1B05A

Structure of oligo-peptide binding protein complexed with lys-cys-lys
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
total genus 185
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b05A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b05A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b05A02
3SEUA 1WVJA 4IO2A 5LOMA 1US5A 2QMWA 1LB9A 2E1SA 5CMMA 2PVUA 5DT6A 4LA9A 3TCHA 1VR5A 3VFJA 2HAUA 4YB5A 3TAJA 1USYH 4FJPA 2HXWA 1DMBA 5CBRA 2OLBA 4RK2A 2NOOA 4F1UA 5IAIA 2QRYA 3PD8A 4OXVA 3H6TA 1Y20A 3M3FA 1B46A 4G68A 4OEVA 2NVUB 1B5HA 3Q27A 4BDMA 1AIVA 4QFPA 1PB8A 4G68B 2WKYA 1MXVA 1R9LA 3PUYE 1WODA 4R6KA 3TQLA 3S9NC 2I0BA 5EYFA 2UYFA 4PFTA 3PMWA 4AB6A 1JETA 2DXRA 2D5WA 1BP5A 3MVWA 2F35A 3LBSA 3UORA 3PAMA 3TKDA 1B4HA 3FD3A 3GBAA 1LAHE 4F39A 1NNPA 1EZOA 4YAHX 3SEYA 4GVOA 3IB0A 2O7IA 2I6EA 3H6UA 3N94A 4Q30B 4XKQA 4ZZEA 1Q1KA 3THIA 3UGWA 2NXOA 4LZ5A 4F2QA 1B05A 1MRPA 3FIRA 2YJPA 2UXAA 3O2AA 3PPQA 4R9GA 4YU0A 1FQFA 4O3AA 3SEVA 2Q2CA 2VOZA 4JSDA 2HZLA 4KD5A 4RNSA 3G3KA 3ZKKA 2DE4A 2XX7A 3N6UA 3GBBA 3K2DA 2UVGA 4RPNA 1Y3PA 1QKBA 1HSJA 4LATA 1MDQA 1QJMA 3CI8A 1P1QA 4RYAA 1N76A 2H98A 1XVYA 2Y7WA 1O7TA 4ZEIA 4H65A 1MY1A 2GHBA 1IUDA 3EHUA 1IQ7A 1UTBB 1BTJA 3G3JA 4ZDMA 3TELA 3U1OA 4R72A 1LBCA 2XXQA 1IXGA 4X1DA 5ICQA 4EUOA 1VFDA 1FQAA 1IEJA 2YLNA 3OSQA 4H67A 2QS2A 3C35A 3VVEA 4F3BA 2WOPA 2AL5A 4EDPA 3IOWA 3K1MA 4IY6A 2OZZA 1NNKA 4R73A 4ZEFA 2DS9A 3EQ1A 3MAMA 3TZAA 4F18A 4OFLA 4LZ7A 5TU0A 1URGA 3DELB 2GRVA 3RN8A 1IITA 3G3GA 2Y7IA 3QSLA 3OO6A 2HFBA 3VV5A 5IKBA 2I3WA 3IB1A 1MDP1 3VXCA 3KFMA 3KSXA 3DRGA 1H43A 2M8CA 2R71A 2FA7A 2XXRA 2RINA 3EPEA 3H4ZA 4THIA 4ZS9A 4AB5A 4LQ5A 2O51A 1B52A 3C4MA 4H5FA 2DYXA 4R2BA 4EXLA 1UTBA 1B3EA 1MQIA 4LZ8A 4DZ1A 4ZZAA 3S9MC 1NMUA 3MZ9A 4GLIA 5KDTA 5AA2B 3G7WA 1SBPA 1AL3A 4TOZA 4U23A 1PBPA 4HS7A 1FTLA 2B65A 3VVFA 1DTZA 3TPAA 3KJ7A 4GD5A 1S7YA 3TTKA 3G3IA 1EZ9A 4OHNA 4FAJA 1P1WA 3BFTA 3K6XA 5H8QB 3VLUA 3H6WA 2DSFA 3I3VA 3Q26A 3VXBA 1M5FA 3I5OA 3M3LA 2ZYMA 1B40A 1OVBA 1ZLQA 3OMBA 3S9EA 2QMXA 5HPQA 5CMKA 3VLWA 1SYHA 3CG3A 4PETA 1FCKA 1DTGA 2F7CA 1SYIA 4LP2B 2HQ0A 5ELVA 3FXQA 1ELJA 2F7AA 2H4IA 1URDA 1POTA 2Z8DA 1TT1A 3H3GA 1JVYA 2F5XA 1CB6A 3N26A 4KHZE 3SDFA 3SEWA 2VGQA 4OYVA 3TQWA 3B6QA 3R6UA 4RA1A 1QULA 4TLMB 4R2FA 5JEIA 2F34A 4Z7EA 2DWAA 1M5DA 1XVXA 4F19A 5EHMA 4G8HA 5DVJA 1TFDA 1M5EA 3K1NA 2A5SA 1YTVA 1JVXA 3PGFA 3N5LA 1B3HA 5BWJA 1A55A 1H45A 3KJTA 4ELOA 1ZTYA 4QFLA 1R6ZA 3KOTA 1NNFA 1J1NA 2H25A 4G68C 4IGTA 1O64A 2KLFA 4ELRA 1NL5A 4IB2A 4BDOA 2I4CA 3RT6B 3SETA 4EXKA 1Y4CA 4XKNA 3OEMA 3CIJA 3FASA 4FORA 4U4SA 2RC7A 1A7LA 1OLCA 4H6DA 2DWIA 4Z0IA 3RPWA 2DXYA 1EU8A 1LFHA 3IX1A 3FUZA 3RYBA 2H5YA 2REGA 3JV9A 1P99A 3W15C 1P1NA 2WOKA 3ZKLA 2P1SA 3O6PA 3MUQA 4YKIA 2UVJA 3DRKA 1GGGA 1B5JA 1NH8A 2XD3A 1IIWA 2XXTA 3B6TA 4O3BA 4R75A 3MZ1A 4DDDA 1Q35A 1UIVA 1POY1 3L6HA 3A3CA 3MP8A 5FHNA 3V5AA 3IK6B 4FATA 3ILUB 5H8FB 4ZEKA 3DP8A 3Q25A 3IL1B 1OVTA 4XIGQ 1DPPA 4TQUQ 3RNNA 3O9PA 2YPNA 1MM7A 3C33A 3HPIA 3O66A 5HBCA 5ISUA 2Y7PA 4XKPA 2Q2AA 4L17A 3TTRA 2OK2A 1M5CA 2XXHA 4ZEDA 1PC3A 4GFRA 1ZMGA 5JK4A 3MP6A 3MP1A 1JNFA 2VD3A 3U8QA 5HM4B 3EHSA 1Y1ZA 2PBWA 2RCAA 2Z8FA 5I59B 3CFZA 1S9TA 3ZS6A 1LGBC 4QF9A 4WXJA 3KG2A 4E0WA 3K02A 5AA2A 1LFGA 1YAEA 5F1QA 2ZNUA 3FVKA 1QKAA 3DRFA 3RGYA 3MPLA 3O6GA 2O84X 4JDFA 4FE8A 1RYOA 2DVCA 2X7QA 4HW8A 1SW2A 4PFWA 5DVIA 3FVNA 3H6VA 2I4BA 4HCWA 3T9UA 1B3FA 1I6BA 3HHGA 2F6PA 1R9QA 3K4UA 1BKAA 4PP0A 5CRYA 4UACA 2I48A 2OBGA 3ONMA 4EF2A 5CBSA 4LONB 5ICTA 3MC2A 2F6GA 4NF5A 5DVFA 5I2KB 2OCUA 1Z7ME 3FVOA 4P11A 4KR5A 5BUUA 1D9YA 3E13X 3G3HA 3OO7A 4G2ZA 2AYSA 2THIA 2P2AA 3K0VA 5JTYB 4YKPA 3MVXA 2UVHA 3BFUA 1SI1A 1B7UA 3A09A 3CR9A 4RY1A 4F22A 1FW0A 3KOSA 1GV8A 1ATGA 2RKMA 1GR2A 3MZBA 2GFEA 2I3VA 4G8MA 5TP9A 3CHGA 3H06B 3PUZE 3CRBA 4IO6A 1B4ZA 1MXWA 1Y3NA 4ZE9A 1B7ZA 1MQJA 3EN3A 4NWCA 4FECA 5JTYA 4F1YA 3TDJA 4YICA 3VDFA 4GWOA 5A5XB 4ZE8A 3U94A 4FEBA 3JYRA 2D3IA 4GF8A 4MF3A 3RUMA 1FQDA 4F3PA 4ESWA 3UIFA 4N6PA 1JW5A 1S50A 1FTJA 2Q88A 3O97A 1MM6A 3DRHA 3ILTB 3QYTA 3SESA 1YPNA 3K01A 2A5TB 5TP9B 2HAVA 4KI0E 3VE1B 3KBRA 4PFUA 4GXAA 4GL8A 4OERA 4KFQA 5H8NB 3MVYA 3P7IA 1LSTA 4GIZA 4LUBA 1FTKA 4U2RA 2Q8JA 3K00A 3GXAA 3KEIA 4QFKA 1B6HA 1MPBA 3E4RA 4XXUA 1QVSA 1ZBMA 1B58A 4C1UA 2QJEA 5CI5A 2PYYA 4YZZA 1LAFE 4F31B 3LSXA 1T0KA 2Z8EA 3Q29A 4NF8A 4R6HA 1OQHA 3IOTA 3ODBA 4IO7A 1AMFA 4OETA 2ZXTA 3MBPA 1R1NA 4JWYA 4QFNA 4N07A 2IEEA 4DCXA 1B2HA 3GLBA 2PT1A 2Q9TA 4KQPA 4OZ9A 1SI0A 3OO8A 4QSEA 3D4GA 3FJGA 3PUWE 3CSGA 3QXMA 1MPDA 3T22A 2DWHA 4IO3A 3DP6A 2G29A 5F7VA 3RY3A 5I58B 5B7DA 4DCYA 3RT8A 2D21A 2DOJA 3QUJA 2F7BA 4Q5TA 1EH3A 3LSFB 4I1DA 4POXA 3PV0E 3T9XB 5I2NB 5I57A 4EQBA 2HZKA 4OFOA 3FTOA 4ONYA 4YMAA 3PMVA 4NF4B 4PFYA 1JEUA 1IXCA 1N0TA 2F8DA 3LVUA 4NF6B 4QSCA 1IXHA 4ZECA 4BLAA 2I49A 1US4A 2QPQA 4KCCA 4MLQA 1P1UA 5TPAB 3HSTA 3IOVA 3PMXA 1MY4A 3W9VA 2O68A 3T93B 1LBBA 2ZYOA 2OWSA 1PEBA 1A99A 4G8NA 2REJA 3QAXA 1JQFA 1GVCA 3QK6A 1FQEA 5H8NA 5L8DA 4I8CA 1QUKA 4OFJA 1MG1A 1XT8A 1MPCA 1FQBA 1I6QA 3QIMA 1BLFA 1ZIUA 2F36A 2A5TA 2Z22A 4OESA 3C32A 5FHOA 1ZU0A 1XC1A 3CG1A 2HEUA 3N6TA 2E0SA 2AL4A 5ITPA 4YMBA 2B3BA 5AA4A 5AA3A 1L5TA 3RTWB 3UA8A 4F29A 2XXPA 2BJJX 1MQDA 4EF1A 1TFAA 5B70A 3V83A 1JW4A 1XOCA 3FVGA 1Y1MA 1N04A 4U1ZA 1YCJA 3H03A 1MXYA 5CMBA 5H8SA 1B7HA 3SERA 4ELPA 4WEDA 2VP1A 3B6WA 4LQ2A 3L6GA 3LUYA 1B1XA 1B1HA 5H8HB 2XXWA 3PPOA 1M5BA 1CE2A 2DQVA 1MH4A 3Q28A 1MQGA 1PDAA 3QUFA 4FIMA 1DPEA 4U21A 3S4UA 3SKPA 4C0RA 3HCQA 2ONKE 4MFIA 2QL3A 4DIGA 3FJ7A 4MBPA 2FYIA 3FJMA 1IZ1A 4F1VA 2ESNA 5CM6A 3RQTA 2H9BA 5H8HA 3TFLA 3TMGA 4ELQA 3O6HA 5I2KA 3TUSA 2IA4A 3SEXA 2O69A 5I84A 1A54A 3OO9A 4H5GA 1LLSA 1IXIA 2B4MA 1N3WA 1N7XA 4ISUA 4OQOA 4BDLA 4NE4A 3UN6A 4AQ4A 3O28A 4H8JA 3AXFA 1GTKA 3LSWA 3LSLA 3DLNA 1EZPA 4NMYA 5AA4B 2ZYNA 2V3QA 1A40A 3IOUA 2PX1A 3LR1A 4GRKA 3C9HA 3IORA 2RCBA 4GQOA 2DP8A 4JWOA 4U4XA 2HCAA 3M8UA 1A8EA 3E3KA 4Q0CA 1PB9A 4EQ9A 4OWDA 5I56A 4GOTA 4BDRA 1MH3A 2XXXA 3IJXB 3OXNA 1Y3QA 2B3FA 2I58A 4RJZA 4RPOA 1Y9UA 2XXYA 4G4PA 3U72A 4YKJA 4JSOA 4E0XA 5KCJA 2OWTA 2O1LA 3OELA 4N13A 2DVZA 1PB7A 4F3GA 2ANJA 3MPKA 3FXUA 4I9DA 3KGCA 2QS3A 1UTHA 1HSLA 1OIBA 2CMOA 3GZGA 5TPAA 3MW0A 1I69A 1UTHB 2Q89A 2QS1A 3HN0A 3MQ9A 1FQCA 2XXIA 3C36A 1NKXA 2B4LA 3OOAA 2V3TA 3H7MA 3IB2A 3HO7A 3K1PA 4H1XA 5FTHA 4IY5A 4EQ7A 3EF7A 4NF4A 4DLDA 5KCJB 2ONRA 3IR1A 4MLVA 4F3SA 2XD2A 1HSEA 1DSNA 1Y4TA 5L9OA 3USDA 5I2NA 3OD7A 3PPNA 4JBZA 3IJOB 4IO5A 4MH5A 1USYE 1MQHA 4HTGA 4POWA 4BDNA 3BKIB 3IO6A 3JZJA 4X1BA 3T96B 2R6GE 5I58A 5L9SA 4KPTA 1P1OA 1SW1A 4IO4A 1B51A 5AA1A 5AE4A 3TODA 3ZSFA 1MY2A 2F78A 2O7UA 3UK4A 2X26A 2O6AA 1VFEA 2XX9A 4JB7A 2RC8A 2RF1A 2GH9A 3O29A 2FNCA 3R7XA 4H8IA 3OSRA 3S9LC 2PMSA 1QW0A 1B3LA 1FTMA 1SQYA 1MXXA 2Y7KA 3A3UA 3TTLA 5J1DA 1ZJLA 2LAOA 1LB8A 3V8XB 1NFTA 3EHTA 3CVGA 4I62A 2X7PA 4NTLA 2RC9A 3CFLA 3ECRA 1PBQA 1VSOA 2R9JA 2XHDA 4ZEBA 2ABHA 3FV2A 5EHSA 4RK9A 1MS7A 3LC8A 1NH7A 3TTNA 2G93A 3TTMA 3TYHA 3PPRA 1MY0A 1D9VA 1AOVA 4TLLB 3U92A 1QUIA 3VLVA 4DE8A 2UVIA 4C1TA 3C31A 4PQJA 3DRIA 3MWBA 1UQWA 5FHMA 2WOLA 4ND9A 4PE5B 1KWHA 3R26A 2DE3A 4KYEA 4QSDA 3KZGA 4U1OA 4UA8A 4K3FA 3HHFA 3PUXE 3D4CA 1LCFA 4WKMA 3T9HB 5A5XA 1QUJA 3KN8A 3TCGA 1UIUA 3TEPA 2Z23A 2NUVA 1N3XA 2QS4A 3K6WA 1MY3A 4FEDA 3IO4A 3O6IA 4GL0A 2VHAA 1TXFA 3PU5A 2Y84A 3M3KA 4KYSA 3WAEA 1O63A 4QHQA 3K6VA 4Q8RA 1JW1A 1SD3A 1OMPA 2GHAA 1ZKBA 3K6UA 4DXCA 4ESXA 1F9BA 3S2VA 3FATA 1TWYA 1SVXB 3MJNA 4IGRA 5DTBA 5H8QA 5AA2D 3G3FA 2AIXA 1N84A 4NWDA 4O3CA 1JEVA 3PPPA 1B3GA 1LAXA 3OENA 3FZVA 4U22A 4QRZA 4XTCQ 1RKMA 4OENA 1A8FA 1RYXA 2UYEA 4OTEA 1WDNA 5KDTB 4NF5B 4NF6A 1MXUA 4R6YA 4DXUA 2H99A 3E9XA 2ONSA 4M1VA 5I57B 2ZYKA 3DP4A 3T66A 2I0CA 4YB7A 2ZNSA 2V93A 3FXRA 4OVJA 2XXUA 3F11A 1H3DA 4KCDA 3MVZA 4QFOA 2Y7RA 4JXIA 3FV1A 2XXVA 4P0GA 3V89B 1Z7NE 2V84A 3FGSA 3U93A 4F2OA 5DEXB 1FTOA 4M4GA 3KN3A 4OEUA 1LAGE 1XHYA 2ALUA 2DE2A 4H0WA 4HCYA 1LCTA 4LVQA 5K2YA 1LFIA 3RTFB 3PUVE 4NEDA 3WAFA 4NF8B 2O1MA 3DRJA 2F97A 4RXLA 3T9VA 3BBRA 5M2VA 3UP9A 4YB6A 1BIYA 2P0SA 1NNTA 2DWJA 4KYDA 5KZTA 3KSJA 1B0HA 4ECFA 1URSA 1H76A 1OLAA 1SW5A 1N7WA 2ZMBA 4P0IA 4R9FA 5DYHA 5CC2A 3RYAA 1ANFA 3W9WA 4G77A 2W7YA 5K2XA 1DOTA 1MXZA 3VVDA 3RLFE 1B9JA 1D3KA 3OEKA 5H8FA 1VE4A 4X48A 2QSXA 3KN7A 3DM0A 4BDQA 4X9TA 3PD9A 5ITOA 1XS5A 2CZLA 2XX8A 4DXBA 1B5IA 4GXSB 3CFXA 4JWXA 3I6VA 1B0LA 3C34A 2V25A 4YKKA 1I6AA 5FTIA 5L9MA 2NWJA 1AH5A 5CMCA 1OQGA 1SDXA 3CSBA 1SW4A 3IAZA 3TCFA 4XKRA 1D4NA 1H44A 2PT2A 2VD2A 3HV1A 3B7DA 4WEPA 5DEXA 4R74A 2OJTA 5I56B 1B32A 2ZNTA 5I59A 2V3UA 1II5A 4OMBA
chains in the Genus database with same CATH superfamily
5LOMA 2QMWA 5CMMA 1LB9A 3VFJA 4YB5A 1USYH 4FJPA 4PAKA 3EKIA 2NOOA 2QRYA 1B5HA 4BDMA 4PF8A 1JETA 3MVWA 1NV3A 4F39A 3GBAA 1NNPA 4YAHX 4GVOA 3IB0A 3H6UA 4LZ5A 4F2QA 1B05A 3O2AA 4YU0A 1FQFA 1NV2A 2VOZA 3G3KA 3GBBA 3U65A 2HXRA 4RPNA 1Y3PA 4LATA 3CI8A 4RYAA 1XVYA 1O7TA 1MY1A 2P3VA 3MYUA 2XXQA 1IXGA 1VFDA 2VPOA 4IY6A 3K1MA 4R73A 4F18A 4NN3A 4P3LA 1IITA 3OO6A 3KSXA 3H4ZA 2XXRA 4ZS9A 4PE3A 4H5FA 4EXLA 4GBWA 1FPKA 1NV0A 3SZPA 4HS7A 1DTZA 3TPAA 3TTKA 4FAJA 3VLUA 5H8QB 3H6WA 2ZZWA 1M5FA 2ZYMA 4HE1A 1OVBA 2QMXA 1SYHA 1FCKA 1SYIA 2DDKA 2HQ0A 3FXQA 2F7AA 1URDA 1CB6A 4OYVA 4PF6A 3B6QA 2QVRA 4TLMB 4R2FA 5JEIA 2DWAA 5EHMA 3PGFA 5DW8A 4XF5A 4QFLA 1LEVA 4G68C 2KLFA 4EXKA 1Y4CA 4DI3D 4P56A 3FASA 2RC7A 1OLCA 3ROJA 2DXYA 1LFHA 5LDZA 3FUZA 1P99A 2HHMA 3MUQA 2UVJA 4O3BA 1NH8A 5FHNA 4GWUA 3ILUB 3IL1B 1SPIA 1OVTA 3TAJA 5HBCA 5I3SA 5ISUA 4MJOA 5JK4A 3MP6A 1JNFA 3U8QA 3EHSA 2PBWA 5IM2A 3O6GA 4FE8A 1RYOA 2X7QA 1SW2A 4PFWA 4HCWA 3A29A 1BKAA 4EF2A 2I48A 3ONMA 1INPA 2F6GA 1Z7ME 2HPGA 1NV4A 4KR5A 2P2AA 3K0VA 4RY1A 1B7UA 1CNQA 4PGNA 1ATGA 1GV8A 4IO6A 3CRBA 4FECA 3VDFA 4FEBA 2D3IA 3RUMA 4N6PA 1JW5A 1S50A 2Q88A 3QYTA 1MM6A 3ILTB 1YPNA 2HAVA 3VE1B 3KBRA 4PFUA 4KFQA 3MVYA 3P7IA 4LUBA 4U2RA 1B6HA 1MPBA 3ISPA 4XXUA 2QJEA 2ZXTA 4N07A 3GLBA 3OO8A 3CSGA 3QXMA 4P47A 3T22A 1BK4A 1YXIA 5F7VA 5I58B 4DCYA 2FBPA 2Y5LA 4I1DA 5I2NB 4JVDA 4OFOA 3PMVA 1JEUA 1N0TA 4NF6B 1IXHA 4ZECA 1KA1A 4N81A 5TPAB 3HSTA 4HE2A 3T93B 2CZKA 1LBBA 3QMFA 4G8NA 1JQFA 1FQEA 1I6QA 1ZIUA 1KA0A 2A5TA 5FHOA 4XFEA 5ITPA 4YMBA 3UA8A 3BIGA 3V83A 5H8SA 4U1ZA 3H03A 3S4UA 1IMAA 5ET7A 2QL3A 1FJ6A 3FJ7A 2FYIA 3RQTA 3TMGA 4ELQA 2IA4A 4H5GA 4ISUA 2VT5A 4BDLA 4NE4A 3O28A 1FBEA 3LSLA 4GRKA 2RCBA 4Q0CA 4PGPA 4GOTA 2XXXA 5I5PA 1Y9UA 4E0XA 4N13A 2DVZA 4F3GA 2ANJA 3KGCA 3E78A 2QS3A 1UTHA 4DXCA 2CMOA 3GZGA 4X1DA 3MQ9A 4FIMA 4DXUA 1NKXA 4H1XA 1LBYA 4IY5A 3EF7A 3IR1A 5I2NA 4MH5A 5I56B 4HW8A 3BKIB 3T96B 5I58A 4KPTA 1SW1A 5AE4A 2O7UA 2X26A 4H8IA 4FBPA 1B3LA 1MXXA 3A3UA 4NTLA 2X7PA 1RDXA 2Q74A 5EHSA 2XHDA 3LC8A 3TTMA 3TYHA 1D9VA 1QUIA 4C1TA 1EYKA 3MWBA 4GWWA 4QSDA 1QUJA 3TEPA 2Z23A 2QS4A 4GXAA 1MY3A 4FEDA 3IO4A 2VHAA 4KYSA 4N4UA 3PU5A 5I7IA 1O63A 1JW1A 1SD3A 3K6UA 3S2VA 3FATA 1TWYA 5DTBA 5AA2D 3G3FA 1B3GA 4U22A 4XTCQ 4QRZA 1WDNA 1MXUA 4R6YA 3E9XA 4PCDA 3RPLA 2XXUA 3F11A 4KCDA 4JXIA 1IMCA 4P0GA 3U93A 2CZIA 3RT6B 4HCYA 1LFIA 4AB6A 5EYHA 4NF8B 3T9VA 3UP9A 4NAPA 3KSJA 4JVCA 4P1LA 3RYAA 3W9WA 2W7YA 5K2XA 1MXZA 2VPNA 3IFAA 4N91A 3IAZA 3GYYA 4XKRA 2PT2A 3HV1A 1K9YA 1US5A 4AS4A 5DT6A 5CBRA 2OLBA 2OX3A 5IAIA 4OXVA 3PD8A 2FIEA 1B46A 2WKYA 1MXVA 4R6KA 3PMWA 2D5WA 4KXPA 2I6EA 4ZZEA 3N94A 4XKQA 3PPQA 2UXAA 4GWXA 2Q2CA 4OVTA 3ZKKA 3N6UA 3K2DA 2WX9A 1NUZA 1MDQA 1P1QA 2Q8MA 1N76A 2Y7WA 4H65A 4OWDA 3EHUA 1BTJA 4F31B 1IEJA 2QS2A 3C35A 3NOHA 2WOPA 1D9QA 2AL5A 4EDPA 4OFLA 3G3GA 4N17A 2Y7IA 3QSLA 2HFBA 3IB1A 3KFMA 1H43A 2R71A 2RINA 4AB5A 1MQIA 3S9MC 4DZ1A 4ZZAA 3MZ9A 3B8BA 5AA2B 1AL3A 3KJ7A 3G3IA 3VXBA 2DSFA 3I5OA 1LBZA 5HPQA 4LP2B 1POTA 2Z8DA 3H3GA 3SDFA 3SEWA 2F5XA 3N26A 5ESYA 4RA1A 2F34A 4G8HA 1M5EA 1JVXA 2WBDA 3KJTA 1R6ZA 3KOTA 4P8BA 4IB2A 4BDOA 4GWSA 2H5YA 2REGA 3W15C 1B5JA 3B6TA 3MZ1A 1Q35A 3A3CA 4FATA 3DP8A 4XIGQ 1DPPA 3O9PA 2YPNA 1FPDA 4L17A 1XI6A 2OK2A 1PC3A 4N6KA 3MP1A 5HM4B 1Y1ZA 2RCAA 2Z8FA 3ZS6A 4QF9A 1QKAA 3DRFA 1IMEA 1LBVA 3RGYA 3MPLA 2O84X 1JP4A 5DVIA 3T9UA 1B3FA 1I6BA 5ET6A 4PP0A 3FVOA 4P11A 4G2ZA 2AYSA 2UVHA 3BFUA 3A09A 5FBPA 2RKMA 1FBPA 4PC9A 4PFRA 4G8MA 5EYGA 3H06B 1MXWA 3EN3A 4ZE9A 4NWCA 3TDJA 4YICA 4GWOA 4MF3A 3HFUA 3K01A 2A5TB 4KI0E 4UABA 4P9KA 4OERA 1FTKA 3KEIA 4OVQA 1ZBMA 2Y5KA 4C1UA 5CI5A 5EQ9A 1LAFE 3KBZA 3LSXA 2Z8EA 3Q29A 4NF8A 3IOTA 4OETA 3MBPA 4DCXA 4KQPA 2Q9TA 1SI0A 3FJGA 3PUWE 3DP6A 5B7DA 1LBXA 3RPLB 4JVIA 2F7BA 4EQBA 3FTOA 2JJKA 4QSCA 3LVUA 4HE0A 2QPQA 4KCCA 4MLQA 3PMXA 5LTCA 1A99A 2REJA 5H8NA 4I8CA 4OFJA 2Z22A 2XWOA 1XT8A 3QIMA 3C32A 4OESA 3CG1A 4LN5A 2WBBA 5AA4A 3RYDA 4EF1A 3PTYA 5B70A 1JW4A 1XOCA 3LUYA 1FJ9A 2DQVA 4C0RA 1MQGA 4MFIA 4MMPA 5CM6A 2H9BA 4GBVA 3O6HA 4N6DA 5I84A 1A54A 3MSTA 1EZPA 4NMYA 2ZYNA 4JWOA 3LR1A 3C9HA 3IORA 4U4XA 2HCAA 4PFBA 4BDRA 1MH3A 1Y3QA 2B3FA 4RJZA 4X04A 4AS5A 5KCJA 4YKJA 4JSOA 4I40A 3FXUA 4I9DA 1FPBA 2QVUA 2Q89A 1I69A 3SETA 3HN0A 3C36A 3OOAA 3H7MA 2ONRA 1DSNA 5L9OA 3USDA 3OD7A 3PPNA 3IJOB 4BDNA 1MQHA 4HTGA 2ZZVA 4X1BA 2R6GE 1B51A 2XX9A 4GX6A 3OSRA 1FTMA 3TTLA 1NFTA 3EHTA 3CVGA 4I62A 4O7MA 1PBQA 1VSOA 4ZEBA 1MS7A 3PPRA 1AOVA 3U92A 2WOLA 4ND9A 2V4CA 2P3NA 3HHFA 3PUXE 3KN8A 3TCGA 1UIUA 2Y84A 1SVXB 3MJNA 5H8QA 2L5VA 3PPPA 1LAXA 3FZVA 4OENA 2UYEA 4OTEA 4NF5B 1Q9DA 2H99A 2V93A 3FXRA 3B50A 4OVJA 1H3DA 4QFOA 2XXVA 3V89B 4M4GA 1EYJA 2DE2A 5K2YA 4H0WA 4LVQA 1EZOA 3WAFA 4NEDA 3DRJA 4RXLA 2P0SA 5KZTA 4ECFA 1URSA 1H76A 2ZMBA 1ANFA 4G77A 1DOTA 3RLFE 1B9JA 1D3KA 4X48A 3KN7A 4BDQA 5ITOA 1XS5A 4DXBA 4GXSB 3I6VA 3C34A 1OQGA 3CSBA 4NG7A 1D4NA 1H44A 4MEVA 3B7DA 5DEXA 1B32A 2ZNTA 2XA5A 3SEUA 1WVJA 4IO2A 4LA9A 3TCHA 2HXWA 4RK2A 3H6TA 4OEVA 4QFPA 3PUYE 4OVPA 2BJIA 3T0JA 2F35A 1BP5A 3UORA 3FD3A 1LAHE 2O7IA 4Q30B 1Q1KA 4OANA 3UGWA 3SEVA 4R9GA 2HZLA 4KD5A 4RNSA 2XX7A 1NUWA 2UVGA 1QJMA 2H98A 2QFLA 4ZEIA 1IUDA 3U1OA 5ICQA 3VVEA 2R8TA 1RDYA 3IOWA 3MAMA 3TZAA 4LZ7A 1URGA 4MNCA 2I3WA 1MDP1 4MIJA 2QVVA 4THIA 2O51A 1B52A 3C4MA 5EQ8A 2DYXA 4R2BA 1UTBA 4LZ8A 4GLIA 5KDTA 1SBPA 4U23A 1PBPA 1FTLA 2B65A 3VVFA 4GD5A 1S7YA 4OHNA 1P1WA 3K6XA 1EYIA 3I3VA 3Q26A 2XWIA 3M3LA 3OMBA 5CMKA 3CG3A 5ELVA 1ELJA 2H4IA 1TT1A 1JVYA 2VGQA 1QULA 3IFCA 4Z7EA 1M5DA 1XVXA 4F19A 1TFDA 5BWJA 1ZTYA 1J1NA 4MNPA 2H25A 4IGTA 4ELRA 1NL5A 2I4CA 4P1EA 4U4SA 1A7LA 3RPWA 1EU8A 5F24A 3RYBA 3O6PA 4YKIA 4QBAA 3DRKA 1GGGA 2XD3A 2FVZA 4DDDA 3MP8A 4NGUA 1DCUA 3RNNA 4TQUQ 4N15A 2Q2AA 3TTRA 1M5CA 2XXHA 4GFRA 1NUXA 5I59B 1K9ZA 1S9TA 4E0WA 4WXJA 1FTAA 3KG2A 1LFGA 1YAEA 1NV5A 2ZNUA 2WYKA 2DVCA 1FPLA 3H6VA 2F6PA 4PAFA 1R9QA 5CRYA 4UACA 2OBGA 5CBSA 3MC2A 5I2KB 5BUUA 3E13X 3G3HA 2THIA 3MVXA 1SI1A 4F22A 3CR9A 3KOSA 1GR2A 3MZBA 2I3VA 3CHGA 3PUZE 1B7ZA 4N8GA 5A5XB 4PBHA 3JYRA 4GF8A 1FQDA 4F3PA 4ESWA 3UIFA 3O97A 1FTJA 3DRHA 3SESA 4GL8A 5H8NB 1LSTA 2Q8JA 3K00A 1NV1A 4QFKA 4O94A 3E79A 2PYYA 4YZZA 1OQHA 3ODBA 1AMFA 1R1NA 3D4GA 2DWHA 2G29A 4MHFA 3RT8A 2D21A 1EH3A 4POXA 3PV0E 1FBGA 2HZKA 3FXBA 4ONYA 3FBPA 4YMAA 4PFYA 2WEFA 1IXCA 4PTKA 1US4A 1P1UA 3W9VA 2O68A 3T1BA 1GVCA 3QK6A 1QUKA 1MG1A 2F36A 1MPCA 1FQBA 1ZU0A 1XC1A 2HEUA 3N6TA 2E0SA 1VDWA 5AA3A 1L5TA 4I3YA 3RTWB 4F29A 2XXPA 2BJJX 1MQDA 1TFAA 1Y1MA 1N04A 1YCJA 1MXYA 3LUZA 3SERA 3B6WA 1B1XA 1B1HA 2XXWA 1M5BA 4U21A 3Q28A 3SKPA 1FPEA 1DPEA 4DIGA 4MBPA 4F1VA 1IZ1A 3TUSA 2O69A 1LLSA 1IXIA 1N3WA 4AQ4A 4H8JA 3LSWA 3DLNA 2V3QA 4N8YA 3IOUA 2PX1A 4X8RA 4EQ9A 3M8UA 1A8EA 1PB9A 3OXNA 4RPOA 3U72A 2OWTA 2CZHA 4NQ8A 5TPAA 2QS1A 4PAIA 1FQCA 4EQ7A 2V3TA 3IB2A 5FTHA 5KCJB 4MLVA 2XD2A 1Y4TA 1YYZA 4H45A 4NX1A 4JBZA 4IO5A 1USYE 3IO6A 3JZJA 5AA1A 3TODA 3ZSFA 1MY2A 4NHBA 1VFEA 4JB7A 2GH9A 1QW0A 5J1DA 1LB8A 3CFLA 3ECRA 4MNIA 4RK9A 1NH7A 2G93A 4GX4A 3VLVA 4DE8A 2UVIA 3C31A 4PQJA 1UQWA 5FHMA 4U1OA 3R26A 2DE3A 4G61A 4UA8A 1KZ8A 3D4CA 1LCFA 1FSAA 3T9HB 5A5XA 2FHYA 4QXDA 4GX3A 1TXFA 4GWYA 4QHQA 3K6VA 4Q8RA 4ESXA 1F9BA 1FBCA 2AIXA 1N84A 4MAGA 3OENA 1QGXA 1RKMA 1RYXA 2ONSA 5I57B 3DP4A 3T66A 2ZNSA 3FV1A 2V84A 3FGSA 4F2OA 5DEXB 1FTOA 4OEUA 1LAGE 1XHYA 3WAEA 3RTFB 5IZ3B 5I59A 5M2VA 4YB6A 1NNTA 1OLAA 1SW5A 1N7WA 5DYHA 5EQAA 2OWZA 3OEKA 2XX8A 3CFXA 5L9MA 1B0LA 4YKKA 1T0KA 5IZ1A 2NWJA 1SDXA 1SW4A 5JTYB 2VD2A 2OJTA 1DK4A 2DE4A 1II5A 2E1SA 2PVUA 1VR5A 2HAUA 4PBQA 1DMBA 4F1UA 4I3EA 1Y20A 3M3FA 1AIVA 4G68A 2NVUB 3Q27A 1PB8A 4G68B 1R9LA 1WODA 1NI9A 3TQLA 3S9NC 2I0BA 5EYFA 2UYFA 4PFTA 2DXRA 3LBSA 1IMDA 3PAMA 3TKDA 1B4HA 3SEYA 1AWBA 3THIA 1RDZA 1FBHA 2NXOA 1MRPA 3FIRA 2YJPA 4O3AA 4JSDA 1QKBA 1HSJA 2GHBA 3TELA 1IQ7A 1UTBB 3G3JA 4ZDMA 4R72A 1LBCA 4EUOA 1FQAA 2YLNA 4H67A 3OSQA 4F3BA 5ET8A 2OZZA 1NNKA 4ZEFA 3KC0A 2DS9A 3EQ1A 5TU0A 3DELB 2GRVA 3RN8A 3VV5A 5IKBA 3VXCA 3DRGA 2M8CA 3EPEA 2FA7A 4LQ5A 2PFZA 1B3EA 1NMUA 3G7WA 4TOZA 1FBFA 1EZ9A 3BFTA 4MX6A 1B40A 1ZLQA 3S9EA 3VLWA 1G0HA 4PETA 1DTGA 2F7CA 4KHZE 3TQWA 3R6UA 3D1RA 5DVJA 3K1NA 2A5SA 1YTVA 3N5LA 1B3HA 1A55A 1H45A 4ELOA 1NNFA 5IZZA 1O64A 4XKNA 3OEMA 3CIJA 4FORA 4XEQA 4H6DA 2DWIA 4Z0IA 3IX1A 2GQ1A 3ZKLA 3JV9A 1P1NA 2WOKA 1DBZA 2KQZA 2P1SA 2PCRA 4R75A 1IIWA 2XXTA 4OA4A 3L6HA 1UIVA 1G0IA 1POY1 3V5AA 3IK6B 5H8FB 4ZEKA 3BIHA 3Q25A 3C33A 3HPIA 1MM7A 3O66A 2Y7PA 4XKPA 4ZEDA 1ZMGA 4NF0A 2VD3A 1FBDA 1YZ0A 3CFZA 1FPGA 1LGBC 3K02A 2PFYA 5F1QA 3FVKA 4HXVA 5IGAA 4JDFA 3FVNA 2I4BA 2XXKA 2ZZXA 3HHGA 3K4UA 4LONB 2CEXA 5ICTA 5DVFA 4NF5A 2OCUA 1D9YA 3OO7A 4YKPA 2FIXA 1FW0A 2GFEA 5TP9A 1B4ZA 1Y3NA 1MQJA 5JTYA 4F1YA 4ZE8A 3U94A 5TP9B 2WYPA 5T3JA 4GIZA 1FPIA 3GXAA 3E4RA 1QVSA 1B58A 4R6HA 5IZ3A 4IO7A 4JWYA 4QFNA 1FRPA 2IEEA 1B2HA 4OZ9A 2PT1A 4QSEA 1MPDA 4IO3A 5A5LA 3RY3A 2XWKA 3QUJA 2DOJA 4Q5TA 3LSFB 5I57A 4NF4B 2F8DA 4BLAA 2I49A 3IOVA 1MY4A 2ZYOA 2OWSA 1PEBA 3QAXA 5L8DA 3T9XB 1BLFA 2AL4A 2B3BA 1NV6A 3FVGA 5CMBA 1B7HA 4ELPA 4WEDA 2VP1A 4LQ2A 3L6GA 5H8HB 3PPOA 1CE2A 1MH4A 3QUFA 1PDAA 3HCQA 2ONKE 3FJMA 2ESNA 3TFLA 5H8HA 5I2KA 3SEXA 3OO9A 4OQOA 2B4MA 1N7XA 3UN6A 3KC1A 3AXFA 1GTKA 5AA4B 1A40A 1IMBA 4GQOA 2DP8A 1FPFA 3E3KA 5I56A 3IJXB 2I58A 4H46A 2XXYA 4PDHA 4G4PA 2O1LA 3OELA 4OVRA 1PB7A 3MPKA 1HSLA 1OIBA 3MW0A 1UTHB 2XXIA 5AA2A 2B4LA 3K1PA 3HO7A 4NF4A 4DLDA 4F3SA 3LV0A 1HSEA 5ET5A 4POWA 1IMFA 1LBWA 5L9SA 5J16A 1P1OA 4IO4A 5EQ7A 2F78A 3UK4A 2O6AA 2KR0A 2RC8A 2RF1A 3O29A 4DI4B 2FNCA 3R7XA 3S9LC 2PMSA 2Y7KA 1SQYA 1ZJLA 2LAOA 2XWVA 3V8XB 2RC9A 2R9JA 2ABHA 3FV2A 3TTNA 1MY0A 4TLLB 4O8MA 3DRIA 4MCOA 4O7IA 1KWHA 4KYEA 3KZGA 4K3FA 4OVSA 4IR8A 4WKMA 2NUVA 1N3XA 3K6WA 4PE5B 4GWZA 4GL0A 3O6IA 2F3BA 3M3KA 1FPJA 2GHAA 1OMPA 1ZKBA 4IGRA 4NWDA 4O3CA 1JEVA 1A8FA 1NUYA 5KDTB 4NF6A 4M1VA 2ZYKA 2I0CA 4YB7A 3MVZA 2Y7RA 1Z7NE 2F3DA 3KN3A 4PFIA 2ALUA 1LCTA 3PUVE 2O1MA 2F97A 3BBRA 1BIYA 1NV7A 2DWJA 4KYDA 1B0HA 4P0IA 4R9FA 5CC2A 4PDDA 3VVDA 5H8FA 2CEYA 1VE4A 2QSXA 3DM0A 2MKZA 4X9TA 3PD9A 2CZLA 1B5IA 4JWXA 5FTIA 2V25A 1I6AA 1AH5A 5CMCA 3TCFA 4WEPA 4R74A 2V3UA 4OMBA
chains in the Genus database with same CATH topology
3SEUA 1WVJA 4IO2A 5LOMA 1US5A 2QMWA 1LB9A 2E1SA 5CMMA 2PVUA 5DT6A 4LA9A 3TCHA 1VR5A 3VFJA 2HAUA 4YB5A 3TAJA 1USYH 4FJPA 2HXWA 1DMBA 5CBRA 2OLBA 4RK2A 2NOOA 4F1UA 5IAIA 2QRYA 3PD8A 4OXVA 3H6TA 1Y20A 3M3FA 1B46A 4G68A 4OEVA 2NVUB 1B5HA 3Q27A 4BDMA 1AIVA 4QFPA 1PB8A 4G68B 2WKYA 1MXVA 1R9LA 3PUYE 1WODA 4R6KA 3TQLA 3S9NC 2I0BA 5EYFA 2UYFA 4PFTA 3PMWA 4AB6A 1JETA 2DXRA 2D5WA 1BP5A 3MVWA 2F35A 3LBSA 3UORA 3PAMA 3TKDA 1B4HA 3FD3A 3GBAA 1LAHE 4F39A 1NNPA 1EZOA 4YAHX 3SEYA 4GVOA 3IB0A 2O7IA 2I6EA 3H6UA 3N94A 4Q30B 4XKQA 4ZZEA 1Q1KA 3THIA 3UGWA 2NXOA 4LZ5A 4F2QA 1B05A 1MRPA 3FIRA 2YJPA 2UXAA 3O2AA 3PPQA 4R9GA 4YU0A 1FQFA 4O3AA 3SEVA 2Q2CA 2VOZA 4JSDA 2HZLA 4KD5A 4RNSA 3G3KA 3ZKKA 2DE4A 2XX7A 3N6UA 3GBBA 3K2DA 2UVGA 4RPNA 1Y3PA 1QKBA 1HSJA 4LATA 1MDQA 1QJMA 3CI8A 1P1QA 4RYAA 1N76A 2H98A 1XVYA 2Y7WA 1O7TA 4ZEIA 4H65A 1MY1A 2GHBA 1IUDA 3EHUA 1IQ7A 1UTBB 1BTJA 3G3JA 4ZDMA 3TELA 3U1OA 4R72A 1LBCA 2XXQA 1IXGA 4X1DA 5ICQA 4EUOA 1VFDA 1FQAA 1IEJA 2YLNA 3OSQA 4H67A 2QS2A 3C35A 3VVEA 4F3BA 2WOPA 2AL5A 4EDPA 3IOWA 3K1MA 4IY6A 2OZZA 1NNKA 4R73A 4ZEFA 2DS9A 3EQ1A 3MAMA 3TZAA 4F18A 4OFLA 4LZ7A 5TU0A 1URGA 3DELB 2GRVA 3RN8A 1IITA 3G3GA 2Y7IA 3QSLA 3OO6A 2HFBA 3VV5A 5IKBA 2I3WA 3IB1A 1MDP1 3VXCA 3KFMA 3KSXA 3DRGA 1H43A 2M8CA 2R71A 2FA7A 2XXRA 2RINA 3EPEA 3H4ZA 4THIA 4ZS9A 4AB5A 4LQ5A 2O51A 1B52A 3C4MA 4H5FA 2DYXA 4R2BA 4EXLA 1UTBA 1B3EA 1MQIA 4LZ8A 4DZ1A 4ZZAA 3S9MC 1NMUA 3MZ9A 4GLIA 5KDTA 5AA2B 3G7WA 1SBPA 1AL3A 4TOZA 4U23A 1PBPA 4HS7A 1FTLA 2B65A 3VVFA 1DTZA 3TPAA 3KJ7A 4GD5A 1S7YA 3TTKA 3G3IA 1EZ9A 4OHNA 4FAJA 1P1WA 3BFTA 3K6XA 5H8QB 3VLUA 3H6WA 2DSFA 3I3VA 3Q26A 3VXBA 1M5FA 3I5OA 3M3LA 2ZYMA 1B40A 1OVBA 1ZLQA 3OMBA 3S9EA 2QMXA 5HPQA 5CMKA 3VLWA 1SYHA 3CG3A 4PETA 1FCKA 1DTGA 2F7CA 1SYIA 4LP2B 2HQ0A 5ELVA 3FXQA 1ELJA 2F7AA 2H4IA 1URDA 1POTA 2Z8DA 1TT1A 3H3GA 1JVYA 2F5XA 1CB6A 3N26A 4KHZE 3SDFA 3SEWA 2VGQA 4OYVA 3TQWA 3B6QA 3R6UA 4RA1A 1QULA 4TLMB 4R2FA 5JEIA 2F34A 4Z7EA 2DWAA 1M5DA 1XVXA 4F19A 5EHMA 4G8HA 5DVJA 1TFDA 1M5EA 3K1NA 2A5SA 1YTVA 1JVXA 3PGFA 3N5LA 1B3HA 5BWJA 1A55A 1H45A 3KJTA 4ELOA 1ZTYA 4QFLA 1R6ZA 3KOTA 1NNFA 1J1NA 2H25A 4G68C 4IGTA 1O64A 2KLFA 4ELRA 1NL5A 4IB2A 4BDOA 2I4CA 3RT6B 3SETA 4EXKA 1Y4CA 4XKNA 3OEMA 3CIJA 3FASA 4FORA 4U4SA 2RC7A 1A7LA 1OLCA 4H6DA 2DWIA 4Z0IA 3RPWA 2DXYA 1EU8A 1LFHA 3IX1A 3FUZA 3RYBA 2H5YA 2REGA 3JV9A 1P99A 3W15C 1P1NA 2WOKA 3ZKLA 2P1SA 3O6PA 3MUQA 4YKIA 2UVJA 3DRKA 1GGGA 1B5JA 1NH8A 2XD3A 1IIWA 2XXTA 3B6TA 4O3BA 4R75A 3MZ1A 4DDDA 1Q35A 1UIVA 1POY1 3L6HA 3A3CA 3MP8A 5FHNA 3V5AA 3IK6B 4FATA 3ILUB 5H8FB 4ZEKA 3DP8A 3Q25A 3IL1B 1OVTA 4XIGQ 1DPPA 4TQUQ 3RNNA 3O9PA 2YPNA 1MM7A 3C33A 3HPIA 3O66A 5HBCA 5ISUA 2Y7PA 4XKPA 2Q2AA 4L17A 3TTRA 2OK2A 1M5CA 2XXHA 4ZEDA 1PC3A 4GFRA 1ZMGA 5JK4A 3MP6A 3MP1A 1JNFA 2VD3A 3U8QA 5HM4B 3EHSA 1Y1ZA 2PBWA 2RCAA 2Z8FA 5I59B 3CFZA 1S9TA 3ZS6A 1LGBC 4QF9A 4WXJA 3KG2A 4E0WA 3K02A 5AA2A 1LFGA 1YAEA 5F1QA 2ZNUA 3FVKA 1QKAA 3DRFA 3RGYA 3MPLA 3O6GA 2O84X 4JDFA 4FE8A 1RYOA 2DVCA 2X7QA 4HW8A 1SW2A 4PFWA 5DVIA 3FVNA 3H6VA 2I4BA 4HCWA 3T9UA 1B3FA 1I6BA 3HHGA 2F6PA 1R9QA 3K4UA 1BKAA 4PP0A 5CRYA 4UACA 2I48A 2OBGA 3ONMA 4EF2A 5CBSA 4LONB 5ICTA 3MC2A 2F6GA 4NF5A 5DVFA 5I2KB 2OCUA 1Z7ME 3FVOA 4P11A 4KR5A 5BUUA 1D9YA 3E13X 3G3HA 3OO7A 4G2ZA 2AYSA 2THIA 2P2AA 3K0VA 5JTYB 4YKPA 3MVXA 2UVHA 3BFUA 1SI1A 1B7UA 3A09A 3CR9A 4RY1A 4F22A 1FW0A 3KOSA 1GV8A 1ATGA 2RKMA 1GR2A 3MZBA 2GFEA 2I3VA 4G8MA 5TP9A 3CHGA 3H06B 3PUZE 3CRBA 4IO6A 1B4ZA 1MXWA 1Y3NA 4ZE9A 1B7ZA 1MQJA 3EN3A 4NWCA 4FECA 5JTYA 4F1YA 3TDJA 4YICA 3VDFA 4GWOA 5A5XB 4ZE8A 3U94A 4FEBA 3JYRA 2D3IA 4GF8A 4MF3A 3RUMA 1FQDA 4F3PA 4ESWA 3UIFA 4N6PA 1JW5A 1S50A 1FTJA 2Q88A 3O97A 1MM6A 3DRHA 3ILTB 3QYTA 3SESA 1YPNA 3K01A 2A5TB 5TP9B 2HAVA 4KI0E 3VE1B 3KBRA 4PFUA 4GXAA 4GL8A 4OERA 4KFQA 5H8NB 3MVYA 3P7IA 1LSTA 4GIZA 4LUBA 1FTKA 4U2RA 2Q8JA 3K00A 3GXAA 3KEIA 4QFKA 1B6HA 1MPBA 3E4RA 4XXUA 1QVSA 1ZBMA 1B58A 4C1UA 2QJEA 5CI5A 2PYYA 4YZZA 1LAFE 4F31B 3LSXA 1T0KA 2Z8EA 3Q29A 4NF8A 4R6HA 1OQHA 3IOTA 3ODBA 4IO7A 1AMFA 4OETA 2ZXTA 3MBPA 1R1NA 4JWYA 4QFNA 4N07A 2IEEA 4DCXA 1B2HA 3GLBA 2PT1A 2Q9TA 4KQPA 4OZ9A 1SI0A 3OO8A 4QSEA 3D4GA 3FJGA 3PUWE 3CSGA 3QXMA 1MPDA 3T22A 2DWHA 4IO3A 3DP6A 2G29A 5F7VA 3RY3A 5I58B 5B7DA 4DCYA 3RT8A 2D21A 2DOJA 3QUJA 2F7BA 4Q5TA 1EH3A 3LSFB 4I1DA 4POXA 3PV0E 3T9XB 5I2NB 5I57A 4EQBA 2HZKA 4OFOA 3FTOA 4ONYA 4YMAA 3PMVA 4NF4B 4PFYA 1JEUA 1IXCA 1N0TA 2F8DA 3LVUA 4NF6B 4QSCA 1IXHA 4ZECA 4BLAA 2I49A 1US4A 2QPQA 4KCCA 4MLQA 1P1UA 5TPAB 3HSTA 3IOVA 3PMXA 1MY4A 3W9VA 2O68A 3T93B 1LBBA 2ZYOA 2OWSA 1PEBA 1A99A 4G8NA 2REJA 3QAXA 1JQFA 1GVCA 3QK6A 1FQEA 5H8NA 5L8DA 4I8CA 1QUKA 4OFJA 1MG1A 1XT8A 1MPCA 1FQBA 1I6QA 3QIMA 1BLFA 1ZIUA 2F36A 2A5TA 2Z22A 4OESA 3C32A 5FHOA 1ZU0A 1XC1A 3CG1A 2HEUA 3N6TA 2E0SA 2AL4A 5ITPA 4YMBA 2B3BA 5AA4A 5AA3A 1L5TA 3RTWB 3UA8A 4F29A 2XXPA 2BJJX 1MQDA 4EF1A 1TFAA 5B70A 3V83A 1JW4A 1XOCA 3FVGA 1Y1MA 1N04A 4U1ZA 1YCJA 3H03A 1MXYA 5CMBA 5H8SA 1B7HA 3SERA 4ELPA 4WEDA 2VP1A 3B6WA 4LQ2A 3L6GA 3LUYA 1B1XA 1B1HA 5H8HB 2XXWA 3PPOA 1M5BA 1CE2A 2DQVA 1MH4A 3Q28A 1MQGA 1PDAA 3QUFA 4FIMA 1DPEA 4U21A 3S4UA 3SKPA 4C0RA 3HCQA 2ONKE 4MFIA 2QL3A 4DIGA 3FJ7A 4MBPA 2FYIA 3FJMA 1IZ1A 4F1VA 2ESNA 5CM6A 3RQTA 2H9BA 5H8HA 3TFLA 3TMGA 4ELQA 3O6HA 5I2KA 3TUSA 2IA4A 3SEXA 2O69A 5I84A 1A54A 3OO9A 4H5GA 1LLSA 1IXIA 2B4MA 1N3WA 1N7XA 4ISUA 4OQOA 4BDLA 4NE4A 3UN6A 4AQ4A 3O28A 4H8JA 3AXFA 1GTKA 3LSWA 3LSLA 3DLNA 1EZPA 4NMYA 5AA4B 2ZYNA 2V3QA 1A40A 3IOUA 2PX1A 3LR1A 4GRKA 3C9HA 3IORA 2RCBA 4GQOA 2DP8A 4JWOA 4U4XA 2HCAA 3M8UA 1A8EA 3E3KA 4Q0CA 1PB9A 4EQ9A 4OWDA 5I56A 4GOTA 4BDRA 1MH3A 2XXXA 3IJXB 3OXNA 1Y3QA 2B3FA 2I58A 4RJZA 4RPOA 1Y9UA 2XXYA 4G4PA 3U72A 4YKJA 4JSOA 4E0XA 5KCJA 2OWTA 2O1LA 3OELA 4N13A 2DVZA 1PB7A 4F3GA 2ANJA 3MPKA 3FXUA 4I9DA 3KGCA 2QS3A 1UTHA 1HSLA 1OIBA 2CMOA 3GZGA 5TPAA 3MW0A 1I69A 1UTHB 2Q89A 2QS1A 3HN0A 3MQ9A 1FQCA 2XXIA 3C36A 1NKXA 2B4LA 3OOAA 2V3TA 3H7MA 3IB2A 3HO7A 3K1PA 4H1XA 5FTHA 4IY5A 4EQ7A 3EF7A 4NF4A 4DLDA 5KCJB 2ONRA 3IR1A 4MLVA 4F3SA 2XD2A 1HSEA 1DSNA 1Y4TA 5L9OA 3USDA 5I2NA 3OD7A 3PPNA 4JBZA 3IJOB 4IO5A 4MH5A 1USYE 1MQHA 4HTGA 4POWA 4BDNA 3BKIB 3IO6A 3JZJA 4X1BA 3T96B 2R6GE 5I58A 5L9SA 4KPTA 1P1OA 1SW1A 4IO4A 1B51A 5AA1A 5AE4A 3TODA 3ZSFA 1MY2A 2F78A 2O7UA 3UK4A 2X26A 2O6AA 1VFEA 2XX9A 4JB7A 2RC8A 2RF1A 2GH9A 3O29A 2FNCA 3R7XA 4H8IA 3OSRA 3S9LC 2PMSA 1QW0A 1B3LA 1FTMA 1SQYA 1MXXA 2Y7KA 3A3UA 3TTLA 5J1DA 1ZJLA 2LAOA 1LB8A 3V8XB 1NFTA 3EHTA 3CVGA 4I62A 2X7PA 4NTLA 2RC9A 3CFLA 3ECRA 1PBQA 1VSOA 2R9JA 2XHDA 4ZEBA 2ABHA 3FV2A 5EHSA 4RK9A 1MS7A 3LC8A 1NH7A 3TTNA 2G93A 3TTMA 3TYHA 3PPRA 1MY0A 1D9VA 1AOVA 4TLLB 3U92A 1QUIA 3VLVA 4DE8A 2UVIA 4C1TA 3C31A 4PQJA 3DRIA 3MWBA 1UQWA 5FHMA 2WOLA 4ND9A 4PE5B 1KWHA 3R26A 2DE3A 4KYEA 4QSDA 3KZGA 4U1OA 4UA8A 4K3FA 3HHFA 3PUXE 3D4CA 1LCFA 4WKMA 3T9HB 5A5XA 1QUJA 3KN8A 3TCGA 1UIUA 3TEPA 2Z23A 2NUVA 1N3XA 2QS4A 3K6WA 1MY3A 4FEDA 3IO4A 3O6IA 4GL0A 2VHAA 1TXFA 3PU5A 2Y84A 3M3KA 4KYSA 3WAEA 1O63A 4QHQA 3K6VA 4Q8RA 1JW1A 1SD3A 1OMPA 2GHAA 1ZKBA 3K6UA 4DXCA 4ESXA 1F9BA 3S2VA 3FATA 1TWYA 1SVXB 3MJNA 4IGRA 5DTBA 5H8QA 5AA2D 3G3FA 2AIXA 1N84A 4NWDA 4O3CA 1JEVA 3PPPA 1B3GA 1LAXA 3OENA 3FZVA 4U22A 4QRZA 4XTCQ 1RKMA 4OENA 1A8FA 1RYXA 2UYEA 4OTEA 1WDNA 5KDTB 4NF5B 4NF6A 1MXUA 4R6YA 4DXUA 2H99A 3E9XA 2ONSA 4M1VA 5I57B 2ZYKA 3DP4A 3T66A 2I0CA 4YB7A 2ZNSA 2V93A 3FXRA 4OVJA 2XXUA 3F11A 1H3DA 4KCDA 3MVZA 4QFOA 2Y7RA 4JXIA 3FV1A 2XXVA 4P0GA 3V89B 1Z7NE 2V84A 3FGSA 3U93A 4F2OA 5DEXB 1FTOA 4M4GA 3KN3A 4OEUA 1LAGE 1XHYA 2ALUA 2DE2A 4H0WA 4HCYA 1LCTA 4LVQA 5K2YA 1LFIA 3RTFB 3PUVE 4NEDA 3WAFA 4NF8B 2O1MA 3DRJA 2F97A 4RXLA 3T9VA 3BBRA 5M2VA 3UP9A 4YB6A 1BIYA 2P0SA 1NNTA 2DWJA 4KYDA 5KZTA 3KSJA 1B0HA 4ECFA 1URSA 1H76A 1OLAA 1SW5A 1N7WA 2ZMBA 4P0IA 4R9FA 5DYHA 5CC2A 3RYAA 1ANFA 3W9WA 4G77A 2W7YA 5K2XA 1DOTA 1MXZA 3VVDA 3RLFE 1B9JA 1D3KA 3OEKA 5H8FA 1VE4A 4X48A 2QSXA 3KN7A 3DM0A 4BDQA 4X9TA 3PD9A 5ITOA 1XS5A 2CZLA 2XX8A 4DXBA 1B5IA 4GXSB 3CFXA 4JWXA 3I6VA 1B0LA 3C34A 2V25A 4YKKA 1I6AA 5FTIA 5L9MA 2NWJA 1AH5A 5CMCA 1OQGA 1SDXA 3CSBA 1SW4A 3IAZA 3TCFA 4XKRA 1D4NA 1H44A 2PT2A 2VD2A 3HV1A 3B7DA 4WEPA 5DEXA 4R74A 2OJTA 5I56B 1B32A 2ZNTA 5I59A 2V3UA 1II5A 4OMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEU A;  1WVJ A;  4IO2 A;  5LOM A;  1US5 A;  2QMW A;  1LB9 A;  2E1S A;  5CMM A;  2PVU A;  5DT6 A;  4LA9 A;  3TCH A;  1VR5 A;  3VFJ A;  2HAU A;  4YB5 A;  3TAJ A;  1USY H;  4FJP A;  2HXW A;  1DMB A;  5CBR A;  2OLB A;  4RK2 A;  2NOO A;  4F1U A;  5IAI A;  2QRY A;  3PD8 A;  4OXV A;  3H6T A;  1Y20 A;  3M3F A;  1B46 A;  4G68 A;  4OEV A;  2NVU B;  1B5H A;  3Q27 A;  4BDM A;  1AIV A;  4QFP A;  1PB8 A;  4G68 B;  2WKY A;  1MXV A;  1R9L A;  3PUY E;  1WOD A;  4R6K A;  3TQL A;  3S9N C;  2I0B A;  5EYF A;  2UYF A;  4PFT A;  3PMW A;  4AB6 A;  1JET A;  2DXR A;  2D5W A;  1BP5 A;  3MVW A;  2F35 A;  3LBS A;  3UOR A;  3PAM A;  3TKD A;  1B4H A;  3FD3 A;  3GBA A;  1LAH E;  4F39 A;  1NNP A;  1EZO A;  4YAH X;  3SEY A;  4GVO A;  3IB0 A;  2O7I A;  2I6E A;  3H6U A;  3N94 A;  4Q30 B;  4XKQ A;  4ZZE A;  1Q1K A;  3THI A;  3UGW A;  2NXO A;  4LZ5 A;  4F2Q A;  1B05 A;  1MRP A;  3FIR A;  2YJP A;  2UXA A;  3O2A A;  3PPQ A;  4R9G A;  4YU0 A;  1FQF A;  4O3A A;  3SEV A;  2Q2C A;  2VOZ A;  4JSD A;  2HZL A;  4KD5 A;  4RNS A;  3G3K A;  3ZKK A;  2DE4 A;  2XX7 A;  3N6U A;  3GBB A;  3K2D A;  2UVG A;  4RPN A;  1Y3P A;  1QKB A;  1HSJ A;  4LAT A;  1MDQ A;  1QJM A;  3CI8 A;  1P1Q A;  4RYA A;  1N76 A;  2H98 A;  1XVY A;  2Y7W A;  1O7T A;  4ZEI A;  4H65 A;  1MY1 A;  2GHB A;  1IUD A;  3EHU A;  1IQ7 A;  1UTB B;  1BTJ A;  3G3J A;  4ZDM A;  3TEL A;  3U1O A;  4R72 A;  1LBC A;  2XXQ A;  1IXG A;  4X1D A;  5ICQ A;  4EUO A;  1VFD A;  1FQA A;  1IEJ A;  2YLN A;  3OSQ A;  4H67 A;  2QS2 A;  3C35 A;  3VVE A;  4F3B A;  2WOP A;  2AL5 A;  4EDP A;  3IOW A;  3K1M A;  4IY6 A;  2OZZ A;  1NNK A;  4R73 A;  4ZEF A;  2DS9 A;  3EQ1 A;  3MAM A;  3TZA A;  4F18 A;  4OFL A;  4LZ7 A;  5TU0 A;  1URG A;  3DEL B;  2GRV A;  3RN8 A;  1IIT A;  3G3G A;  2Y7I A;  3QSL A;  3OO6 A;  2HFB A;  3VV5 A;  5IKB A;  2I3W A;  3IB1 A;  1MDP 1;  3VXC A;  3KFM A;  3KSX A;  3DRG A;  1H43 A;  2M8C A;  2R71 A;  2FA7 A;  2XXR A;  2RIN A;  3EPE A;  3H4Z A;  4THI A;  4ZS9 A;  4AB5 A;  4LQ5 A;  2O51 A;  1B52 A;  3C4M A;  4H5F A;  2DYX A;  4R2B A;  4EXL A;  1UTB A;  1B3E A;  1MQI A;  4LZ8 A;  4DZ1 A;  4ZZA A;  3S9M C;  1NMU A;  3MZ9 A;  4GLI A;  5KDT A;  5AA2 B;  3G7W A;  1SBP A;  1AL3 A;  4TOZ A;  4U23 A;  1PBP A;  4HS7 A;  1FTL A;  2B65 A;  3VVF A;  1DTZ A;  3TPA A;  3KJ7 A;  4GD5 A;  1S7Y A;  3TTK A;  3G3I A;  1EZ9 A;  4OHN A;  4FAJ A;  1P1W A;  3BFT A;  3K6X A;  5H8Q B;  3VLU A;  3H6W A;  2DSF A;  3I3V A;  3Q26 A;  3VXB A;  1M5F A;  3I5O A;  3M3L A;  2ZYM A;  1B40 A;  1OVB A;  1ZLQ A;  3OMB A;  3S9E A;  2QMX A;  5HPQ A;  5CMK A;  3VLW A;  1SYH A;  3CG3 A;  4PET A;  1FCK A;  1DTG A;  2F7C A;  1SYI A;  4LP2 B;  2HQ0 A;  5ELV A;  3FXQ A;  1ELJ A;  2F7A A;  2H4I A;  1URD A;  1POT A;  2Z8D A;  1TT1 A;  3H3G A;  1JVY A;  2F5X A;  1CB6 A;  3N26 A;  4KHZ E;  3SDF A;  3SEW A;  2VGQ A;  4OYV A;  3TQW A;  3B6Q A;  3R6U A;  4RA1 A;  1QUL A;  4TLM B;  4R2F A;  5JEI A;  2F34 A;  4Z7E A;  2DWA A;  1M5D A;  1XVX A;  4F19 A;  5EHM A;  4G8H A;  5DVJ A;  1TFD A;  1M5E A;  3K1N A;  2A5S A;  1YTV A;  1JVX A;  3PGF A;  3N5L A;  1B3H A;  5BWJ A;  1A55 A;  1H45 A;  3KJT A;  4ELO A;  1ZTY A;  4QFL A;  1R6Z A;  3KOT A;  1NNF A;  1J1N A;  2H25 A;  4G68 C;  4IGT A;  1O64 A;  2KLF A;  4ELR A;  1NL5 A;  4IB2 A;  4BDO A;  2I4C A;  3RT6 B;  3SET A;  4EXK A;  1Y4C A;  4XKN A;  3OEM A;  3CIJ A;  3FAS A;  4FOR A;  4U4S A;  2RC7 A;  1A7L A;  1OLC A;  4H6D A;  2DWI A;  4Z0I A;  3RPW A;  2DXY A;  1EU8 A;  1LFH A;  3IX1 A;  3FUZ A;  3RYB A;  2H5Y A;  2REG A;  3JV9 A;  1P99 A;  3W15 C;  1P1N A;  2WOK A;  3ZKL A;  2P1S A;  3O6P A;  3MUQ A;  4YKI A;  2UVJ A;  3DRK A;  1GGG A;  1B5J A;  1NH8 A;  2XD3 A;  1IIW A;  2XXT A;  3B6T A;  4O3B A;  4R75 A;  3MZ1 A;  4DDD A;  1Q35 A;  1UIV A;  1POY 1;  3L6H A;  3A3C A;  3MP8 A;  5FHN A;  3V5A A;  3IK6 B;  4FAT A;  3ILU B;  5H8F B;  4ZEK A;  3DP8 A;  3Q25 A;  3IL1 B;  1OVT A;  4XIG Q;  1DPP A;  4TQU Q;  3RNN A;  3O9P A;  2YPN A;  1MM7 A;  3C33 A;  3HPI A;  3O66 A;  5HBC A;  5ISU A;  2Y7P A;  4XKP A;  2Q2A A;  4L17 A;  3TTR A;  2OK2 A;  1M5C A;  2XXH A;  4ZED A;  1PC3 A;  4GFR A;  1ZMG A;  5JK4 A;  3MP6 A;  3MP1 A;  1JNF A;  2VD3 A;  3U8Q A;  5HM4 B;  3EHS A;  1Y1Z A;  2PBW A;  2RCA A;  2Z8F A;  5I59 B;  3CFZ A;  1S9T A;  3ZS6 A;  1LGB C;  4QF9 A;  4WXJ A;  3KG2 A;  4E0W A;  3K02 A;  5AA2 A;  1LFG A;  1YAE A;  5F1Q A;  2ZNU A;  3FVK A;  1QKA A;  3DRF A;  3RGY A;  3MPL A;  3O6G A;  2O84 X;  4JDF A;  4FE8 A;  1RYO A;  2DVC A;  2X7Q A;  4HW8 A;  1SW2 A;  4PFW A;  5DVI A;  3FVN A;  3H6V A;  2I4B A;  4HCW A;  3T9U A;  1B3F A;  1I6B A;  3HHG A;  2F6P A;  1R9Q A;  3K4U A;  1BKA A;  4PP0 A;  5CRY A;  4UAC A;  2I48 A;  2OBG A;  3ONM A;  4EF2 A;  5CBS A;  4LON B;  5ICT A;  3MC2 A;  2F6G A;  4NF5 A;  5DVF A;  5I2K B;  2OCU A;  1Z7M E;  3FVO A;  4P11 A;  4KR5 A;  5BUU A;  1D9Y A;  3E13 X;  3G3H A;  3OO7 A;  4G2Z A;  2AYS A;  2THI A;  2P2A A;  3K0V A;  5JTY B;  4YKP A;  3MVX A;  2UVH A;  3BFU A;  1SI1 A;  1B7U A;  3A09 A;  3CR9 A;  4RY1 A;  4F22 A;  1FW0 A;  3KOS A;  1GV8 A;  1ATG A;  2RKM A;  1GR2 A;  3MZB A;  2GFE A;  2I3V A;  4G8M A;  5TP9 A;  3CHG A;  3H06 B;  3PUZ E;  3CRB A;  4IO6 A;  1B4Z A;  1MXW A;  1Y3N A;  4ZE9 A;  1B7Z A;  1MQJ A;  3EN3 A;  4NWC A;  4FEC A;  5JTY A;  4F1Y A;  3TDJ A;  4YIC A;  3VDF A;  4GWO A;  5A5X B;  4ZE8 A;  3U94 A;  4FEB A;  3JYR A;  2D3I A;  4GF8 A;  4MF3 A;  3RUM A;  1FQD A;  4F3P A;  4ESW A;  3UIF A;  4N6P A;  1JW5 A;  1S50 A;  1FTJ A;  2Q88 A;  3O97 A;  1MM6 A;  3DRH A;  3ILT B;  3QYT A;  3SES A;  1YPN A;  3K01 A;  2A5T B;  5TP9 B;  2HAV A;  4KI0 E;  3VE1 B;  3KBR A;  4PFU A;  4GXA A;  4GL8 A;  4OER A;  4KFQ A;  5H8N B;  3MVY A;  3P7I A;  1LST A;  4GIZ A;  4LUB A;  1FTK A;  4U2R A;  2Q8J A;  3K00 A;  3GXA A;  3KEI A;  4QFK A;  1B6H A;  1MPB A;  3E4R A;  4XXU A;  1QVS A;  1ZBM A;  1B58 A;  4C1U A;  2QJE A;  5CI5 A;  2PYY A;  4YZZ A;  1LAF E;  4F31 B;  3LSX A;  1T0K A;  2Z8E A;  3Q29 A;  4NF8 A;  4R6H A;  1OQH A;  3IOT A;  3ODB A;  4IO7 A;  1AMF A;  4OET A;  2ZXT A;  3MBP A;  1R1N A;  4JWY A;  4QFN A;  4N07 A;  2IEE A;  4DCX A;  1B2H A;  3GLB A;  2PT1 A;  2Q9T A;  4KQP A;  4OZ9 A;  1SI0 A;  3OO8 A;  4QSE A;  3D4G A;  3FJG A;  3PUW E;  3CSG A;  3QXM A;  1MPD A;  3T22 A;  2DWH A;  4IO3 A;  3DP6 A;  2G29 A;  5F7V A;  3RY3 A;  5I58 B;  5B7D A;  4DCY A;  3RT8 A;  2D21 A;  2DOJ A;  3QUJ A;  2F7B A;  4Q5T A;  1EH3 A;  3LSF B;  4I1D A;  4POX A;  3PV0 E;  3T9X B;  5I2N B;  5I57 A;  4EQB A;  2HZK A;  4OFO A;  3FTO A;  4ONY A;  4YMA A;  3PMV A;  4NF4 B;  4PFY A;  1JEU A;  1IXC A;  1N0T A;  2F8D A;  3LVU A;  4NF6 B;  4QSC A;  1IXH A;  4ZEC A;  4BLA A;  2I49 A;  1US4 A;  2QPQ A;  4KCC A;  4MLQ A;  1P1U A;  5TPA B;  3HST A;  3IOV A;  3PMX A;  1MY4 A;  3W9V A;  2O68 A;  3T93 B;  1LBB A;  2ZYO A;  2OWS A;  1PEB A;  1A99 A;  4G8N A;  2REJ A;  3QAX A;  1JQF A;  1GVC A;  3QK6 A;  1FQE A;  5H8N A;  5L8D A;  4I8C A;  1QUK A;  4OFJ A;  1MG1 A;  1XT8 A;  1MPC A;  1FQB A;  1I6Q A;  3QIM A;  1BLF A;  1ZIU A;  2F36 A;  2A5T A;  2Z22 A;  4OES A;  3C32 A;  5FHO A;  1ZU0 A;  1XC1 A;  3CG1 A;  2HEU A;  3N6T A;  2E0S A;  2AL4 A;  5ITP A;  4YMB A;  2B3B A;  5AA4 A;  5AA3 A;  1L5T A;  3RTW B;  3UA8 A;  4F29 A;  2XXP A;  2BJJ X;  1MQD A;  4EF1 A;  1TFA A;  5B70 A;  3V83 A;  1JW4 A;  1XOC A;  3FVG A;  1Y1M A;  1N04 A;  4U1Z A;  1YCJ A;  3H03 A;  1MXY A;  5CMB A;  5H8S A;  1B7H A;  3SER A;  4ELP A;  4WED A;  2VP1 A;  3B6W A;  4LQ2 A;  3L6G A;  3LUY A;  1B1X A;  1B1H A;  5H8H B;  2XXW A;  3PPO A;  1M5B A;  1CE2 A;  2DQV A;  1MH4 A;  3Q28 A;  1MQG A;  1PDA A;  3QUF A;  4FIM A;  1DPE A;  4U21 A;  3S4U A;  3SKP A;  4C0R A;  3HCQ A;  2ONK E;  4MFI A;  2QL3 A;  4DIG A;  3FJ7 A;  4MBP A;  2FYI A;  3FJM A;  1IZ1 A;  4F1V A;  2ESN A;  5CM6 A;  3RQT A;  2H9B A;  5H8H A;  3TFL A;  3TMG A;  4ELQ A;  3O6H A;  5I2K A;  3TUS A;  2IA4 A;  3SEX A;  2O69 A;  5I84 A;  1A54 A;  3OO9 A;  4H5G A;  1LLS A;  1IXI A;  2B4M A;  1N3W A;  1N7X A;  4ISU A;  4OQO A;  4BDL A;  4NE4 A;  3UN6 A;  4AQ4 A;  3O28 A;  4H8J A;  3AXF A;  1GTK A;  3LSW A;  3LSL A;  3DLN A;  1EZP A;  4NMY A;  5AA4 B;  2ZYN A;  2V3Q A;  1A40 A;  3IOU A;  2PX1 A;  3LR1 A;  4GRK A;  3C9H A;  3IOR A;  2RCB A;  4GQO A;  2DP8 A;  4JWO A;  4U4X A;  2HCA A;  3M8U A;  1A8E A;  3E3K A;  4Q0C A;  1PB9 A;  4EQ9 A;  4OWD A;  5I56 A;  4GOT A;  4BDR A;  1MH3 A;  2XXX A;  3IJX B;  3OXN A;  1Y3Q A;  2B3F A;  2I58 A;  4RJZ A;  4RPO A;  1Y9U A;  2XXY A;  4G4P A;  3U72 A;  4YKJ A;  4JSO A;  4E0X A;  5KCJ A;  2OWT A;  2O1L A;  3OEL A;  4N13 A;  2DVZ A;  1PB7 A;  4F3G A;  2ANJ A;  3MPK A;  3FXU A;  4I9D A;  3KGC A;  2QS3 A;  1UTH A;  1HSL A;  1OIB A;  2CMO A;  3GZG A;  5TPA A;  3MW0 A;  1I69 A;  1UTH B;  2Q89 A;  2QS1 A;  3HN0 A;  3MQ9 A;  1FQC A;  2XXI A;  3C36 A;  1NKX A;  2B4L A;  3OOA A;  2V3T A;  3H7M A;  3IB2 A;  3HO7 A;  3K1P A;  4H1X A;  5FTH A;  4IY5 A;  4EQ7 A;  3EF7 A;  4NF4 A;  4DLD A;  5KCJ B;  2ONR A;  3IR1 A;  4MLV A;  4F3S A;  2XD2 A;  1HSE A;  1DSN A;  1Y4T A;  5L9O A;  3USD A;  5I2N A;  3OD7 A;  3PPN A;  4JBZ A;  3IJO B;  4IO5 A;  4MH5 A;  1USY E;  1MQH A;  4HTG A;  4POW A;  4BDN A;  3BKI B;  3IO6 A;  3JZJ A;  4X1B A;  3T96 B;  2R6G E;  5I58 A;  5L9S A;  4KPT A;  1P1O A;  1SW1 A;  4IO4 A;  1B51 A;  5AA1 A;  5AE4 A;  3TOD A;  3ZSF A;  1MY2 A;  2F78 A;  2O7U A;  3UK4 A;  2X26 A;  2O6A A;  1VFE A;  2XX9 A;  4JB7 A;  2RC8 A;  2RF1 A;  2GH9 A;  3O29 A;  2FNC A;  3R7X A;  4H8I A;  3OSR A;  3S9L C;  2PMS A;  1QW0 A;  1B3L A;  1FTM A;  1SQY A;  1MXX A;  2Y7K A;  3A3U A;  3TTL A;  5J1D A;  1ZJL A;  2LAO A;  1LB8 A;  3V8X B;  1NFT A;  3EHT A;  3CVG A;  4I62 A;  2X7P A;  4NTL A;  2RC9 A;  3CFL A;  3ECR A;  1PBQ A;  1VSO A;  2R9J A;  2XHD A;  4ZEB A;  2ABH A;  3FV2 A;  5EHS A;  4RK9 A;  1MS7 A;  3LC8 A;  1NH7 A;  3TTN A;  2G93 A;  3TTM A;  3TYH A;  3PPR A;  1MY0 A;  1D9V A;  1AOV A;  4TLL B;  3U92 A;  1QUI A;  3VLV A;  4DE8 A;  2UVI A;  4C1T A;  3C31 A;  4PQJ A;  3DRI A;  3MWB A;  1UQW A;  5FHM A;  2WOL A;  4ND9 A;  4PE5 B;  1KWH A;  3R26 A;  2DE3 A;  4KYE A;  4QSD A;  3KZG A;  4U1O A;  4UA8 A;  4K3F A;  3HHF A;  3PUX E;  3D4C A;  1LCF A;  4WKM A;  3T9H B;  5A5X A;  1QUJ A;  3KN8 A;  3TCG A;  1UIU A;  3TEP A;  2Z23 A;  2NUV A;  1N3X A;  2QS4 A;  3K6W A;  1MY3 A;  4FED A;  3IO4 A;  3O6I A;  4GL0 A;  2VHA A;  1TXF A;  3PU5 A;  2Y84 A;  3M3K A;  4KYS A;  3WAE A;  1O63 A;  4QHQ A;  3K6V A;  4Q8R A;  1JW1 A;  1SD3 A;  1OMP A;  2GHA A;  1ZKB A;  3K6U A;  4DXC A;  4ESX A;  1F9B A;  3S2V A;  3FAT A;  1TWY A;  1SVX B;  3MJN A;  4IGR A;  5DTB A;  5H8Q A;  5AA2 D;  3G3F A;  2AIX A;  1N84 A;  4NWD A;  4O3C A;  1JEV A;  3PPP A;  1B3G A;  1LAX A;  3OEN A;  3FZV A;  4U22 A;  4QRZ A;  4XTC Q;  1RKM A;  4OEN A;  1A8F A;  1RYX A;  2UYE A;  4OTE A;  1WDN A;  5KDT B;  4NF5 B;  4NF6 A;  1MXU A;  4R6Y A;  4DXU A;  2H99 A;  3E9X A;  2ONS A;  4M1V A;  5I57 B;  2ZYK A;  3DP4 A;  3T66 A;  2I0C A;  4YB7 A;  2ZNS A;  2V93 A;  3FXR A;  4OVJ A;  2XXU A;  3F11 A;  1H3D A;  4KCD A;  3MVZ A;  4QFO A;  2Y7R A;  4JXI A;  3FV1 A;  2XXV A;  4P0G A;  3V89 B;  1Z7N E;  2V84 A;  3FGS A;  3U93 A;  4F2O A;  5DEX B;  1FTO A;  4M4G A;  3KN3 A;  4OEU A;  1LAG E;  1XHY A;  2ALU A;  2DE2 A;  4H0W A;  4HCY A;  1LCT A;  4LVQ A;  5K2Y A;  1LFI A;  3RTF B;  3PUV E;  4NED A;  3WAF A;  4NF8 B;  2O1M A;  3DRJ A;  2F97 A;  4RXL A;  3T9V A;  3BBR A;  5M2V A;  3UP9 A;  4YB6 A;  1BIY A;  2P0S A;  1NNT A;  2DWJ A;  4KYD A;  5KZT A;  3KSJ A;  1B0H A;  4ECF A;  1URS A;  1H76 A;  1OLA A;  1SW5 A;  1N7W A;  2ZMB A;  4P0I A;  4R9F A;  5DYH A;  5CC2 A;  3RYA A;  1ANF A;  3W9W A;  4G77 A;  2W7Y A;  5K2X A;  1DOT A;  1MXZ A;  3VVD A;  3RLF E;  1B9J A;  1D3K A;  3OEK A;  5H8F A;  1VE4 A;  4X48 A;  2QSX A;  3KN7 A;  3DM0 A;  4BDQ A;  4X9T A;  3PD9 A;  5ITO A;  1XS5 A;  2CZL A;  2XX8 A;  4DXB A;  1B5I A;  4GXS B;  3CFX A;  4JWX A;  3I6V A;  1B0L A;  3C34 A;  2V25 A;  4YKK A;  1I6A A;  5FTI A;  5L9M A;  2NWJ A;  1AH5 A;  5CMC A;  1OQG A;  1SDX A;  3CSB A;  1SW4 A;  3IAZ A;  3TCF A;  4XKR A;  1D4N A;  1H44 A;  2PT2 A;  2VD2 A;  3HV1 A;  3B7D A;  4WEP A;  5DEX A;  4R74 A;  2OJT A;  5I56 B;  1B32 A;  2ZNT A;  5I59 A;  2V3U A;  1II5 A;  4OMB A; 
#chains in the Genus database with same CATH topology
 5LOM A;  2QMW A;  5CMM A;  1LB9 A;  3VFJ A;  4YB5 A;  1USY H;  4FJP A;  4PAK A;  3EKI A;  2NOO A;  2QRY A;  1B5H A;  4BDM A;  4PF8 A;  1JET A;  3MVW A;  1NV3 A;  4F39 A;  3GBA A;  1NNP A;  4YAH X;  4GVO A;  3IB0 A;  3H6U A;  4LZ5 A;  4F2Q A;  1B05 A;  3O2A A;  4YU0 A;  1FQF A;  1NV2 A;  2VOZ A;  3G3K A;  3GBB A;  3U65 A;  2HXR A;  4RPN A;  1Y3P A;  4LAT A;  3CI8 A;  4RYA A;  1XVY A;  1O7T A;  1MY1 A;  2P3V A;  3MYU A;  2XXQ A;  1IXG A;  1VFD A;  2VPO A;  4IY6 A;  3K1M A;  4R73 A;  4F18 A;  4NN3 A;  4P3L A;  1IIT A;  3OO6 A;  3KSX A;  3H4Z A;  2XXR A;  4ZS9 A;  4PE3 A;  4H5F A;  4EXL A;  4GBW A;  1FPK A;  1NV0 A;  3SZP A;  4HS7 A;  1DTZ A;  3TPA A;  3TTK A;  4FAJ A;  3VLU A;  5H8Q B;  3H6W A;  2ZZW A;  1M5F A;  2ZYM A;  4HE1 A;  1OVB A;  2QMX A;  1SYH A;  1FCK A;  1SYI A;  2DDK A;  2HQ0 A;  3FXQ A;  2F7A A;  1URD A;  1CB6 A;  4OYV A;  4PF6 A;  3B6Q A;  2QVR A;  4TLM B;  4R2F A;  5JEI A;  2DWA A;  5EHM A;  3PGF A;  5DW8 A;  4XF5 A;  4QFL A;  1LEV A;  4G68 C;  2KLF A;  4EXK A;  1Y4C A;  4DI3 D;  4P56 A;  3FAS A;  2RC7 A;  1OLC A;  3ROJ A;  2DXY A;  1LFH A;  5LDZ A;  3FUZ A;  1P99 A;  2HHM A;  3MUQ A;  2UVJ A;  4O3B A;  1NH8 A;  5FHN A;  4GWU A;  3ILU B;  3IL1 B;  1SPI A;  1OVT A;  3TAJ A;  5HBC A;  5I3S A;  5ISU A;  4MJO A;  5JK4 A;  3MP6 A;  1JNF A;  3U8Q A;  3EHS A;  2PBW A;  5IM2 A;  3O6G A;  4FE8 A;  1RYO A;  2X7Q A;  1SW2 A;  4PFW A;  4HCW A;  3A29 A;  1BKA A;  4EF2 A;  2I48 A;  3ONM A;  1INP A;  2F6G A;  1Z7M E;  2HPG A;  1NV4 A;  4KR5 A;  2P2A A;  3K0V A;  4RY1 A;  1B7U A;  1CNQ A;  4PGN A;  1ATG A;  1GV8 A;  4IO6 A;  3CRB A;  4FEC A;  3VDF A;  4FEB A;  2D3I A;  3RUM A;  4N6P A;  1JW5 A;  1S50 A;  2Q88 A;  3QYT A;  1MM6 A;  3ILT B;  1YPN A;  2HAV A;  3VE1 B;  3KBR A;  4PFU A;  4KFQ A;  3MVY A;  3P7I A;  4LUB A;  4U2R A;  1B6H A;  1MPB A;  3ISP A;  4XXU A;  2QJE A;  2ZXT A;  4N07 A;  3GLB A;  3OO8 A;  3CSG A;  3QXM A;  4P47 A;  3T22 A;  1BK4 A;  1YXI A;  5F7V A;  5I58 B;  4DCY A;  2FBP A;  2Y5L A;  4I1D A;  5I2N B;  4JVD A;  4OFO A;  3PMV A;  1JEU A;  1N0T A;  4NF6 B;  1IXH A;  4ZEC A;  1KA1 A;  4N81 A;  5TPA B;  3HST A;  4HE2 A;  3T93 B;  2CZK A;  1LBB A;  3QMF A;  4G8N A;  1JQF A;  1FQE A;  1I6Q A;  1ZIU A;  1KA0 A;  2A5T A;  5FHO A;  4XFE A;  5ITP A;  4YMB A;  3UA8 A;  3BIG A;  3V83 A;  5H8S A;  4U1Z A;  3H03 A;  3S4U A;  1IMA A;  5ET7 A;  2QL3 A;  1FJ6 A;  3FJ7 A;  2FYI A;  3RQT A;  3TMG A;  4ELQ A;  2IA4 A;  4H5G A;  4ISU A;  2VT5 A;  4BDL A;  4NE4 A;  3O28 A;  1FBE A;  3LSL A;  4GRK A;  2RCB A;  4Q0C A;  4PGP A;  4GOT A;  2XXX A;  5I5P A;  1Y9U A;  4E0X A;  4N13 A;  2DVZ A;  4F3G A;  2ANJ A;  3KGC A;  3E78 A;  2QS3 A;  1UTH A;  4DXC A;  2CMO A;  3GZG A;  4X1D A;  3MQ9 A;  4FIM A;  4DXU A;  1NKX A;  4H1X A;  1LBY A;  4IY5 A;  3EF7 A;  3IR1 A;  5I2N A;  4MH5 A;  5I56 B;  4HW8 A;  3BKI B;  3T96 B;  5I58 A;  4KPT A;  1SW1 A;  5AE4 A;  2O7U A;  2X26 A;  4H8I A;  4FBP A;  1B3L A;  1MXX A;  3A3U A;  4NTL A;  2X7P A;  1RDX A;  2Q74 A;  5EHS A;  2XHD A;  3LC8 A;  3TTM A;  3TYH A;  1D9V A;  1QUI A;  4C1T A;  1EYK A;  3MWB A;  4GWW A;  4QSD A;  1QUJ A;  3TEP A;  2Z23 A;  2QS4 A;  4GXA A;  1MY3 A;  4FED A;  3IO4 A;  2VHA A;  4KYS A;  4N4U A;  3PU5 A;  5I7I A;  1O63 A;  1JW1 A;  1SD3 A;  3K6U A;  3S2V A;  3FAT A;  1TWY A;  5DTB A;  5AA2 D;  3G3F A;  1B3G A;  4U22 A;  4XTC Q;  4QRZ A;  1WDN A;  1MXU A;  4R6Y A;  3E9X A;  4PCD A;  3RPL A;  2XXU A;  3F11 A;  4KCD A;  4JXI A;  1IMC A;  4P0G A;  3U93 A;  2CZI A;  3RT6 B;  4HCY A;  1LFI A;  4AB6 A;  5EYH A;  4NF8 B;  3T9V A;  3UP9 A;  4NAP A;  3KSJ A;  4JVC A;  4P1L A;  3RYA A;  3W9W A;  2W7Y A;  5K2X A;  1MXZ A;  2VPN A;  3IFA A;  4N91 A;  3IAZ A;  3GYY A;  4XKR A;  2PT2 A;  3HV1 A;  1K9Y A;  1US5 A;  4AS4 A;  5DT6 A;  5CBR A;  2OLB A;  2OX3 A;  5IAI A;  4OXV A;  3PD8 A;  2FIE A;  1B46 A;  2WKY A;  1MXV A;  4R6K A;  3PMW A;  2D5W A;  4KXP A;  2I6E A;  4ZZE A;  3N94 A;  4XKQ A;  3PPQ A;  2UXA A;  4GWX A;  2Q2C A;  4OVT A;  3ZKK A;  3N6U A;  3K2D A;  2WX9 A;  1NUZ A;  1MDQ A;  1P1Q A;  2Q8M A;  1N76 A;  2Y7W A;  4H65 A;  4OWD A;  3EHU A;  1BTJ A;  4F31 B;  1IEJ A;  2QS2 A;  3C35 A;  3NOH A;  2WOP A;  1D9Q A;  2AL5 A;  4EDP A;  4OFL A;  3G3G A;  4N17 A;  2Y7I A;  3QSL A;  2HFB A;  3IB1 A;  3KFM A;  1H43 A;  2R71 A;  2RIN A;  4AB5 A;  1MQI A;  3S9M C;  4DZ1 A;  4ZZA A;  3MZ9 A;  3B8B A;  5AA2 B;  1AL3 A;  3KJ7 A;  3G3I A;  3VXB A;  2DSF A;  3I5O A;  1LBZ A;  5HPQ A;  4LP2 B;  1POT A;  2Z8D A;  3H3G A;  3SDF A;  3SEW A;  2F5X A;  3N26 A;  5ESY A;  4RA1 A;  2F34 A;  4G8H A;  1M5E A;  1JVX A;  2WBD A;  3KJT A;  1R6Z A;  3KOT A;  4P8B A;  4IB2 A;  4BDO A;  4GWS A;  2H5Y A;  2REG A;  3W15 C;  1B5J A;  3B6T A;  3MZ1 A;  1Q35 A;  3A3C A;  4FAT A;  3DP8 A;  4XIG Q;  1DPP A;  3O9P A;  2YPN A;  1FPD A;  4L17 A;  1XI6 A;  2OK2 A;  1PC3 A;  4N6K A;  3MP1 A;  5HM4 B;  1Y1Z A;  2RCA A;  2Z8F A;  3ZS6 A;  4QF9 A;  1QKA A;  3DRF A;  1IME A;  1LBV A;  3RGY A;  3MPL A;  2O84 X;  1JP4 A;  5DVI A;  3T9U A;  1B3F A;  1I6B A;  5ET6 A;  4PP0 A;  3FVO A;  4P11 A;  4G2Z A;  2AYS A;  2UVH A;  3BFU A;  3A09 A;  5FBP A;  2RKM A;  1FBP A;  4PC9 A;  4PFR A;  4G8M A;  5EYG A;  3H06 B;  1MXW A;  3EN3 A;  4ZE9 A;  4NWC A;  3TDJ A;  4YIC A;  4GWO A;  4MF3 A;  3HFU A;  3K01 A;  2A5T B;  4KI0 E;  4UAB A;  4P9K A;  4OER A;  1FTK A;  3KEI A;  4OVQ A;  1ZBM A;  2Y5K A;  4C1U A;  5CI5 A;  5EQ9 A;  1LAF E;  3KBZ A;  3LSX A;  2Z8E A;  3Q29 A;  4NF8 A;  3IOT A;  4OET A;  3MBP A;  4DCX A;  4KQP A;  2Q9T A;  1SI0 A;  3FJG A;  3PUW E;  3DP6 A;  5B7D A;  1LBX A;  3RPL B;  4JVI A;  2F7B A;  4EQB A;  3FTO A;  2JJK A;  4QSC A;  3LVU A;  4HE0 A;  2QPQ A;  4KCC A;  4MLQ A;  3PMX A;  5LTC A;  1A99 A;  2REJ A;  5H8N A;  4I8C A;  4OFJ A;  2Z22 A;  2XWO A;  1XT8 A;  3QIM A;  3C32 A;  4OES A;  3CG1 A;  4LN5 A;  2WBB A;  5AA4 A;  3RYD A;  4EF1 A;  3PTY A;  5B70 A;  1JW4 A;  1XOC A;  3LUY A;  1FJ9 A;  2DQV A;  4C0R A;  1MQG A;  4MFI A;  4MMP A;  5CM6 A;  2H9B A;  4GBV A;  3O6H A;  4N6D A;  5I84 A;  1A54 A;  3MST A;  1EZP A;  4NMY A;  2ZYN A;  4JWO A;  3LR1 A;  3C9H A;  3IOR A;  4U4X A;  2HCA A;  4PFB A;  4BDR A;  1MH3 A;  1Y3Q A;  2B3F A;  4RJZ A;  4X04 A;  4AS5 A;  5KCJ A;  4YKJ A;  4JSO A;  4I40 A;  3FXU A;  4I9D A;  1FPB A;  2QVU A;  2Q89 A;  1I69 A;  3SET A;  3HN0 A;  3C36 A;  3OOA A;  3H7M A;  2ONR A;  1DSN A;  5L9O A;  3USD A;  3OD7 A;  3PPN A;  3IJO B;  4BDN A;  1MQH A;  4HTG A;  2ZZV A;  4X1B A;  2R6G E;  1B51 A;  2XX9 A;  4GX6 A;  3OSR A;  1FTM A;  3TTL A;  1NFT A;  3EHT A;  3CVG A;  4I62 A;  4O7M A;  1PBQ A;  1VSO A;  4ZEB A;  1MS7 A;  3PPR A;  1AOV A;  3U92 A;  2WOL A;  4ND9 A;  2V4C A;  2P3N A;  3HHF A;  3PUX E;  3KN8 A;  3TCG A;  1UIU A;  2Y84 A;  1SVX B;  3MJN A;  5H8Q A;  2L5V A;  3PPP A;  1LAX A;  3FZV A;  4OEN A;  2UYE A;  4OTE A;  4NF5 B;  1Q9D A;  2H99 A;  2V93 A;  3FXR A;  3B50 A;  4OVJ A;  1H3D A;  4QFO A;  2XXV A;  3V89 B;  4M4G A;  1EYJ A;  2DE2 A;  5K2Y A;  4H0W A;  4LVQ A;  1EZO A;  3WAF A;  4NED A;  3DRJ A;  4RXL A;  2P0S A;  5KZT A;  4ECF A;  1URS A;  1H76 A;  2ZMB A;  1ANF A;  4G77 A;  1DOT A;  3RLF E;  1B9J A;  1D3K A;  4X48 A;  3KN7 A;  4BDQ A;  5ITO A;  1XS5 A;  4DXB A;  4GXS B;  3I6V A;  3C34 A;  1OQG A;  3CSB A;  4NG7 A;  1D4N A;  1H44 A;  4MEV A;  3B7D A;  5DEX A;  1B32 A;  2ZNT A;  2XA5 A;  3SEU A;  1WVJ A;  4IO2 A;  4LA9 A;  3TCH A;  2HXW A;  4RK2 A;  3H6T A;  4OEV A;  4QFP A;  3PUY E;  4OVP A;  2BJI A;  3T0J A;  2F35 A;  1BP5 A;  3UOR A;  3FD3 A;  1LAH E;  2O7I A;  4Q30 B;  1Q1K A;  4OAN A;  3UGW A;  3SEV A;  4R9G A;  2HZL A;  4KD5 A;  4RNS A;  2XX7 A;  1NUW A;  2UVG A;  1QJM A;  2H98 A;  2QFL A;  4ZEI A;  1IUD A;  3U1O A;  5ICQ A;  3VVE A;  2R8T A;  1RDY A;  3IOW A;  3MAM A;  3TZA A;  4LZ7 A;  1URG A;  4MNC A;  2I3W A;  1MDP 1;  4MIJ A;  2QVV A;  4THI A;  2O51 A;  1B52 A;  3C4M A;  5EQ8 A;  2DYX A;  4R2B A;  1UTB A;  4LZ8 A;  4GLI A;  5KDT A;  1SBP A;  4U23 A;  1PBP A;  1FTL A;  2B65 A;  3VVF A;  4GD5 A;  1S7Y A;  4OHN A;  1P1W A;  3K6X A;  1EYI A;  3I3V A;  3Q26 A;  2XWI A;  3M3L A;  3OMB A;  5CMK A;  3CG3 A;  5ELV A;  1ELJ A;  2H4I A;  1TT1 A;  1JVY A;  2VGQ A;  1QUL A;  3IFC A;  4Z7E A;  1M5D A;  1XVX A;  4F19 A;  1TFD A;  5BWJ A;  1ZTY A;  1J1N A;  4MNP A;  2H25 A;  4IGT A;  4ELR A;  1NL5 A;  2I4C A;  4P1E A;  4U4S A;  1A7L A;  3RPW A;  1EU8 A;  5F24 A;  3RYB A;  3O6P A;  4YKI A;  4QBA A;  3DRK A;  1GGG A;  2XD3 A;  2FVZ A;  4DDD A;  3MP8 A;  4NGU A;  1DCU A;  3RNN A;  4TQU Q;  4N15 A;  2Q2A A;  3TTR A;  1M5C A;  2XXH A;  4GFR A;  1NUX A;  5I59 B;  1K9Z A;  1S9T A;  4E0W A;  4WXJ A;  1FTA A;  3KG2 A;  1LFG A;  1YAE A;  1NV5 A;  2ZNU A;  2WYK A;  2DVC A;  1FPL A;  3H6V A;  2F6P A;  4PAF A;  1R9Q A;  5CRY A;  4UAC A;  2OBG A;  5CBS A;  3MC2 A;  5I2K B;  5BUU A;  3E13 X;  3G3H A;  2THI A;  3MVX A;  1SI1 A;  4F22 A;  3CR9 A;  3KOS A;  1GR2 A;  3MZB A;  2I3V A;  3CHG A;  3PUZ E;  1B7Z A;  4N8G A;  5A5X B;  4PBH A;  3JYR A;  4GF8 A;  1FQD A;  4F3P A;  4ESW A;  3UIF A;  3O97 A;  1FTJ A;  3DRH A;  3SES A;  4GL8 A;  5H8N B;  1LST A;  2Q8J A;  3K00 A;  1NV1 A;  4QFK A;  4O94 A;  3E79 A;  2PYY A;  4YZZ A;  1OQH A;  3ODB A;  1AMF A;  1R1N A;  3D4G A;  2DWH A;  2G29 A;  4MHF A;  3RT8 A;  2D21 A;  1EH3 A;  4POX A;  3PV0 E;  1FBG A;  2HZK A;  3FXB A;  4ONY A;  3FBP A;  4YMA A;  4PFY A;  2WEF A;  1IXC A;  4PTK A;  1US4 A;  1P1U A;  3W9V A;  2O68 A;  3T1B A;  1GVC A;  3QK6 A;  1QUK A;  1MG1 A;  2F36 A;  1MPC A;  1FQB A;  1ZU0 A;  1XC1 A;  2HEU A;  3N6T A;  2E0S A;  1VDW A;  5AA3 A;  1L5T A;  4I3Y A;  3RTW B;  4F29 A;  2XXP A;  2BJJ X;  1MQD A;  1TFA A;  1Y1M A;  1N04 A;  1YCJ A;  1MXY A;  3LUZ A;  3SER A;  3B6W A;  1B1X A;  1B1H A;  2XXW A;  1M5B A;  4U21 A;  3Q28 A;  3SKP A;  1FPE A;  1DPE A;  4DIG A;  4MBP A;  4F1V A;  1IZ1 A;  3TUS A;  2O69 A;  1LLS A;  1IXI A;  1N3W A;  4AQ4 A;  4H8J A;  3LSW A;  3DLN A;  2V3Q A;  4N8Y A;  3IOU A;  2PX1 A;  4X8R A;  4EQ9 A;  3M8U A;  1A8E A;  1PB9 A;  3OXN A;  4RPO A;  3U72 A;  2OWT A;  2CZH A;  4NQ8 A;  5TPA A;  2QS1 A;  4PAI A;  1FQC A;  4EQ7 A;  2V3T A;  3IB2 A;  5FTH A;  5KCJ B;  4MLV A;  2XD2 A;  1Y4T A;  1YYZ A;  4H45 A;  4NX1 A;  4JBZ A;  4IO5 A;  1USY E;  3IO6 A;  3JZJ A;  5AA1 A;  3TOD A;  3ZSF A;  1MY2 A;  4NHB A;  1VFE A;  4JB7 A;  2GH9 A;  1QW0 A;  5J1D A;  1LB8 A;  3CFL A;  3ECR A;  4MNI A;  4RK9 A;  1NH7 A;  2G93 A;  4GX4 A;  3VLV A;  4DE8 A;  2UVI A;  3C31 A;  4PQJ A;  1UQW A;  5FHM A;  4U1O A;  3R26 A;  2DE3 A;  4G61 A;  4UA8 A;  1KZ8 A;  3D4C A;  1LCF A;  1FSA A;  3T9H B;  5A5X A;  2FHY A;  4QXD A;  4GX3 A;  1TXF A;  4GWY A;  4QHQ A;  3K6V A;  4Q8R A;  4ESX A;  1F9B A;  1FBC A;  2AIX A;  1N84 A;  4MAG A;  3OEN A;  1QGX A;  1RKM A;  1RYX A;  2ONS A;  5I57 B;  3DP4 A;  3T66 A;  2ZNS A;  3FV1 A;  2V84 A;  3FGS A;  4F2O A;  5DEX B;  1FTO A;  4OEU A;  1LAG E;  1XHY A;  3WAE A;  3RTF B;  5IZ3 B;  5I59 A;  5M2V A;  4YB6 A;  1NNT A;  1OLA A;  1SW5 A;  1N7W A;  5DYH A;  5EQA A;  2OWZ A;  3OEK A;  2XX8 A;  3CFX A;  5L9M A;  1B0L A;  4YKK A;  1T0K A;  5IZ1 A;  2NWJ A;  1SDX A;  1SW4 A;  5JTY B;  2VD2 A;  2OJT A;  1DK4 A;  2DE4 A;  1II5 A;  2E1S A;  2PVU A;  1VR5 A;  2HAU A;  4PBQ A;  1DMB A;  4F1U A;  4I3E A;  1Y20 A;  3M3F A;  1AIV A;  4G68 A;  2NVU B;  3Q27 A;  1PB8 A;  4G68 B;  1R9L A;  1WOD A;  1NI9 A;  3TQL A;  3S9N C;  2I0B A;  5EYF A;  2UYF A;  4PFT A;  2DXR A;  3LBS A;  1IMD A;  3PAM A;  3TKD A;  1B4H A;  3SEY A;  1AWB A;  3THI A;  1RDZ A;  1FBH A;  2NXO A;  1MRP A;  3FIR A;  2YJP A;  4O3A A;  4JSD A;  1QKB A;  1HSJ A;  2GHB A;  3TEL A;  1IQ7 A;  1UTB B;  3G3J A;  4ZDM A;  4R72 A;  1LBC A;  4EUO A;  1FQA A;  2YLN A;  4H67 A;  3OSQ A;  4F3B A;  5ET8 A;  2OZZ A;  1NNK A;  4ZEF A;  3KC0 A;  2DS9 A;  3EQ1 A;  5TU0 A;  3DEL B;  2GRV A;  3RN8 A;  3VV5 A;  5IKB A;  3VXC A;  3DRG A;  2M8C A;  3EPE A;  2FA7 A;  4LQ5 A;  2PFZ A;  1B3E A;  1NMU A;  3G7W A;  4TOZ A;  1FBF A;  1EZ9 A;  3BFT A;  4MX6 A;  1B40 A;  1ZLQ A;  3S9E A;  3VLW A;  1G0H A;  4PET A;  1DTG A;  2F7C A;  4KHZ E;  3TQW A;  3R6U A;  3D1R A;  5DVJ A;  3K1N A;  2A5S A;  1YTV A;  3N5L A;  1B3H A;  1A55 A;  1H45 A;  4ELO A;  1NNF A;  5IZZ A;  1O64 A;  4XKN A;  3OEM A;  3CIJ A;  4FOR A;  4XEQ A;  4H6D A;  2DWI A;  4Z0I A;  3IX1 A;  2GQ1 A;  3ZKL A;  3JV9 A;  1P1N A;  2WOK A;  1DBZ A;  2KQZ A;  2P1S A;  2PCR A;  4R75 A;  1IIW A;  2XXT A;  4OA4 A;  3L6H A;  1UIV A;  1G0I A;  1POY 1;  3V5A A;  3IK6 B;  5H8F B;  4ZEK A;  3BIH A;  3Q25 A;  3C33 A;  3HPI A;  1MM7 A;  3O66 A;  2Y7P A;  4XKP A;  4ZED A;  1ZMG A;  4NF0 A;  2VD3 A;  1FBD A;  1YZ0 A;  3CFZ A;  1FPG A;  1LGB C;  3K02 A;  2PFY A;  5F1Q A;  3FVK A;  4HXV A;  5IGA A;  4JDF A;  3FVN A;  2I4B A;  2XXK A;  2ZZX A;  3HHG A;  3K4U A;  4LON B;  2CEX A;  5ICT A;  5DVF A;  4NF5 A;  2OCU A;  1D9Y A;  3OO7 A;  4YKP A;  2FIX A;  1FW0 A;  2GFE A;  5TP9 A;  1B4Z A;  1Y3N A;  1MQJ A;  5JTY A;  4F1Y A;  4ZE8 A;  3U94 A;  5TP9 B;  2WYP A;  5T3J A;  4GIZ A;  1FPI A;  3GXA A;  3E4R A;  1QVS A;  1B58 A;  4R6H A;  5IZ3 A;  4IO7 A;  4JWY A;  4QFN A;  1FRP A;  2IEE A;  1B2H A;  4OZ9 A;  2PT1 A;  4QSE A;  1MPD A;  4IO3 A;  5A5L A;  3RY3 A;  2XWK A;  3QUJ A;  2DOJ A;  4Q5T A;  3LSF B;  5I57 A;  4NF4 B;  2F8D A;  4BLA A;  2I49 A;  3IOV A;  1MY4 A;  2ZYO A;  2OWS A;  1PEB A;  3QAX A;  5L8D A;  3T9X B;  1BLF A;  2AL4 A;  2B3B A;  1NV6 A;  3FVG A;  5CMB A;  1B7H A;  4ELP A;  4WED A;  2VP1 A;  4LQ2 A;  3L6G A;  5H8H B;  3PPO A;  1CE2 A;  1MH4 A;  3QUF A;  1PDA A;  3HCQ A;  2ONK E;  3FJM A;  2ESN A;  3TFL A;  5H8H A;  5I2K A;  3SEX A;  3OO9 A;  4OQO A;  2B4M A;  1N7X A;  3UN6 A;  3KC1 A;  3AXF A;  1GTK A;  5AA4 B;  1A40 A;  1IMB A;  4GQO A;  2DP8 A;  1FPF A;  3E3K A;  5I56 A;  3IJX B;  2I58 A;  4H46 A;  2XXY A;  4PDH A;  4G4P A;  2O1L A;  3OEL A;  4OVR A;  1PB7 A;  3MPK A;  1HSL A;  1OIB A;  3MW0 A;  1UTH B;  2XXI A;  5AA2 A;  2B4L A;  3K1P A;  3HO7 A;  4NF4 A;  4DLD A;  4F3S A;  3LV0 A;  1HSE A;  5ET5 A;  4POW A;  1IMF A;  1LBW A;  5L9S A;  5J16 A;  1P1O A;  4IO4 A;  5EQ7 A;  2F78 A;  3UK4 A;  2O6A A;  2KR0 A;  2RC8 A;  2RF1 A;  3O29 A;  4DI4 B;  2FNC A;  3R7X A;  3S9L C;  2PMS A;  2Y7K A;  1SQY A;  1ZJL A;  2LAO A;  2XWV A;  3V8X B;  2RC9 A;  2R9J A;  2ABH A;  3FV2 A;  3TTN A;  1MY0 A;  4TLL B;  4O8M A;  3DRI A;  4MCO A;  4O7I A;  1KWH A;  4KYE A;  3KZG A;  4K3F A;  4OVS A;  4IR8 A;  4WKM A;  2NUV A;  1N3X A;  3K6W A;  4PE5 B;  4GWZ A;  4GL0 A;  3O6I A;  2F3B A;  3M3K A;  1FPJ A;  2GHA A;  1OMP A;  1ZKB A;  4IGR A;  4NWD A;  4O3C A;  1JEV A;  1A8F A;  1NUY A;  5KDT B;  4NF6 A;  4M1V A;  2ZYK A;  2I0C A;  4YB7 A;  3MVZ A;  2Y7R A;  1Z7N E;  2F3D A;  3KN3 A;  4PFI A;  2ALU A;  1LCT A;  3PUV E;  2O1M A;  2F97 A;  3BBR A;  1BIY A;  1NV7 A;  2DWJ A;  4KYD A;  1B0H A;  4P0I A;  4R9F A;  5CC2 A;  4PDD A;  3VVD A;  5H8F A;  2CEY A;  1VE4 A;  2QSX A;  3DM0 A;  2MKZ A;  4X9T A;  3PD9 A;  2CZL A;  1B5I A;  4JWX A;  5FTI A;  2V25 A;  1I6A A;  1AH5 A;  5CMC A;  3TCF A;  4WEP A;  4R74 A;  2V3U A;  4OMB A; 
#chains in the Genus database with same CATH homology
 3SEU A;  1WVJ A;  4IO2 A;  5LOM A;  1US5 A;  2QMW A;  1LB9 A;  2E1S A;  5CMM A;  2PVU A;  5DT6 A;  4LA9 A;  3TCH A;  1VR5 A;  3VFJ A;  2HAU A;  4YB5 A;  3TAJ A;  1USY H;  4FJP A;  2HXW A;  1DMB A;  5CBR A;  2OLB A;  4RK2 A;  2NOO A;  4F1U A;  5IAI A;  2QRY A;  3PD8 A;  4OXV A;  3H6T A;  1Y20 A;  3M3F A;  1B46 A;  4G68 A;  4OEV A;  2NVU B;  1B5H A;  3Q27 A;  4BDM A;  1AIV A;  4QFP A;  1PB8 A;  4G68 B;  2WKY A;  1MXV A;  1R9L A;  3PUY E;  1WOD A;  4R6K A;  3TQL A;  3S9N C;  2I0B A;  5EYF A;  2UYF A;  4PFT A;  3PMW A;  4AB6 A;  1JET A;  2DXR A;  2D5W A;  1BP5 A;  3MVW A;  2F35 A;  3LBS A;  3UOR A;  3PAM A;  3TKD A;  1B4H A;  3FD3 A;  3GBA A;  1LAH E;  4F39 A;  1NNP A;  1EZO A;  4YAH X;  3SEY A;  4GVO A;  3IB0 A;  2O7I A;  2I6E A;  3H6U A;  3N94 A;  4Q30 B;  4XKQ A;  4ZZE A;  1Q1K A;  3THI A;  3UGW A;  2NXO A;  4LZ5 A;  4F2Q A;  1B05 A;  1MRP A;  3FIR A;  2YJP A;  2UXA A;  3O2A A;  3PPQ A;  4R9G A;  4YU0 A;  1FQF A;  4O3A A;  3SEV A;  2Q2C A;  2VOZ A;  4JSD A;  2HZL A;  4KD5 A;  4RNS A;  3G3K A;  3ZKK A;  2DE4 A;  2XX7 A;  3N6U A;  3GBB A;  3K2D A;  2UVG A;  4RPN A;  1Y3P A;  1QKB A;  1HSJ A;  4LAT A;  1MDQ A;  1QJM A;  3CI8 A;  1P1Q A;  4RYA A;  1N76 A;  2H98 A;  1XVY A;  2Y7W A;  1O7T A;  4ZEI A;  4H65 A;  1MY1 A;  2GHB A;  1IUD A;  3EHU A;  1IQ7 A;  1UTB B;  1BTJ A;  3G3J A;  4ZDM A;  3TEL A;  3U1O A;  4R72 A;  1LBC A;  2XXQ A;  1IXG A;  4X1D A;  5ICQ A;  4EUO A;  1VFD A;  1FQA A;  1IEJ A;  2YLN A;  3OSQ A;  4H67 A;  2QS2 A;  3C35 A;  3VVE A;  4F3B A;  2WOP A;  2AL5 A;  4EDP A;  3IOW A;  3K1M A;  4IY6 A;  2OZZ A;  1NNK A;  4R73 A;  4ZEF A;  2DS9 A;  3EQ1 A;  3MAM A;  3TZA A;  4F18 A;  4OFL A;  4LZ7 A;  5TU0 A;  1URG A;  3DEL B;  2GRV A;  3RN8 A;  1IIT A;  3G3G A;  2Y7I A;  3QSL A;  3OO6 A;  2HFB A;  3VV5 A;  5IKB A;  2I3W A;  3IB1 A;  1MDP 1;  3VXC A;  3KFM A;  3KSX A;  3DRG A;  1H43 A;  2M8C A;  2R71 A;  2FA7 A;  2XXR A;  2RIN A;  3EPE A;  3H4Z A;  4THI A;  4ZS9 A;  4AB5 A;  4LQ5 A;  2O51 A;  1B52 A;  3C4M A;  4H5F A;  2DYX A;  4R2B A;  4EXL A;  1UTB A;  1B3E A;  1MQI A;  4LZ8 A;  4DZ1 A;  4ZZA A;  3S9M C;  1NMU A;  3MZ9 A;  4GLI A;  5KDT A;  5AA2 B;  3G7W A;  1SBP A;  1AL3 A;  4TOZ A;  4U23 A;  1PBP A;  4HS7 A;  1FTL A;  2B65 A;  3VVF A;  1DTZ A;  3TPA A;  3KJ7 A;  4GD5 A;  1S7Y A;  3TTK A;  3G3I A;  1EZ9 A;  4OHN A;  4FAJ A;  1P1W A;  3BFT A;  3K6X A;  5H8Q B;  3VLU A;  3H6W A;  2DSF A;  3I3V A;  3Q26 A;  3VXB A;  1M5F A;  3I5O A;  3M3L A;  2ZYM A;  1B40 A;  1OVB A;  1ZLQ A;  3OMB A;  3S9E A;  2QMX A;  5HPQ A;  5CMK A;  3VLW A;  1SYH A;  3CG3 A;  4PET A;  1FCK A;  1DTG A;  2F7C A;  1SYI A;  4LP2 B;  2HQ0 A;  5ELV A;  3FXQ A;  1ELJ A;  2F7A A;  2H4I A;  1URD A;  1POT A;  2Z8D A;  1TT1 A;  3H3G A;  1JVY A;  2F5X A;  1CB6 A;  3N26 A;  4KHZ E;  3SDF A;  3SEW A;  2VGQ A;  4OYV A;  3TQW A;  3B6Q A;  3R6U A;  4RA1 A;  1QUL A;  4TLM B;  4R2F A;  5JEI A;  2F34 A;  4Z7E A;  2DWA A;  1M5D A;  1XVX A;  4F19 A;  5EHM A;  4G8H A;  5DVJ A;  1TFD A;  1M5E A;  3K1N A;  2A5S A;  1YTV A;  1JVX A;  3PGF A;  3N5L A;  1B3H A;  5BWJ A;  1A55 A;  1H45 A;  3KJT A;  4ELO A;  1ZTY A;  4QFL A;  1R6Z A;  3KOT A;  1NNF A;  1J1N A;  2H25 A;  4G68 C;  4IGT A;  1O64 A;  2KLF A;  4ELR A;  1NL5 A;  4IB2 A;  4BDO A;  2I4C A;  3RT6 B;  3SET A;  4EXK A;  1Y4C A;  4XKN A;  3OEM A;  3CIJ A;  3FAS A;  4FOR A;  4U4S A;  2RC7 A;  1A7L A;  1OLC A;  4H6D A;  2DWI A;  4Z0I A;  3RPW A;  2DXY A;  1EU8 A;  1LFH A;  3IX1 A;  3FUZ A;  3RYB A;  2H5Y A;  2REG A;  3JV9 A;  1P99 A;  3W15 C;  1P1N A;  2WOK A;  3ZKL A;  2P1S A;  3O6P A;  3MUQ A;  4YKI A;  2UVJ A;  3DRK A;  1GGG A;  1B5J A;  1NH8 A;  2XD3 A;  1IIW A;  2XXT A;  3B6T A;  4O3B A;  4R75 A;  3MZ1 A;  4DDD A;  1Q35 A;  1UIV A;  1POY 1;  3L6H A;  3A3C A;  3MP8 A;  5FHN A;  3V5A A;  3IK6 B;  4FAT A;  3ILU B;  5H8F B;  4ZEK A;  3DP8 A;  3Q25 A;  3IL1 B;  1OVT A;  4XIG Q;  1DPP A;  4TQU Q;  3RNN A;  3O9P A;  2YPN A;  1MM7 A;  3C33 A;  3HPI A;  3O66 A;  5HBC A;  5ISU A;  2Y7P A;  4XKP A;  2Q2A A;  4L17 A;  3TTR A;  2OK2 A;  1M5C A;  2XXH A;  4ZED A;  1PC3 A;  4GFR A;  1ZMG A;  5JK4 A;  3MP6 A;  3MP1 A;  1JNF A;  2VD3 A;  3U8Q A;  5HM4 B;  3EHS A;  1Y1Z A;  2PBW A;  2RCA A;  2Z8F A;  5I59 B;  3CFZ A;  1S9T A;  3ZS6 A;  1LGB C;  4QF9 A;  4WXJ A;  3KG2 A;  4E0W A;  3K02 A;  5AA2 A;  1LFG A;  1YAE A;  5F1Q A;  2ZNU A;  3FVK A;  1QKA A;  3DRF A;  3RGY A;  3MPL A;  3O6G A;  2O84 X;  4JDF A;  4FE8 A;  1RYO A;  2DVC A;  2X7Q A;  4HW8 A;  1SW2 A;  4PFW A;  5DVI A;  3FVN A;  3H6V A;  2I4B A;  4HCW A;  3T9U A;  1B3F A;  1I6B A;  3HHG A;  2F6P A;  1R9Q A;  3K4U A;  1BKA A;  4PP0 A;  5CRY A;  4UAC A;  2I48 A;  2OBG A;  3ONM A;  4EF2 A;  5CBS A;  4LON B;  5ICT A;  3MC2 A;  2F6G A;  4NF5 A;  5DVF A;  5I2K B;  2OCU A;  1Z7M E;  3FVO A;  4P11 A;  4KR5 A;  5BUU A;  1D9Y A;  3E13 X;  3G3H A;  3OO7 A;  4G2Z A;  2AYS A;  2THI A;  2P2A A;  3K0V A;  5JTY B;  4YKP A;  3MVX A;  2UVH A;  3BFU A;  1SI1 A;  1B7U A;  3A09 A;  3CR9 A;  4RY1 A;  4F22 A;  1FW0 A;  3KOS A;  1GV8 A;  1ATG A;  2RKM A;  1GR2 A;  3MZB A;  2GFE A;  2I3V A;  4G8M A;  5TP9 A;  3CHG A;  3H06 B;  3PUZ E;  3CRB A;  4IO6 A;  1B4Z A;  1MXW A;  1Y3N A;  4ZE9 A;  1B7Z A;  1MQJ A;  3EN3 A;  4NWC A;  4FEC A;  5JTY A;  4F1Y A;  3TDJ A;  4YIC A;  3VDF A;  4GWO A;  5A5X B;  4ZE8 A;  3U94 A;  4FEB A;  3JYR A;  2D3I A;  4GF8 A;  4MF3 A;  3RUM A;  1FQD A;  4F3P A;  4ESW A;  3UIF A;  4N6P A;  1JW5 A;  1S50 A;  1FTJ A;  2Q88 A;  3O97 A;  1MM6 A;  3DRH A;  3ILT B;  3QYT A;  3SES A;  1YPN A;  3K01 A;  2A5T B;  5TP9 B;  2HAV A;  4KI0 E;  3VE1 B;  3KBR A;  4PFU A;  4GXA A;  4GL8 A;  4OER A;  4KFQ A;  5H8N B;  3MVY A;  3P7I A;  1LST A;  4GIZ A;  4LUB A;  1FTK A;  4U2R A;  2Q8J A;  3K00 A;  3GXA A;  3KEI A;  4QFK A;  1B6H A;  1MPB A;  3E4R A;  4XXU A;  1QVS A;  1ZBM A;  1B58 A;  4C1U A;  2QJE A;  5CI5 A;  2PYY A;  4YZZ A;  1LAF E;  4F31 B;  3LSX A;  1T0K A;  2Z8E A;  3Q29 A;  4NF8 A;  4R6H A;  1OQH A;  3IOT A;  3ODB A;  4IO7 A;  1AMF A;  4OET A;  2ZXT A;  3MBP A;  1R1N A;  4JWY A;  4QFN A;  4N07 A;  2IEE A;  4DCX A;  1B2H A;  3GLB A;  2PT1 A;  2Q9T A;  4KQP A;  4OZ9 A;  1SI0 A;  3OO8 A;  4QSE A;  3D4G A;  3FJG A;  3PUW E;  3CSG A;  3QXM A;  1MPD A;  3T22 A;  2DWH A;  4IO3 A;  3DP6 A;  2G29 A;  5F7V A;  3RY3 A;  5I58 B;  5B7D A;  4DCY A;  3RT8 A;  2D21 A;  2DOJ A;  3QUJ A;  2F7B A;  4Q5T A;  1EH3 A;  3LSF B;  4I1D A;  4POX A;  3PV0 E;  3T9X B;  5I2N B;  5I57 A;  4EQB A;  2HZK A;  4OFO A;  3FTO A;  4ONY A;  4YMA A;  3PMV A;  4NF4 B;  4PFY A;  1JEU A;  1IXC A;  1N0T A;  2F8D A;  3LVU A;  4NF6 B;  4QSC A;  1IXH A;  4ZEC A;  4BLA A;  2I49 A;  1US4 A;  2QPQ A;  4KCC A;  4MLQ A;  1P1U A;  5TPA B;  3HST A;  3IOV A;  3PMX A;  1MY4 A;  3W9V A;  2O68 A;  3T93 B;  1LBB A;  2ZYO A;  2OWS A;  1PEB A;  1A99 A;  4G8N A;  2REJ A;  3QAX A;  1JQF A;  1GVC A;  3QK6 A;  1FQE A;  5H8N A;  5L8D A;  4I8C A;  1QUK A;  4OFJ A;  1MG1 A;  1XT8 A;  1MPC A;  1FQB A;  1I6Q A;  3QIM A;  1BLF A;  1ZIU A;  2F36 A;  2A5T A;  2Z22 A;  4OES A;  3C32 A;  5FHO A;  1ZU0 A;  1XC1 A;  3CG1 A;  2HEU A;  3N6T A;  2E0S A;  2AL4 A;  5ITP A;  4YMB A;  2B3B A;  5AA4 A;  5AA3 A;  1L5T A;  3RTW B;  3UA8 A;  4F29 A;  2XXP A;  2BJJ X;  1MQD A;  4EF1 A;  1TFA A;  5B70 A;  3V83 A;  1JW4 A;  1XOC A;  3FVG A;  1Y1M A;  1N04 A;  4U1Z A;  1YCJ A;  3H03 A;  1MXY A;  5CMB A;  5H8S A;  1B7H A;  3SER A;  4ELP A;  4WED A;  2VP1 A;  3B6W A;  4LQ2 A;  3L6G A;  3LUY A;  1B1X A;  1B1H A;  5H8H B;  2XXW A;  3PPO A;  1M5B A;  1CE2 A;  2DQV A;  1MH4 A;  3Q28 A;  1MQG A;  1PDA A;  3QUF A;  4FIM A;  1DPE A;  4U21 A;  3S4U A;  3SKP A;  4C0R A;  3HCQ A;  2ONK E;  4MFI A;  2QL3 A;  4DIG A;  3FJ7 A;  4MBP A;  2FYI A;  3FJM A;  1IZ1 A;  4F1V A;  2ESN A;  5CM6 A;  3RQT A;  2H9B A;  5H8H A;  3TFL A;  3TMG A;  4ELQ A;  3O6H A;  5I2K A;  3TUS A;  2IA4 A;  3SEX A;  2O69 A;  5I84 A;  1A54 A;  3OO9 A;  4H5G A;  1LLS A;  1IXI A;  2B4M A;  1N3W A;  1N7X A;  4ISU A;  4OQO A;  4BDL A;  4NE4 A;  3UN6 A;  4AQ4 A;  3O28 A;  4H8J A;  3AXF A;  1GTK A;  3LSW A;  3LSL A;  3DLN A;  1EZP A;  4NMY A;  5AA4 B;  2ZYN A;  2V3Q A;  1A40 A;  3IOU A;  2PX1 A;  3LR1 A;  4GRK A;  3C9H A;  3IOR A;  2RCB A;  4GQO A;  2DP8 A;  4JWO A;  4U4X A;  2HCA A;  3M8U A;  1A8E A;  3E3K A;  4Q0C A;  1PB9 A;  4EQ9 A;  4OWD A;  5I56 A;  4GOT A;  4BDR A;  1MH3 A;  2XXX A;  3IJX B;  3OXN A;  1Y3Q A;  2B3F A;  2I58 A;  4RJZ A;  4RPO A;  1Y9U A;  2XXY A;  4G4P A;  3U72 A;  4YKJ A;  4JSO A;  4E0X A;  5KCJ A;  2OWT A;  2O1L A;  3OEL A;  4N13 A;  2DVZ A;  1PB7 A;  4F3G A;  2ANJ A;  3MPK A;  3FXU A;  4I9D A;  3KGC A;  2QS3 A;  1UTH A;  1HSL A;  1OIB A;  2CMO A;  3GZG A;  5TPA A;  3MW0 A;  1I69 A;  1UTH B;  2Q89 A;  2QS1 A;  3HN0 A;  3MQ9 A;  1FQC A;  2XXI A;  3C36 A;  1NKX A;  2B4L A;  3OOA A;  2V3T A;  3H7M A;  3IB2 A;  3HO7 A;  3K1P A;  4H1X A;  5FTH A;  4IY5 A;  4EQ7 A;  3EF7 A;  4NF4 A;  4DLD A;  5KCJ B;  2ONR A;  3IR1 A;  4MLV A;  4F3S A;  2XD2 A;  1HSE A;  1DSN A;  1Y4T A;  5L9O A;  3USD A;  5I2N A;  3OD7 A;  3PPN A;  4JBZ A;  3IJO B;  4IO5 A;  4MH5 A;  1USY E;  1MQH A;  4HTG A;  4POW A;  4BDN A;  3BKI B;  3IO6 A;  3JZJ A;  4X1B A;  3T96 B;  2R6G E;  5I58 A;  5L9S A;  4KPT A;  1P1O A;  1SW1 A;  4IO4 A;  1B51 A;  5AA1 A;  5AE4 A;  3TOD A;  3ZSF A;  1MY2 A;  2F78 A;  2O7U A;  3UK4 A;  2X26 A;  2O6A A;  1VFE A;  2XX9 A;  4JB7 A;  2RC8 A;  2RF1 A;  2GH9 A;  3O29 A;  2FNC A;  3R7X A;  4H8I A;  3OSR A;  3S9L C;  2PMS A;  1QW0 A;  1B3L A;  1FTM A;  1SQY A;  1MXX A;  2Y7K A;  3A3U A;  3TTL A;  5J1D A;  1ZJL A;  2LAO A;  1LB8 A;  3V8X B;  1NFT A;  3EHT A;  3CVG A;  4I62 A;  2X7P A;  4NTL A;  2RC9 A;  3CFL A;  3ECR A;  1PBQ A;  1VSO A;  2R9J A;  2XHD A;  4ZEB A;  2ABH A;  3FV2 A;  5EHS A;  4RK9 A;  1MS7 A;  3LC8 A;  1NH7 A;  3TTN A;  2G93 A;  3TTM A;  3TYH A;  3PPR A;  1MY0 A;  1D9V A;  1AOV A;  4TLL B;  3U92 A;  1QUI A;  3VLV A;  4DE8 A;  2UVI A;  4C1T A;  3C31 A;  4PQJ A;  3DRI A;  3MWB A;  1UQW A;  5FHM A;  2WOL A;  4ND9 A;  4PE5 B;  1KWH A;  3R26 A;  2DE3 A;  4KYE A;  4QSD A;  3KZG A;  4U1O A;  4UA8 A;  4K3F A;  3HHF A;  3PUX E;  3D4C A;  1LCF A;  4WKM A;  3T9H B;  5A5X A;  1QUJ A;  3KN8 A;  3TCG A;  1UIU A;  3TEP A;  2Z23 A;  2NUV A;  1N3X A;  2QS4 A;  3K6W A;  1MY3 A;  4FED A;  3IO4 A;  3O6I A;  4GL0 A;  2VHA A;  1TXF A;  3PU5 A;  2Y84 A;  3M3K A;  4KYS A;  3WAE A;  1O63 A;  4QHQ A;  3K6V A;  4Q8R A;  1JW1 A;  1SD3 A;  1OMP A;  2GHA A;  1ZKB A;  3K6U A;  4DXC A;  4ESX A;  1F9B A;  3S2V A;  3FAT A;  1TWY A;  1SVX B;  3MJN A;  4IGR A;  5DTB A;  5H8Q A;  5AA2 D;  3G3F A;  2AIX A;  1N84 A;  4NWD A;  4O3C A;  1JEV A;  3PPP A;  1B3G A;  1LAX A;  3OEN A;  3FZV A;  4U22 A;  4QRZ A;  4XTC Q;  1RKM A;  4OEN A;  1A8F A;  1RYX A;  2UYE A;  4OTE A;  1WDN A;  5KDT B;  4NF5 B;  4NF6 A;  1MXU A;  4R6Y A;  4DXU A;  2H99 A;  3E9X A;  2ONS A;  4M1V A;  5I57 B;  2ZYK A;  3DP4 A;  3T66 A;  2I0C A;  4YB7 A;  2ZNS A;  2V93 A;  3FXR A;  4OVJ A;  2XXU A;  3F11 A;  1H3D A;  4KCD A;  3MVZ A;  4QFO A;  2Y7R A;  4JXI A;  3FV1 A;  2XXV A;  4P0G A;  3V89 B;  1Z7N E;  2V84 A;  3FGS A;  3U93 A;  4F2O A;  5DEX B;  1FTO A;  4M4G A;  3KN3 A;  4OEU A;  1LAG E;  1XHY A;  2ALU A;  2DE2 A;  4H0W A;  4HCY A;  1LCT A;  4LVQ A;  5K2Y A;  1LFI A;  3RTF B;  3PUV E;  4NED A;  3WAF A;  4NF8 B;  2O1M A;  3DRJ A;  2F97 A;  4RXL A;  3T9V A;  3BBR A;  5M2V A;  3UP9 A;  4YB6 A;  1BIY A;  2P0S A;  1NNT A;  2DWJ A;  4KYD A;  5KZT A;  3KSJ A;  1B0H A;  4ECF A;  1URS A;  1H76 A;  1OLA A;  1SW5 A;  1N7W A;  2ZMB A;  4P0I A;  4R9F A;  5DYH A;  5CC2 A;  3RYA A;  1ANF A;  3W9W A;  4G77 A;  2W7Y A;  5K2X A;  1DOT A;  1MXZ A;  3VVD A;  3RLF E;  1B9J A;  1D3K A;  3OEK A;  5H8F A;  1VE4 A;  4X48 A;  2QSX A;  3KN7 A;  3DM0 A;  4BDQ A;  4X9T A;  3PD9 A;  5ITO A;  1XS5 A;  2CZL A;  2XX8 A;  4DXB A;  1B5I A;  4GXS B;  3CFX A;  4JWX A;  3I6V A;  1B0L A;  3C34 A;  2V25 A;  4YKK A;  1I6A A;  5FTI A;  5L9M A;  2NWJ A;  1AH5 A;  5CMC A;  1OQG A;  1SDX A;  3CSB A;  1SW4 A;  3IAZ A;  3TCF A;  4XKR A;  1D4N A;  1H44 A;  2PT2 A;  2VD2 A;  3HV1 A;  3B7D A;  4WEP A;  5DEX A;  4R74 A;  2OJT A;  5I56 B;  1B32 A;  2ZNT A;  5I59 A;  2V3U A;  1II5 A;  4OMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...