1B05A

Structure of oligo-peptide binding protein complexed with lys-cys-lys
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 185
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b05A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b05A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b05A02
3JV9A 1S7YA 3G7WA 4O3AA 4P0GA 5KDTB 2GH9A 1XT8A 4N6PA 2Y84A 3W9WA 3B6WA 1LFHA 4LUBA 3UP9A 2XXQA 1BIYA 3H6WA 3UIFA 3O6IA 4EF2A 2XXHA 3KOSA 3C34A 4JWYA 1NH7A 4ZEFA 1AIVA 3IORA 5FTIA 2DWHA 4XKQA 2GFEA 1SD3A 5AA2A 3VVFA 2DE4A 3U72A 3T9XB 4WEDA 3RT6B 3N26A 1T0KA 3IOUA 3G3HA 2CMOA 3H03A 1FTMA 4F1YA 2I0BA 5I2NA 1POTA 3VVEA 5JEIA 3PD8A 4TQUQ 3OO7A 3MP1A 3DRIA 2Y7IA 2Y7PA 4EQ7A 1LLSA 1EU8A 1Y20A 2XX7A 3C32A 4OTEA 3SDFA 1S9TA 3MP6A 1OMPA 4JWOA 2ANJA 3N94A 3MZ1A 2Z8EA 4H6DA 2ALUA 1MQHA 1B3FA 2H9BA 3WAEA 2P0SA 3MBPA 2DWJA 2RCBA 1SW1A 2PT1A 4FJPA 3HHFA 5DT6A 3TMGA 3DRJA 4BDLA 3FATA 1USYH 2ZYKA 2XXXA 1B6HA 3DP8A 5L8DA 3KJ7A 1Y1MA 1J1NA 2DWIA 5CM6A 2RC7A 1POY1 3M3KA 1JQFA 4IY5A 2DYXA 2PBWA 3LC8A 3OMBA 1M5FA 2XD3A 3DRFA 1FQEA 4N07A 1PDAA 1OIBA 1MPDA 5AA2D 4FEBA 1SI0A 2FYIA 5KCJA 4R2FA 2O84X 4F2QA 1A40A 3C4MA 3SEYA 1WVJA 1MXWA 1B58A 4KCDA 5HPQA 1LAFE 1LAGE 1ZBMA 1NNPA 4EQBA 1P1NA 4ELQA 5DYHA 4I8CA 3QXMA 3TQLA 2Q2AA 2I6EA 1R6ZA 3DP6A 3E13X 3FVKA 2ONRA 4POXA 5TPAB 3ZKKA 1A55A 1LAHE 2P1SA 4ESXA 3Q28A 3CSBA 1LBBA 3U94A 1M5CA 3PPPA 5I58B 5FTHA 3LSLA 5I2KB 1OVTA 4Z0IA 3D4CA 2XHDA 2FA7A 3S9LC 2M8CA 2PMSA 1B3GA 2I4CA 2IA4A 4FEDA 1IZ1A 3CFXA 1MQJA 1SQYA 5I59B 2X7QA 3I3VA 3MC2A 1P1OA 3FASA 3UORA 1JEUA 2UYFA 3TQWA 1LBCA 4XTCQ 2XXYA 4NTLA 4BLAA 1RKMA 5H8HA 4QFLA 1JW1A 2OWTA 3E3KA 1IXGA 1B5JA 4BDRA 4BDQA 2DXYA 3H3GA 3O9PA 1NL5A 3HN0A 4HCYA 3S9EA 3IL1B 4G68A 4E0XA 4R6KA 2XX8A 4H5FA 4YB7A 4NF6B 1B1HA 1MXXA 1B32A 3SEVA 3VXBA 2ESNA 4NMYA 3DP4A 2A5TB 5JTYB 4GL0A 2OWSA 4OWDA 3LBSA 3N6TA 3T9VA 4N13A 4TOZA 4HCWA 5H8QB 1N84A 1FQAA 4KFQA 1I69A 3A09A 2B3FA 2GHAA 4RJZA 3PUZE 2WOKA 1H3DA 3FJMA 1H76A 4AB5A 2OCUA 1Y4CA 5DEXB 4ELOA 3GLBA 4E0WA 2RC9A 4IO6A 3TEPA 5AA1A 3IB1A 1MM7A 3EF7A 4ECFA 1A7LA 2XXRA 1AL3A 1ZMGA 3GBAA 2F7AA 1VR5A 2ZYMA 4U1OA 4GD5A 5EHSA 2DP8A 4M4GA 4U1ZA 1TT1A 4RY1A 4DXCA 1HSEA 2G93A 3VFJA 1P1WA 4X1DA 2ZNSA 2O7UA 1IEJA 3M8UA 3LVUA 1JW5A 3TAJA 3U92A 1N7XA 3EPEA 4O3BA 3VE1B 2XXTA 4XXUA 1QULA 3KN3A 4GFRA 4NEDA 3HO7A 4U2RA 4H5GA 1AH5A 3JZJA 3H6TA 4TLLB 4H65A 5CMBA 2QS1A 4LZ5A 3TPAA 3K00A 4EXKA 5B7DA 5CMCA 1TXFA 2YLNA 4KCCA 4OZ9A 4U4SA 3S2VA 1US4A 2FNCA 3ZS6A 3GZGA 3V8XB 1LFIA 3H4ZA 4MBPA 2HXWA 2XXVA 1JEVA 5A5XB 3PMVA 1LGBC 4DE8A 2H4IA 1ZU0A 1I6QA 3B7DA 4JB7A 4Q8RA 4KI0E 4JBZA 4C1TA 2H5YA 3CIJA 5AA4B 4DZ1A 4EUOA 4XKRA 3R26A 1DTGA 5DVJA 2YPNA 1OVBA 2F78A 1D3KA 4DCXA 3Q25A 4GOTA 1VFEA 3K6UA 4OFJA 4OVJA 4GL8A 2DE2A 3U1OA 2HAUA 4RXLA 1B7UA 1XS5A 3OEKA 1TFAA 1EZ9A 1M5BA 1XVYA 4DIGA 1DMBA 1VE4A 2ZNUA 3PGFA 2ZMBA 1FQDA 1O7TA 3UGWA 2WOLA 1MY2A 1A54A 3QUJA 4UA8A 3IO4A 1ZJLA 3DRHA 3IX1A 4THIA 4KR5A 4BDNA 3VLWA 4ELRA 1R9QA 5TPAA 3T9UA 4G68C 5I57B 3RUMA 2E0SA 3MJNA 3K1PA 3SEXA 1FQFA 2XXWA 4QSDA 2RKMA 1URSA 2AL4A 3PMXA 2RCAA 3U93A 2Z23A 1BTJA 4ZECA 2PVUA 4OERA 1UTHA 5I58A 4FORA 5FHOA 5I2KA 3PD9A 4G8HA 3MWBA 1CE2A 4ZEDA 1LCTA 2UXAA 5IAIA 3TDJA 5I59A 4OQOA 2I58A 3PPOA 3V5AA 1EZPA 3C36A 3LSFB 4YAHX 4ZE8A 4ONYA 3MVYA 1JETA 2D3IA 3RTFB 2F97A 3TTLA 4F22A 3HV1A 2X7PA 2Z8FA 3OEMA 1GTKA 3MZBA 4TLMB 4EQ9A 2E1SA 2F36A 1MH4A 3K6VA 3OENA 4OXVA 3QAXA 3RGYA 2Y7WA 1QUJA 4NF6A 3O97A 5H8SA 2I0CA 1RYXA 3EHTA 1KWHA 3PUWE 1SYIA 4I9DA 3W15C 3ILUB 3K1MA 4QF9A 2DVCA 2DWAA 2A5TA 2THIA 5JTYA 5CI5A 4JDFA 1GGGA 3UA8A 3FJ7A 2R9JA 1Y1ZA 5M2VA 3K6WA 1B9JA 5H8FB 5H8QA 3LSWA 4X48A 1MG1A 2DQVA 4RYAA 1MQIA 2ZNTA 3PPRA 4R75A 4I62A 1ATGA 4U4XA 2QSXA 3TTKA 3IOVA 2O1MA 3T93B 2VD3A 5DEXA 3CSGA 4P11A 3HHGA 4EF1A 2O6AA 3ONMA 1IITA 3TODA 4NF8B 5FHNA 3OD7A 5L9OA 2O7IA 4HW8A 3VV5A 1UIVA 5CC2A 2ONKE 4MF3A 4LZ8A 3RT8A 4H8JA 3JYRA 1PBQA 1B7ZA 1DPPA 3SETA 4OMBA 3G3FA 3KZGA 3KGCA 4R6HA 3DLNA 5F1QA 2GHBA 3N6UA 4R2BA 3OSRA 1OLCA 4ZDMA 3D4GA 3CFLA 4PFTA 3O2AA 4F39A 4QFPA 5ITOA 4U23A 4KPTA 2OJTA 4R74A 3K1NA 3VLVA 1NNFA 3TCGA 1Y3NA 1XOCA 1MDP1 2Q89A 4ISUA 1B51A 2VOZA 3U8QA 3KEIA 1YPNA 2HEUA 2W7YA 1SW5A 2V93A 4KYDA 5A5XA 4I1DA 4JXIA 4BDMA 1TWYA 3RPWA 1B4HA 4YB5A 2NVUB 3W9VA 5ICTA 1ZTYA 1TFDA 1MXVA 5TP9B 2DXRA 1B40A 5AA4A 1SBPA 3BKIB 2ABHA 4R9FA 2BJJX 4NWDA 4YZZA 1N3XA 2XXPA 4PP0A 4BDOA 3FV2A 1AMFA 2V3QA 4HS7A 5AA2B 3VDFA 2P2AA 1PC3A 3ZSFA 3PMWA 4ZEIA 3K02A 3THIA 2B3BA 3RNNA 3RLFE 4YICA 1SW2A 2UYEA 1LCFA 1MY3A 3MQ9A 1PBPA 4PFWA 3CRBA 5I2NB 4PQJA 4MH5A 1N04A 2DE3A 1PB7A 2NWJA 5CMKA 1MPCA 1BP5A 3EQ1A 3USDA 3N5LA 2HFBA 3PUXE 5I57A 4DXBA 4WKMA 4RPNA 1XC1A 1NH8A 4ZZAA 4R6YA 5KDTA 2AIXA 4YKKA 5FHMA 4R9GA 3K4UA 4FE8A 2LAOA 4P0IA 4IB2A 2X26A 3CVGA 3CG1A 1LB9A 4QRZA 3QUFA 2GRVA 3KSJA 1IIWA 5DVIA 3M3FA 3MPLA 1WODA 5ELVA 3B6TA 3B6QA 3R7XA 2V25A 4LVQA 3MW0A 1ZKBA 1MXYA 3RYAA 1MXZA 1MY1A 2O1LA 4HTGA 3S9NC 3Q29A 3P7IA 3S4UA 1ZLQA 5I84A 1MXUA 4YKIA 4QFNA 4YKJA 2A5SA 1MDQA 3RY3A 2I49A 2PX1A 1DTZA 3CG3A 3KN8A 4OHNA 1MM6A 4KYEA 4LP2B 4H8IA 4NE4A 1JVXA 4JSDA 1LB8A 1NNTA 3SESA 4KQPA 3PPQA 3DRKA 5ISUA 4WXJA 2VD2A 1HSLA 3QK6A 3IAZA 3K0VA 4G4PA 1A8FA 3G3JA 4IO4A 1UQWA 4FECA 1M5DA 3QIMA 4ELPA 3VXCA 4GWOA 1P99A 3FTOA 2Q8JA 1CB6A 5H8FA 4GRKA 1FTJA 2Z22A 1M5EA 2HZKA 3RQTA 4NF5B 3MVXA 1Z7ME 3UN6A 1Q35A 4AQ4A 4DDDA 1B4ZA 2XXIA 5L9MA 1F9BA 1FQBA 1EH3A 3FVNA 4LONB 1OQHA 1Z7NE 5DVFA 4C1UA 1Y9UA 4KHZE 5K2YA 4OENA 3KG2A 4F1VA 1H45A 4RK2A 2Q2CA 1B3EA 4LA9A 4NF8A 1JW4A 1UTBB 2Q88A 1N3WA 4PFUA 4R73A 5HBCA 3H6VA 3K2DA 3F11A 5L9SA 1XVXA 4NF4B 4Q30B 3BFTA 3GXAA 3PUYE 1MY0A 4FAJA 2Y7KA 1WDNA 3SEWA 2XXUA 3KN7A 4GF8A 5JK4A 4F3SA 2O51A 4JWXA 3TTMA 4F29A 3KSXA 3IK6B 1O63A 4PE5B 4JSOA 4G2ZA 3TFLA 1YCJA 1VSOA 3IJOB 2REJA 2ZXTA 2Q9TA 1MS7A 4ESWA 2DSFA 1IXHA 3T22A 1I6BA 2Z8DA 2DS9A 2F7BA 3RYBA 3MAMA 1B52A 1Y3QA 5TP9A 1I6AA 2XD2A 3TELA 5I56B 3RTWB 3C9HA 3A3UA 3O66A 4LZ7A 1B1XA 4G8MA 4G8NA 1P1UA 4GVOA 5J1DA 1FCKA 5ICQA 3O29A 4POWA 2QJEA 1B46A 3HSTA 2V84A 4MLQA 1QJMA 2REGA 2AYSA 4F3GA 1MQGA 3PV0E 4PETA 1FTOA 2VP1A 4Q5TA 1PEBA 3OO8A 2PT2A 3FXUA 1JNFA 1Y4TA 2VGQA 3K6XA 3HPIA 5DTBA 5AE4A 1B0LA 2NXOA 3I6VA 3O6PA 1US5A 2H25A 4DXUA 1QUIA 3PPNA 2HQ0A 2F8DA 5TU0A 1N0TA 3FV1A 1Y3PA 2UVIA 2PYYA 3TTRA 3FD3A 2QS2A 4L17A 3IB0A 4DLDA 1NKXA 3I5OA 2QMWA 4LQ5A 2H99A 3VLUA 3C33A 4F3BA 1GVCA 1GR2A 3C31A 1UIUA 2UVHA 2OBGA 4ZE9A 3PU5A 1D4NA 1B5HA 4GQOA 1H44A 4G77A 1SVXB 1Q1KA 5CMMA 4H67A 5IKBA 4IY6A 1B05A 1L5TA 1QKAA 4ZZEA 1URGA 3Q26A 2VHAA 3E9XA 4F1UA 1A99A 5EYFA 3KFMA 3FXQA 3LR1A 1RYOA 3EN3A 2UVJA 4ZEBA 1AOVA 4PFYA 3G3KA 2KLFA 1JVYA 3LSXA 3FJGA 4F18A 4FATA 5F7VA 4RNSA 1QVSA 4F31B 4RK9A 4Z7EA 1DPEA 4YB6A 3FGSA 5H8NB 2QMXA 2I3WA 4ZS9A 3PAMA 3OXNA 4O3CA 4OYVA 3KBRA 2F34A 3CR9A 2RC8A 1QW0A 4WEPA 1LSTA 3GBBA 3AXFA 3K01A 1OQGA 5BWJA 1B2HA 1IUDA 4QSCA 5AA3A 4IO5A 3TUSA 2D21A 3T96B 3CHGA 4KD5A 1MH3A 1N76A 1FTKA 1D9VA 1HSJA 3OO9A 4NF5A 4UACA 3IOWA 1FTLA 5LOMA 1B0HA 5KZTA 2I3VA 3L6HA 1B5IA 4FIMA 3Q27A 1UTHB 3SERA 1MRPA 2F6GA 2H98A 4C0RA 2NOOA 3A3CA 1UTBA 3UK4A 3FVGA 1B7HA 1MY4A 1DSNA 4U22A 5B70A 3ODBA 5CBRA 1SI1A 3EHSA 1QKBA 3MP8A 2HAVA 3IB2A 2WOPA 2RINA 1FW0A 4OESA 4LQ2A 3DRGA 3BFUA 2IEEA 1XHYA 1B3LA 1S50A 2I4BA 2QS3A 1ANFA 1LFGA 2O69A 5ITPA 3V83A 2F7CA 4NF4A 4F19A 4IO2A 4ZEKA 1PB9A 4GXSB 1OLAA 2DOJA 4Q0CA 1FQCA 3L6GA 2O68A 1USYE 3G3GA 2RF1A 3ILTB 2D5WA 1SYHA 2OK2A 4XKPA 3OO6A 5EHMA 3WAFA 1NFTA 2YJPA 3MUQA 4QFOA 1SW4A 4XKNA 3FZVA 3O28A 3EHUA 2V3UA 4NWCA 3IOTA 3RN8A 2OLBA 3QYTA 4H1XA 4LATA 2AL5A 1YTVA 1GV8A 3E4RA 2ONSA 3MPKA 2G29A 1II5A 1R9LA 1URDA 2V3TA 4GIZA 4RA1A 2B4MA 4K3FA 4OFLA 3TYHA 3OOAA 1IXIA 4GXAA 3MZ9A 4QSEA 5I56A 2XX9A 3TZAA 2QS4A 5CBSA 4OETA 3M3LA 4MFIA 4H0WA 1N7WA 3FVOA 3OSQA 4KYSA 1BLFA 3BBRA 4YMAA 4IO7A 4MLVA 5KCJB 4R72A 2QRYA 1IXCA 4IGRA 4OEUA 4GLIA 4IO3A 1BKAA 2R71A 3FIRA 3HCQA 3OELA 3CI8A 1MQDA 3SKPA 4M1VA 2ZYNA 3TCHA 3H7MA 1R1NA 3O6GA 2ZYOA 2Y7RA 3ECRA 3MVZA 1P1QA 3T9HB 1MPBA 1ELJA 2R6GE 4YU0A 3VVDA 5CRYA 2DVZA 1QUKA 4X9TA 3PUVE 4RPOA 2F6PA 1NNKA 4F2OA 3SEUA 1H43A 3G3IA 3CFZA 3H6UA 3ZKLA 3IJXB 4X1BA 3IO6A 1YAEA 4OEVA 3S9MC 2F5XA 1O64A 4U21A 3TKDA 2CZLA 3R6UA 2WKYA 3TCFA 1SDXA 3DM0A 4YMBA 1NMUA 1A8EA 4EXLA 1LAXA 3FXRA 4DCYA 4EDPA 3KJTA 1DOTA 3H06B 2B4LA 2OZZA 2QL3A 3LUYA 2UVGA 3QSLA 4XIGQ 3C35A 2NUVA 4AB6A 5H8HB 1IQ7A 3V89B 2F35A 3MVWA 1PB8A 5HM4B 4QFKA 3FUZA 2I48A 5H8NA 4G68B 2HCAA 4F3PA 1VFDA 1D9YA 1ZIUA 2QPQA 3TTNA 4IGTA 2B65A 3DELB 5K2XA 4YKPA 4OFOA 4ND9A 1EZOA 4QHQA 3IR1A 1B3HA 3KOTA 3O6HA 2HZLA 3T66A 5BUUA
chains in the Genus database with same CATH superfamily
3JV9A 1S7YA 3G7WA 4O3AA 4P0GA 5KDTB 2GH9A 1XT8A 4GWYA 4N6PA 2Y84A 3W9WA 3B6WA 1LFHA 4LUBA 3UP9A 2XXQA 1BIYA 1LBZA 5EQ8A 3H6WA 3UIFA 3O6IA 4EF2A 2XXHA 3KOSA 1NV5A 3C34A 4JWYA 1FPDA 5ET7A 1NH7A 4ZEFA 1AIVA 3IORA 2CEXA 5FTIA 1XI6A 2DWHA 4XKQA 2GFEA 1SD3A 5AA2A 4NQ8A 3VVFA 2DE4A 3U72A 3T9XB 2Y5LA 4WEDA 3RT6B 3N26A 1T0KA 3IOUA 3G3HA 2CMOA 3H03A 1FTMA 3ISPA 2I0BA 4F1YA 1NI9A 5DW8A 5I2NA 1POTA 3VVEA 5JEIA 3PD8A 4TQUQ 3OO7A 4NGUA 3MP1A 3DRIA 3T1BA 2Y7IA 2Y7PA 4EQ7A 1LLSA 1EU8A 1Y20A 2XX7A 3C32A 4OTEA 3SDFA 1S9TA 3MP6A 1OMPA 4JWOA 2ANJA 2V4CA 3N94A 3MZ1A 2Z8EA 4H6DA 2ALUA 1MQHA 1B3FA 1KA0A 2H9BA 3WAEA 2P0SA 3MBPA 2DWJA 2RCBA 5LDZA 1SW1A 2PT1A 4FJPA 3HHFA 5DT6A 3TMGA 3DRJA 2GQ1A 4BDLA 3FATA 1USYH 2ZYKA 2XXXA 1B6HA 3DP8A 5L8DA 3KJ7A 1Y1MA 1J1NA 2DWIA 2QVRA 2RC7A 5CM6A 1POY1 3M3KA 1JQFA 2XWKA 4IY5A 2DYXA 2PBWA 4OVRA 2HPGA 3LC8A 3OMBA 2QVUA 2CZIA 1M5FA 1IMBA 2XD3A 3DRFA 1FQEA 4N07A 1PDAA 1OIBA 1MPDA 5AA2D 1Q9DA 4FEBA 1SI0A 2FYIA 5KCJA 4R2FA 2O84X 4F2QA 5EQAA 5IZ3A 1A40A 3C4MA 2XWVA 3SEYA 1WVJA 4QXDA 1MXWA 1B58A 4KCDA 5HPQA 1LAFE 1LAGE 1ZBMA 1NNPA 1LBXA 4EQBA 1P1NA 4ELQA 5DYHA 4I8CA 2F3DA 5EQ9A 3QXMA 4GWWA 3TQLA 2Q2AA 2I6EA 1R6ZA 3DP6A 3E13X 3FVKA 4P9KA 3HFUA 4PFBA 2ONRA 4POXA 5TPAB 5I7IA 3ZKKA 1A55A 1LAHE 2P1SA 3KC1A 4ESXA 3Q28A 3CSBA 1LBBA 3U94A 1M5CA 3PPPA 5I58B 5FTHA 3LSLA 5I2KB 1OVTA 4Z0IA 1SPIA 2F3BA 3D4CA 2XHDA 2FA7A 3S9LC 2M8CA 2PMSA 1B3GA 2I4CA 2IA4A 4FEDA 4P47A 1FRPA 1IZ1A 3CFXA 1MQJA 1SQYA 5I59B 2X7QA 3I3VA 1NUWA 3MC2A 1P1OA 3FASA 3UORA 1JEUA 2QVVA 2UYFA 1NV3A 1LBCA 4XTCQ 3TQWA 3A29A 2XXYA 4NTLA 4BLAA 1RKMA 1KZ8A 5H8HA 4QFLA 1JW1A 2OWTA 1DK4A 3E3KA 1IXGA 2MKZA 1B5JA 4BDRA 4BDQA 2DXYA 3H3GA 3O9PA 1NL5A 3HN0A 4HCYA 3S9EA 3IL1B 4G68A 4E0XA 4R6KA 2XX8A 4H5FA 4YB7A 4NF6B 4GWUA 2KQZA 1B1HA 1MXXA 4PDDA 1B32A 3SEVA 3VXBA 2ESNA 4NMYA 4O7MA 2WBBA 3DP4A 2A5TB 5JTYB 4GL0A 2OWSA 4OWDA 3LBSA 3N6TA 3T9VA 4OVTA 4N13A 2QFLA 4TOZA 4HCWA 5H8QB 4GX3A 1N84A 1FQAA 4KFQA 1I69A 3A09A 4OVPA 2B3FA 2GHAA 4RJZA 3PUZE 2WOKA 1H3DA 3FJMA 1H76A 4AB5A 2OCUA 1Y4CA 4PBQA 5DEXB 3QMFA 4ELOA 4GWXA 3GLBA 4E0WA 4JVIA 2Q8MA 2RC9A 4IO6A 3TEPA 5AA1A 4P8BA 3IB1A 1MM7A 3EF7A 4ECFA 1A7LA 2XXRA 1AL3A 1ZMGA 3GBAA 2F7AA 1VR5A 4P3LA 2ZYMA 1G0IA 4U1OA 4GD5A 5EHSA 2VT5A 4NAPA 2DP8A 4M4GA 1FJ9A 4U1ZA 1TT1A 4RY1A 1FBFA 4DXCA 1FBEA 4PE3A 1HSEA 1JP4A 2G93A 3VFJA 1P1WA 4X1DA 2ZNSA 2O7UA 1IEJA 2VPOA 3M8UA 2DDKA 3LVUA 1JW5A 1D9QA 3TAJA 3U92A 1N7XA 3EPEA 4O3BA 3VE1B 2XXTA 1FPIA 4XXUA 1QULA 3KN3A 3LUZA 4GFRA 4NEDA 3HO7A 4H45A 4U2RA 4NN3A 4H5GA 1AH5A 3JZJA 3H6TA 4TLLB 4H65A 5CMBA 4NHBA 2QS1A 4LZ5A 4PCDA 3TPAA 3K00A 4EXKA 5B7DA 5CMCA 1TXFA 2YLNA 4KCCA 4OZ9A 4U4SA 3S2VA 1US4A 2FNCA 4PC9A 3ZS6A 3GZGA 3V8XB 1LFIA 3H4ZA 4MBPA 2HXWA 2XXVA 1JEVA 5A5XB 3PMVA 1LGBC 4DE8A 2H4IA 1ZU0A 1I6QA 3B7DA 4JB7A 4Q8RA 4KI0E 4JBZA 4C1TA 1G0HA 2H5YA 3CIJA 5AA4B 4DZ1A 4EUOA 4XKRA 3R26A 4QBAA 4P56A 1DTGA 5DVJA 2CEYA 2YPNA 1NV1A 2VPNA 1OVBA 2F78A 1D3KA 4DCXA 3Q25A 1INPA 4GOTA 1VFEA 1VDWA 3K6UA 4OFJA 4OVJA 1NV2A 4GL8A 2DE2A 4PTKA 3U1OA 2HAUA 4RXLA 1B7UA 1XS5A 3OEKA 1TFAA 1EZ9A 1M5BA 1XVYA 4DIGA 1DMBA 2FBPA 2XXKA 1VE4A 2ZNUA 3PGFA 2ZMBA 1FQDA 1O7TA 3UGWA 2WOLA 1MY2A 1A54A 3QUJA 4UA8A 3IO4A 1ZJLA 3DRHA 3IX1A 4THIA 4KR5A 4BDNA 3VLWA 4ELRA 1R9QA 1FPEA 1YYZA 3MYUA 3LV0A 5TPAA 3T9UA 4G68C 5I57B 3RUMA 3FBPA 2E0SA 3MJNA 3K1PA 3SEXA 4XF5A 1FQFA 2XXWA 4QSDA 2RKMA 1URSA 2AL4A 3PMXA 2RCAA 3U93A 2Z23A 4MIJA 1IMEA 2JJKA 1BTJA 4ZECA 2PVUA 4OERA 1UTHA 5I58A 2WX9A 4FORA 5FHOA 2P3NA 5I2KA 3PD9A 4G8HA 3MWBA 4I3EA 4X04A 1CE2A 4ZEDA 1LCTA 5EYHA 2UXAA 5IAIA 3TDJA 5I59A 4OQOA 2I58A 3PPOA 3V5AA 1EZPA 3C36A 3LSFB 4YAHX 4ZE8A 4ONYA 3MVYA 1JETA 2D3IA 3RTFB 2F97A 1BK4A 5I3SA 3KC0A 3TTLA 4F22A 3HV1A 2X7PA 2Z8FA 3OEMA 1GTKA 3MZBA 4TLMB 4EQ9A 2E1SA 2BJIA 2F36A 1MH4A 2ZZXA 3K6VA 3OENA 4OXVA 3QAXA 3RGYA 5ESYA 2OX3A 2Y7WA 1QUJA 4NF6A 3O97A 5H8SA 2FIXA 5IZ1A 2I0CA 1RYXA 3EHTA 1KWHA 3PUWE 1SYIA 4I9DA 2R8TA 3W15C 3ILUB 3K1MA 4QF9A 2DVCA 2DWAA 2A5TA 2THIA 5JTYA 5CI5A 4JDFA 2ZZWA 1GGGA 3UA8A 2OWZA 3FJ7A 2R9JA 1Y1ZA 4OA4A 5M2VA 3K6WA 1B9JA 4PGNA 5H8FB 5H8QA 2FHYA 3LSWA 4X48A 3IFAA 1MG1A 2DQVA 4RYAA 1MQIA 2ZNTA 3PPRA 4R75A 4I62A 1ATGA 4U4XA 4XEQA 2QSXA 3TTKA 3IOVA 2O1MA 3T93B 2VD3A 2KR0A 5DEXA 4MEVA 3CSGA 4P11A 4PGPA 3HHGA 4EF1A 2O6AA 3ONMA 1RDZA 3NOHA 1IITA 2ZZVA 3TODA 4NF8B 5FHNA 3OD7A 5L9OA 4O8MA 2HXRA 2O7IA 4FBPA 4HW8A 4H46A 3VV5A 1UIVA 5CC2A 3KBZA 2ONKE 4MF3A 4LZ8A 3RT8A 4H8JA 3JYRA 1PBQA 1B7ZA 1DPPA 4PAFA 4OMBA 3SETA 3G3FA 3KZGA 3KGCA 4R6HA 4N17A 3DLNA 5F1QA 2GHBA 3N6UA 4R2BA 3OSRA 1OLCA 4ZDMA 3D4GA 3RPLB 3CFLA 1FTAA 5FBPA 4PFTA 3O2AA 4F39A 3B50A 4NG7A 4QFPA 5ITOA 4KXPA 4U23A 4KPTA 4OVSA 2PFYA 2OJTA 4R74A 4P1EA 3K1NA 3VLVA 1NNFA 3TCGA 1Y3NA 1XOCA 3PTYA 1MDP1 2Q89A 4ISUA 1B51A 2VOZA 3U8QA 3KEIA 1YPNA 2HEUA 3ROJA 2WEFA 2W7YA 1SW5A 2V93A 4KYDA 5A5XA 4I1DA 4JXIA 4BDMA 1TWYA 3RPWA 1B4HA 4YB5A 2NVUB 3W9VA 5ICTA 1ZTYA 1TFDA 1MXVA 4GX6A 5TP9B 2DXRA 1B40A 5AA4A 3E79A 1SBPA 3BKIB 2ABHA 4R9FA 2BJJX 4UABA 5I5PA 4NWDA 4YZZA 1N3XA 2XWIA 2XXPA 4PP0A 4BDOA 3FV2A 4I40A 1AMFA 4OVQA 2V3QA 4HS7A 5AA2B 3VDFA 5EYGA 2P2AA 3SZPA 1PC3A 3ZSFA 3PMWA 2HHMA 4ZEIA 3K02A 1IMAA 3THIA 2B3BA 3RNNA 4PBHA 3RLFE 4O94A 4YICA 2P3VA 1SW2A 2UYEA 1LCFA 1MY3A 3MQ9A 1PBPA 4PFWA 3CRBA 5I2NB 4PQJA 4I3YA 4MH5A 1N04A 2DE3A 1PB7A 2PFZA 2NWJA 5CMKA 1MPCA 4MX6A 1BP5A 3EQ1A 3USDA 3N5LA 2HFBA 3PUXE 5I57A 4DXBA 4WKMA 4NF0A 4RPNA 1XC1A 1NH8A 4ZZAA 4R6YA 5KDTA 1EYJA 2AIXA 4YKKA 5FHMA 4R9GA 1FBPA 1NUXA 2Y5KA 3K4UA 4FE8A 2LAOA 4P0IA 4IB2A 2X26A 3CVGA 3CG1A 1LB9A 1FBDA 4QRZA 3QUFA 2GRVA 3KSJA 1IIWA 5DVIA 3M3FA 3MPLA 1WODA 5ELVA 3B6TA 3B6QA 3R7XA 2V25A 4LVQA 3MW0A 1ZKBA 1MXYA 3RYAA 1MXZA 1MY1A 2O1LA 4HTGA 3S9NC 3Q29A 4PDHA 3P7IA 3S4UA 4PAKA 1ZLQA 5I84A 1MXUA 4YKIA 4QFNA 3E78A 4YKJA 2A5SA 1MDQA 3RY3A 2I49A 2PX1A 1DTZA 3CG3A 3KN8A 4OHNA 1MM6A 1DCUA 4KYEA 1FPFA 4LP2B 4H8IA 4NE4A 1JVXA 5EQ7A 4JSDA 1LB8A 1NNTA 3SESA 3D1RA 3PPQA 4KQPA 3DRKA 5ISUA 4WXJA 2VD2A 4G61A 5IGAA 1HSLA 3QK6A 3IAZA 4G4PA 3K0VA 1A8FA 1YXIA 3G3JA 4IO4A 1UQWA 4FECA 1M5DA 3QIMA 4ELPA 3VXCA 1NV6A 4GWOA 5J16A 1P99A 3BIHA 3FTOA 1LBYA 2Q8JA 1CB6A 5H8FA 4GRKA 1FTJA 2Z22A 1M5EA 2HZKA 3RQTA 4NF5B 3MVXA 1Z7ME 3UN6A 1Q35A 4AQ4A 4DDDA 1B4ZA 2XXIA 5L9MA 1F9BA 1FQBA 5ET5A 1EH3A 3FVNA 4LONB 1OQHA 1Z7NE 5DVFA 4C1UA 1Y9UA 4KHZE 2Q74A 5K2YA 1FJ6A 4OENA 3KG2A 4F1VA 1H45A 4RK2A 2Q2CA 1B3EA 4LA9A 4NF8A 1JW4A 1UTBB 2Q88A 1N3WA 4PFUA 4R73A 5HBCA 3B8BA 3H6VA 3K2DA 3F11A 5L9SA 1XVXA 4PF6A 4NF4B 3FXBA 4Q30B 3RYDA 1RDXA 3BFTA 1FPGA 1IMDA 3GXAA 3PUYE 1MY0A 4FAJA 2Y7KA 1WDNA 4GX4A 3SEWA 2XXUA 3KN7A 4GF8A 5JK4A 4F3SA 2O51A 4N8GA 4N6DA 4JWXA 3TTMA 4F29A 3KSXA 3IK6B 1O63A 4PE5B 4JSOA 4G2ZA 3TFLA 5T3JA 1YCJA 1VSOA 3IJOB 2REJA 2ZXTA 2Q9TA 1MS7A 4N15A 4ESWA 2DSFA 1IXHA 3T22A 1I6BA 2Z8DA 2DS9A 1IMFA 2F7BA 1FBHA 1NUZA 3RYBA 4OANA 3MAMA 1B52A 5F24A 1Y3QA 2FVZA 5TP9A 1I6AA 2XD2A 3TELA 1YZ0A 5I56B 3RTWB 3C9HA 3A3UA 3O66A 4LZ7A 4MNIA 1LBVA 1B1XA 4G8MA 4G8NA 1P1UA 4GVOA 5J1DA 1FCKA 5ICQA 3O29A 2WYPA 4POWA 2QJEA 1B46A 3HSTA 2V84A 4MLQA 1QJMA 2REGA 4IR8A 2AYSA 4GWZA 4F3GA 1MQGA 3PV0E 4PETA 1FTOA 2VP1A 4Q5TA 1PEBA 3OO8A 2PT2A 3FXUA 1JNFA 1Y4TA 2VGQA 1NV7A 3K6XA 3HPIA 5DTBA 5AE4A 1B0LA 2NXOA 3I6VA 3O6PA 1US5A 2H25A 4DXUA 1QUIA 4JVDA 3PPNA 1LBWA 2HQ0A 2F8DA 5TU0A 1N0TA 3FV1A 1Y3PA 2UVIA 2PYYA 3TTRA 3FD3A 2QS2A 4L17A 3IB0A 4DLDA 1NKXA 3I5OA 2QMWA 4LQ5A 4MMPA 4MNCA 2H99A 3VLUA 3C33A 4F3BA 1GVCA 1GR2A 3C31A 1UIUA 2WYKA 2UVHA 2OBGA 4ZE9A 4MNPA 4PFRA 3PU5A 1D4NA 1B5HA 4GQOA 1H44A 4G77A 1SVXB 1Q1KA 5CMMA 1FPLA 4H67A 5IKBA 4IY6A 1B05A 3GYYA 1L5TA 1QKAA 4ZZEA 1URGA 3Q26A 2VHAA 3E9XA 4N6KA 4F1UA 1A99A 5EYFA 3KFMA 3FXQA 3EKIA 3LR1A 1RYOA 3EN3A 2UVJA 4ZEBA 1AOVA 4PFYA 3G3KA 2KLFA 1JVYA 3LSXA 3FJGA 4F18A 4FATA 5F7VA 4RNSA 4AS4A 1QVSA 4F31B 4RK9A 2L5VA 4Z7EA 1DPEA 4YB6A 3FGSA 5H8NB 4X8RA 2QMXA 2I3WA 4ZS9A 3PAMA 4N8YA 3OXNA 4O3CA 4OYVA 2WBDA 4DI4B 3KBRA 2F34A 3CR9A 2RC8A 1QW0A 4WEPA 1LSTA 3GBBA 3AXFA 5IM2A 3K01A 1OQGA 5BWJA 1B2HA 1IUDA 4QSCA 5AA3A 4IO5A 3TUSA 2D21A 4MHFA 3T96B 3CHGA 4KD5A 4LN5A 1MH3A 1N76A 1FTKA 1NV0A 1D9VA 1HSJA 3OO9A 4NF5A 4UACA 3IOWA 1FTLA 5LOMA 1B0HA 5KZTA 1EYKA 2I3VA 4XFEA 3L6HA 1B5IA 4FIMA 4NX1A 3Q27A 1UTHB 3SERA 1MRPA 2F6GA 2H98A 4C0RA 2NOOA 3A3CA 4JVCA 2CZKA 1UTBA 3UK4A 3FVGA 1B7HA 1MY4A 1DSNA 4U22A 3BIGA 5B70A 3ODBA 5CBRA 1SI1A 1RDYA 1QKBA 3EHSA 3MP8A 2HAVA 3IB2A 2WOPA 2RINA 1FW0A 4OESA 4LQ2A 3DRGA 3BFUA 3IFCA 2IEEA 1XHYA 1B3LA 1S50A 2I4BA 2QS3A 1ANFA 1LFGA 2O69A 5ITPA 4GBWA 4HE2A 2F7CA 3V83A 4NF4A 4F19A 1KA1A 4IO2A 4ZEKA 1FPBA 1PB9A 4GXSB 1OLAA 2DOJA 4Q0CA 1FQCA 3L6GA 2O68A 1USYE 3G3GA 2RF1A 3ILTB 2D5WA 1SYHA 2OK2A 4XKPA 3OO6A 5EHMA 3WAFA 1NFTA 2YJPA 3MUQA 4QFOA 1SW4A 4XKNA 3FZVA 3O28A 3EHUA 2V3UA 4NWCA 3IOTA 4N81A 3RN8A 2OLBA 3QYTA 2XWOA 4H1XA 4LATA 1FBCA 2AL5A 1YTVA 1GV8A 3E4RA 4HE1A 1NV4A 2ONSA 3MPKA 5IZZA 2G29A 1II5A 1R9LA 4N91A 1URDA 1FPKA 4PF8A 2V3TA 4GIZA 4RA1A 1CNQA 2B4MA 4K3FA 4OFLA 3TYHA 3OOAA 1LEVA 1IXIA 4AS5A 5LTCA 1QGXA 4GXAA 3MZ9A 4QSEA 5I56A 2XX9A 3TZAA 4MAGA 2QS4A 3MSTA 5CBSA 4OETA 4N4UA 3M3LA 2XA5A 4MFIA 4H0WA 1N7WA 3FVOA 1NUYA 3OSQA 4KYSA 1BLFA 3BBRA 4YMAA 4GBVA 4PAIA 4IO7A 4MLVA 5KCJB 4R72A 1AWBA 2QRYA 5IZ3B 1IXCA 4IGRA 3T0JA 4OEUA 4GLIA 4IO3A 1BKAA 5ET6A 2R71A 3FIRA 1EYIA 5ET8A 3HCQA 3OELA 3CI8A 1MQDA 3SKPA 4M1VA 2ZYNA 3TCHA 3H7MA 1R1NA 3O6GA 1FSAA 2ZYOA 2Y7RA 3ECRA 3MVZA 1P1QA 3T9HB 1MPBA 1ELJA 2R6GE 4YU0A 3VVDA 5CRYA 2DVZA 4GWSA 1QUKA 2CZHA 4X9TA 3PUVE 4RPOA 2F6PA 1NNKA 4F2OA 1H43A 3SEUA 3G3IA 3CFZA 3H6UA 3ZKLA 3IJXB 4X1BA 4HXVA 3IO6A 1YAEA 4OEVA 3S9MC 2F5XA 1O64A 4U21A 3TKDA 2CZLA 4PFIA 3R6UA 2WKYA 3TCFA 1SDXA 4MCOA 3DM0A 4YMBA 1NMUA 1A8EA 4EXLA 2PCRA 4MJOA 1LAXA 3FXRA 4DCYA 4EDPA 3KJTA 1DOTA 3H06B 2B4LA 1IMCA 2OZZA 2QL3A 3LUYA 2UVGA 3QSLA 4XIGQ 3C35A 1FBGA 2NUVA 4AB6A 5H8HB 4DI3D 1IQ7A 3V89B 2F35A 3U65A 3MVWA 1PB8A 5HM4B 4QFKA 5A5LA 3RPLA 3FUZA 2I48A 5H8NA 4G68B 1K9ZA 2HCAA 4F3PA 1VFDA 2FIEA 1DBZA 1D9YA 4O7IA 1ZIUA 2QPQA 3TTNA 4IGTA 2B65A 3DELB 1K9YA 5K2XA 4YKPA 4OFOA 4ND9A 1EZOA 4QHQA 3IR1A 1B3HA 3KOTA 4HE0A 3O6HA 2HZLA 3T66A 4P1LA 5BUUA 1FPJA
chains in the Genus database with same CATH topology
3JV9A 1S7YA 3G7WA 4O3AA 4P0GA 5KDTB 2GH9A 1XT8A 4N6PA 2Y84A 3W9WA 3B6WA 1LFHA 4LUBA 3UP9A 2XXQA 1BIYA 3H6WA 3UIFA 3O6IA 4EF2A 2XXHA 3KOSA 3C34A 4JWYA 1NH7A 4ZEFA 1AIVA 3IORA 5FTIA 2DWHA 4XKQA 2GFEA 1SD3A 5AA2A 3VVFA 2DE4A 3U72A 3T9XB 4WEDA 3RT6B 3N26A 1T0KA 3IOUA 3G3HA 2CMOA 3H03A 1FTMA 4F1YA 2I0BA 5I2NA 1POTA 3VVEA 5JEIA 3PD8A 4TQUQ 3OO7A 3MP1A 3DRIA 2Y7IA 2Y7PA 4EQ7A 1LLSA 1EU8A 1Y20A 2XX7A 3C32A 4OTEA 3SDFA 1S9TA 3MP6A 1OMPA 4JWOA 2ANJA 3N94A 3MZ1A 2Z8EA 4H6DA 2ALUA 1MQHA 1B3FA 2H9BA 3WAEA 2P0SA 3MBPA 2DWJA 2RCBA 1SW1A 2PT1A 4FJPA 3HHFA 5DT6A 3TMGA 3DRJA 4BDLA 3FATA 1USYH 2ZYKA 2XXXA 1B6HA 3DP8A 5L8DA 3KJ7A 1Y1MA 1J1NA 2DWIA 5CM6A 2RC7A 1POY1 3M3KA 1JQFA 4IY5A 2DYXA 2PBWA 3LC8A 3OMBA 1M5FA 2XD3A 3DRFA 1FQEA 4N07A 1PDAA 1OIBA 1MPDA 5AA2D 4FEBA 1SI0A 2FYIA 5KCJA 4R2FA 2O84X 4F2QA 1A40A 3C4MA 3SEYA 1WVJA 1MXWA 1B58A 4KCDA 5HPQA 1LAFE 1LAGE 1ZBMA 1NNPA 4EQBA 1P1NA 4ELQA 5DYHA 4I8CA 3QXMA 3TQLA 2Q2AA 2I6EA 1R6ZA 3DP6A 3E13X 3FVKA 2ONRA 4POXA 5TPAB 3ZKKA 1A55A 1LAHE 2P1SA 4ESXA 3Q28A 3CSBA 1LBBA 3U94A 1M5CA 3PPPA 5I58B 5FTHA 3LSLA 5I2KB 1OVTA 4Z0IA 3D4CA 2XHDA 2FA7A 3S9LC 2M8CA 2PMSA 1B3GA 2I4CA 2IA4A 4FEDA 1IZ1A 3CFXA 1MQJA 1SQYA 5I59B 2X7QA 3I3VA 3MC2A 1P1OA 3FASA 3UORA 1JEUA 2UYFA 3TQWA 1LBCA 4XTCQ 2XXYA 4NTLA 4BLAA 1RKMA 5H8HA 4QFLA 1JW1A 2OWTA 3E3KA 1IXGA 1B5JA 4BDRA 4BDQA 2DXYA 3H3GA 3O9PA 1NL5A 3HN0A 4HCYA 3S9EA 3IL1B 4G68A 4E0XA 4R6KA 2XX8A 4H5FA 4YB7A 4NF6B 1B1HA 1MXXA 1B32A 3SEVA 3VXBA 2ESNA 4NMYA 3DP4A 2A5TB 5JTYB 4GL0A 2OWSA 4OWDA 3LBSA 3N6TA 3T9VA 4N13A 4TOZA 4HCWA 5H8QB 1N84A 1FQAA 4KFQA 1I69A 3A09A 2B3FA 2GHAA 4RJZA 3PUZE 2WOKA 1H3DA 3FJMA 1H76A 4AB5A 2OCUA 1Y4CA 5DEXB 4ELOA 3GLBA 4E0WA 2RC9A 4IO6A 3TEPA 5AA1A 3IB1A 1MM7A 3EF7A 4ECFA 1A7LA 2XXRA 1AL3A 1ZMGA 3GBAA 2F7AA 1VR5A 2ZYMA 4U1OA 4GD5A 5EHSA 2DP8A 4M4GA 4U1ZA 1TT1A 4RY1A 4DXCA 1HSEA 2G93A 3VFJA 1P1WA 4X1DA 2ZNSA 2O7UA 1IEJA 3M8UA 3LVUA 1JW5A 3TAJA 3U92A 1N7XA 3EPEA 4O3BA 3VE1B 2XXTA 4XXUA 1QULA 3KN3A 4GFRA 4NEDA 3HO7A 4U2RA 4H5GA 1AH5A 3JZJA 3H6TA 4TLLB 4H65A 5CMBA 2QS1A 4LZ5A 3TPAA 3K00A 4EXKA 5B7DA 5CMCA 1TXFA 2YLNA 4KCCA 4OZ9A 4U4SA 3S2VA 1US4A 2FNCA 3ZS6A 3GZGA 3V8XB 1LFIA 3H4ZA 4MBPA 2HXWA 2XXVA 1JEVA 5A5XB 3PMVA 1LGBC 4DE8A 2H4IA 1ZU0A 1I6QA 3B7DA 4JB7A 4Q8RA 4KI0E 4JBZA 4C1TA 2H5YA 3CIJA 5AA4B 4DZ1A 4EUOA 4XKRA 3R26A 1DTGA 5DVJA 2YPNA 1OVBA 2F78A 1D3KA 4DCXA 3Q25A 4GOTA 1VFEA 3K6UA 4OFJA 4OVJA 4GL8A 2DE2A 3U1OA 2HAUA 4RXLA 1B7UA 1XS5A 3OEKA 1TFAA 1EZ9A 1M5BA 1XVYA 4DIGA 1DMBA 1VE4A 2ZNUA 3PGFA 2ZMBA 1FQDA 1O7TA 3UGWA 2WOLA 1MY2A 1A54A 3QUJA 4UA8A 3IO4A 1ZJLA 3DRHA 3IX1A 4THIA 4KR5A 4BDNA 3VLWA 4ELRA 1R9QA 5TPAA 3T9UA 4G68C 5I57B 3RUMA 2E0SA 3MJNA 3K1PA 3SEXA 1FQFA 2XXWA 4QSDA 2RKMA 1URSA 2AL4A 3PMXA 2RCAA 3U93A 2Z23A 1BTJA 4ZECA 2PVUA 4OERA 1UTHA 5I58A 4FORA 5FHOA 5I2KA 3PD9A 4G8HA 3MWBA 1CE2A 4ZEDA 1LCTA 2UXAA 5IAIA 3TDJA 5I59A 4OQOA 2I58A 3PPOA 3V5AA 1EZPA 3C36A 3LSFB 4YAHX 4ZE8A 4ONYA 3MVYA 1JETA 2D3IA 3RTFB 2F97A 3TTLA 4F22A 3HV1A 2X7PA 2Z8FA 3OEMA 1GTKA 3MZBA 4TLMB 4EQ9A 2E1SA 2F36A 1MH4A 3K6VA 3OENA 4OXVA 3QAXA 3RGYA 2Y7WA 1QUJA 4NF6A 3O97A 5H8SA 2I0CA 1RYXA 3EHTA 1KWHA 3PUWE 1SYIA 4I9DA 3W15C 3ILUB 3K1MA 4QF9A 2DVCA 2DWAA 2A5TA 2THIA 5JTYA 5CI5A 4JDFA 1GGGA 3UA8A 3FJ7A 2R9JA 1Y1ZA 5M2VA 3K6WA 1B9JA 5H8FB 5H8QA 3LSWA 4X48A 1MG1A 2DQVA 4RYAA 1MQIA 2ZNTA 3PPRA 4R75A 4I62A 1ATGA 4U4XA 2QSXA 3TTKA 3IOVA 2O1MA 3T93B 2VD3A 5DEXA 3CSGA 4P11A 3HHGA 4EF1A 2O6AA 3ONMA 1IITA 3TODA 4NF8B 5FHNA 3OD7A 5L9OA 2O7IA 4HW8A 3VV5A 1UIVA 5CC2A 2ONKE 4MF3A 4LZ8A 3RT8A 4H8JA 3JYRA 1PBQA 1B7ZA 1DPPA 3SETA 4OMBA 3G3FA 3KZGA 3KGCA 4R6HA 3DLNA 5F1QA 2GHBA 3N6UA 4R2BA 3OSRA 1OLCA 4ZDMA 3D4GA 3CFLA 4PFTA 3O2AA 4F39A 4QFPA 5ITOA 4U23A 4KPTA 2OJTA 4R74A 3K1NA 3VLVA 1NNFA 3TCGA 1Y3NA 1XOCA 1MDP1 2Q89A 4ISUA 1B51A 2VOZA 3U8QA 3KEIA 1YPNA 2HEUA 2W7YA 1SW5A 2V93A 4KYDA 5A5XA 4I1DA 4JXIA 4BDMA 1TWYA 3RPWA 1B4HA 4YB5A 2NVUB 3W9VA 5ICTA 1ZTYA 1TFDA 1MXVA 5TP9B 2DXRA 1B40A 5AA4A 1SBPA 3BKIB 2ABHA 4R9FA 2BJJX 4NWDA 4YZZA 1N3XA 2XXPA 4PP0A 4BDOA 3FV2A 1AMFA 2V3QA 4HS7A 5AA2B 3VDFA 2P2AA 1PC3A 3ZSFA 3PMWA 4ZEIA 3K02A 3THIA 2B3BA 3RNNA 3RLFE 4YICA 1SW2A 2UYEA 1LCFA 1MY3A 3MQ9A 1PBPA 4PFWA 3CRBA 5I2NB 4PQJA 4MH5A 1N04A 2DE3A 1PB7A 2NWJA 5CMKA 1MPCA 1BP5A 3EQ1A 3USDA 3N5LA 2HFBA 3PUXE 5I57A 4DXBA 4WKMA 4RPNA 1XC1A 1NH8A 4ZZAA 4R6YA 5KDTA 2AIXA 4YKKA 5FHMA 4R9GA 3K4UA 4FE8A 2LAOA 4P0IA 4IB2A 2X26A 3CVGA 3CG1A 1LB9A 4QRZA 3QUFA 2GRVA 3KSJA 1IIWA 5DVIA 3M3FA 3MPLA 1WODA 5ELVA 3B6TA 3B6QA 3R7XA 2V25A 4LVQA 3MW0A 1ZKBA 1MXYA 3RYAA 1MXZA 1MY1A 2O1LA 4HTGA 3S9NC 3Q29A 3P7IA 3S4UA 1ZLQA 5I84A 1MXUA 4YKIA 4QFNA 4YKJA 2A5SA 1MDQA 3RY3A 2I49A 2PX1A 1DTZA 3CG3A 3KN8A 4OHNA 1MM6A 4KYEA 4LP2B 4H8IA 4NE4A 1JVXA 4JSDA 1LB8A 1NNTA 3SESA 4KQPA 3PPQA 3DRKA 5ISUA 4WXJA 2VD2A 1HSLA 3QK6A 3IAZA 3K0VA 4G4PA 1A8FA 3G3JA 4IO4A 1UQWA 4FECA 1M5DA 3QIMA 4ELPA 3VXCA 4GWOA 1P99A 3FTOA 2Q8JA 1CB6A 5H8FA 4GRKA 1FTJA 2Z22A 1M5EA 2HZKA 3RQTA 4NF5B 3MVXA 1Z7ME 3UN6A 1Q35A 4AQ4A 4DDDA 1B4ZA 2XXIA 5L9MA 1F9BA 1FQBA 1EH3A 3FVNA 4LONB 1OQHA 1Z7NE 5DVFA 4C1UA 1Y9UA 4KHZE 5K2YA 4OENA 3KG2A 4F1VA 1H45A 4RK2A 2Q2CA 1B3EA 4LA9A 4NF8A 1JW4A 1UTBB 2Q88A 1N3WA 4PFUA 4R73A 5HBCA 3H6VA 3K2DA 3F11A 5L9SA 1XVXA 4NF4B 4Q30B 3BFTA 3GXAA 3PUYE 1MY0A 4FAJA 2Y7KA 1WDNA 3SEWA 2XXUA 3KN7A 4GF8A 5JK4A 4F3SA 2O51A 4JWXA 3TTMA 4F29A 3KSXA 3IK6B 1O63A 4PE5B 4JSOA 4G2ZA 3TFLA 1YCJA 1VSOA 3IJOB 2REJA 2ZXTA 2Q9TA 1MS7A 4ESWA 2DSFA 1IXHA 3T22A 1I6BA 2Z8DA 2DS9A 2F7BA 3RYBA 3MAMA 1B52A 1Y3QA 5TP9A 1I6AA 2XD2A 3TELA 5I56B 3RTWB 3C9HA 3A3UA 3O66A 4LZ7A 1B1XA 4G8MA 4G8NA 1P1UA 4GVOA 5J1DA 1FCKA 5ICQA 3O29A 4POWA 2QJEA 1B46A 3HSTA 2V84A 4MLQA 1QJMA 2REGA 2AYSA 4F3GA 1MQGA 3PV0E 4PETA 1FTOA 2VP1A 4Q5TA 1PEBA 3OO8A 2PT2A 3FXUA 1JNFA 1Y4TA 2VGQA 3K6XA 3HPIA 5DTBA 5AE4A 1B0LA 2NXOA 3I6VA 3O6PA 1US5A 2H25A 4DXUA 1QUIA 3PPNA 2HQ0A 2F8DA 5TU0A 1N0TA 3FV1A 1Y3PA 2UVIA 2PYYA 3TTRA 3FD3A 2QS2A 4L17A 3IB0A 4DLDA 1NKXA 3I5OA 2QMWA 4LQ5A 2H99A 3VLUA 3C33A 4F3BA 1GVCA 1GR2A 3C31A 1UIUA 2UVHA 2OBGA 4ZE9A 3PU5A 1D4NA 1B5HA 4GQOA 1H44A 4G77A 1SVXB 1Q1KA 5CMMA 4H67A 5IKBA 4IY6A 1B05A 1L5TA 1QKAA 4ZZEA 1URGA 3Q26A 2VHAA 3E9XA 4F1UA 1A99A 5EYFA 3KFMA 3FXQA 3LR1A 1RYOA 3EN3A 2UVJA 4ZEBA 1AOVA 4PFYA 3G3KA 2KLFA 1JVYA 3LSXA 3FJGA 4F18A 4FATA 5F7VA 4RNSA 1QVSA 4F31B 4RK9A 4Z7EA 1DPEA 4YB6A 3FGSA 5H8NB 2QMXA 2I3WA 4ZS9A 3PAMA 3OXNA 4O3CA 4OYVA 3KBRA 2F34A 3CR9A 2RC8A 1QW0A 4WEPA 1LSTA 3GBBA 3AXFA 3K01A 1OQGA 5BWJA 1B2HA 1IUDA 4QSCA 5AA3A 4IO5A 3TUSA 2D21A 3T96B 3CHGA 4KD5A 1MH3A 1N76A 1FTKA 1D9VA 1HSJA 3OO9A 4NF5A 4UACA 3IOWA 1FTLA 5LOMA 1B0HA 5KZTA 2I3VA 3L6HA 1B5IA 4FIMA 3Q27A 1UTHB 3SERA 1MRPA 2F6GA 2H98A 4C0RA 2NOOA 3A3CA 1UTBA 3UK4A 3FVGA 1B7HA 1MY4A 1DSNA 4U22A 5B70A 3ODBA 5CBRA 1SI1A 3EHSA 1QKBA 3MP8A 2HAVA 3IB2A 2WOPA 2RINA 1FW0A 4OESA 4LQ2A 3DRGA 3BFUA 2IEEA 1XHYA 1B3LA 1S50A 2I4BA 2QS3A 1ANFA 1LFGA 2O69A 5ITPA 3V83A 2F7CA 4NF4A 4F19A 4IO2A 4ZEKA 1PB9A 4GXSB 1OLAA 2DOJA 4Q0CA 1FQCA 3L6GA 2O68A 1USYE 3G3GA 2RF1A 3ILTB 2D5WA 1SYHA 2OK2A 4XKPA 3OO6A 5EHMA 3WAFA 1NFTA 2YJPA 3MUQA 4QFOA 1SW4A 4XKNA 3FZVA 3O28A 3EHUA 2V3UA 4NWCA 3IOTA 3RN8A 2OLBA 3QYTA 4H1XA 4LATA 2AL5A 1YTVA 1GV8A 3E4RA 2ONSA 3MPKA 2G29A 1II5A 1R9LA 1URDA 2V3TA 4GIZA 4RA1A 2B4MA 4K3FA 4OFLA 3TYHA 3OOAA 1IXIA 4GXAA 3MZ9A 4QSEA 5I56A 2XX9A 3TZAA 2QS4A 5CBSA 4OETA 3M3LA 4MFIA 4H0WA 1N7WA 3FVOA 3OSQA 4KYSA 1BLFA 3BBRA 4YMAA 4IO7A 4MLVA 5KCJB 4R72A 2QRYA 1IXCA 4IGRA 4OEUA 4GLIA 4IO3A 1BKAA 2R71A 3FIRA 3HCQA 3OELA 3CI8A 1MQDA 3SKPA 4M1VA 2ZYNA 3TCHA 3H7MA 1R1NA 3O6GA 2ZYOA 2Y7RA 3ECRA 3MVZA 1P1QA 3T9HB 1MPBA 1ELJA 2R6GE 4YU0A 3VVDA 5CRYA 2DVZA 1QUKA 4X9TA 3PUVE 4RPOA 2F6PA 1NNKA 4F2OA 3SEUA 1H43A 3G3IA 3CFZA 3H6UA 3ZKLA 3IJXB 4X1BA 3IO6A 1YAEA 4OEVA 3S9MC 2F5XA 1O64A 4U21A 3TKDA 2CZLA 3R6UA 2WKYA 3TCFA 1SDXA 3DM0A 4YMBA 1NMUA 1A8EA 4EXLA 1LAXA 3FXRA 4DCYA 4EDPA 3KJTA 1DOTA 3H06B 2B4LA 2OZZA 2QL3A 3LUYA 2UVGA 3QSLA 4XIGQ 3C35A 2NUVA 4AB6A 5H8HB 1IQ7A 3V89B 2F35A 3MVWA 1PB8A 5HM4B 4QFKA 3FUZA 2I48A 5H8NA 4G68B 2HCAA 4F3PA 1VFDA 1D9YA 1ZIUA 2QPQA 3TTNA 4IGTA 2B65A 3DELB 5K2XA 4YKPA 4OFOA 4ND9A 1EZOA 4QHQA 3IR1A 1B3HA 3KOTA 3O6HA 2HZLA 3T66A 5BUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JV9 A;  1S7Y A;  3G7W A;  4O3A A;  4P0G A;  5KDT B;  2GH9 A;  1XT8 A;  4N6P A;  2Y84 A;  3W9W A;  3B6W A;  1LFH A;  4LUB A;  3UP9 A;  2XXQ A;  1BIY A;  3H6W A;  3UIF A;  3O6I A;  4EF2 A;  2XXH A;  3KOS A;  3C34 A;  4JWY A;  1NH7 A;  4ZEF A;  1AIV A;  3IOR A;  5FTI A;  2DWH A;  4XKQ A;  2GFE A;  1SD3 A;  5AA2 A;  3VVF A;  2DE4 A;  3U72 A;  3T9X B;  4WED A;  3RT6 B;  3N26 A;  1T0K A;  3IOU A;  3G3H A;  2CMO A;  3H03 A;  1FTM A;  4F1Y A;  2I0B A;  5I2N A;  1POT A;  3VVE A;  5JEI A;  3PD8 A;  4TQU Q;  3OO7 A;  3MP1 A;  3DRI A;  2Y7I A;  2Y7P A;  4EQ7 A;  1LLS A;  1EU8 A;  1Y20 A;  2XX7 A;  3C32 A;  4OTE A;  3SDF A;  1S9T A;  3MP6 A;  1OMP A;  4JWO A;  2ANJ A;  3N94 A;  3MZ1 A;  2Z8E A;  4H6D A;  2ALU A;  1MQH A;  1B3F A;  2H9B A;  3WAE A;  2P0S A;  3MBP A;  2DWJ A;  2RCB A;  1SW1 A;  2PT1 A;  4FJP A;  3HHF A;  5DT6 A;  3TMG A;  3DRJ A;  4BDL A;  3FAT A;  1USY H;  2ZYK A;  2XXX A;  1B6H A;  3DP8 A;  5L8D A;  3KJ7 A;  1Y1M A;  1J1N A;  2DWI A;  5CM6 A;  2RC7 A;  1POY 1;  3M3K A;  1JQF A;  4IY5 A;  2DYX A;  2PBW A;  3LC8 A;  3OMB A;  1M5F A;  2XD3 A;  3DRF A;  1FQE A;  4N07 A;  1PDA A;  1OIB A;  1MPD A;  5AA2 D;  4FEB A;  1SI0 A;  2FYI A;  5KCJ A;  4R2F A;  2O84 X;  4F2Q A;  1A40 A;  3C4M A;  3SEY A;  1WVJ A;  1MXW A;  1B58 A;  4KCD A;  5HPQ A;  1LAF E;  1LAG E;  1ZBM A;  1NNP A;  4EQB A;  1P1N A;  4ELQ A;  5DYH A;  4I8C A;  3QXM A;  3TQL A;  2Q2A A;  2I6E A;  1R6Z A;  3DP6 A;  3E13 X;  3FVK A;  2ONR A;  4POX A;  5TPA B;  3ZKK A;  1A55 A;  1LAH E;  2P1S A;  4ESX A;  3Q28 A;  3CSB A;  1LBB A;  3U94 A;  1M5C A;  3PPP A;  5I58 B;  5FTH A;  3LSL A;  5I2K B;  1OVT A;  4Z0I A;  3D4C A;  2XHD A;  2FA7 A;  3S9L C;  2M8C A;  2PMS A;  1B3G A;  2I4C A;  2IA4 A;  4FED A;  1IZ1 A;  3CFX A;  1MQJ A;  1SQY A;  5I59 B;  2X7Q A;  3I3V A;  3MC2 A;  1P1O A;  3FAS A;  3UOR A;  1JEU A;  2UYF A;  3TQW A;  1LBC A;  4XTC Q;  2XXY A;  4NTL A;  4BLA A;  1RKM A;  5H8H A;  4QFL A;  1JW1 A;  2OWT A;  3E3K A;  1IXG A;  1B5J A;  4BDR A;  4BDQ A;  2DXY A;  3H3G A;  3O9P A;  1NL5 A;  3HN0 A;  4HCY A;  3S9E A;  3IL1 B;  4G68 A;  4E0X A;  4R6K A;  2XX8 A;  4H5F A;  4YB7 A;  4NF6 B;  1B1H A;  1MXX A;  1B32 A;  3SEV A;  3VXB A;  2ESN A;  4NMY A;  3DP4 A;  2A5T B;  5JTY B;  4GL0 A;  2OWS A;  4OWD A;  3LBS A;  3N6T A;  3T9V A;  4N13 A;  4TOZ A;  4HCW A;  5H8Q B;  1N84 A;  1FQA A;  4KFQ A;  1I69 A;  3A09 A;  2B3F A;  2GHA A;  4RJZ A;  3PUZ E;  2WOK A;  1H3D A;  3FJM A;  1H76 A;  4AB5 A;  2OCU A;  1Y4C A;  5DEX B;  4ELO A;  3GLB A;  4E0W A;  2RC9 A;  4IO6 A;  3TEP A;  5AA1 A;  3IB1 A;  1MM7 A;  3EF7 A;  4ECF A;  1A7L A;  2XXR A;  1AL3 A;  1ZMG A;  3GBA A;  2F7A A;  1VR5 A;  2ZYM A;  4U1O A;  4GD5 A;  5EHS A;  2DP8 A;  4M4G A;  4U1Z A;  1TT1 A;  4RY1 A;  4DXC A;  1HSE A;  2G93 A;  3VFJ A;  1P1W A;  4X1D A;  2ZNS A;  2O7U A;  1IEJ A;  3M8U A;  3LVU A;  1JW5 A;  3TAJ A;  3U92 A;  1N7X A;  3EPE A;  4O3B A;  3VE1 B;  2XXT A;  4XXU A;  1QUL A;  3KN3 A;  4GFR A;  4NED A;  3HO7 A;  4U2R A;  4H5G A;  1AH5 A;  3JZJ A;  3H6T A;  4TLL B;  4H65 A;  5CMB A;  2QS1 A;  4LZ5 A;  3TPA A;  3K00 A;  4EXK A;  5B7D A;  5CMC A;  1TXF A;  2YLN A;  4KCC A;  4OZ9 A;  4U4S A;  3S2V A;  1US4 A;  2FNC A;  3ZS6 A;  3GZG A;  3V8X B;  1LFI A;  3H4Z A;  4MBP A;  2HXW A;  2XXV A;  1JEV A;  5A5X B;  3PMV A;  1LGB C;  4DE8 A;  2H4I A;  1ZU0 A;  1I6Q A;  3B7D A;  4JB7 A;  4Q8R A;  4KI0 E;  4JBZ A;  4C1T A;  2H5Y A;  3CIJ A;  5AA4 B;  4DZ1 A;  4EUO A;  4XKR A;  3R26 A;  1DTG A;  5DVJ A;  2YPN A;  1OVB A;  2F78 A;  1D3K A;  4DCX A;  3Q25 A;  4GOT A;  1VFE A;  3K6U A;  4OFJ A;  4OVJ A;  4GL8 A;  2DE2 A;  3U1O A;  2HAU A;  4RXL A;  1B7U A;  1XS5 A;  3OEK A;  1TFA A;  1EZ9 A;  1M5B A;  1XVY A;  4DIG A;  1DMB A;  1VE4 A;  2ZNU A;  3PGF A;  2ZMB A;  1FQD A;  1O7T A;  3UGW A;  2WOL A;  1MY2 A;  1A54 A;  3QUJ A;  4UA8 A;  3IO4 A;  1ZJL A;  3DRH A;  3IX1 A;  4THI A;  4KR5 A;  4BDN A;  3VLW A;  4ELR A;  1R9Q A;  5TPA A;  3T9U A;  4G68 C;  5I57 B;  3RUM A;  2E0S A;  3MJN A;  3K1P A;  3SEX A;  1FQF A;  2XXW A;  4QSD A;  2RKM A;  1URS A;  2AL4 A;  3PMX A;  2RCA A;  3U93 A;  2Z23 A;  1BTJ A;  4ZEC A;  2PVU A;  4OER A;  1UTH A;  5I58 A;  4FOR A;  5FHO A;  5I2K A;  3PD9 A;  4G8H A;  3MWB A;  1CE2 A;  4ZED A;  1LCT A;  2UXA A;  5IAI A;  3TDJ A;  5I59 A;  4OQO A;  2I58 A;  3PPO A;  3V5A A;  1EZP A;  3C36 A;  3LSF B;  4YAH X;  4ZE8 A;  4ONY A;  3MVY A;  1JET A;  2D3I A;  3RTF B;  2F97 A;  3TTL A;  4F22 A;  3HV1 A;  2X7P A;  2Z8F A;  3OEM A;  1GTK A;  3MZB A;  4TLM B;  4EQ9 A;  2E1S A;  2F36 A;  1MH4 A;  3K6V A;  3OEN A;  4OXV A;  3QAX A;  3RGY A;  2Y7W A;  1QUJ A;  4NF6 A;  3O97 A;  5H8S A;  2I0C A;  1RYX A;  3EHT A;  1KWH A;  3PUW E;  1SYI A;  4I9D A;  3W15 C;  3ILU B;  3K1M A;  4QF9 A;  2DVC A;  2DWA A;  2A5T A;  2THI A;  5JTY A;  5CI5 A;  4JDF A;  1GGG A;  3UA8 A;  3FJ7 A;  2R9J A;  1Y1Z A;  5M2V A;  3K6W A;  1B9J A;  5H8F B;  5H8Q A;  3LSW A;  4X48 A;  1MG1 A;  2DQV A;  4RYA A;  1MQI A;  2ZNT A;  3PPR A;  4R75 A;  4I62 A;  1ATG A;  4U4X A;  2QSX A;  3TTK A;  3IOV A;  2O1M A;  3T93 B;  2VD3 A;  5DEX A;  3CSG A;  4P11 A;  3HHG A;  4EF1 A;  2O6A A;  3ONM A;  1IIT A;  3TOD A;  4NF8 B;  5FHN A;  3OD7 A;  5L9O A;  2O7I A;  4HW8 A;  3VV5 A;  1UIV A;  5CC2 A;  2ONK E;  4MF3 A;  4LZ8 A;  3RT8 A;  4H8J A;  3JYR A;  1PBQ A;  1B7Z A;  1DPP A;  3SET A;  4OMB A;  3G3F A;  3KZG A;  3KGC A;  4R6H A;  3DLN A;  5F1Q A;  2GHB A;  3N6U A;  4R2B A;  3OSR A;  1OLC A;  4ZDM A;  3D4G A;  3CFL A;  4PFT A;  3O2A A;  4F39 A;  4QFP A;  5ITO A;  4U23 A;  4KPT A;  2OJT A;  4R74 A;  3K1N A;  3VLV A;  1NNF A;  3TCG A;  1Y3N A;  1XOC A;  1MDP 1;  2Q89 A;  4ISU A;  1B51 A;  2VOZ A;  3U8Q A;  3KEI A;  1YPN A;  2HEU A;  2W7Y A;  1SW5 A;  2V93 A;  4KYD A;  5A5X A;  4I1D A;  4JXI A;  4BDM A;  1TWY A;  3RPW A;  1B4H A;  4YB5 A;  2NVU B;  3W9V A;  5ICT A;  1ZTY A;  1TFD A;  1MXV A;  5TP9 B;  2DXR A;  1B40 A;  5AA4 A;  1SBP A;  3BKI B;  2ABH A;  4R9F A;  2BJJ X;  4NWD A;  4YZZ A;  1N3X A;  2XXP A;  4PP0 A;  4BDO A;  3FV2 A;  1AMF A;  2V3Q A;  4HS7 A;  5AA2 B;  3VDF A;  2P2A A;  1PC3 A;  3ZSF A;  3PMW A;  4ZEI A;  3K02 A;  3THI A;  2B3B A;  3RNN A;  3RLF E;  4YIC A;  1SW2 A;  2UYE A;  1LCF A;  1MY3 A;  3MQ9 A;  1PBP A;  4PFW A;  3CRB A;  5I2N B;  4PQJ A;  4MH5 A;  1N04 A;  2DE3 A;  1PB7 A;  2NWJ A;  5CMK A;  1MPC A;  1BP5 A;  3EQ1 A;  3USD A;  3N5L A;  2HFB A;  3PUX E;  5I57 A;  4DXB A;  4WKM A;  4RPN A;  1XC1 A;  1NH8 A;  4ZZA A;  4R6Y A;  5KDT A;  2AIX A;  4YKK A;  5FHM A;  4R9G A;  3K4U A;  4FE8 A;  2LAO A;  4P0I A;  4IB2 A;  2X26 A;  3CVG A;  3CG1 A;  1LB9 A;  4QRZ A;  3QUF A;  2GRV A;  3KSJ A;  1IIW A;  5DVI A;  3M3F A;  3MPL A;  1WOD A;  5ELV A;  3B6T A;  3B6Q A;  3R7X A;  2V25 A;  4LVQ A;  3MW0 A;  1ZKB A;  1MXY A;  3RYA A;  1MXZ A;  1MY1 A;  2O1L A;  4HTG A;  3S9N C;  3Q29 A;  3P7I A;  3S4U A;  1ZLQ A;  5I84 A;  1MXU A;  4YKI A;  4QFN A;  4YKJ A;  2A5S A;  1MDQ A;  3RY3 A;  2I49 A;  2PX1 A;  1DTZ A;  3CG3 A;  3KN8 A;  4OHN A;  1MM6 A;  4KYE A;  4LP2 B;  4H8I A;  4NE4 A;  1JVX A;  4JSD A;  1LB8 A;  1NNT A;  3SES A;  4KQP A;  3PPQ A;  3DRK A;  5ISU A;  4WXJ A;  2VD2 A;  1HSL A;  3QK6 A;  3IAZ A;  3K0V A;  4G4P A;  1A8F A;  3G3J A;  4IO4 A;  1UQW A;  4FEC A;  1M5D A;  3QIM A;  4ELP A;  3VXC A;  4GWO A;  1P99 A;  3FTO A;  2Q8J A;  1CB6 A;  5H8F A;  4GRK A;  1FTJ A;  2Z22 A;  1M5E A;  2HZK A;  3RQT A;  4NF5 B;  3MVX A;  1Z7M E;  3UN6 A;  1Q35 A;  4AQ4 A;  4DDD A;  1B4Z A;  2XXI A;  5L9M A;  1F9B A;  1FQB A;  1EH3 A;  3FVN A;  4LON B;  1OQH A;  1Z7N E;  5DVF A;  4C1U A;  1Y9U A;  4KHZ E;  5K2Y A;  4OEN A;  3KG2 A;  4F1V A;  1H45 A;  4RK2 A;  2Q2C A;  1B3E A;  4LA9 A;  4NF8 A;  1JW4 A;  1UTB B;  2Q88 A;  1N3W A;  4PFU A;  4R73 A;  5HBC A;  3H6V A;  3K2D A;  3F11 A;  5L9S A;  1XVX A;  4NF4 B;  4Q30 B;  3BFT A;  3GXA A;  3PUY E;  1MY0 A;  4FAJ A;  2Y7K A;  1WDN A;  3SEW A;  2XXU A;  3KN7 A;  4GF8 A;  5JK4 A;  4F3S A;  2O51 A;  4JWX A;  3TTM A;  4F29 A;  3KSX A;  3IK6 B;  1O63 A;  4PE5 B;  4JSO A;  4G2Z A;  3TFL A;  1YCJ A;  1VSO A;  3IJO B;  2REJ A;  2ZXT A;  2Q9T A;  1MS7 A;  4ESW A;  2DSF A;  1IXH A;  3T22 A;  1I6B A;  2Z8D A;  2DS9 A;  2F7B A;  3RYB A;  3MAM A;  1B52 A;  1Y3Q A;  5TP9 A;  1I6A A;  2XD2 A;  3TEL A;  5I56 B;  3RTW B;  3C9H A;  3A3U A;  3O66 A;  4LZ7 A;  1B1X A;  4G8M A;  4G8N A;  1P1U A;  4GVO A;  5J1D A;  1FCK A;  5ICQ A;  3O29 A;  4POW A;  2QJE A;  1B46 A;  3HST A;  2V84 A;  4MLQ A;  1QJM A;  2REG A;  2AYS A;  4F3G A;  1MQG A;  3PV0 E;  4PET A;  1FTO A;  2VP1 A;  4Q5T A;  1PEB A;  3OO8 A;  2PT2 A;  3FXU A;  1JNF A;  1Y4T A;  2VGQ A;  3K6X A;  3HPI A;  5DTB A;  5AE4 A;  1B0L A;  2NXO A;  3I6V A;  3O6P A;  1US5 A;  2H25 A;  4DXU A;  1QUI A;  3PPN A;  2HQ0 A;  2F8D A;  5TU0 A;  1N0T A;  3FV1 A;  1Y3P A;  2UVI A;  2PYY A;  3TTR A;  3FD3 A;  2QS2 A;  4L17 A;  3IB0 A;  4DLD A;  1NKX A;  3I5O A;  2QMW A;  4LQ5 A;  2H99 A;  3VLU A;  3C33 A;  4F3B A;  1GVC A;  1GR2 A;  3C31 A;  1UIU A;  2UVH A;  2OBG A;  4ZE9 A;  3PU5 A;  1D4N A;  1B5H A;  4GQO A;  1H44 A;  4G77 A;  1SVX B;  1Q1K A;  5CMM A;  4H67 A;  5IKB A;  4IY6 A;  1B05 A;  1L5T A;  1QKA A;  4ZZE A;  1URG A;  3Q26 A;  2VHA A;  3E9X A;  4F1U A;  1A99 A;  5EYF A;  3KFM A;  3FXQ A;  3LR1 A;  1RYO A;  3EN3 A;  2UVJ A;  4ZEB A;  1AOV A;  4PFY A;  3G3K A;  2KLF A;  1JVY A;  3LSX A;  3FJG A;  4F18 A;  4FAT A;  5F7V A;  4RNS A;  1QVS A;  4F31 B;  4RK9 A;  4Z7E A;  1DPE A;  4YB6 A;  3FGS A;  5H8N B;  2QMX A;  2I3W A;  4ZS9 A;  3PAM A;  3OXN A;  4O3C A;  4OYV A;  3KBR A;  2F34 A;  3CR9 A;  2RC8 A;  1QW0 A;  4WEP A;  1LST A;  3GBB A;  3AXF A;  3K01 A;  1OQG A;  5BWJ A;  1B2H A;  1IUD A;  4QSC A;  5AA3 A;  4IO5 A;  3TUS A;  2D21 A;  3T96 B;  3CHG A;  4KD5 A;  1MH3 A;  1N76 A;  1FTK A;  1D9V A;  1HSJ A;  3OO9 A;  4NF5 A;  4UAC A;  3IOW A;  1FTL A;  5LOM A;  1B0H A;  5KZT A;  2I3V A;  3L6H A;  1B5I A;  4FIM A;  3Q27 A;  1UTH B;  3SER A;  1MRP A;  2F6G A;  2H98 A;  4C0R A;  2NOO A;  3A3C A;  1UTB A;  3UK4 A;  3FVG A;  1B7H A;  1MY4 A;  1DSN A;  4U22 A;  5B70 A;  3ODB A;  5CBR A;  1SI1 A;  3EHS A;  1QKB A;  3MP8 A;  2HAV A;  3IB2 A;  2WOP A;  2RIN A;  1FW0 A;  4OES A;  4LQ2 A;  3DRG A;  3BFU A;  2IEE A;  1XHY A;  1B3L A;  1S50 A;  2I4B A;  2QS3 A;  1ANF A;  1LFG A;  2O69 A;  5ITP A;  3V83 A;  2F7C A;  4NF4 A;  4F19 A;  4IO2 A;  4ZEK A;  1PB9 A;  4GXS B;  1OLA A;  2DOJ A;  4Q0C A;  1FQC A;  3L6G A;  2O68 A;  1USY E;  3G3G A;  2RF1 A;  3ILT B;  2D5W A;  1SYH A;  2OK2 A;  4XKP A;  3OO6 A;  5EHM A;  3WAF A;  1NFT A;  2YJP A;  3MUQ A;  4QFO A;  1SW4 A;  4XKN A;  3FZV A;  3O28 A;  3EHU A;  2V3U A;  4NWC A;  3IOT A;  3RN8 A;  2OLB A;  3QYT A;  4H1X A;  4LAT A;  2AL5 A;  1YTV A;  1GV8 A;  3E4R A;  2ONS A;  3MPK A;  2G29 A;  1II5 A;  1R9L A;  1URD A;  2V3T A;  4GIZ A;  4RA1 A;  2B4M A;  4K3F A;  4OFL A;  3TYH A;  3OOA A;  1IXI A;  4GXA A;  3MZ9 A;  4QSE A;  5I56 A;  2XX9 A;  3TZA A;  2QS4 A;  5CBS A;  4OET A;  3M3L A;  4MFI A;  4H0W A;  1N7W A;  3FVO A;  3OSQ A;  4KYS A;  1BLF A;  3BBR A;  4YMA A;  4IO7 A;  4MLV A;  5KCJ B;  4R72 A;  2QRY A;  1IXC A;  4IGR A;  4OEU A;  4GLI A;  4IO3 A;  1BKA A;  2R71 A;  3FIR A;  3HCQ A;  3OEL A;  3CI8 A;  1MQD A;  3SKP A;  4M1V A;  2ZYN A;  3TCH A;  3H7M A;  1R1N A;  3O6G A;  2ZYO A;  2Y7R A;  3ECR A;  3MVZ A;  1P1Q A;  3T9H B;  1MPB A;  1ELJ A;  2R6G E;  4YU0 A;  3VVD A;  5CRY A;  2DVZ A;  1QUK A;  4X9T A;  3PUV E;  4RPO A;  2F6P A;  1NNK A;  4F2O A;  3SEU A;  1H43 A;  3G3I A;  3CFZ A;  3H6U A;  3ZKL A;  3IJX B;  4X1B A;  3IO6 A;  1YAE A;  4OEV A;  3S9M C;  2F5X A;  1O64 A;  4U21 A;  3TKD A;  2CZL A;  3R6U A;  2WKY A;  3TCF A;  1SDX A;  3DM0 A;  4YMB A;  1NMU A;  1A8E A;  4EXL A;  1LAX A;  3FXR A;  4DCY A;  4EDP A;  3KJT A;  1DOT A;  3H06 B;  2B4L A;  2OZZ A;  2QL3 A;  3LUY A;  2UVG A;  3QSL A;  4XIG Q;  3C35 A;  2NUV A;  4AB6 A;  5H8H B;  1IQ7 A;  3V89 B;  2F35 A;  3MVW A;  1PB8 A;  5HM4 B;  4QFK A;  3FUZ A;  2I48 A;  5H8N A;  4G68 B;  2HCA A;  4F3P A;  1VFD A;  1D9Y A;  1ZIU A;  2QPQ A;  3TTN A;  4IGT A;  2B65 A;  3DEL B;  5K2X A;  4YKP A;  4OFO A;  4ND9 A;  1EZO A;  4QHQ A;  3IR1 A;  1B3H A;  3KOT A;  3O6H A;  2HZL A;  3T66 A;  5BUU A; 
#chains in the Genus database with same CATH topology
 3JV9 A;  1S7Y A;  3G7W A;  4O3A A;  4P0G A;  5KDT B;  2GH9 A;  1XT8 A;  4GWY A;  4N6P A;  2Y84 A;  3W9W A;  3B6W A;  1LFH A;  4LUB A;  3UP9 A;  2XXQ A;  1BIY A;  1LBZ A;  5EQ8 A;  3H6W A;  3UIF A;  3O6I A;  4EF2 A;  2XXH A;  3KOS A;  1NV5 A;  3C34 A;  4JWY A;  1FPD A;  5ET7 A;  1NH7 A;  4ZEF A;  1AIV A;  3IOR A;  2CEX A;  5FTI A;  1XI6 A;  2DWH A;  4XKQ A;  2GFE A;  1SD3 A;  5AA2 A;  4NQ8 A;  3VVF A;  2DE4 A;  3U72 A;  3T9X B;  2Y5L A;  4WED A;  3RT6 B;  3N26 A;  1T0K A;  3IOU A;  3G3H A;  2CMO A;  3H03 A;  1FTM A;  3ISP A;  2I0B A;  4F1Y A;  1NI9 A;  5DW8 A;  5I2N A;  1POT A;  3VVE A;  5JEI A;  3PD8 A;  4TQU Q;  3OO7 A;  4NGU A;  3MP1 A;  3DRI A;  3T1B A;  2Y7I A;  2Y7P A;  4EQ7 A;  1LLS A;  1EU8 A;  1Y20 A;  2XX7 A;  3C32 A;  4OTE A;  3SDF A;  1S9T A;  3MP6 A;  1OMP A;  4JWO A;  2ANJ A;  2V4C A;  3N94 A;  3MZ1 A;  2Z8E A;  4H6D A;  2ALU A;  1MQH A;  1B3F A;  1KA0 A;  2H9B A;  3WAE A;  2P0S A;  3MBP A;  2DWJ A;  2RCB A;  5LDZ A;  1SW1 A;  2PT1 A;  4FJP A;  3HHF A;  5DT6 A;  3TMG A;  3DRJ A;  2GQ1 A;  4BDL A;  3FAT A;  1USY H;  2ZYK A;  2XXX A;  1B6H A;  3DP8 A;  5L8D A;  3KJ7 A;  1Y1M A;  1J1N A;  2DWI A;  2QVR A;  2RC7 A;  5CM6 A;  1POY 1;  3M3K A;  1JQF A;  2XWK A;  4IY5 A;  2DYX A;  2PBW A;  4OVR A;  2HPG A;  3LC8 A;  3OMB A;  2QVU A;  2CZI A;  1M5F A;  1IMB A;  2XD3 A;  3DRF A;  1FQE A;  4N07 A;  1PDA A;  1OIB A;  1MPD A;  5AA2 D;  1Q9D A;  4FEB A;  1SI0 A;  2FYI A;  5KCJ A;  4R2F A;  2O84 X;  4F2Q A;  5EQA A;  5IZ3 A;  1A40 A;  3C4M A;  2XWV A;  3SEY A;  1WVJ A;  4QXD A;  1MXW A;  1B58 A;  4KCD A;  5HPQ A;  1LAF E;  1LAG E;  1ZBM A;  1NNP A;  1LBX A;  4EQB A;  1P1N A;  4ELQ A;  5DYH A;  4I8C A;  2F3D A;  5EQ9 A;  3QXM A;  4GWW A;  3TQL A;  2Q2A A;  2I6E A;  1R6Z A;  3DP6 A;  3E13 X;  3FVK A;  4P9K A;  3HFU A;  4PFB A;  2ONR A;  4POX A;  5TPA B;  5I7I A;  3ZKK A;  1A55 A;  1LAH E;  2P1S A;  3KC1 A;  4ESX A;  3Q28 A;  3CSB A;  1LBB A;  3U94 A;  1M5C A;  3PPP A;  5I58 B;  5FTH A;  3LSL A;  5I2K B;  1OVT A;  4Z0I A;  1SPI A;  2F3B A;  3D4C A;  2XHD A;  2FA7 A;  3S9L C;  2M8C A;  2PMS A;  1B3G A;  2I4C A;  2IA4 A;  4FED A;  4P47 A;  1FRP A;  1IZ1 A;  3CFX A;  1MQJ A;  1SQY A;  5I59 B;  2X7Q A;  3I3V A;  1NUW A;  3MC2 A;  1P1O A;  3FAS A;  3UOR A;  1JEU A;  2QVV A;  2UYF A;  1NV3 A;  1LBC A;  4XTC Q;  3TQW A;  3A29 A;  2XXY A;  4NTL A;  4BLA A;  1RKM A;  1KZ8 A;  5H8H A;  4QFL A;  1JW1 A;  2OWT A;  1DK4 A;  3E3K A;  1IXG A;  2MKZ A;  1B5J A;  4BDR A;  4BDQ A;  2DXY A;  3H3G A;  3O9P A;  1NL5 A;  3HN0 A;  4HCY A;  3S9E A;  3IL1 B;  4G68 A;  4E0X A;  4R6K A;  2XX8 A;  4H5F A;  4YB7 A;  4NF6 B;  4GWU A;  2KQZ A;  1B1H A;  1MXX A;  4PDD A;  1B32 A;  3SEV A;  3VXB A;  2ESN A;  4NMY A;  4O7M A;  2WBB A;  3DP4 A;  2A5T B;  5JTY B;  4GL0 A;  2OWS A;  4OWD A;  3LBS A;  3N6T A;  3T9V A;  4OVT A;  4N13 A;  2QFL A;  4TOZ A;  4HCW A;  5H8Q B;  4GX3 A;  1N84 A;  1FQA A;  4KFQ A;  1I69 A;  3A09 A;  4OVP A;  2B3F A;  2GHA A;  4RJZ A;  3PUZ E;  2WOK A;  1H3D A;  3FJM A;  1H76 A;  4AB5 A;  2OCU A;  1Y4C A;  4PBQ A;  5DEX B;  3QMF A;  4ELO A;  4GWX A;  3GLB A;  4E0W A;  4JVI A;  2Q8M A;  2RC9 A;  4IO6 A;  3TEP A;  5AA1 A;  4P8B A;  3IB1 A;  1MM7 A;  3EF7 A;  4ECF A;  1A7L A;  2XXR A;  1AL3 A;  1ZMG A;  3GBA A;  2F7A A;  1VR5 A;  4P3L A;  2ZYM A;  1G0I A;  4U1O A;  4GD5 A;  5EHS A;  2VT5 A;  4NAP A;  2DP8 A;  4M4G A;  1FJ9 A;  4U1Z A;  1TT1 A;  4RY1 A;  1FBF A;  4DXC A;  1FBE A;  4PE3 A;  1HSE A;  1JP4 A;  2G93 A;  3VFJ A;  1P1W A;  4X1D A;  2ZNS A;  2O7U A;  1IEJ A;  2VPO A;  3M8U A;  2DDK A;  3LVU A;  1JW5 A;  1D9Q A;  3TAJ A;  3U92 A;  1N7X A;  3EPE A;  4O3B A;  3VE1 B;  2XXT A;  1FPI A;  4XXU A;  1QUL A;  3KN3 A;  3LUZ A;  4GFR A;  4NED A;  3HO7 A;  4H45 A;  4U2R A;  4NN3 A;  4H5G A;  1AH5 A;  3JZJ A;  3H6T A;  4TLL B;  4H65 A;  5CMB A;  4NHB A;  2QS1 A;  4LZ5 A;  4PCD A;  3TPA A;  3K00 A;  4EXK A;  5B7D A;  5CMC A;  1TXF A;  2YLN A;  4KCC A;  4OZ9 A;  4U4S A;  3S2V A;  1US4 A;  2FNC A;  4PC9 A;  3ZS6 A;  3GZG A;  3V8X B;  1LFI A;  3H4Z A;  4MBP A;  2HXW A;  2XXV A;  1JEV A;  5A5X B;  3PMV A;  1LGB C;  4DE8 A;  2H4I A;  1ZU0 A;  1I6Q A;  3B7D A;  4JB7 A;  4Q8R A;  4KI0 E;  4JBZ A;  4C1T A;  1G0H A;  2H5Y A;  3CIJ A;  5AA4 B;  4DZ1 A;  4EUO A;  4XKR A;  3R26 A;  4QBA A;  4P56 A;  1DTG A;  5DVJ A;  2CEY A;  2YPN A;  1NV1 A;  2VPN A;  1OVB A;  2F78 A;  1D3K A;  4DCX A;  3Q25 A;  1INP A;  4GOT A;  1VFE A;  1VDW A;  3K6U A;  4OFJ A;  4OVJ A;  1NV2 A;  4GL8 A;  2DE2 A;  4PTK A;  3U1O A;  2HAU A;  4RXL A;  1B7U A;  1XS5 A;  3OEK A;  1TFA A;  1EZ9 A;  1M5B A;  1XVY A;  4DIG A;  1DMB A;  2FBP A;  2XXK A;  1VE4 A;  2ZNU A;  3PGF A;  2ZMB A;  1FQD A;  1O7T A;  3UGW A;  2WOL A;  1MY2 A;  1A54 A;  3QUJ A;  4UA8 A;  3IO4 A;  1ZJL A;  3DRH A;  3IX1 A;  4THI A;  4KR5 A;  4BDN A;  3VLW A;  4ELR A;  1R9Q A;  1FPE A;  1YYZ A;  3MYU A;  3LV0 A;  5TPA A;  3T9U A;  4G68 C;  5I57 B;  3RUM A;  3FBP A;  2E0S A;  3MJN A;  3K1P A;  3SEX A;  4XF5 A;  1FQF A;  2XXW A;  4QSD A;  2RKM A;  1URS A;  2AL4 A;  3PMX A;  2RCA A;  3U93 A;  2Z23 A;  4MIJ A;  1IME A;  2JJK A;  1BTJ A;  4ZEC A;  2PVU A;  4OER A;  1UTH A;  5I58 A;  2WX9 A;  4FOR A;  5FHO A;  2P3N A;  5I2K A;  3PD9 A;  4G8H A;  3MWB A;  4I3E A;  4X04 A;  1CE2 A;  4ZED A;  1LCT A;  5EYH A;  2UXA A;  5IAI A;  3TDJ A;  5I59 A;  4OQO A;  2I58 A;  3PPO A;  3V5A A;  1EZP A;  3C36 A;  3LSF B;  4YAH X;  4ZE8 A;  4ONY A;  3MVY A;  1JET A;  2D3I A;  3RTF B;  2F97 A;  1BK4 A;  5I3S A;  3KC0 A;  3TTL A;  4F22 A;  3HV1 A;  2X7P A;  2Z8F A;  3OEM A;  1GTK A;  3MZB A;  4TLM B;  4EQ9 A;  2E1S A;  2BJI A;  2F36 A;  1MH4 A;  2ZZX A;  3K6V A;  3OEN A;  4OXV A;  3QAX A;  3RGY A;  5ESY A;  2OX3 A;  2Y7W A;  1QUJ A;  4NF6 A;  3O97 A;  5H8S A;  2FIX A;  5IZ1 A;  2I0C A;  1RYX A;  3EHT A;  1KWH A;  3PUW E;  1SYI A;  4I9D A;  2R8T A;  3W15 C;  3ILU B;  3K1M A;  4QF9 A;  2DVC A;  2DWA A;  2A5T A;  2THI A;  5JTY A;  5CI5 A;  4JDF A;  2ZZW A;  1GGG A;  3UA8 A;  2OWZ A;  3FJ7 A;  2R9J A;  1Y1Z A;  4OA4 A;  5M2V A;  3K6W A;  1B9J A;  4PGN A;  5H8F B;  5H8Q A;  2FHY A;  3LSW A;  4X48 A;  3IFA A;  1MG1 A;  2DQV A;  4RYA A;  1MQI A;  2ZNT A;  3PPR A;  4R75 A;  4I62 A;  1ATG A;  4U4X A;  4XEQ A;  2QSX A;  3TTK A;  3IOV A;  2O1M A;  3T93 B;  2VD3 A;  2KR0 A;  5DEX A;  4MEV A;  3CSG A;  4P11 A;  4PGP A;  3HHG A;  4EF1 A;  2O6A A;  3ONM A;  1RDZ A;  3NOH A;  1IIT A;  2ZZV A;  3TOD A;  4NF8 B;  5FHN A;  3OD7 A;  5L9O A;  4O8M A;  2HXR A;  2O7I A;  4FBP A;  4HW8 A;  4H46 A;  3VV5 A;  1UIV A;  5CC2 A;  3KBZ A;  2ONK E;  4MF3 A;  4LZ8 A;  3RT8 A;  4H8J A;  3JYR A;  1PBQ A;  1B7Z A;  1DPP A;  4PAF A;  4OMB A;  3SET A;  3G3F A;  3KZG A;  3KGC A;  4R6H A;  4N17 A;  3DLN A;  5F1Q A;  2GHB A;  3N6U A;  4R2B A;  3OSR A;  1OLC A;  4ZDM A;  3D4G A;  3RPL B;  3CFL A;  1FTA A;  5FBP A;  4PFT A;  3O2A A;  4F39 A;  3B50 A;  4NG7 A;  4QFP A;  5ITO A;  4KXP A;  4U23 A;  4KPT A;  4OVS A;  2PFY A;  2OJT A;  4R74 A;  4P1E A;  3K1N A;  3VLV A;  1NNF A;  3TCG A;  1Y3N A;  1XOC A;  3PTY A;  1MDP 1;  2Q89 A;  4ISU A;  1B51 A;  2VOZ A;  3U8Q A;  3KEI A;  1YPN A;  2HEU A;  3ROJ A;  2WEF A;  2W7Y A;  1SW5 A;  2V93 A;  4KYD A;  5A5X A;  4I1D A;  4JXI A;  4BDM A;  1TWY A;  3RPW A;  1B4H A;  4YB5 A;  2NVU B;  3W9V A;  5ICT A;  1ZTY A;  1TFD A;  1MXV A;  4GX6 A;  5TP9 B;  2DXR A;  1B40 A;  5AA4 A;  3E79 A;  1SBP A;  3BKI B;  2ABH A;  4R9F A;  2BJJ X;  4UAB A;  5I5P A;  4NWD A;  4YZZ A;  1N3X A;  2XWI A;  2XXP A;  4PP0 A;  4BDO A;  3FV2 A;  4I40 A;  1AMF A;  4OVQ A;  2V3Q A;  4HS7 A;  5AA2 B;  3VDF A;  5EYG A;  2P2A A;  3SZP A;  1PC3 A;  3ZSF A;  3PMW A;  2HHM A;  4ZEI A;  3K02 A;  1IMA A;  3THI A;  2B3B A;  3RNN A;  4PBH A;  3RLF E;  4O94 A;  4YIC A;  2P3V A;  1SW2 A;  2UYE A;  1LCF A;  1MY3 A;  3MQ9 A;  1PBP A;  4PFW A;  3CRB A;  5I2N B;  4PQJ A;  4I3Y A;  4MH5 A;  1N04 A;  2DE3 A;  1PB7 A;  2PFZ A;  2NWJ A;  5CMK A;  1MPC A;  4MX6 A;  1BP5 A;  3EQ1 A;  3USD A;  3N5L A;  2HFB A;  3PUX E;  5I57 A;  4DXB A;  4WKM A;  4NF0 A;  4RPN A;  1XC1 A;  1NH8 A;  4ZZA A;  4R6Y A;  5KDT A;  1EYJ A;  2AIX A;  4YKK A;  5FHM A;  4R9G A;  1FBP A;  1NUX A;  2Y5K A;  3K4U A;  4FE8 A;  2LAO A;  4P0I A;  4IB2 A;  2X26 A;  3CVG A;  3CG1 A;  1LB9 A;  1FBD A;  4QRZ A;  3QUF A;  2GRV A;  3KSJ A;  1IIW A;  5DVI A;  3M3F A;  3MPL A;  1WOD A;  5ELV A;  3B6T A;  3B6Q A;  3R7X A;  2V25 A;  4LVQ A;  3MW0 A;  1ZKB A;  1MXY A;  3RYA A;  1MXZ A;  1MY1 A;  2O1L A;  4HTG A;  3S9N C;  3Q29 A;  4PDH A;  3P7I A;  3S4U A;  4PAK A;  1ZLQ A;  5I84 A;  1MXU A;  4YKI A;  4QFN A;  3E78 A;  4YKJ A;  2A5S A;  1MDQ A;  3RY3 A;  2I49 A;  2PX1 A;  1DTZ A;  3CG3 A;  3KN8 A;  4OHN A;  1MM6 A;  1DCU A;  4KYE A;  1FPF A;  4LP2 B;  4H8I A;  4NE4 A;  1JVX A;  5EQ7 A;  4JSD A;  1LB8 A;  1NNT A;  3SES A;  3D1R A;  3PPQ A;  4KQP A;  3DRK A;  5ISU A;  4WXJ A;  2VD2 A;  4G61 A;  5IGA A;  1HSL A;  3QK6 A;  3IAZ A;  4G4P A;  3K0V A;  1A8F A;  1YXI A;  3G3J A;  4IO4 A;  1UQW A;  4FEC A;  1M5D A;  3QIM A;  4ELP A;  3VXC A;  1NV6 A;  4GWO A;  5J16 A;  1P99 A;  3BIH A;  3FTO A;  1LBY A;  2Q8J A;  1CB6 A;  5H8F A;  4GRK A;  1FTJ A;  2Z22 A;  1M5E A;  2HZK A;  3RQT A;  4NF5 B;  3MVX A;  1Z7M E;  3UN6 A;  1Q35 A;  4AQ4 A;  4DDD A;  1B4Z A;  2XXI A;  5L9M A;  1F9B A;  1FQB A;  5ET5 A;  1EH3 A;  3FVN A;  4LON B;  1OQH A;  1Z7N E;  5DVF A;  4C1U A;  1Y9U A;  4KHZ E;  2Q74 A;  5K2Y A;  1FJ6 A;  4OEN A;  3KG2 A;  4F1V A;  1H45 A;  4RK2 A;  2Q2C A;  1B3E A;  4LA9 A;  4NF8 A;  1JW4 A;  1UTB B;  2Q88 A;  1N3W A;  4PFU A;  4R73 A;  5HBC A;  3B8B A;  3H6V A;  3K2D A;  3F11 A;  5L9S A;  1XVX A;  4PF6 A;  4NF4 B;  3FXB A;  4Q30 B;  3RYD A;  1RDX A;  3BFT A;  1FPG A;  1IMD A;  3GXA A;  3PUY E;  1MY0 A;  4FAJ A;  2Y7K A;  1WDN A;  4GX4 A;  3SEW A;  2XXU A;  3KN7 A;  4GF8 A;  5JK4 A;  4F3S A;  2O51 A;  4N8G A;  4N6D A;  4JWX A;  3TTM A;  4F29 A;  3KSX A;  3IK6 B;  1O63 A;  4PE5 B;  4JSO A;  4G2Z A;  3TFL A;  5T3J A;  1YCJ A;  1VSO A;  3IJO B;  2REJ A;  2ZXT A;  2Q9T A;  1MS7 A;  4N15 A;  4ESW A;  2DSF A;  1IXH A;  3T22 A;  1I6B A;  2Z8D A;  2DS9 A;  1IMF A;  2F7B A;  1FBH A;  1NUZ A;  3RYB A;  4OAN A;  3MAM A;  1B52 A;  5F24 A;  1Y3Q A;  2FVZ A;  5TP9 A;  1I6A A;  2XD2 A;  3TEL A;  1YZ0 A;  5I56 B;  3RTW B;  3C9H A;  3A3U A;  3O66 A;  4LZ7 A;  4MNI A;  1LBV A;  1B1X A;  4G8M A;  4G8N A;  1P1U A;  4GVO A;  5J1D A;  1FCK A;  5ICQ A;  3O29 A;  2WYP A;  4POW A;  2QJE A;  1B46 A;  3HST A;  2V84 A;  4MLQ A;  1QJM A;  2REG A;  4IR8 A;  2AYS A;  4GWZ A;  4F3G A;  1MQG A;  3PV0 E;  4PET A;  1FTO A;  2VP1 A;  4Q5T A;  1PEB A;  3OO8 A;  2PT2 A;  3FXU A;  1JNF A;  1Y4T A;  2VGQ A;  1NV7 A;  3K6X A;  3HPI A;  5DTB A;  5AE4 A;  1B0L A;  2NXO A;  3I6V A;  3O6P A;  1US5 A;  2H25 A;  4DXU A;  1QUI A;  4JVD A;  3PPN A;  1LBW A;  2HQ0 A;  2F8D A;  5TU0 A;  1N0T A;  3FV1 A;  1Y3P A;  2UVI A;  2PYY A;  3TTR A;  3FD3 A;  2QS2 A;  4L17 A;  3IB0 A;  4DLD A;  1NKX A;  3I5O A;  2QMW A;  4LQ5 A;  4MMP A;  4MNC A;  2H99 A;  3VLU A;  3C33 A;  4F3B A;  1GVC A;  1GR2 A;  3C31 A;  1UIU A;  2WYK A;  2UVH A;  2OBG A;  4ZE9 A;  4MNP A;  4PFR A;  3PU5 A;  1D4N A;  1B5H A;  4GQO A;  1H44 A;  4G77 A;  1SVX B;  1Q1K A;  5CMM A;  1FPL A;  4H67 A;  5IKB A;  4IY6 A;  1B05 A;  3GYY A;  1L5T A;  1QKA A;  4ZZE A;  1URG A;  3Q26 A;  2VHA A;  3E9X A;  4N6K A;  4F1U A;  1A99 A;  5EYF A;  3KFM A;  3FXQ A;  3EKI A;  3LR1 A;  1RYO A;  3EN3 A;  2UVJ A;  4ZEB A;  1AOV A;  4PFY A;  3G3K A;  2KLF A;  1JVY A;  3LSX A;  3FJG A;  4F18 A;  4FAT A;  5F7V A;  4RNS A;  4AS4 A;  1QVS A;  4F31 B;  4RK9 A;  2L5V A;  4Z7E A;  1DPE A;  4YB6 A;  3FGS A;  5H8N B;  4X8R A;  2QMX A;  2I3W A;  4ZS9 A;  3PAM A;  4N8Y A;  3OXN A;  4O3C A;  4OYV A;  2WBD A;  4DI4 B;  3KBR A;  2F34 A;  3CR9 A;  2RC8 A;  1QW0 A;  4WEP A;  1LST A;  3GBB A;  3AXF A;  5IM2 A;  3K01 A;  1OQG A;  5BWJ A;  1B2H A;  1IUD A;  4QSC A;  5AA3 A;  4IO5 A;  3TUS A;  2D21 A;  4MHF A;  3T96 B;  3CHG A;  4KD5 A;  4LN5 A;  1MH3 A;  1N76 A;  1FTK A;  1NV0 A;  1D9V A;  1HSJ A;  3OO9 A;  4NF5 A;  4UAC A;  3IOW A;  1FTL A;  5LOM A;  1B0H A;  5KZT A;  1EYK A;  2I3V A;  4XFE A;  3L6H A;  1B5I A;  4FIM A;  4NX1 A;  3Q27 A;  1UTH B;  3SER A;  1MRP A;  2F6G A;  2H98 A;  4C0R A;  2NOO A;  3A3C A;  4JVC A;  2CZK A;  1UTB A;  3UK4 A;  3FVG A;  1B7H A;  1MY4 A;  1DSN A;  4U22 A;  3BIG A;  5B70 A;  3ODB A;  5CBR A;  1SI1 A;  1RDY A;  1QKB A;  3EHS A;  3MP8 A;  2HAV A;  3IB2 A;  2WOP A;  2RIN A;  1FW0 A;  4OES A;  4LQ2 A;  3DRG A;  3BFU A;  3IFC A;  2IEE A;  1XHY A;  1B3L A;  1S50 A;  2I4B A;  2QS3 A;  1ANF A;  1LFG A;  2O69 A;  5ITP A;  4GBW A;  4HE2 A;  2F7C A;  3V83 A;  4NF4 A;  4F19 A;  1KA1 A;  4IO2 A;  4ZEK A;  1FPB A;  1PB9 A;  4GXS B;  1OLA A;  2DOJ A;  4Q0C A;  1FQC A;  3L6G A;  2O68 A;  1USY E;  3G3G A;  2RF1 A;  3ILT B;  2D5W A;  1SYH A;  2OK2 A;  4XKP A;  3OO6 A;  5EHM A;  3WAF A;  1NFT A;  2YJP A;  3MUQ A;  4QFO A;  1SW4 A;  4XKN A;  3FZV A;  3O28 A;  3EHU A;  2V3U A;  4NWC A;  3IOT A;  4N81 A;  3RN8 A;  2OLB A;  3QYT A;  2XWO A;  4H1X A;  4LAT A;  1FBC A;  2AL5 A;  1YTV A;  1GV8 A;  3E4R A;  4HE1 A;  1NV4 A;  2ONS A;  3MPK A;  5IZZ A;  2G29 A;  1II5 A;  1R9L A;  4N91 A;  1URD A;  1FPK A;  4PF8 A;  2V3T A;  4GIZ A;  4RA1 A;  1CNQ A;  2B4M A;  4K3F A;  4OFL A;  3TYH A;  3OOA A;  1LEV A;  1IXI A;  4AS5 A;  5LTC A;  1QGX A;  4GXA A;  3MZ9 A;  4QSE A;  5I56 A;  2XX9 A;  3TZA A;  4MAG A;  2QS4 A;  3MST A;  5CBS A;  4OET A;  4N4U A;  3M3L A;  2XA5 A;  4MFI A;  4H0W A;  1N7W A;  3FVO A;  1NUY A;  3OSQ A;  4KYS A;  1BLF A;  3BBR A;  4YMA A;  4GBV A;  4PAI A;  4IO7 A;  4MLV A;  5KCJ B;  4R72 A;  1AWB A;  2QRY A;  5IZ3 B;  1IXC A;  4IGR A;  3T0J A;  4OEU A;  4GLI A;  4IO3 A;  1BKA A;  5ET6 A;  2R71 A;  3FIR A;  1EYI A;  5ET8 A;  3HCQ A;  3OEL A;  3CI8 A;  1MQD A;  3SKP A;  4M1V A;  2ZYN A;  3TCH A;  3H7M A;  1R1N A;  3O6G A;  1FSA A;  2ZYO A;  2Y7R A;  3ECR A;  3MVZ A;  1P1Q A;  3T9H B;  1MPB A;  1ELJ A;  2R6G E;  4YU0 A;  3VVD A;  5CRY A;  2DVZ A;  4GWS A;  1QUK A;  2CZH A;  4X9T A;  3PUV E;  4RPO A;  2F6P A;  1NNK A;  4F2O A;  1H43 A;  3SEU A;  3G3I A;  3CFZ A;  3H6U A;  3ZKL A;  3IJX B;  4X1B A;  4HXV A;  3IO6 A;  1YAE A;  4OEV A;  3S9M C;  2F5X A;  1O64 A;  4U21 A;  3TKD A;  2CZL A;  4PFI A;  3R6U A;  2WKY A;  3TCF A;  1SDX A;  4MCO A;  3DM0 A;  4YMB A;  1NMU A;  1A8E A;  4EXL A;  2PCR A;  4MJO A;  1LAX A;  3FXR A;  4DCY A;  4EDP A;  3KJT A;  1DOT A;  3H06 B;  2B4L A;  1IMC A;  2OZZ A;  2QL3 A;  3LUY A;  2UVG A;  3QSL A;  4XIG Q;  3C35 A;  1FBG A;  2NUV A;  4AB6 A;  5H8H B;  4DI3 D;  1IQ7 A;  3V89 B;  2F35 A;  3U65 A;  3MVW A;  1PB8 A;  5HM4 B;  4QFK A;  5A5L A;  3RPL A;  3FUZ A;  2I48 A;  5H8N A;  4G68 B;  1K9Z A;  2HCA A;  4F3P A;  1VFD A;  2FIE A;  1DBZ A;  1D9Y A;  4O7I A;  1ZIU A;  2QPQ A;  3TTN A;  4IGT A;  2B65 A;  3DEL B;  1K9Y A;  5K2X A;  4YKP A;  4OFO A;  4ND9 A;  1EZO A;  4QHQ A;  3IR1 A;  1B3H A;  3KOT A;  4HE0 A;  3O6H A;  2HZL A;  3T66 A;  4P1L A;  5BUU A;  1FPJ A; 
#chains in the Genus database with same CATH homology
 3JV9 A;  1S7Y A;  3G7W A;  4O3A A;  4P0G A;  5KDT B;  2GH9 A;  1XT8 A;  4N6P A;  2Y84 A;  3W9W A;  3B6W A;  1LFH A;  4LUB A;  3UP9 A;  2XXQ A;  1BIY A;  3H6W A;  3UIF A;  3O6I A;  4EF2 A;  2XXH A;  3KOS A;  3C34 A;  4JWY A;  1NH7 A;  4ZEF A;  1AIV A;  3IOR A;  5FTI A;  2DWH A;  4XKQ A;  2GFE A;  1SD3 A;  5AA2 A;  3VVF A;  2DE4 A;  3U72 A;  3T9X B;  4WED A;  3RT6 B;  3N26 A;  1T0K A;  3IOU A;  3G3H A;  2CMO A;  3H03 A;  1FTM A;  4F1Y A;  2I0B A;  5I2N A;  1POT A;  3VVE A;  5JEI A;  3PD8 A;  4TQU Q;  3OO7 A;  3MP1 A;  3DRI A;  2Y7I A;  2Y7P A;  4EQ7 A;  1LLS A;  1EU8 A;  1Y20 A;  2XX7 A;  3C32 A;  4OTE A;  3SDF A;  1S9T A;  3MP6 A;  1OMP A;  4JWO A;  2ANJ A;  3N94 A;  3MZ1 A;  2Z8E A;  4H6D A;  2ALU A;  1MQH A;  1B3F A;  2H9B A;  3WAE A;  2P0S A;  3MBP A;  2DWJ A;  2RCB A;  1SW1 A;  2PT1 A;  4FJP A;  3HHF A;  5DT6 A;  3TMG A;  3DRJ A;  4BDL A;  3FAT A;  1USY H;  2ZYK A;  2XXX A;  1B6H A;  3DP8 A;  5L8D A;  3KJ7 A;  1Y1M A;  1J1N A;  2DWI A;  5CM6 A;  2RC7 A;  1POY 1;  3M3K A;  1JQF A;  4IY5 A;  2DYX A;  2PBW A;  3LC8 A;  3OMB A;  1M5F A;  2XD3 A;  3DRF A;  1FQE A;  4N07 A;  1PDA A;  1OIB A;  1MPD A;  5AA2 D;  4FEB A;  1SI0 A;  2FYI A;  5KCJ A;  4R2F A;  2O84 X;  4F2Q A;  1A40 A;  3C4M A;  3SEY A;  1WVJ A;  1MXW A;  1B58 A;  4KCD A;  5HPQ A;  1LAF E;  1LAG E;  1ZBM A;  1NNP A;  4EQB A;  1P1N A;  4ELQ A;  5DYH A;  4I8C A;  3QXM A;  3TQL A;  2Q2A A;  2I6E A;  1R6Z A;  3DP6 A;  3E13 X;  3FVK A;  2ONR A;  4POX A;  5TPA B;  3ZKK A;  1A55 A;  1LAH E;  2P1S A;  4ESX A;  3Q28 A;  3CSB A;  1LBB A;  3U94 A;  1M5C A;  3PPP A;  5I58 B;  5FTH A;  3LSL A;  5I2K B;  1OVT A;  4Z0I A;  3D4C A;  2XHD A;  2FA7 A;  3S9L C;  2M8C A;  2PMS A;  1B3G A;  2I4C A;  2IA4 A;  4FED A;  1IZ1 A;  3CFX A;  1MQJ A;  1SQY A;  5I59 B;  2X7Q A;  3I3V A;  3MC2 A;  1P1O A;  3FAS A;  3UOR A;  1JEU A;  2UYF A;  3TQW A;  1LBC A;  4XTC Q;  2XXY A;  4NTL A;  4BLA A;  1RKM A;  5H8H A;  4QFL A;  1JW1 A;  2OWT A;  3E3K A;  1IXG A;  1B5J A;  4BDR A;  4BDQ A;  2DXY A;  3H3G A;  3O9P A;  1NL5 A;  3HN0 A;  4HCY A;  3S9E A;  3IL1 B;  4G68 A;  4E0X A;  4R6K A;  2XX8 A;  4H5F A;  4YB7 A;  4NF6 B;  1B1H A;  1MXX A;  1B32 A;  3SEV A;  3VXB A;  2ESN A;  4NMY A;  3DP4 A;  2A5T B;  5JTY B;  4GL0 A;  2OWS A;  4OWD A;  3LBS A;  3N6T A;  3T9V A;  4N13 A;  4TOZ A;  4HCW A;  5H8Q B;  1N84 A;  1FQA A;  4KFQ A;  1I69 A;  3A09 A;  2B3F A;  2GHA A;  4RJZ A;  3PUZ E;  2WOK A;  1H3D A;  3FJM A;  1H76 A;  4AB5 A;  2OCU A;  1Y4C A;  5DEX B;  4ELO A;  3GLB A;  4E0W A;  2RC9 A;  4IO6 A;  3TEP A;  5AA1 A;  3IB1 A;  1MM7 A;  3EF7 A;  4ECF A;  1A7L A;  2XXR A;  1AL3 A;  1ZMG A;  3GBA A;  2F7A A;  1VR5 A;  2ZYM A;  4U1O A;  4GD5 A;  5EHS A;  2DP8 A;  4M4G A;  4U1Z A;  1TT1 A;  4RY1 A;  4DXC A;  1HSE A;  2G93 A;  3VFJ A;  1P1W A;  4X1D A;  2ZNS A;  2O7U A;  1IEJ A;  3M8U A;  3LVU A;  1JW5 A;  3TAJ A;  3U92 A;  1N7X A;  3EPE A;  4O3B A;  3VE1 B;  2XXT A;  4XXU A;  1QUL A;  3KN3 A;  4GFR A;  4NED A;  3HO7 A;  4U2R A;  4H5G A;  1AH5 A;  3JZJ A;  3H6T A;  4TLL B;  4H65 A;  5CMB A;  2QS1 A;  4LZ5 A;  3TPA A;  3K00 A;  4EXK A;  5B7D A;  5CMC A;  1TXF A;  2YLN A;  4KCC A;  4OZ9 A;  4U4S A;  3S2V A;  1US4 A;  2FNC A;  3ZS6 A;  3GZG A;  3V8X B;  1LFI A;  3H4Z A;  4MBP A;  2HXW A;  2XXV A;  1JEV A;  5A5X B;  3PMV A;  1LGB C;  4DE8 A;  2H4I A;  1ZU0 A;  1I6Q A;  3B7D A;  4JB7 A;  4Q8R A;  4KI0 E;  4JBZ A;  4C1T A;  2H5Y A;  3CIJ A;  5AA4 B;  4DZ1 A;  4EUO A;  4XKR A;  3R26 A;  1DTG A;  5DVJ A;  2YPN A;  1OVB A;  2F78 A;  1D3K A;  4DCX A;  3Q25 A;  4GOT A;  1VFE A;  3K6U A;  4OFJ A;  4OVJ A;  4GL8 A;  2DE2 A;  3U1O A;  2HAU A;  4RXL A;  1B7U A;  1XS5 A;  3OEK A;  1TFA A;  1EZ9 A;  1M5B A;  1XVY A;  4DIG A;  1DMB A;  1VE4 A;  2ZNU A;  3PGF A;  2ZMB A;  1FQD A;  1O7T A;  3UGW A;  2WOL A;  1MY2 A;  1A54 A;  3QUJ A;  4UA8 A;  3IO4 A;  1ZJL A;  3DRH A;  3IX1 A;  4THI A;  4KR5 A;  4BDN A;  3VLW A;  4ELR A;  1R9Q A;  5TPA A;  3T9U A;  4G68 C;  5I57 B;  3RUM A;  2E0S A;  3MJN A;  3K1P A;  3SEX A;  1FQF A;  2XXW A;  4QSD A;  2RKM A;  1URS A;  2AL4 A;  3PMX A;  2RCA A;  3U93 A;  2Z23 A;  1BTJ A;  4ZEC A;  2PVU A;  4OER A;  1UTH A;  5I58 A;  4FOR A;  5FHO A;  5I2K A;  3PD9 A;  4G8H A;  3MWB A;  1CE2 A;  4ZED A;  1LCT A;  2UXA A;  5IAI A;  3TDJ A;  5I59 A;  4OQO A;  2I58 A;  3PPO A;  3V5A A;  1EZP A;  3C36 A;  3LSF B;  4YAH X;  4ZE8 A;  4ONY A;  3MVY A;  1JET A;  2D3I A;  3RTF B;  2F97 A;  3TTL A;  4F22 A;  3HV1 A;  2X7P A;  2Z8F A;  3OEM A;  1GTK A;  3MZB A;  4TLM B;  4EQ9 A;  2E1S A;  2F36 A;  1MH4 A;  3K6V A;  3OEN A;  4OXV A;  3QAX A;  3RGY A;  2Y7W A;  1QUJ A;  4NF6 A;  3O97 A;  5H8S A;  2I0C A;  1RYX A;  3EHT A;  1KWH A;  3PUW E;  1SYI A;  4I9D A;  3W15 C;  3ILU B;  3K1M A;  4QF9 A;  2DVC A;  2DWA A;  2A5T A;  2THI A;  5JTY A;  5CI5 A;  4JDF A;  1GGG A;  3UA8 A;  3FJ7 A;  2R9J A;  1Y1Z A;  5M2V A;  3K6W A;  1B9J A;  5H8F B;  5H8Q A;  3LSW A;  4X48 A;  1MG1 A;  2DQV A;  4RYA A;  1MQI A;  2ZNT A;  3PPR A;  4R75 A;  4I62 A;  1ATG A;  4U4X A;  2QSX A;  3TTK A;  3IOV A;  2O1M A;  3T93 B;  2VD3 A;  5DEX A;  3CSG A;  4P11 A;  3HHG A;  4EF1 A;  2O6A A;  3ONM A;  1IIT A;  3TOD A;  4NF8 B;  5FHN A;  3OD7 A;  5L9O A;  2O7I A;  4HW8 A;  3VV5 A;  1UIV A;  5CC2 A;  2ONK E;  4MF3 A;  4LZ8 A;  3RT8 A;  4H8J A;  3JYR A;  1PBQ A;  1B7Z A;  1DPP A;  3SET A;  4OMB A;  3G3F A;  3KZG A;  3KGC A;  4R6H A;  3DLN A;  5F1Q A;  2GHB A;  3N6U A;  4R2B A;  3OSR A;  1OLC A;  4ZDM A;  3D4G A;  3CFL A;  4PFT A;  3O2A A;  4F39 A;  4QFP A;  5ITO A;  4U23 A;  4KPT A;  2OJT A;  4R74 A;  3K1N A;  3VLV A;  1NNF A;  3TCG A;  1Y3N A;  1XOC A;  1MDP 1;  2Q89 A;  4ISU A;  1B51 A;  2VOZ A;  3U8Q A;  3KEI A;  1YPN A;  2HEU A;  2W7Y A;  1SW5 A;  2V93 A;  4KYD A;  5A5X A;  4I1D A;  4JXI A;  4BDM A;  1TWY A;  3RPW A;  1B4H A;  4YB5 A;  2NVU B;  3W9V A;  5ICT A;  1ZTY A;  1TFD A;  1MXV A;  5TP9 B;  2DXR A;  1B40 A;  5AA4 A;  1SBP A;  3BKI B;  2ABH A;  4R9F A;  2BJJ X;  4NWD A;  4YZZ A;  1N3X A;  2XXP A;  4PP0 A;  4BDO A;  3FV2 A;  1AMF A;  2V3Q A;  4HS7 A;  5AA2 B;  3VDF A;  2P2A A;  1PC3 A;  3ZSF A;  3PMW A;  4ZEI A;  3K02 A;  3THI A;  2B3B A;  3RNN A;  3RLF E;  4YIC A;  1SW2 A;  2UYE A;  1LCF A;  1MY3 A;  3MQ9 A;  1PBP A;  4PFW A;  3CRB A;  5I2N B;  4PQJ A;  4MH5 A;  1N04 A;  2DE3 A;  1PB7 A;  2NWJ A;  5CMK A;  1MPC A;  1BP5 A;  3EQ1 A;  3USD A;  3N5L A;  2HFB A;  3PUX E;  5I57 A;  4DXB A;  4WKM A;  4RPN A;  1XC1 A;  1NH8 A;  4ZZA A;  4R6Y A;  5KDT A;  2AIX A;  4YKK A;  5FHM A;  4R9G A;  3K4U A;  4FE8 A;  2LAO A;  4P0I A;  4IB2 A;  2X26 A;  3CVG A;  3CG1 A;  1LB9 A;  4QRZ A;  3QUF A;  2GRV A;  3KSJ A;  1IIW A;  5DVI A;  3M3F A;  3MPL A;  1WOD A;  5ELV A;  3B6T A;  3B6Q A;  3R7X A;  2V25 A;  4LVQ A;  3MW0 A;  1ZKB A;  1MXY A;  3RYA A;  1MXZ A;  1MY1 A;  2O1L A;  4HTG A;  3S9N C;  3Q29 A;  3P7I A;  3S4U A;  1ZLQ A;  5I84 A;  1MXU A;  4YKI A;  4QFN A;  4YKJ A;  2A5S A;  1MDQ A;  3RY3 A;  2I49 A;  2PX1 A;  1DTZ A;  3CG3 A;  3KN8 A;  4OHN A;  1MM6 A;  4KYE A;  4LP2 B;  4H8I A;  4NE4 A;  1JVX A;  4JSD A;  1LB8 A;  1NNT A;  3SES A;  4KQP A;  3PPQ A;  3DRK A;  5ISU A;  4WXJ A;  2VD2 A;  1HSL A;  3QK6 A;  3IAZ A;  3K0V A;  4G4P A;  1A8F A;  3G3J A;  4IO4 A;  1UQW A;  4FEC A;  1M5D A;  3QIM A;  4ELP A;  3VXC A;  4GWO A;  1P99 A;  3FTO A;  2Q8J A;  1CB6 A;  5H8F A;  4GRK A;  1FTJ A;  2Z22 A;  1M5E A;  2HZK A;  3RQT A;  4NF5 B;  3MVX A;  1Z7M E;  3UN6 A;  1Q35 A;  4AQ4 A;  4DDD A;  1B4Z A;  2XXI A;  5L9M A;  1F9B A;  1FQB A;  1EH3 A;  3FVN A;  4LON B;  1OQH A;  1Z7N E;  5DVF A;  4C1U A;  1Y9U A;  4KHZ E;  5K2Y A;  4OEN A;  3KG2 A;  4F1V A;  1H45 A;  4RK2 A;  2Q2C A;  1B3E A;  4LA9 A;  4NF8 A;  1JW4 A;  1UTB B;  2Q88 A;  1N3W A;  4PFU A;  4R73 A;  5HBC A;  3H6V A;  3K2D A;  3F11 A;  5L9S A;  1XVX A;  4NF4 B;  4Q30 B;  3BFT A;  3GXA A;  3PUY E;  1MY0 A;  4FAJ A;  2Y7K A;  1WDN A;  3SEW A;  2XXU A;  3KN7 A;  4GF8 A;  5JK4 A;  4F3S A;  2O51 A;  4JWX A;  3TTM A;  4F29 A;  3KSX A;  3IK6 B;  1O63 A;  4PE5 B;  4JSO A;  4G2Z A;  3TFL A;  1YCJ A;  1VSO A;  3IJO B;  2REJ A;  2ZXT A;  2Q9T A;  1MS7 A;  4ESW A;  2DSF A;  1IXH A;  3T22 A;  1I6B A;  2Z8D A;  2DS9 A;  2F7B A;  3RYB A;  3MAM A;  1B52 A;  1Y3Q A;  5TP9 A;  1I6A A;  2XD2 A;  3TEL A;  5I56 B;  3RTW B;  3C9H A;  3A3U A;  3O66 A;  4LZ7 A;  1B1X A;  4G8M A;  4G8N A;  1P1U A;  4GVO A;  5J1D A;  1FCK A;  5ICQ A;  3O29 A;  4POW A;  2QJE A;  1B46 A;  3HST A;  2V84 A;  4MLQ A;  1QJM A;  2REG A;  2AYS A;  4F3G A;  1MQG A;  3PV0 E;  4PET A;  1FTO A;  2VP1 A;  4Q5T A;  1PEB A;  3OO8 A;  2PT2 A;  3FXU A;  1JNF A;  1Y4T A;  2VGQ A;  3K6X A;  3HPI A;  5DTB A;  5AE4 A;  1B0L A;  2NXO A;  3I6V A;  3O6P A;  1US5 A;  2H25 A;  4DXU A;  1QUI A;  3PPN A;  2HQ0 A;  2F8D A;  5TU0 A;  1N0T A;  3FV1 A;  1Y3P A;  2UVI A;  2PYY A;  3TTR A;  3FD3 A;  2QS2 A;  4L17 A;  3IB0 A;  4DLD A;  1NKX A;  3I5O A;  2QMW A;  4LQ5 A;  2H99 A;  3VLU A;  3C33 A;  4F3B A;  1GVC A;  1GR2 A;  3C31 A;  1UIU A;  2UVH A;  2OBG A;  4ZE9 A;  3PU5 A;  1D4N A;  1B5H A;  4GQO A;  1H44 A;  4G77 A;  1SVX B;  1Q1K A;  5CMM A;  4H67 A;  5IKB A;  4IY6 A;  1B05 A;  1L5T A;  1QKA A;  4ZZE A;  1URG A;  3Q26 A;  2VHA A;  3E9X A;  4F1U A;  1A99 A;  5EYF A;  3KFM A;  3FXQ A;  3LR1 A;  1RYO A;  3EN3 A;  2UVJ A;  4ZEB A;  1AOV A;  4PFY A;  3G3K A;  2KLF A;  1JVY A;  3LSX A;  3FJG A;  4F18 A;  4FAT A;  5F7V A;  4RNS A;  1QVS A;  4F31 B;  4RK9 A;  4Z7E A;  1DPE A;  4YB6 A;  3FGS A;  5H8N B;  2QMX A;  2I3W A;  4ZS9 A;  3PAM A;  3OXN A;  4O3C A;  4OYV A;  3KBR A;  2F34 A;  3CR9 A;  2RC8 A;  1QW0 A;  4WEP A;  1LST A;  3GBB A;  3AXF A;  3K01 A;  1OQG A;  5BWJ A;  1B2H A;  1IUD A;  4QSC A;  5AA3 A;  4IO5 A;  3TUS A;  2D21 A;  3T96 B;  3CHG A;  4KD5 A;  1MH3 A;  1N76 A;  1FTK A;  1D9V A;  1HSJ A;  3OO9 A;  4NF5 A;  4UAC A;  3IOW A;  1FTL A;  5LOM A;  1B0H A;  5KZT A;  2I3V A;  3L6H A;  1B5I A;  4FIM A;  3Q27 A;  1UTH B;  3SER A;  1MRP A;  2F6G A;  2H98 A;  4C0R A;  2NOO A;  3A3C A;  1UTB A;  3UK4 A;  3FVG A;  1B7H A;  1MY4 A;  1DSN A;  4U22 A;  5B70 A;  3ODB A;  5CBR A;  1SI1 A;  3EHS A;  1QKB A;  3MP8 A;  2HAV A;  3IB2 A;  2WOP A;  2RIN A;  1FW0 A;  4OES A;  4LQ2 A;  3DRG A;  3BFU A;  2IEE A;  1XHY A;  1B3L A;  1S50 A;  2I4B A;  2QS3 A;  1ANF A;  1LFG A;  2O69 A;  5ITP A;  3V83 A;  2F7C A;  4NF4 A;  4F19 A;  4IO2 A;  4ZEK A;  1PB9 A;  4GXS B;  1OLA A;  2DOJ A;  4Q0C A;  1FQC A;  3L6G A;  2O68 A;  1USY E;  3G3G A;  2RF1 A;  3ILT B;  2D5W A;  1SYH A;  2OK2 A;  4XKP A;  3OO6 A;  5EHM A;  3WAF A;  1NFT A;  2YJP A;  3MUQ A;  4QFO A;  1SW4 A;  4XKN A;  3FZV A;  3O28 A;  3EHU A;  2V3U A;  4NWC A;  3IOT A;  3RN8 A;  2OLB A;  3QYT A;  4H1X A;  4LAT A;  2AL5 A;  1YTV A;  1GV8 A;  3E4R A;  2ONS A;  3MPK A;  2G29 A;  1II5 A;  1R9L A;  1URD A;  2V3T A;  4GIZ A;  4RA1 A;  2B4M A;  4K3F A;  4OFL A;  3TYH A;  3OOA A;  1IXI A;  4GXA A;  3MZ9 A;  4QSE A;  5I56 A;  2XX9 A;  3TZA A;  2QS4 A;  5CBS A;  4OET A;  3M3L A;  4MFI A;  4H0W A;  1N7W A;  3FVO A;  3OSQ A;  4KYS A;  1BLF A;  3BBR A;  4YMA A;  4IO7 A;  4MLV A;  5KCJ B;  4R72 A;  2QRY A;  1IXC A;  4IGR A;  4OEU A;  4GLI A;  4IO3 A;  1BKA A;  2R71 A;  3FIR A;  3HCQ A;  3OEL A;  3CI8 A;  1MQD A;  3SKP A;  4M1V A;  2ZYN A;  3TCH A;  3H7M A;  1R1N A;  3O6G A;  2ZYO A;  2Y7R A;  3ECR A;  3MVZ A;  1P1Q A;  3T9H B;  1MPB A;  1ELJ A;  2R6G E;  4YU0 A;  3VVD A;  5CRY A;  2DVZ A;  1QUK A;  4X9T A;  3PUV E;  4RPO A;  2F6P A;  1NNK A;  4F2O A;  3SEU A;  1H43 A;  3G3I A;  3CFZ A;  3H6U A;  3ZKL A;  3IJX B;  4X1B A;  3IO6 A;  1YAE A;  4OEV A;  3S9M C;  2F5X A;  1O64 A;  4U21 A;  3TKD A;  2CZL A;  3R6U A;  2WKY A;  3TCF A;  1SDX A;  3DM0 A;  4YMB A;  1NMU A;  1A8E A;  4EXL A;  1LAX A;  3FXR A;  4DCY A;  4EDP A;  3KJT A;  1DOT A;  3H06 B;  2B4L A;  2OZZ A;  2QL3 A;  3LUY A;  2UVG A;  3QSL A;  4XIG Q;  3C35 A;  2NUV A;  4AB6 A;  5H8H B;  1IQ7 A;  3V89 B;  2F35 A;  3MVW A;  1PB8 A;  5HM4 B;  4QFK A;  3FUZ A;  2I48 A;  5H8N A;  4G68 B;  2HCA A;  4F3P A;  1VFD A;  1D9Y A;  1ZIU A;  2QPQ A;  3TTN A;  4IGT A;  2B65 A;  3DEL B;  5K2X A;  4YKP A;  4OFO A;  4ND9 A;  1EZO A;  4QHQ A;  3IR1 A;  1B3H A;  3KOT A;  3O6H A;  2HZL A;  3T66 A;  5BUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...