4DCY A;  5CBR A;  4PFW A;  3A3C A;  3KN3 A;  5HM4 B;  1ZU0 A;  5AA2 D;  4DXB A;  1SW2 A;  4ELQ A;  3LBS A;  2XXY A;  3VLW A;  1YPN A;  3PUW E;  4OEV A;  4LP2 B;  1LB9 A;  4U23 A;  5FTI A;  3TYH A;  2WKY A;  4DDD A;  5CC2 A;  3EHU A;  1MM7 A;  1EZP A;  2I49 A;  2FYI A;  4FJP A;  4H6D A;  3MP6 A;  2AYS A;  1JET A;  2AIX A;  2DS9 A;  1N7X A;  5H8N B;  4X1B A;  2R6G E;  3D4C A;  1S9T A;  2DXY A;  4C1T A;  1FTL A;  3K1P A;  3ONM A;  3V5A A;  4YMA A;  3FD3 A;  5AA3 A;  4GWO A;  3S2V A;  3W15 C;  4F1U A;  3UK4 A;  3MVY A;  4KHZ E;  2CMO A;  3RGY A;  3O6I A;  3PMW A;  1B4H A;  3G3I A;  3FVN A;  5KCJ A;  1AIV A;  4ONY A;  4F39 A;  2Y7R A;  1LAX A;  1XC1 A;  2F36 A;  4IGT A;  4F1Y A;  5A5X B;  4FAJ A;  1BKA A;  3R26 A;  3MZ9 A;  3L6H A;  3E13 X;  2GHB A;  4MLQ A;  3B6T A;  3JZJ A;  3OEM A;  2XXW A;  3SER A;  1SBP A;  4OHN A;  3KJT A;  2I4C A;  3C33 A;  2V3T A;  3FGS A;  3PPN A;  4LUB A;  4OEN A;  4YKP A;  3RT6 B;  4NE4 A;  4Q30 B;  3VLU A;  3V89 B;  2O69 A;  2RF1 A;  4POX A;  3TFL A;  4I62 A;  1FQE A;  1B3E A;  4KPT A;  4QSE A;  4R2B A;  2DVC A;  1ZMG A;  1MQI A;  3DP6 A;  3IOU A;  3OO9 A;  3LSX A;  3K4U A;  3S4U A;  3TTL A;  3K1N A;  5KDT A;  4F3G A;  4RNS A;  4LAT A;  1MQJ A;  3T9X B;  3G3H A;  1GVC A;  1II5 A;  1CB6 A;  4I1D A;  2IA4 A;  1B52 A;  1NNK A;  4NF4 B;  5B70 A;  5L9S A;  2Q8J A;  1EU8 A;  5KDT B;  1MDP 1;  3B6Q A;  4RXL A;  4N07 A;  3CRB A;  2F35 A;  3FAS A;  3JV9 A;  1FQF A;  5I2K B;  4R6H A;  2ZYN A;  2A5T A;  5TPA A;  5B7D A;  3KN8 A;  1NNT A;  1O7T A;  4F18 A;  3D4G A;  3OEL A;  3N6T A;  4O3C A;  4R6Y A;  1N84 A;  2DXR A;  2ONK E;  3IO4 A;  1IIT A;  1LFG A;  3IOV A;  3FUZ A;  1LAG E;  4OXV A;  3PAM A;  4NWD A;  1R6Z A;  2Z8F A;  2F78 A;  4GL8 A;  4BDQ A;  4JDF A;  3N5L A;  4JBZ A;  1SI1 A;  2H9B A;  4GOT A;  1VE4 A;  4YIC A;  4GXS B;  4E0X A;  1SI0 A;  4I8C A;  4R2F A;  1OLC A;  5I59 B;  4DCX A;  3Q26 A;  5EHS A;  1MXX A;  2O68 A;  3MW0 A;  3TUS A;  1OQH A;  3OOA A;  4U1O A;  3VVF A;  1VR5 A;  4TOZ A;  4KYD A;  4QRZ A;  3O66 A;  3LC8 A;  5FHN A;  2H98 A;  3OXN A;  1B2H A;  3FVK A;  1USY E;  1LFH A;  4THI A;  1B3G A;  1SW4 A;  1B7H A;  1ATG A;  3VVD A;  3H6U A;  3FAT A;  4OFO A;  1MM6 A;  1B58 A;  1OMP A;  5H8N A;  1PEB A;  4F2O A;  3DP8 A;  3HN0 A;  1URG A;  3TEP A;  4G8N A;  2XX9 A;  3U1O A;  4ZEK A;  3KG2 A;  3TQW A;  3C9H A;  2H4I A;  1NNP A;  2VP1 A;  1PC3 A;  5JK4 A;  3TCG A;  2NXO A;  2OWS A;  3N26 A;  3FIR A;  1QW0 A;  3PUY E;  4IY5 A;  2GH9 A;  4OVJ A;  3C34 A;  3IO6 A;  1YCJ A;  4U2R A;  3PMX A;  3SEU A;  5I56 B;  4NWC A;  4R9F A;  1H3D A;  4LQ2 A;  3TOD A;  3DRJ A;  1Y1M A;  2Q2A A;  3OEN A;  3TPA A;  1US4 A;  5FHO A;  3C36 A;  2ESN A;  3I5O A;  4ZEB A;  1M5E A;  4H67 A;  3RY3 A;  5BWJ A;  3IJO B;  1M5C A;  2THI A;  4O3B A;  3DRF A;  1FQC A;  1QJM A;  4G68 A;  3TTN A;  4PFT A;  2FNC A;  2O1M A;  1MS7 A;  3IB1 A;  4JSO A;  3MP8 A;  3N94 A;  2ZXT A;  4R72 A;  2G29 A;  1GV8 A;  3SES A;  2E1S A;  3O97 A;  3IB0 A;  3ODB A;  1AL3 A;  4U4S A;  1Q1K A;  3CG3 A;  5H8Q B;  3HCQ A;  2UVH A;  3Q25 A;  4LZ7 A;  3RNN A;  4IO6 A;  3HV1 A;  5CMK A;  2UVG A;  4H8I A;  4QFN A;  5ICQ A;  2YLN A;  2DQV A;  4P11 A;  2GHA A;  4G68 C;  1EZO A;  1B6H A;  3U93 A;  5F1Q A;  1B7Z A;  1MDQ A;  3S9M C;  2X7Q A;  1LCF A;  2XXX A;  5I57 A;  3GXA A;  5EYF A;  1SW1 A;  1TWY A;  1Q35 A;  2PX1 A;  1XT8 A;  2M8C A;  4JWY A;  4GF8 A;  4ZDM A;  2XXH A;  2UXA A;  3N6U A;  4FEB A;  3KN7 A;  2HZL A;  2B65 A;  3QIM A;  4BDN A;  2ANJ A;  3CR9 A;  4ELO A;  1B9J A;  1I6A A;  3OO7 A;  3OMB A;  3JYR A;  5AA2 B;  2ONS A;  3TZA A;  1MXW A;  3KZG A;  3G7W A;  2O84 X;  1UTH B;  2P0S A;  1MY1 A;  4IY6 A;  3T22 A;  4YB6 A;  3KFM A;  4OFL A;  1AMF A;  1QVS A;  1SD3 A;  2BJJ X;  1ZTY A;  1BLF A;  4IO2 A;  3HHG A;  4KYE A;  3FJM A;  3TDJ A;  3PU5 A;  2OK2 A;  2O7I A;  1Z7M E;  3H6W A;  3OSR A;  4XTC Q;  5CBS A;  5ITP A;  3M3L A;  4C1U A;  3V83 A;  3H3G A;  4G2Z A;  1B5I A;  1B5J A;  4GRK A;  4HCW A;  1PBQ A;  1FQA A;  4JWX A;  1GTK A;  1P1U A;  4YMB A;  4JXI A;  4DZ1 A;  4F19 A;  5EHM A;  5I2N A;  4F31 B;  1D3K A;  3PD8 A;  3CG1 A;  4P0G A;  2ZYO A;  3TAJ A;  1F9B A;  2R71 A;  1A7L A;  1POY 1;  1GR2 A;  1O64 A;  2REG A;  3LR1 A;  4LQ5 A;  3FZV A;  4NF5 A;  5CI5 A;  3DLN A;  4R9G A;  4U22 A;  1XS5 A;  3MZB A;  2I4B A;  4N13 A;  2ZMB A;  2DYX A;  3K1M A;  2NOO A;  4NMY A;  2O7U A;  4GVO A;  2DSF A;  5H8F A;  1IXC A;  1OQG A;  1US5 A;  2F6G A;  2I3V A;  3FV2 A;  2Y7W A;  1QUL A;  4WXJ A;  2F7C A;  3KJ7 A;  4EQB A;  3H06 B;  3LVU A;  4MFI A;  4OEU A;  2XD2 A;  4RYA A;  1MXU A;  1EH3 A;  4LON B;  4YU0 A;  4WKM A;  4IO4 A;  3TQL A;  3K02 A;  2V25 A;  5K2Y A;  1JNF A;  5F7V A;  4GIZ A;  1JVY A;  3Q29 A;  3QAX A;  1YAE A;  4DE8 A;  4F29 A;  3DP4 A;  2Y7K A;  1B3H A;  2V3Q A;  1P1N A;  2NUV A;  2XXV A;  3T93 B;  2I58 A;  5TP9 B;  3VXC A;  3M3F A;  2DWI A;  3DEL B;  4IB2 A;  3V8X B;  4F1V A;  1Y4C A;  4MLV A;  1MRP A;  3VV5 A;  4XIG Q;  3PPO A;  4FAT A;  2RC9 A;  4F22 A;  4OMB A;  1JEV A;  1L5T A;  4N6P A;  4JWO A;  3L6G A;  5ICT A;  3R7X A;  2DE3 A;  2V84 A;  2WOL A;  3ZS6 A;  5DVF A;  1PB7 A;  1AOV A;  1NH8 A;  1B3F A;  1FTM A;  2V93 A;  2GRV A;  3KSJ A;  4HTG A;  5FHM A;  3TTM A;  2XXT A;  1FQB A;  3VFJ A;  1D4N A;  1A55 A;  2REJ A;  3HHF A;  2YJP A;  3G3G A;  2F7A A;  3ILU B;  2XXP A;  2XXU A;  2HCA A;  1QUI A;  4KCC A;  3O6P A;  4OYV A;  5CMC A;  1JW5 A;  3M3K A;  4NTL A;  2F8D A;  4QFO A;  3KSX A;  3SKP A;  4X48 A;  4ND9 A;  3TEL A;  2W7Y A;  3O9P A;  1MQH A;  4RPN A;  3IOR A;  3ZSF A;  2O51 A;  1PB9 A;  5IKB A;  4XKR A;  1H43 A;  1P99 A;  2ZNT A;  3C32 A;  3B6W A;  4YKI A;  3UIF A;  3MVX A;  3C35 A;  1NMU A;  1B4Z A;  1B7U A;  2AL4 A;  4UA8 A;  3K6U A;  3U94 A;  3IOT A;  4ZZE A;  3TTR A;  4ECF A;  1LLS A;  1SYH A;  1MY4 A;  3MVZ A;  4NED A;  3CFL A;  1QUK A;  4RY1 A;  2QL3 A;  5TP9 A;  3GZG A;  2Q2C A;  3FTO A;  3QXM A;  5AA4 B;  1ZBM A;  1P1Q A;  2I6E A;  4GQO A;  3VVE A;  4ZZA A;  4RPO A;  3UN6 A;  2NWJ A;  4U1Z A;  2VGQ A;  4R75 A;  2X26 A; 
#chains in the Genus database with same CATH topology
 1NH7 A;  3DRH A;  1FPL A;  3RUM A;  4E0W A;  2D3I A;  3G3J A;  1WVJ A;  4BLA A;  2Z8E A;  1IMB A;  2H25 A;  2VD2 A;  3MYU A;  2E0S A;  3K0V A;  1A8F A;  5IZ3 A;  4Z7E A;  1A8E A;  2HAV A;  4H5F A;  4EDP A;  4ELR A;  4TLL B;  5I2N B;  2DWA A;  1QKB A;  1DMB A;  2PMS A;  4PFY A;  1BP5 A;  4G77 A;  2HFB A;  1LST A;  2HXW A;  3U65 A;  1B0H A;  2FIE A;  1SPI A;  2CZH A;  5FTH A;  1UTB B;  1SYI A;  2RCB A;  2WX9 A;  3IL1 B;  4QSC A;  4X8R A;  1NV3 A;  4DXU A;  1XVY A;  1MPB A;  3KOS A;  2QS3 A;  4ZEI A;  2HHM A;  2XXK A;  2ZZX A;  4MNP A;  1K9Y A;  5CRY A;  4ISU A;  3O29 A;  1FW0 A;  1XI6 A;  2OZZ A;  2Q88 A;  4G4P A;  4EQ7 A;  1YTV A;  1T0K A;  4JSD A;  1N0T A;  2RC7 A;  2QS2 A;  3FXU A;  4HS7 A;  3VLV A;  5I5P A;  2QS1 A;  5BUU A;  1TXF A;  1FPK A;  4PGP A;  2R8T A;  3RN8 A;  3PMV A;  4QXD A;  3MAM A;  2Y5L A;  4KFQ A;  4EUO A;  2B3B A;  1EYJ A;  3I6V A;  1IMD A;  2G93 A;  4OFJ A;  3O6G A;  2QS4 A;  4OZ9 A;  1INP A;  4NF6 A;  2P2A A;  2F97 A;  4GX3 A;  3EHS A;  1B5H A;  3A29 A;  3IR1 A;  1IXI A;  1Q9D A;  1ANF A;  1POT A;  3SDF A;  1I6Q A;  1MPC A;  4DIG A;  1MY0 A;  2QMX A;  3A09 A;  3KBR A;  2ZNU A;  1MH4 A;  3OD7 A;  3MP1 A;  4R73 A;  2ABH A;  5EQ8 A;  2DWJ A;  2CEX A;  4P1E A;  5L9O A;  4NF5 B;  4LZ8 A;  4QF9 A;  1DCU A;  4GX6 A;  4QFP A;  4IO5 A;  3IFA A;  5KZT A;  1BTJ A;  4MBP A;  2B4L A;  5I56 A;  2R9J A;  3MVW A;  5HPQ A;  1Y4T A;  1LAF E;  1FPJ A;  1QKA A;  1LBY A;  3U8Q A;  1MXZ A;  2Y7I A;  2XX7 A;  2VOZ A;  2F3B A;  2F6P A;  2Z23 A;  2B4M A;  5IAI A;  1NV4 A;  4QBA A;  5K2X A;  1LFI A;  4YB5 A;  4PP0 A;  3T9U A;  4JB7 A;  3O2A A;  3M8U A;  3WAE A;  1IQ7 A;  3S9N C;  2O1L A;  3S9E A;  3T96 B;  4FIM A;  3HO7 A;  2H99 A;  1NNF A;  3RTF B;  3IOW A;  5H8S A;  1DTZ A;  3KEI A;  4PET A;  2UYE A;  3RYA A;  2WEF A;  1A40 A;  1SDX A;  2HAU A;  1URD A;  4QFL A;  1BK4 A;  4G8H A;  1IXG A;  1DSN A;  4XKP A;  3EQ1 A;  4C0R A;  1NV2 A;  1JVX A;  1Y9U A;  4NF8 A;  2Z8D A;  4IR8 A;  3P7I A;  1ZIU A;  3FXR A;  2F34 A;  4Q5T A;  5J16 A;  4PFU A;  3LSF B;  2DE4 A;  3TCH A;  3QUF A;  2A5S A;  4GD5 A;  1TT1 A;  5CMM A;  5A5X A;  1MQD A;  1Y3N A;  4PFW A;  1ZU0 A;  1SW2 A;  4ELQ A;  2XXY A;  1YPN A;  4OEV A;  1FTA A;  3TYH A;  4DDD A;  1MM7 A;  3MP6 A;  2AIX A;  2DS9 A;  1N7X A;  4X1B A;  3QMF A;  1FTL A;  3V5A A;  4YMA A;  2HPG A;  4N81 A;  4GWW A;  2CMO A;  1B4H A;  1AIV A;  1XC1 A;  2F36 A;  4IGT A;  5A5X B;  3R26 A;  3MZ9 A;  2GHB A;  3JZJ A;  3SER A;  2XXW A;  3KJT A;  2V3T A;  3FGS A;  4YKP A;  4Q30 B;  5ET5 A;  2O69 A;  3TFL A;  2DVC A;  1G0I A;  1ZMG A;  3OO9 A;  3TTL A;  5IGA A;  4LAT A;  1JP4 A;  3T9X B;  3G3H A;  5B70 A;  2Q8J A;  1G0H A;  3CRB A;  5I2K B;  1FQF A;  4R6H A;  2ZYN A;  2A5T A;  5B7D A;  5ET7 A;  4GWX A;  3IO4 A;  4OVT A;  1IIT A;  4OXV A;  4NWD A;  4JBZ A;  1SI1 A;  4YIC A;  4GXS B;  5I59 B;  3MW0 A;  3TUS A;  3VVF A;  4TOZ A;  4KYD A;  4QRZ A;  5FHN A;  3OXN A;  3FXB A;  3VVD A;  1B58 A;  1PEB A;  3U1O A;  2XX9 A;  3TQW A;  4GWU A;  2NXO A;  3N26 A;  3HFU A;  5I56 B;  1H3D A;  3TOD A;  3TPA A;  2ESN A;  3I5O A;  4ZEB A;  1M5E A;  5A5L A;  5DW8 A;  1FQC A;  4G68 A;  2FNC A;  4MHF A;  3MP8 A;  3N94 A;  3ODB A;  4U4S A;  5CMK A;  3Q25 A;  2KQZ A;  3HV1 A;  2YLN A;  1B6H A;  1FBC A;  2X7Q A;  5I57 A;  4JWY A;  2Q8M A;  4FEB A;  4BDN A;  2FVZ A;  4ELO A;  3OMB A;  3JYR A;  2ONS A;  3G7W A;  4IY6 A;  3T22 A;  4PDH A;  4YB6 A;  1AMF A;  3USD A;  4KYE A;  3HHG A;  3PU5 A;  5ITP A;  4G2Z A;  1PBQ A;  4YMB A;  4F31 B;  4P0G A;  2ZYO A;  4F22 A;  1F9B A;  2R71 A;  1A7L A;  4LQ5 A;  3DLN A;  4U22 A;  4N13 A;  2ZMB A;  4NMY A;  2DSF A;  1US5 A;  2I3V A;  4O94 A;  4OEU A;  2CEY A;  1EH3 A;  4LON B;  4X04 A;  4IO4 A;  2V25 A;  1FPF A;  1YAE A;  1B3H A;  2XXV A;  1P1N A;  2NUV A;  3VXC A;  2DWI A;  4FAT A;  1Y4C A;  3PPO A;  5ICT A;  2WOL A;  5DVF A;  4HTG A;  5FHM A;  1D4N A;  3ILU B;  5CMC A;  3M3K A;  5F24 A;  4X48 A;  4ND9 A;  1MQH A;  1PB9 A;  4XKR A;  1P99 A;  4YKI A;  3B6W A;  3MVX A;  1NMU A;  4UA8 A;  1LLS A;  3MVZ A;  4RY1 A;  3QXM A;  3VVE A;  2NWJ A;  2VGQ A;  3VLW A;  3RT8 A;  5ISU A;  4O7M A;  5ET8 A;  3KOT A;  5JTY A;  2RKM A;  3LUY A;  3PPP A;  1JEU A;  2QRY A;  4U4X A;  4UAC A;  2I0C A;  1VFD A;  4GFR A;  1RYO A;  3K2D A;  2DOJ A;  3U72 A;  2FBP A;  4K3F A;  1A54 A;  3SEY A;  3RLF E;  2ONR A;  1M5D A;  4MEV A;  1H44 A;  1NL5 A;  3ZKK A;  5ELV A;  1OVT A;  5DYH A;  4F3S A;  5I84 A;  4N8G A;  3DM0 A;  4KD5 A;  3K00 A;  4EQ9 A;  4HW8 A;  5I57 B;  4EXL A;  1R9Q A;  4DXC A;  3RPL A;  4H1X A;  2IEE A;  1MQG A;  1LBV A;  4H0W A;  1B51 A;  4PDD A;  1N04 A;  3RTW B;  1D9Y A;  3DRI A;  2QJE A;  1Y20 A;  2PT2 A;  3W9V A;  3CVG A;  3H6T A;  2YPN A;  3C4M A;  5I59 A;  5AA1 A;  3SET A;  3QYT A;  1Y3P A;  1NKX A;  1NUY A;  3OSQ A;  4EF1 A;  1MY3 A;  4N8Y A;  5I58 A;  1B1X A;  5H8H A;  4PAF A;  2CZL A;  1MH3 A;  5L8D A;  3E4R A;  4YZZ A;  4HE1 A;  4OA4 A;  3PV0 E;  2ZNS A;  1VFE A;  5ET6 A;  4IGR A;  4R74 A;  3HST A;  3LSW A;  2V4C A;  3PD9 A;  5AE4 A;  1IUD A;  4RA1 A;  4FEC A;  3FJ7 A;  3E78 A;  5JEI A;  2AL5 A;  2A5T B;  1MXV A;  2F7B A;  1ZJL A;  3I3V A;  4G68 B;  1USY H;  2FA7 A;  4O3A A;  1WDN A;  4KR5 A;  2I48 A;  4NAP A;  1P1O A;  1SVX B;  3QK6 A;  1AH5 A;  2GFE A;  1LBC A;  1A99 A;  3MQ9 A;  1IXH A;  2UYF A;  5JTY B;  1LBX A;  3PUV E;  4M1V A;  1B3L A;  1DOT A;  3H03 A;  4FED A;  5T3J A;  3TTK A;  1PBP A;  2XA5 A;  4MCO A;  5K2Y A;  1Y1Z A;  2O6A A;  4X9T A;  4RJZ A;  4DI4 B;  2OLB A;  4TQU Q;  1LGB C;  5H8Q A;  5TPA B;  1FJ6 A;  4R6K A;  4MX6 A;  4KYS A;  5EYG A;  1TFA A;  1I6B A;  1SW5 A;  4ZEF A;  4DLD A;  1JW4 A;  1R9L A;  3B50 A;  1H45 A;  5I58 B;  4POW A;  1OIB A;  1YYZ A;  1NV5 A;  2ZYK A;  1N3X A;  1NV1 A;  1OLA A;  4OER A;  5L9M A;  1KWH A;  4DCY A;  4N6D A;  3A3C A;  5EQ9 A;  2WKY A;  1EZP A;  4FJP A;  4P3L A;  2R6G E;  2DXY A;  3KBZ A;  1DK4 A;  3S2V A;  4F1U A;  2OX3 A;  4ONY A;  2Y7R A;  1LAX A;  3E13 X;  4MLQ A;  1SBP A;  3PPN A;  2I4C A;  4LUB A;  4I40 A;  2VT5 A;  3PTY A;  3V89 B;  1MQI A;  3IOU A;  3K1N A;  4OAN A;  4F3G A;  1MQJ A;  4NF4 B;  4P56 A;  3MST A;  4RXL A;  2F35 A;  5TPA A;  3KN8 A;  1NNT A;  1O7T A;  3OEL A;  4R6Y A;  2DXR A;  3FUZ A;  2F78 A;  1QGX A;  3ISP A;  3O66 A;  3LC8 A;  4GWS A;  2H98 A;  3FVK A;  1LFH A;  1B3G A;  1SW4 A;  4F2O A;  4G8N A;  1FJ9 A;  2H4I A;  1NNP A;  1PC3 A;  4OVJ A;  3PUY E;  1QW0 A;  4U2R A;  1IMA A;  3OEN A;  1Y1M A;  4H67 A;  3RY3 A;  5BWJ A;  1M5C A;  3DRF A;  1QJM A;  3SES A;  2ZXT A;  2E1S A;  3IB0 A;  1Q1K A;  3CG3 A;  3HCQ A;  4P11 A;  2GHA A;  4G68 C;  3U93 A;  5F1Q A;  4HE2 A;  3GXA A;  5EYF A;  1SW1 A;  2PX1 A;  4ZDM A;  2M8C A;  4GF8 A;  2UXA A;  4PC9 A;  2ANJ A;  5AA2 B;  2P0S A;  3KFM A;  2BJJ X;  4E0X A;  1BLF A;  3FJM A;  1Z7M E;  3OSR A;  4XTC Q;  5FBP A;  3M3L A;  4C1U A;  4GRK A;  4PE3 A;  1P1U A;  4DZ1 A;  5EHM A;  3PD8 A;  2REG A;  2GQ1 A;  1POY 1;  3VXB A;  4NF5 A;  3FZV A;  2QVR A;  2I4B A;  5H8F A;  2DYX A;  2NOO A;  2O7U A;  3FV2 A;  1RDY A;  2Y7W A;  4EQB A;  2F7C A;  3KJ7 A;  2XD2 A;  4RYA A;  4YU0 A;  1JNF A;  4PGN A;  3QAX A;  3E79 A;  4F1V A;  4MLV A;  1MRP A;  3VV5 A;  1L5T A;  3ZS6 A;  1B3F A;  3TTM A;  2XXT A;  1FQB A;  1A55 A;  3HHF A;  2XXU A;  2HCA A;  4O8M A;  3O6P A;  1JW5 A;  4QFO A;  4OVQ A;  3TEL A;  3O9P A;  3ZSF A;  2AL4 A;  3IOT A;  3TTR A;  3CFL A;  2QL3 A;  5TP9 A;  1ZBM A;  4GQO A;  1FPD A;  3UN6 A;  4RPO A;  4U1Z A;  4OVS A;  3DRK A;  1ZLQ A;  3H4Z A;  4YAH X;  3F11 A;  5EQA A;  3IJX B;  2UVJ A;  4AS4 A;  5IZZ A;  4QHQ A;  4QFK A;  4AB5 A;  2XWK A;  4WEP A;  1NV6 A;  1FRP A;  1RKM A;  3THI A;  2I0B A;  3B7D A;  1FQD A;  3CHG A;  1O63 A;  3MUQ A;  4L17 A;  2XD3 A;  1JW1 A;  2HQ0 A;  2QVU A;  1NFT A;  4N4U A;  3TCF A;  4KXP A;  3CFZ A;  4GL0 A;  1Z7N E;  3GLB A;  4P1L A;  3BBR A;  1XHY A;  2PBW A;  1FPE A;  2PYY A;  4KI0 E;  2P1S A;  5AA2 A;  3CSG A;  5M2V A;  4EXK A;  3K6V A;  1D9V A;  1VSO A;  3WAF A;  1PB8 A;  3R6U A;  2PVU A;  1WOD A;  1OVB A;  3CSB A;  3MWB A;  1IZ1 A;  1Y3Q A;  3K6X A;  3OO6 A;  1UQW A;  4IO3 A;  2PT1 A;  3FJG A;  1XVX A;  4OTE A;  4ESW A;  2XXI A;  4RK9 A;  1MXY A;  3MC2 A;  1N3W A;  1N76 A;  5H8F B;  5ESY A;  4H5G A;  1I69 A;  5IZ1 A;  3RPW A;  3Q27 A;  3GYY A;  2Y84 A;  2XHD A;  4YKK A;  4PE5 B;  3G3F A;  1QUJ A;  3CIJ A;  4KCD A;  4JVC A;  4F3B A;  1TFD A;  4GLI A;  2WYK A;  3AXF A;  3K6W A;  3K01 A;  3FVO A;  1B0L A;  1KA0 A;  4KQP A;  1FTJ A;  3UGW A;  3T1B A;  1LBB A;  3E9X A;  3BIH A;  2H5Y A;  4FBP A;  4Q0C A;  4N15 A;  3U92 A;  3KC1 A;  3VDF A;  4JVI A;  3EHT A;  1URS A;  4LZ5 A;  4MIJ A;  2QMW A;  4NF4 A;  4MNI A;  4JVD A;  1LCT A;  3G3K A;  5ITO A;  3MBP A;  4RK2 A;  1B1H A;  3D1R A;  3FXQ A;  4F39 A;  3OEK A;  3MZ1 A;  1MY2 A;  4Z0I A;  3QUJ A;  4BDL A;  4MNC A;  3T9H B;  4OVP A;  3IAZ A;  1S7Y A;  4OWD A;  5DTB A;  3FV1 A;  4IO7 A;  4LVQ A;  2FHY A;  3PUZ E;  4HCY A;  1XOC A;  4EF2 A;  4YKJ A;  4F2Q A;  2ZYM A;  2PCR A;  2FIX A;  1LEV A;  4GXA A;  2Y7P A;  2F5X A;  3SEX A;  4H65 A;  1DPP A;  1NV0 A;  2VHA A;  5DVI A;  1LB8 A;  4PQJ A;  4H45 A;  3IFC A;  3FVG A;  5EQ7 A;  5LOM A;  4ZED A;  4GBW A;  3PUX E;  4H46 A;  2QSX A;  4ESX A;  5CMB A;  4GBV A;  2F3D A;  4PBH A;  1M5B A;  4MMP A;  3SZP A;  2OBG A;  4NF6 B;  2KLF A;  1KZ8 A;  3KN3 A;  4I3Y A;  3PUW E;  4U23 A;  1LB9 A;  5CC2 A;  3EHU A;  2I49 A;  4H6D A;  1JET A;  5H8N B;  1S9T A;  4C1T A;  3K1P A;  3FD3 A;  2DDK A;  3UK4 A;  3MVY A;  4KHZ E;  3RGY A;  3O6I A;  3PMW A;  3G3I A;  2WBD A;  4F1Y A;  4P9K A;  4FAJ A;  3L6H A;  3B6T A;  3OEM A;  3RT6 B;  4NE4 A;  4POX A;  4KPT A;  1FQE A;  4QSE A;  1KA1 A;  3DP6 A;  3LSX A;  3K4U A;  5KDT A;  4LN5 A;  1GVC A;  4I1D A;  2IA4 A;  1NNK A;  5KDT B;  3B6Q A;  4PFB A;  4N07 A;  3JV9 A;  4F18 A;  4O3C A;  3N6T A;  1N84 A;  2ONK E;  3IOV A;  1LFG A;  3PAM A;  4GL8 A;  4BDQ A;  2H9B A;  4GOT A;  1VE4 A;  1SI0 A;  4I8C A;  4R2F A;  3Q26 A;  4NG7 A;  1OQH A;  3LUZ A;  1USY E;  4THI A;  1B7H A;  3H6U A;  3FAT A;  1MM6 A;  3HN0 A;  1URG A;  2L5V A;  5IZ3 B;  2VP1 A;  4MAG A;  4BDM A;  1AOV A;  4IY5 A;  3SEU A;  3IO6 A;  3PMX A;  4NWC A;  4R9F A;  3DRJ A;  5FHO A;  2Q74 A;  2THI A;  4O3B A;  3TTN A;  2O1M A;  1MS7 A;  1GV8 A;  2G29 A;  5H8Q B;  2UVH A;  4LZ7 A;  4IO6 A;  1FPI A;  1B7Z A;  3S9M C;  1LCF A;  1FPG A;  2XXX A;  1TWY A;  1FBH A;  2XXH A;  3N6U A;  2HZL A;  3QIM A;  1B9J A;  3OO7 A;  3T0J A;  3TZA A;  1MXW A;  1MY1 A;  4MJO A;  4PAK A;  1QVS A;  2CZK A;  3TDJ A;  3V83 A;  1B5I A;  1B5J A;  1GTK A;  3B8B A;  1RDX A;  4F19 A;  5I2N A;  1D3K A;  3CG1 A;  3S4U A;  1O64 A;  5IM2 A;  2P3V A;  5CI5 A;  4R9G A;  1XS5 A;  3MZB A;  2WYP A;  1IXC A;  2F6G A;  2Y5K A;  4WXJ A;  3H06 B;  4MFI A;  1MXU A;  2XWV A;  4PAI A;  4N17 A;  5F7V A;  3Q29 A;  4GX4 A;  1NV7 A;  4DE8 A;  4F29 A;  3DP4 A;  1FBE A;  2Y7K A;  2I58 A;  5TP9 B;  4XIG Q;  2RC9 A;  4OMB A;  1JEV A;  4JWO A;  4NN3 A;  1NH8 A;  2MKZ A;  2V93 A;  2GRV A;  3VFJ A;  2REJ A;  2F7A A;  2XXP A;  3LV0 A;  4OVR A;  4KCC A;  1NUZ A;  4OYV A;  4NTL A;  3KSX A;  2W7Y A;  4RPN A;  1NUX A;  3IOR A;  3C32 A;  1H43 A;  3UIF A;  3C35 A;  1YZ0 A;  1B7U A;  1DBZ A;  3K6U A;  3U94 A;  4ECF A;  1SYH A;  1MY4 A;  4NED A;  2Q2C A;  3FTO A;  3KC0 A;  1P1Q A;  4ZZA A;  5IKB A;  2X26 A;  3ECR A;  3BKI B;  4ELP A;  1ELJ A;  1B05 A;  2OWT A;  1LAH E;  3CFX A;  3EKI A;  3RQT A;  2I3W A;  3TKD A;  1MG1 A;  5I7I A;  4OQO A;  1UIV A;  2LAO A;  4NGU A;  2RC8 A;  3VE1 B;  4XXU A;  4FOR A;  5TU0 A;  1N7W A;  2HZK A;  4QSD A;  1IEJ A;  3ILT B;  4I9D A;  3SEV A;  3O6H A;  3MPL A;  1EZ9 A;  3EF7 A;  4P47 A;  1J1N A;  3PGF A;  4DI3 D;  1FBP A;  1S50 A;  4TLM B;  4UAB A;  2OWZ A;  2QFL A;  3UOR A;  1ZKB A;  4WED A;  3MJN A;  5H8H B;  5HBC A;  2OCU A;  1B40 A;  4NF8 B;  2PFY A;  1UTB A;  2OJT A;  3PPQ A;  1B32 A;  3UA8 A;  4HXV A;  1CE2 A;  3T66 A;  3C31 A;  3QSL A;  3PPR A;  2VD3 A;  5EYH A;  2XXQ A;  5DEX A;  3RYB A;  4ZS9 A;  4MH5 A;  4YB7 A;  2NVU B;  4Q8R A;  4P0I A;  4N6K A;  4XEQ A;  4AB6 A;  2D5W A;  4X1D A;  5LTC A;  1B46 A;  1FBF A;  3CI8 A;  1FBG A;  4ZE8 A;  2VPO A;  3O28 A;  1FTO A;  3IK6 B;  3OO8 A;  2DWH A;  1IIW A;  4BDR A;  2Q89 A;  1FSA A;  5DEX B;  2DE2 A;  1K9Z A;  1FCK A;  4FE8 A;  5J1D A;  4PBQ A;  2WOP A;  3ZKL A;  4G8M A;  1DTG A;  3T9V A;  3BFU A;  1UIU A;  2Q9T A;  3RPL B;  4NX1 A;  2XXR A;  3MPK A;  4ZEC A;  3NOH A;  4BDO A;  2D21 A;  2ALU A;  1PDA A;  4ZE9 A;  3W9W A;  5CM6 A;  4MF3 A;  5DT6 A;  5DVJ A;  4U21 A;  3RYD A;  2DVZ A;  3GBA A;  4LP2 B;  3IB2 A;  1RYX A;  3DRG A;  4G61 A;  4OES A;  1MPD A;  4XKQ A;  4M4G A;  1HSE A;  3GBB A;  4N91 A;  3HPI A;  1BIY A;  3E3K A;  4H8J A;  5AA4 A;  2V3U A;  3UP9 A;  4I3E A;  2JJK A;  3EN3 A;  2Z22 A;  3KGC A;  2RIN A;  2B3F A;  1FPB A;  2WOK A;  3A3U A;  1VDW A;  3LSL A;  3H6V A;  1JQF A;  4XKN A;  1DPE A;  1M5F A;  2X7P A;  1R1N A;  1HSJ A;  1SQY A;  3SEW A;  2DP8 A;  1LBW A;  1P1W A;  1HSL A;  1UTH A;  4AQ4 A;  1FTK A;  3S9L C;  2KR0 A;  2UVI A;  4LA9 A;  2QPQ A;  3Q28 A;  2XX8 A;  3FBP A;  4OET A;  3BFT A;  3H7M A;  1GGG A;  5I2K A;  1LBZ A;  2HEU A;  2RCA A;  1D9Q A;  3TMG A;  3IX1 A;  3EPE A;  1H76 A;  1YXI A;  1IMC A;  5HM4 B;  5AA2 D;  4DXB A;  2QVV A;  3LBS A;  5FTI A;  2FYI A;  2AYS A;  4O7I A;  3D4C A;  3ONM A;  1IMF A;  5AA3 A;  4GWO A;  2XWO A;  3W15 C;  4GWZ A;  3FVN A;  5KCJ A;  1EYK A;  1BKA A;  4NQ8 A;  4OHN A;  4OEN A;  3C33 A;  2P3N A;  3VLU A;  2RF1 A;  5I3S A;  4I62 A;  4R2B A;  1B3E A;  4RNS A;  1II5 A;  1CB6 A;  4GWY A;  5L9S A;  1B52 A;  5LDZ A;  1IME A;  1EU8 A;  1MDP 1;  4PF6 A;  4P8B A;  3FAS A;  1NI9 A;  3D4G A;  4PFR A;  1LAG E;  1R6Z A;  2Z8F A;  4JDF A;  3N5L A;  4PTK A;  1OLC A;  4DCX A;  5EHS A;  1MXX A;  2O68 A;  3OOA A;  4U1O A;  1VR5 A;  1EYI A;  1B2H A;  2CZI A;  2ZZV A;  1ATG A;  5H8N A;  4OFO A;  1OMP A;  3TEP A;  3DP8 A;  4ZEK A;  3KG2 A;  3C9H A;  4NF0 A;  2VPN A;  5JK4 A;  3TCG A;  2OWS A;  2BJI A;  3FIR A;  2GH9 A;  3C34 A;  1YCJ A;  4LQ2 A;  2Q2A A;  3BIG A;  1US4 A;  3C36 A;  3IJO B;  5KCJ B;  4PFT A;  3IB1 A;  4R72 A;  4JSO A;  3ROJ A;  4F3P A;  3O97 A;  1AL3 A;  3RNN A;  4AS5 A;  2ZZW A;  2UVG A;  4H8I A;  4QFN A;  5ICQ A;  2DQV A;  1EZO A;  1MDQ A;  1Q35 A;  1XT8 A;  1FBD A;  2XWI A;  2B65 A;  1RDZ A;  3KN7 A;  3CR9 A;  1I6A A;  2PFZ A;  1AWB A;  3KZG A;  2O84 X;  1UTH B;  4OFL A;  1SD3 A;  1ZTY A;  4IO2 A;  2OK2 A;  2O7I A;  3H6W A;  5CBS A;  3H3G A;  4HCW A;  1FQA A;  4JWX A;  4JXI A;  3TAJ A;  1GR2 A;  3LR1 A;  3K1M A;  4GVO A;  4PCD A;  1OQG A;  1QUL A;  1NUW A;  2HXR A;  3LVU A;  4WKM A;  3TQL A;  4PFI A;  3K02 A;  4GIZ A;  1JVY A;  2V3Q A;  3T93 B;  3M3F A;  3V8X B;  3DEL B;  4IB2 A;  1CNQ A;  4N6P A;  3L6G A;  3R7X A;  2DE3 A;  2V84 A;  1PB7 A;  1FTM A;  3KSJ A;  5CBR A;  2YJP A;  3G3G A;  1QUI A;  4NHB A;  2F8D A;  3SKP A;  2O51 A;  2WBB A;  4XF5 A;  2ZNT A;  1B4Z A;  4PF8 A;  4HE0 A;  4ZZE A;  1QUK A;  3GZG A;  5AA4 B;  2I6E A;  4XFE A;  4R75 A; 
#chains in the Genus database with same CATH homology
 5ISU A;  1NH7 A;  3DRH A;  3ECR A;  3RUM A;  4E0W A;  3DRK A;  2D3I A;  3G3J A;  1WVJ A;  4BLA A;  1ZLQ A;  2Z8E A;  3BKI B;  3H4Z A;  3KOT A;  3F11 A;  4YAH X;  3IJX B;  4ELP A;  1ELJ A;  5JTY A;  2UVJ A;  2RKM A;  3LUY A;  3PPP A;  1B05 A;  2OWT A;  2H25 A;  4QHQ A;  1JEU A;  2QRY A;  4QFK A;  2VD2 A;  4U4X A;  1LAH E;  4UAC A;  2I0C A;  1VFD A;  3CFX A;  4AB5 A;  3RQT A;  4GFR A;  1A8F A;  1RYO A;  2E0S A;  3K0V A;  3K2D A;  4WEP A;  4Z7E A;  2DOJ A;  1A8E A;  2HAV A;  2I3W A;  4H5F A;  3U72 A;  4TLL B;  3TKD A;  4EDP A;  4ELR A;  5I2N B;  1RKM A;  2DWA A;  1QKB A;  1DMB A;  1MG1 A;  2PMS A;  4PFY A;  3THI A;  2I0B A;  1BP5 A;  3B7D A;  1UIV A;  2LAO A;  4G77 A;  4OQO A;  1FQD A;  2RC8 A;  3VE1 B;  4XXU A;  2HFB A;  4FOR A;  1LST A;  4JB7 A;  5TU0 A;  3CHG A;  2HXW A;  1N7W A;  2HZK A;  1A54 A;  1O63 A;  4K3F A;  4QSD A;  1B0H A;  3MUQ A;  1IEJ A;  4L17 A;  2XD3 A;  3ILT B;  3RLF E;  1JW1 A;  2ONR A;  1M5D A;  3SEY A;  4I9D A;  5FTH A;  1UTB B;  2HQ0 A;  3SEV A;  3O6H A;  1NFT A;  1SYI A;  3MPL A;  1H44 A;  1NL5 A;  2RCB A;  1EZ9 A;  3TCF A;  3IL1 B;  3ZKK A;  3CFZ A;  3EF7 A;  4GL0 A;  4QSC A;  5ELV A;  1OVT A;  1J1N A;  4DXU A;  1Z7N E;  3GLB A;  3PGF A;  5DYH A;  1S50 A;  3BBR A;  4F3S A;  5I84 A;  1XVY A;  1MPB A;  3KOS A;  1XHY A;  2QS3 A;  2PBW A;  4TLM B;  3UOR A;  4ZEI A;  2PYY A;  1ZKB A;  4WED A;  2P1S A;  3DM0 A;  3MJN A;  4KI0 E;  5AA2 A;  3CSG A;  5H8H B;  5M2V A;  4EXK A;  4KD5 A;  5HBC A;  3K00 A;  5CRY A;  4ISU A;  3O29 A;  1FW0 A;  1D9V A;  1VSO A;  2OCU A;  3K6V A;  2OZZ A;  2Q88 A;  1B40 A;  4G4P A;  3WAF A;  4EQ9 A;  4EQ7 A;  4HW8 A;  1PB8 A;  1YTV A;  1T0K A;  3R6U A;  5I57 B;  2PVU A;  4JSD A;  4NF8 B;  1N0T A;  1WOD A;  1OVB A;  2RC7 A;  3CSB A;  3MWB A;  2QS2 A;  1IZ1 A;  4EXL A;  1Y3Q A;  3FXU A;  3K6X A;  3RT8 A;  4HS7 A;  1R9Q A;  1UTB A;  2OJT A;  1B32 A;  2QS1 A;  3OO6 A;  1UQW A;  3PPQ A;  3VLV A;  1TXF A;  4H1X A;  4DXC A;  5BUU A;  4IO3 A;  2PT1 A;  3FJG A;  1XVX A;  4OTE A;  3RN8 A;  2IEE A;  2XXI A;  4RK9 A;  3UA8 A;  4ESW A;  1MXY A;  3MC2 A;  1CE2 A;  1N3W A;  1MQG A;  3PMV A;  1N76 A;  4H0W A;  1B51 A;  3T66 A;  3MAM A;  3C31 A;  5H8F B;  5KCJ B;  4H5G A;  4KFQ A;  1I69 A;  1N04 A;  3RTW B;  3QSL A;  1D9Y A;  4EUO A;  3RPW A;  3PPR A;  2B3B A;  3DRI A;  2QJE A;  2VD3 A;  1Y20 A;  2XXQ A;  3Q27 A;  2PT2 A;  2Y84 A;  5DEX A;  3W9V A;  3I6V A;  2XHD A;  3RYB A;  4ZS9 A;  4MH5 A;  3CVG A;  4YB7 A;  4YKK A;  2NVU B;  4PE5 B;  3H6T A;  3G3F A;  2YPN A;  2G93 A;  1QUJ A;  3C4M A;  3CIJ A;  4Q8R A;  4OFJ A;  4P0I A;  4KCD A;  5I59 A;  5AA1 A;  4F3B A;  3O6G A;  4AB6 A;  2QS4 A;  1TFD A;  4GLI A;  3SET A;  4OZ9 A;  3QYT A;  1Y3P A;  1NKX A;  4NF6 A;  2P2A A;  3AXF A;  3K01 A;  2D5W A;  3K6W A;  4X1D A;  3FVO A;  1B0L A;  2F97 A;  4KQP A;  1B46 A;  3CI8 A;  3EHS A;  3OSQ A;  1B5H A;  4ZE8 A;  3IR1 A;  3O28 A;  1FTO A;  1IXI A;  4EF1 A;  1FTJ A;  1POT A;  1ANF A;  3SDF A;  3IK6 B;  1I6Q A;  1MPC A;  1MY3 A;  3OO8 A;  3USD A;  3UGW A;  4BDM A;  4DIG A;  1LBB A;  2DWH A;  1IIW A;  4BDR A;  5I58 A;  1MY0 A;  2Q89 A;  5DEX B;  1B1X A;  5H8H A;  3E9X A;  2CZL A;  1MH3 A;  2H5Y A;  2QMX A;  5L8D A;  3A09 A;  3E4R A;  4YZZ A;  3KBR A;  4Q0C A;  3PV0 E;  2DE2 A;  2ZNU A;  3U92 A;  2ZNS A;  1FCK A;  1MH4 A;  4FE8 A;  5J1D A;  2WOP A;  3OD7 A;  3VDF A;  3MP1 A;  1VFE A;  4R73 A;  2ABH A;  3EHT A;  1URS A;  2DWJ A;  3ZKL A;  4G8M A;  4IGR A;  5L9O A;  4LZ5 A;  1DTG A;  4NF5 B;  3T9V A;  3BFU A;  4R74 A;  4LZ8 A;  4QF9 A;  1UIU A;  2Q9T A;  3HST A;  2QMW A;  3T9U A;  3LSW A;  3PD9 A;  5AE4 A;  4NF4 A;  1IUD A;  2XXR A;  4QFP A;  4RA1 A;  3MPK A;  4IO5 A;  4FEC A;  1LCT A;  4ZEC A;  4BDO A;  3G3K A;  5ITO A;  5KZT A;  1BTJ A;  3FJ7 A;  2D21 A;  4MBP A;  5JEI A;  2B4L A;  2AL5 A;  2A5T B;  1MXV A;  2ALU A;  5I56 A;  2F7B A;  3MBP A;  2R9J A;  3MVW A;  4RK2 A;  3VXB A;  1PDA A;  1Y4T A;  5HPQ A;  1B1H A;  4ZE9 A;  1LAF E;  1ZJL A;  3I3V A;  4G68 B;  3W9W A;  3FXQ A;  5CM6 A;  1QKA A;  4MF3 A;  4F3P A;  3U8Q A;  1MXZ A;  1USY H;  2Y7I A;  2FA7 A;  2XX7 A;  4U21 A;  2VOZ A;  3OEK A;  4O3A A;  2F6P A;  5DT6 A;  3MZ1 A;  2Z23 A;  5DVJ A;  2B4M A;  1WDN A;  1MY2 A;  4KR5 A;  5K2X A;  5IAI A;  1LFI A;  4Z0I A;  2I48 A;  4YB5 A;  4PP0 A;  2DVZ A;  3GBA A;  3O2A A;  1P1O A;  1SVX B;  3IB2 A;  1AH5 A;  3QK6 A;  3QUJ A;  3M8U A;  1RYX A;  3DRG A;  1LBC A;  4OES A;  2GFE A;  1A99 A;  4BDL A;  3MQ9 A;  1IXH A;  4XKQ A;  1MPD A;  2UYF A;  4M4G A;  5JTY B;  1HSE A;  3WAE A;  3GBB A;  3T9H B;  1IQ7 A;  3HPI A;  3PUV E;  4M1V A;  3S9N C;  3IAZ A;  1BIY A;  1B3L A;  1S7Y A;  1DOT A;  3E3K A;  4H8J A;  4OWD A;  5DTB A;  3FV1 A;  3H03 A;  2O1L A;  4FED A;  4IO7 A;  5AA4 A;  3S9E A;  2V3U A;  3T96 B;  4LVQ A;  3UP9 A;  4FIM A;  3HO7 A;  3EN3 A;  2H99 A;  2Z22 A;  3KGC A;  1PBP A;  1NNF A;  2RIN A;  3IOW A;  3PUZ E;  4HCY A;  5H8S A;  1DTZ A;  1XOC A;  3RTF B;  4YKJ A;  4EF2 A;  2B3F A;  2ZYM A;  3KEI A;  4PET A;  4F2Q A;  2WOK A;  2UYE A;  3RYA A;  1Y1Z A;  2O6A A;  4GXA A;  1A40 A;  1SDX A;  3A3U A;  3LSL A;  4RJZ A;  2HAU A;  4X9T A;  3H6V A;  2OLB A;  4XKN A;  1JQF A;  1URD A;  1DPE A;  4TQU Q;  4QFL A;  1LGB C;  2Y7P A;  5H8Q A;  2F5X A;  1M5F A;  5TPA B;  2X7P A;  1R1N A;  1HSJ A;  1SQY A;  4H65 A;  4R6K A;  3SEX A;  3TTK A;  1DPP A;  2VHA A;  4G8H A;  1IXG A;  5DVI A;  4KYS A;  3SEW A;  1DSN A;  1P1W A;  1TFA A;  2DP8 A;  1HSL A;  1UTH A;  1I6B A;  4XKP A;  3EQ1 A;  4AQ4 A;  1LB8 A;  1FTK A;  4PQJ A;  3S9L C;  4C0R A;  1SW5 A;  2UVI A;  4ZEF A;  4LA9 A;  3FVG A;  4DLD A;  2QPQ A;  1JVX A;  1Y9U A;  1JW4 A;  3Q28 A;  4NF8 A;  2XX8 A;  2Z8D A;  1R9L A;  4OET A;  3P7I A;  5LOM A;  3BFT A;  1ZIU A;  3H7M A;  3FXR A;  1GGG A;  4ZED A;  1H45 A;  2F34 A;  5I58 B;  4POW A;  4Q5T A;  1OIB A;  5I2K A;  4PFU A;  3LSF B;  2HEU A;  2DE4 A;  3PUX E;  3TCH A;  2RCA A;  2QSX A;  3QUF A;  4ESX A;  2A5S A;  4GD5 A;  5CMB A;  2ZYK A;  1N3X A;  1OLA A;  4OER A;  1TT1 A;  5CMM A;  3TMG A;  1M5B A;  3IX1 A;  2OBG A;  5L9M A;  1KWH A;  1MQD A;  1Y3N A;  3EPE A;  4NF6 B;  5A5X A;  1H76 A;  2KLF A;  4DCY A;  5CBR A;  4PFW A;  3A3C A;  3KN3 A;  5HM4 B;  1ZU0 A;  5AA2 D;  4DXB A;  1SW2 A;  4ELQ A;  3LBS A;  2XXY A;  3VLW A;  1YPN A;  3PUW E;  4OEV A;  4LP2 B;  1LB9 A;  4U23 A;  5FTI A;  3TYH A;  2WKY A;  4DDD A;  5CC2 A;  3EHU A;  1MM7 A;  1EZP A;  2I49 A;  2FYI A;  4FJP A;  4H6D A;  3MP6 A;  2AYS A;  1JET A;  2AIX A;  2DS9 A;  1N7X A;  5H8N B;  4X1B A;  2R6G E;  3D4C A;  1S9T A;  2DXY A;  4C1T A;  1FTL A;  3K1P A;  3ONM A;  3V5A A;  4YMA A;  3FD3 A;  5AA3 A;  4GWO A;  3S2V A;  3W15 C;  4F1U A;  3UK4 A;  3MVY A;  4KHZ E;  2CMO A;  3RGY A;  3O6I A;  3PMW A;  1B4H A;  3G3I A;  3FVN A;  5KCJ A;  1AIV A;  4ONY A;  4F39 A;  2Y7R A;  1LAX A;  1XC1 A;  2F36 A;  4IGT A;  4F1Y A;  5A5X B;  4FAJ A;  1BKA A;  3R26 A;  3MZ9 A;  3L6H A;  3E13 X;  2GHB A;  4MLQ A;  3B6T A;  3JZJ A;  3OEM A;  2XXW A;  3SER A;  1SBP A;  4OHN A;  3KJT A;  2I4C A;  3C33 A;  2V3T A;  3FGS A;  3PPN A;  4LUB A;  4OEN A;  4YKP A;  3RT6 B;  4NE4 A;  4Q30 B;  3VLU A;  3V89 B;  2O69 A;  2RF1 A;  4POX A;  3TFL A;  4I62 A;  1FQE A;  1B3E A;  4KPT A;  4QSE A;  4R2B A;  2DVC A;  1ZMG A;  1MQI A;  3DP6 A;  3IOU A;  3OO9 A;  3LSX A;  3K4U A;  3S4U A;  3TTL A;  3K1N A;  5KDT A;  4F3G A;  4RNS A;  4LAT A;  1MQJ A;  3T9X B;  3G3H A;  1GVC A;  1II5 A;  1CB6 A;  4I1D A;  2IA4 A;  1B52 A;  1NNK A;  4NF4 B;  5B70 A;  5L9S A;  2Q8J A;  1EU8 A;  5KDT B;  1MDP 1;  3B6Q A;  4RXL A;  4N07 A;  3CRB A;  2F35 A;  3FAS A;  3JV9 A;  1FQF A;  5I2K B;  4R6H A;  2ZYN A;  2A5T A;  5TPA A;  5B7D A;  3KN8 A;  1NNT A;  1O7T A;  4F18 A;  3D4G A;  3OEL A;  3N6T A;  4O3C A;  4R6Y A;  1N84 A;  2DXR A;  2ONK E;  3IO4 A;  1IIT A;  1LFG A;  3IOV A;  3FUZ A;  1LAG E;  4OXV A;  3PAM A;  4NWD A;  1R6Z A;  2Z8F A;  2F78 A;  4GL8 A;  4BDQ A;  4JDF A;  3N5L A;  4JBZ A;  1SI1 A;  2H9B A;  4GOT A;  1VE4 A;  4YIC A;  4GXS B;  4E0X A;  1SI0 A;  4I8C A;  4R2F A;  1OLC A;  5I59 B;  4DCX A;  3Q26 A;  5EHS A;  1MXX A;  2O68 A;  3MW0 A;  3TUS A;  1OQH A;  3OOA A;  4U1O A;  3VVF A;  1VR5 A;  4TOZ A;  4KYD A;  4QRZ A;  3O66 A;  3LC8 A;  5FHN A;  2H98 A;  3OXN A;  1B2H A;  3FVK A;  1USY E;  1LFH A;  4THI A;  1B3G A;  1SW4 A;  1B7H A;  1ATG A;  3VVD A;  3H6U A;  3FAT A;  4OFO A;  1MM6 A;  1B58 A;  1OMP A;  5H8N A;  1PEB A;  4F2O A;  3DP8 A;  3HN0 A;  1URG A;  3TEP A;  4G8N A;  2XX9 A;  3U1O A;  4ZEK A;  3KG2 A;  3TQW A;  3C9H A;  2H4I A;  1NNP A;  2VP1 A;  1PC3 A;  5JK4 A;  3TCG A;  2NXO A;  2OWS A;  3N26 A;  3FIR A;  1QW0 A;  3PUY E;  4IY5 A;  2GH9 A;  4OVJ A;  3C34 A;  3IO6 A;  1YCJ A;  4U2R A;  3PMX A;  3SEU A;  5I56 B;  4NWC A;  4R9F A;  1H3D A;  4LQ2 A;  3TOD A;  3DRJ A;  1Y1M A;  2Q2A A;  3OEN A;  3TPA A;  1US4 A;  5FHO A;  3C36 A;  2ESN A;  3I5O A;  4ZEB A;  1M5E A;  4H67 A;  3RY3 A;  5BWJ A;  3IJO B;  1M5C A;  2THI A;  4O3B A;  3DRF A;  1FQC A;  1QJM A;  4G68 A;  3TTN A;  4PFT A;  2FNC A;  2O1M A;  1MS7 A;  3IB1 A;  4JSO A;  3MP8 A;  3N94 A;  2ZXT A;  4R72 A;  2G29 A;  1GV8 A;  3SES A;  2E1S A;  3O97 A;  3IB0 A;  3ODB A;  1AL3 A;  4U4S A;  1Q1K A;  3CG3 A;  5H8Q B;  3HCQ A;  2UVH A;  3Q25 A;  4LZ7 A;  3RNN A;  4IO6 A;  3HV1 A;  5CMK A;  2UVG A;  4H8I A;  4QFN A;  5ICQ A;  2YLN A;  2DQV A;  4P11 A;  2GHA A;  4G68 C;  1EZO A;  1B6H A;  3U93 A;  5F1Q A;  1B7Z A;  1MDQ A;  3S9M C;  2X7Q A;  1LCF A;  2XXX A;  5I57 A;  3GXA A;  5EYF A;  1SW1 A;  1TWY A;  1Q35 A;  2PX1 A;  1XT8 A;  2M8C A;  4JWY A;  4GF8 A;  4ZDM A;  2XXH A;  2UXA A;  3N6U A;  4FEB A;  3KN7 A;  2HZL A;  2B65 A;  3QIM A;  4BDN A;  2ANJ A;  3CR9 A;  4ELO A;  1B9J A;  1I6A A;  3OO7 A;  3OMB A;  3JYR A;  5AA2 B;  2ONS A;  3TZA A;  1MXW A;  3KZG A;  3G7W A;  2O84 X;  1UTH B;  2P0S A;  1MY1 A;  4IY6 A;  3T22 A;  4YB6 A;  3KFM A;  4OFL A;  1AMF A;  1QVS A;  1SD3 A;  2BJJ X;  1ZTY A;  1BLF A;  4IO2 A;  3HHG A;  4KYE A;  3FJM A;  3TDJ A;  3PU5 A;  2OK2 A;  2O7I A;  1Z7M E;  3H6W A;  3OSR A;  4XTC Q;  5CBS A;  5ITP A;  3M3L A;  4C1U A;  3V83 A;  3H3G A;  4G2Z A;  1B5I A;  1B5J A;  4GRK A;  4HCW A;  1PBQ A;  1FQA A;  4JWX A;  1GTK A;  1P1U A;  4YMB A;  4JXI A;  4DZ1 A;  4F19 A;  5EHM A;  5I2N A;  4F31 B;  1D3K A;  3PD8 A;  3CG1 A;  4P0G A;  2ZYO A;  3TAJ A;  1F9B A;  2R71 A;  1A7L A;  1POY 1;  1GR2 A;  1O64 A;  2REG A;  3LR1 A;  4LQ5 A;  3FZV A;  4NF5 A;  5CI5 A;  3DLN A;  4R9G A;  4U22 A;  1XS5 A;  3MZB A;  2I4B A;  4N13 A;  2ZMB A;  2DYX A;  3K1M A;  2NOO A;  4NMY A;  2O7U A;  4GVO A;  2DSF A;  5H8F A;  1IXC A;  1OQG A;  1US5 A;  2F6G A;  2I3V A;  3FV2 A;  2Y7W A;  1QUL A;  4WXJ A;  2F7C A;  3KJ7 A;  4EQB A;  3H06 B;  3LVU A;  4MFI A;  4OEU A;  2XD2 A;  4RYA A;  1MXU A;  1EH3 A;  4LON B;  4YU0 A;  4WKM A;  4IO4 A;  3TQL A;  3K02 A;  2V25 A;  5K2Y A;  1JNF A;  5F7V A;  4GIZ A;  1JVY A;  3Q29 A;  3QAX A;  1YAE A;  4DE8 A;  4F29 A;  3DP4 A;  2Y7K A;  1B3H A;  2V3Q A;  1P1N A;  2NUV A;  2XXV A;  3T93 B;  2I58 A;  5TP9 B;  3VXC A;  3M3F A;  2DWI A;  3DEL B;  4IB2 A;  3V8X B;  4F1V A;  1Y4C A;  4MLV A;  1MRP A;  3VV5 A;  4XIG Q;  3PPO A;  4FAT A;  2RC9 A;  4F22 A;  4OMB A;  1JEV A;  1L5T A;  4N6P A;  4JWO A;  3L6G A;  5ICT A;  3R7X A;  2DE3 A;  2V84 A;  2WOL A;  3ZS6 A;  5DVF A;  1PB7 A;  1AOV A;  1NH8 A;  1B3F A;  1FTM A;  2V93 A;  2GRV A;  3KSJ A;  4HTG A;  5FHM A;  3TTM A;  2XXT A;  1FQB A;  3VFJ A;  1D4N A;  1A55 A;  2REJ A;  3HHF A;  2YJP A;  3G3G A;  2F7A A;  3ILU B;  2XXP A;  2XXU A;  2HCA A;  1QUI A;  4KCC A;  3O6P A;  4OYV A;  5CMC A;  1JW5 A;  3M3K A;  4NTL A;  2F8D A;  4QFO A;  3KSX A;  3SKP A;  4X48 A;  4ND9 A;  3TEL A;  2W7Y A;  3O9P A;  1MQH A;  4RPN A;  3IOR A;  3ZSF A;  2O51 A;  1PB9 A;  5IKB A;  4XKR A;  1H43 A;  1P99 A;  2ZNT A;  3C32 A;  3B6W A;  4YKI A;  3UIF A;  3MVX A;  3C35 A;  1NMU A;  1B4Z A;  1B7U A;  2AL4 A;  4UA8 A;  3K6U A;  3U94 A;  3IOT A;  4ZZE A;  3TTR A;  4ECF A;  1LLS A;  1SYH A;  1MY4 A;  3MVZ A;  4NED A;  3CFL A;  1QUK A;  4RY1 A;  2QL3 A;  5TP9 A;  3GZG A;  2Q2C A;  3FTO A;  3QXM A;  5AA4 B;  1ZBM A;  1P1Q A;  2I6E A;  4GQO A;  3VVE A;  4ZZA A;  4RPO A;  3UN6 A;  2NWJ A;  4U1Z A;  2VGQ A;  4R75 A;  2X26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...