1B05A

Structure of oligo-peptide binding protein complexed with lys-cys-lys
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 185
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b05A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b05A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b05A02
2Y84A 3CIJA 2HAVA 3HSTA 4OYVA 5TP9A 1HSJA 3EHSA 3MQ9A 2O7IA 4I9DA 3MPKA 3C35A 2E0SA 2ALUA 2G29A 2DYXA 1LFHA 4JSDA 5K2YA 4F3BA 5ELVA 2VHAA 4L17A 1MY3A 4X48A 3TMGA 3JYRA 3N94A 2RINA 1USYH 4NMYA 2P0SA 4IGTA 4X1DA 2F5XA 4LUBA 5FTHA 3W9VA 1MXXA 3ECRA 1SI1A 3SEVA 5DYHA 3GLBA 4EUOA 4GXAA 4NTLA 1NNKA 4MLVA 5EHSA 2Z8EA 1N7XA 3PUVE 2AYSA 1Y9UA 2X7PA 4U1ZA 3I6VA 2OJTA 1FQAA 2M8CA 3ILUB 5ITOA 4U1OA 4QF9A 2F78A 3OO7A 4RPNA 1VSOA 1MH3A 2F35A 3TFLA 2XD3A 5AA4B 4R2BA 1F9BA 1EZPA 2QS1A 2AL4A 5ICQA 1SDXA 4X1BA 1L5TA 4G68B 3G3GA 1Y1MA 2V84A 3SEUA 1WVJA 3DP4A 2ABHA 5I56B 4TQUQ 4N6PA 1Y3NA 2ONSA 4P0IA 4YKPA 5CMCA 2H98A 4BDQA 4EDPA 2XX7A 4IO3A 3FVGA 2Q2AA 3T9HB 5CBSA 3RYBA 2UYFA 3C36A 3B7DA 4LQ5A 4YKIA 4OHNA 1TXFA 3HHGA 3PPQA 5KCJB 4DXUA 1B5JA 3N5LA 4AB5A 3PV0E 1B6HA 1UIUA 2Q8JA 5L9SA 4RA1A 3TTNA 5HPQA 2D21A 3W15C 1QKBA 2IA4A 3OELA 2VOZA 4KPTA 2F7BA 4OQOA 3RN8A 2XXXA 1AIVA 5F7VA 1M5FA 5H8HA 2Z22A 2X26A 3K02A 3TKDA 3CG3A 4GQOA 4R74A 4WXJA 2PT2A 4ZECA 2NXOA 3ZS6A 4Q30B 2AL5A 3TELA 4U23A 4DXCA 1PB8A 4JXIA 1H76A 4G8NA 3DRJA 3CRBA 1MG1A 3DRGA 3ONMA 4KI0E 2YJPA 1R6ZA 3K0VA 3EQ1A 1SW4A 2THIA 1WDNA 3DP6A 1AH5A 3EHTA 3PMVA 1RYOA 2QS4A 1FQCA 4OERA 1H44A 2I3WA 1MY4A 3MAMA 2OZZA 3T9UA 2I6EA 3C31A 2ZNSA 4KFQA 2OWTA 4BLAA 3PAMA 1N04A 4ONYA 4XIGQ 1PBPA 3VVFA 1IIWA 4O3CA 3LVUA 4U22A 5KDTA 1LAXA 4MFIA 1IUDA 2B3BA 2HEUA 3M3LA 3Q25A 1MPDA 4RPOA 3MZ1A 3TUSA 4HCWA 5CMMA 1NNTA 4R6YA 2PYYA 3QIMA 4MLQA 4EQBA 4NWDA 4G8MA 2ANJA 3LSXA 1OMPA 4OFJA 4FEDA 3TTMA 3OO9A 3M3FA 3MUQA 3H03A 3IAZA 1MPCA 5ISUA 2ZNTA 4ZEIA 1N3WA 2PMSA 3H6WA 2XXUA 5DVFA 1JW1A 4GL0A 3G3KA 3RYAA 1DSNA 1ZTYA 2H5YA 2RC9A 3C33A 3D4CA 4NF8B 2NUVA 1MXVA 3W9WA 2Z23A 3TPAA 2Z8DA 4ZZAA 3QYTA 1IXGA 1DOTA 2H99A 3KZGA 3CI8A 5FHNA 2QRYA 5H8NB 2Y7RA 1A7LA 1AMFA 3GBAA 4IO4A 2XXHA 3KSJA 1QKAA 3TAJA 4IY5A 4ECFA 5EHMA 4M1VA 4C0RA 2FA7A 4DLDA 1SYIA 4LATA 1ZU0A 3LBSA 1Z7ME 2QPQA 3O6HA 3SKPA 4YMAA 3PUYE 2ZMBA 3SEWA 1HSLA 1DTGA 2I48A 5TU0A 3FJ7A 4NE4A 3HV1A 4U4SA 3Q27A 5I2NB 4QFNA 5I58B 3V8XB 1SBPA 1MRPA 5I57A 4THIA 1JVYA 2Y7IA 2DE2A 4QRZA 5FHOA 2I0BA 2HAUA 4LONB 1URDA 4RJZA 1MQDA 2H9BA 3KOTA 4KQPA 3MPLA 2DWJA 1N0TA 4AQ4A 2D5WA 1UTBA 2R71A 4QSCA 2I3VA 4Q8RA 1N3XA 1N84A 3G3IA 3FUZA 3C34A 3S4UA 4WEPA 2DWAA 1MQGA 4ELRA 3AXFA 1MXYA 3G3FA 4NF4B 2RKMA 4WEDA 2QJEA 5CRYA 3L6GA 2Z8FA 3FASA 1Y4CA 2CZLA 2V3UA 3KG2A 4OZ9A 1GGGA 1B4HA 1FQDA 2XXRA 1POTA 4Z7EA 4PFWA 3MBPA 3O66A 4H1XA 2DQVA 1VFDA 4G2ZA 3TTLA 2DE3A 2NOOA 2ONRA 3K2DA 3RUMA 3JZJA 1B9JA 3IORA 1H3DA 2OBGA 4Q0CA 4RXLA 3I3VA 3VLVA 2O84X 3FVKA 3ILTB 2F6GA 2Y7KA 1RYXA 2AIXA 5B70A 1B3FA 4YKJA 2IEEA 3O6IA 4OENA 4ZE8A 5HM4B 1USYE 1O7TA 5EYFA 3P7IA 5JTYB 1B4ZA 1PC3A 1NNFA 2ZYNA 1XOCA 2DXRA 2DXYA 1UQWA 1QUJA 4ZEDA 1P1WA 4O3BA 3H4ZA 4XKQA 4HTGA 4YB6A 2P2AA 3H06B 5AA4A 1B05A 1Y1ZA 5LOMA 3VLWA 3RT6B 5A5XB 2UYEA 2REGA 3H6TA 3IOWA 3KN8A 3OSQA 2REJA 2UVHA 4G68A 3N6TA 4N13A 1OVBA 4QHQA 3T9XB 5I56A 2O7UA 3O6GA 1XT8A 5KZTA 1O63A 4XXUA 3Q26A 3MC2A 2RCBA 4YZZA 3DRHA 3CFLA 3CSGA 5CM6A 5I2KB 3E4RA 1VE4A 1Y4TA 1US4A 4F3SA 3TZAA 1O64A 5KCJA 1IXCA 1MY1A 1R1NA 1DMBA 1ZKBA 4LP2B 2O69A 1UTHB 2DE4A 4GVOA 1BIYA 4E0XA 1TFDA 3K6UA 3U1OA 3LSLA 3E13X 1LCFA 4FEBA 4G68C 2XXIA 1Q35A 1PB7A 3SEXA 3EHUA 1US5A 4EXKA 2P1SA 3VXCA 2PX1A 1FQEA 4G77A 4Q5TA 2HFBA 4M4GA 5HBCA 4KYDA 3N26A 3FVOA 3PPNA 3R26A 4N07A 3S2VA 4AB6A 1FTJA 3BFUA 2OCUA 4DCYA 4FJPA 1A8FA 1IQ7A 3D4GA 3PMXA 4LZ8A 3OENA 3B6TA 1PDAA 1MM6A 2WOPA 1ZIUA 4R72A 2XXYA 3LUYA 3THIA 3G7WA 1A54A 1YCJA 4R73A 3KJ7A 1ZLQA 1SI0A 4ZEFA 4KCDA 1M5CA 2E1SA 4U4XA 4TOZA 3CG1A 3EN3A 3L6HA 1D3KA 3SERA 1P99A 1MH4A 1WODA 5DEXB 4BDMA 4F22A 3R6UA 3ZSFA 3IOUA 1A99A 4IY6A 4PP0A 4F18A 1NMUA 4E0WA 4OXVA 2A5TB 1B3EA 1LBBA 4RK2A 5AE4A 2ZXTA 5K2XA 3GZGA 3HO7A 4F2OA 4ZEKA 2UXAA 3ZKLA 4G8HA 3S9LC 3FXUA 1MXUA 3TCHA 2PBWA 1SW2A 1TFAA 5H8QB 5CI5A 2Q88A 3T9VA 1A8EA 2RF1A 2QS3A 4BDRA 2XXWA 4Z0IA 1Y3PA 3HHFA 3IR1A 4FATA 4NF8A 3PPPA 1S9TA 3LC8A 4H8IA 3TYHA 4PQJA 1SW5A 4POWA 1ELJA 1Y20A 5H8NA 1D9VA 4YMBA 1SVXB 4HCYA 1PEBA 4QFKA 4MH5A 4ZZEA 2V3TA 3G3JA 1NFTA 4PE5B 3CFZA 3T66A 4POXA 1FQBA 3TQLA 4QFPA 1M5BA 4EXLA 4GFRA 4ND9A 1XVYA 1GR2A 4OWDA 3OO8A 1J1NA 3PMWA 1ZBMA 1URGA 3RT8A 2WOLA 3VVDA 4JB7A 1DPPA 1B46A 3E9XA 2UVIA 4LA9A 1B5IA 5I2NA 5I58A 4GLIA 4BDLA 4JWYA 2R6GE 4ELQA 1AOVA 2Q2CA 2F7AA 2XHDA 1QW0A 3B6QA 2YPNA 4BDOA 2R9JA 4DCXA 2WKYA 4OMBA 1JW4A 1QULA 1GV8A 4NF5B 3T93B 5H8FA 4YB5A 2QMWA 3O2AA 3FXRA 2Q89A 2ZYOA 3T22A 2B4MA 3MP8A 2RC8A 1N7WA 2HCAA 5FHMA 1NH8A 5J1DA 2I4CA 3O28A 3PGFA 4OETA 4DIGA 3WAEA 4QFOA 3M8UA 3KJTA 3A09A 1MPBA 4I1DA 2GH9A 3U92A 3O97A 4NF4A 3R7XA 1JNFA 4EF1A 5TPAB 4QSDA 5CMKA 2F97A 1ANFA 2O68A 1S7YA 3LSWA 2OLBA 1I6QA 5CMBA 1YAEA 4IGRA 2XXVA 4F3PA 1LB9A 1PBQA 1ZJLA 4G4PA 4R2FA 2GHBA 1GVCA 3DP8A 2DOJA 3K1NA 5CBRA 1IEJA 2H4IA 3E3KA 4ZE9A 3MVXA 3MW0A 4KHZE 3CFXA 5H8FB 3QUFA 2OWSA 1OLCA 1URSA 3Q28A 3FV1A 2O6AA 4DDDA 1OIBA 1BP5A 4H0WA 3C9HA 1JW5A 3PD9A 4ELOA 3EPEA 1JVXA 3H3GA 3H7MA 3UK4A 3PUWE 2UVJA 1B7UA 4LZ7A 2QMXA 3K4UA 5JK4A 1ZMGA 4YICA 3MVYA 4DXBA 3IJOB 5JTYA 2DWIA 4OEUA 4RK9A 2H25A 3VFJA 2QS2A 1B7ZA 3O6PA 4NF6B 2GRVA 4IO2A 3MVZA 1IZ1A 1B5HA 1II5A 1FQFA 2DVCA 3RTFB 1I6AA 1CE2A 5A5XA 1LFIA 3FJGA 1MQJA 1B0HA 1A40A 4F19A 3VLUA 3A3CA 1KWHA 5L9MA 4R9FA 2ONKE 4H8JA 4GXSB 4WKMA 4HS7A 4P0GA 1EU8A 2GFEA 1YPNA 3QK6A 2V3QA 4GRKA 3IB0A 3RGYA 5IKBA 2W7YA 3T96B 2XXQA 4F3GA 3BBRA 3USDA 5I2KA 3I5OA 2LAOA 1IITA 4JDFA 1B1XA 4OTEA 5AA2B 4KYEA 4YB7A 1UIVA 4KD5A 2F8DA 5DVJA 3MWBA 3IK6B 1H45A 5ICTA 3U94A 1JEUA 3IL1B 1UTHA 3MP6A 3M3KA 3KN7A 4TLLB 1IXHA 1BKAA 4ISUA 4H67A 3VVEA 1B7HA 3DELB 4LZ5A 5ITPA 1R9QA 1SW1A 3DRKA 3HPIA 3JV9A 5BWJA 4FECA 4ESWA 2HQ0A 3G3HA 2ESNA 3TCGA 2RCAA 3RQTA 2HZKA 4OVJA 3V89B 4I62A 4F2QA 2HZLA 2V93A 1ATGA 3PU5A 1JETA 1MQIA 1FTLA 2XX9A 3IJXB 1LAHE 1EZ9A 4KCCA 1LB8A 4R6HA 3DLNA 4F31B 3DM0A 1EZOA 4PFTA 2UVGA 3KOSA 3Q29A 1MXZA 1OLAA 3UA8A 3FZVA 1LBCA 3UORA 4QFLA 3QXMA 3OSRA 1S50A 2CMOA 4YAHX 5TP9B 1PB9A 4OESA 4LQ2A 4F39A 3TDJA 3TEPA 1N76A 1B52A 2B3FA 3OEKA 3PPOA 4R6KA 3OD7A 1B3GA 3CHGA 2Q9TA 1XHYA 5DEXA 3B6WA 1FCKA 4FE8A 4IO5A 4IB2A 4EQ9A 1SYHA 3C4MA 3OEMA 3FD3A 4I8CA 1XC1A 3SETA 3FV2A 1EH3A 2A5TA 2YLNA 3MP1A 4F1YA 5DTBA 2I4BA 1I6BA 3OO6A 4XKNA 4K3FA 1IXIA 1P1UA 3WAFA 1D9YA 1LAFE 2VD3A 3K00A 4C1UA 5M2VA 2I58A 2VP1A 1QVSA 1B51A 3S9NC 1QUIA 5H8QA 1B58A 3LR1A 3K1MA 5CC2A 3QSLA 1P1OA 2DS9A 1B32A 1P1QA 5BUUA 2DVZA 1DTZA 1NH7A 2D3IA 1MM7A 4GOTA 4DZ1A 2F36A 3GBBA 3KN3A 1NKXA 2OK2A 3K6WA 4RYAA 3CVGA 4X9TA 2XX8A 3SDFA 3TTRA 3U8QA 3C32A 3DRIA 2FYIA 3K01A 1MY2A 2DP8A 3F11A 3FTOA 3A3UA 2B4LA 4OEVA 1FTMA 3K1PA 4PFYA 2A5SA 3RTWB 3IB2A 3RPWA 1MQHA 2QSXA 5AA1A 3O29A 5AA2D 4EQ7A 3FIRA 4ZEBA 2Y7WA 3KGCA 3VDFA 2I0CA 1HSEA 3KBRA 2F7CA 1QJMA 3KEIA 5L8DA 1AL3A 4U2RA 1MS7A 3TQWA 4YKKA 3RY3A 4GIZA 2F6PA 1OVTA 3PUZE 3GXAA 4MBPA 3K6VA 3UGWA 1XS5A 4GD5A 1B40A 5AA3A 2O1LA 3UP9A 4KR5A 2DWHA 2WOKA 4NWCA 3CR9A 4RY1A 4R9GA 5H8HB 1VFEA 2O51A 1B2HA 3V5AA 1CB6A 3MVWA 2QL3A 1B0LA 1B1HA 3ODBA 3MZBA 3OXNA 4NF5A 3PUXE 3V83A 3H6VA 1XVXA 4RNSA 4QSEA 2XXTA 4ZDMA 2NWJA 5I59A 1FTKA 3OOAA 3FJMA 1FTOA 3U72A 1SD3A 1TT1A 4OFOA 3PPRA 4IO6A 2VGQA 1LFGA 2G93A 4JWXA 4EF2A 3FXQA 3IX1A 1LLSA 2F34A 2X7QA 1POY1 5TPAA 2V25A 4H5GA 5F1QA 4YU0A 2VD2A 3IB1A 3S9MC 2DSFA 1MDQA 4GWOA 4H65A 5IAIA 3HN0A 3TTKA 1LGBC 2NVUB 4GL8A 4ESXA 1M5EA 3UIFA 3MJNA 3IO6A 1DPEA 3CSBA 5JEIA 4MF3A 4R75A 5KDTB 1Y3QA 1YTVA 1QUKA 4F1VA 3H6UA 4NEDA 5I59B 1H43A 1A55A 4PETA 4XKRA 4XTCQ 3O9PA 2I49A 3U93A 3RNNA 5DT6A 2XXPA 1Z7NE 4OFLA 4P11A 4UA8A 4H6DA 5H8SA 4C1TA 3TODA 1OQGA 2PT1A 5I84A 3FVNA 3PD8A 3VXBA 1D4NA 1RKMA 1P1NA 4ELPA 1LCTA 3DRFA 3EF7A 4NF6A 2O1MA 3SESA 1B3HA 1VR5A 2ZYMA 2B65A 1BTJA 4F29A 3IOVA 2ZYKA 3OMBA 5DVIA 4BDNA 4LVQA 3TCFA 4IO7A 2ZNUA 3HCQA 3MZ9A 3N6UA 4U21A 1MDP1 1JQFA 3K6XA 2HXWA 2BJJX 2KLFA 3IO4A 1MY0A 1LAGE 3FATA 4TLMB 5B7DA 5L9OA 4JBZA 1FW0A 1OQHA 5AA2A 3FGSA 4FORA 1R9LA 1NL5A 3SEYA 4JSOA 3S9EA 1GTKA 1T0KA 4FAJA 2Y7PA 5FTIA 3UN6A 1BLFA 4XKPA 1Q1KA 3BFTA 4ZS9A 2RC7A 3QUJA 1JEVA 3BKIB 2GHAA 1MXWA 4FIMA 5I57B 2XD2A 3KSXA 1B3LA 4DE8A 4F1UA 3LSFB 3VE1B 3ZKKA 1TWYA 4UACA 1LSTA 4GF8A 1NNPA 3VV5A 4HW8A 4H5FA 3IOTA 4JWOA 1UTBB 3RLFE 1SQYA 4O3AA 1M5DA 2FNCA 2PVUA 4KYSA 3QAXA 3KFMA 4PFUA 1I69A
chains in the Genus database with same CATH superfamily
1KA0A 2Y84A 3CIJA 2WBBA 2HAVA 3HSTA 4OYVA 4GWXA 5I3SA 5TP9A 3FBPA 1HSJA 3EHSA 1LBYA 3MQ9A 2O7IA 4I9DA 3MPKA 1CNQA 3C35A 2E0SA 2ALUA 2G29A 2DYXA 1LFHA 4JSDA 1FPIA 5K2YA 4F3BA 5ELVA 3B8BA 2VHAA 4L17A 1MY3A 4X48A 3TMGA 3JYRA 3N94A 2RINA 1USYH 4NMYA 2P0SA 4IGTA 4X1DA 2F5XA 4LUBA 5FTHA 3W9VA 1MXXA 3ECRA 1SI1A 3SEVA 1NV2A 5DYHA 3GLBA 1LBWA 4EUOA 4GXAA 4NTLA 1NNKA 4MLVA 5EHSA 2Z8EA 5ET6A 3NOHA 4O8MA 1N7XA 3PUVE 2AYSA 1Y9UA 2X7PA 4U1ZA 3I6VA 2OJTA 1FQAA 2M8CA 4NN3A 3ILUB 4JVDA 5ITOA 4U1OA 4QF9A 2F78A 3OO7A 4RPNA 1VSOA 1MH3A 2F35A 3TFLA 2XD3A 5AA4B 4R2BA 1F9BA 1EZPA 2QS1A 2AL4A 5ICQA 1SDXA 4X1BA 1L5TA 4G68B 3G3GA 1Y1MA 2V84A 3SEUA 1WVJA 3DP4A 2ABHA 5I56B 4TQUQ 4N6PA 1Y3NA 2ONSA 4P0IA 4YKPA 5CMCA 3E79A 2HPGA 2H98A 4BDQA 4EDPA 2XX7A 4IO3A 3FVGA 3EKIA 2Q2AA 3T9HB 2L5VA 5CBSA 3RYBA 2UYFA 3C36A 3B7DA 4LQ5A 4YKIA 2JJKA 4OHNA 1TXFA 3HHGA 3PPQA 5KCJB 4DXUA 1B5JA 3N5LA 4AB5A 1IMEA 3PV0E 1B6HA 1UIUA 2Q8JA 5L9SA 4RA1A 3TTNA 5HPQA 2D21A 3W15C 1QKBA 2XWVA 2IA4A 3OELA 2VOZA 4KPTA 4OVPA 2XWOA 3KC0A 2F7BA 4OQOA 3RN8A 2XXXA 1AIVA 5F7VA 1M5FA 5H8HA 4PF6A 2Z22A 2X26A 3K02A 3TKDA 5DW8A 3CG3A 4GQOA 4R74A 4WXJA 2PT2A 4ZECA 2NXOA 2HXRA 3ZS6A 4Q30B 2AL5A 3TELA 4U23A 4DXCA 1PB8A 4PGNA 4JXIA 1H76A 4G8NA 3DRJA 3CRBA 1MG1A 1FJ6A 3DRGA 3ONMA 5J16A 4KI0E 2YJPA 1R6ZA 3K0VA 3EQ1A 1SW4A 2THIA 3RYDA 2QFLA 1DBZA 1WDNA 3DP6A 1AH5A 2KQZA 3EHTA 1LBVA 4GBVA 3PMVA 1RYOA 2QS4A 1FQCA 5LTCA 4OERA 1H44A 2I3WA 1MY4A 3MAMA 3PTYA 2OZZA 3T9UA 2I6EA 3C31A 2ZNSA 1FTAA 4KFQA 2OWTA 4BLAA 3PAMA 1N04A 4X8RA 4ONYA 4XIGQ 1PBPA 3VVFA 1IIWA 4O3CA 3LVUA 4U22A 5KDTA 1LAXA 4MFIA 1IUDA 1NV0A 2B3BA 2HEUA 3M3LA 3Q25A 1MPDA 4JVIA 4MEVA 4RPOA 2VPOA 3MZ1A 3TUSA 4HCWA 5CMMA 2Y5LA 1NNTA 4MCOA 4R6YA 2PYYA 3QIMA 4MLQA 4EQBA 4NWDA 4G8MA 2ANJA 4XFEA 3LSXA 1OMPA 1SPIA 4OFJA 4FEDA 3TTMA 3OO9A 3M3FA 3MUQA 3H03A 3IAZA 1MPCA 1D9QA 5ISUA 2ZNTA 4ZEIA 1N3WA 4I40A 2PMSA 3BIHA 4H45A 3H6WA 4O7IA 2XXUA 5DVFA 1JW1A 4GL0A 3QMFA 3G3KA 3RYAA 4N8YA 1DSNA 4UABA 1ZTYA 2H5YA 2RC9A 3C33A 4O7MA 4P3LA 3D4CA 4NF8B 2NUVA 1MXVA 3W9WA 2Z23A 3TPAA 2Z8DA 4ZZAA 3QYTA 1IXGA 1DOTA 2H99A 1LEVA 3KZGA 3CI8A 5FHNA 2QRYA 5H8NB 2Y7RA 4JVCA 1A7LA 1AMFA 1QGXA 4H46A 3GBAA 4IO4A 1YZ0A 2XXHA 3KSJA 1QKAA 3TAJA 4IY5A 4ECFA 1FBGA 5EHMA 2F3BA 4NGUA 4M1VA 4C0RA 2XA5A 2FA7A 4DLDA 1SYIA 4PGPA 5I7IA 4MX6A 4LATA 1ZU0A 3LBSA 5IM2A 1Z7ME 2QPQA 3O6HA 3SKPA 4YMAA 3PUYE 2ZMBA 3SEWA 1HSLA 1DTGA 1YYZA 2I48A 5TU0A 3FJ7A 4NE4A 3HV1A 4U4SA 3Q27A 5I2NB 4QFNA 5I58B 3V8XB 1SBPA 1MRPA 5I57A 4THIA 1JVYA 2Y7IA 4P47A 1NV5A 2DE2A 4QRZA 5FHOA 2I0BA 2HAUA 1G0HA 4LONB 1URDA 1DCUA 4RJZA 4P8BA 1MQDA 2H9BA 3KOTA 4NHBA 4KQPA 3MPLA 2DWJA 1N0TA 4AQ4A 2D5WA 1UTBA 2R71A 4QSCA 3RPLA 2I3VA 4Q8RA 1N3XA 1N84A 3G3IA 3FUZA 3C34A 3S4UA 4N15A 1G0IA 4WEPA 2DWAA 1MQGA 4MIJA 4ELRA 3AXFA 1MXYA 3G3FA 4NF4B 2RKMA 4WEDA 2QJEA 5CRYA 3L6GA 2Z8FA 3FASA 4I3YA 1Y4CA 2CZLA 2V3UA 3KG2A 4OZ9A 1GGGA 5F24A 4OANA 1B4HA 4OA4A 1FQDA 2XXRA 1FSAA 1POTA 4Z7EA 4PFWA 3MBPA 3O66A 4H1XA 2DQVA 1VFDA 4G2ZA 3TTLA 2DE3A 4NG7A 1KA1A 2NOOA 1VDWA 2ONRA 3K2DA 3RUMA 3JZJA 1B9JA 3IORA 1H3DA 2OBGA 4Q0CA 4RXLA 3I3VA 3VLVA 2O84X 1FBDA 4OVTA 3FVKA 3ILTB 2F6GA 4MJOA 2Y7KA 1RYXA 1IMBA 2AIXA 5IZ1A 5B70A 4MNIA 1B3FA 4YKJA 2IEEA 3O6IA 4OENA 4ZE8A 5HM4B 1USYE 1O7TA 5EYFA 3P7IA 5JTYB 1B4ZA 2ZZWA 1PC3A 5EQAA 1NNFA 2ZYNA 1XOCA 4GX3A 2DXRA 2DXYA 1UQWA 3D1RA 1QUJA 4ZEDA 1P1WA 3KBZA 4O3BA 3H4ZA 4XKQA 4HTGA 4YB6A 2P2AA 3H06B 4GX6A 5AA4A 1B05A 1Y1ZA 5LOMA 3U65A 3VLWA 3RT6B 5A5XB 2UYEA 4OVQA 2REGA 2CZIA 3H6TA 3IOWA 3KN8A 3OSQA 3FXBA 2REJA 2UVHA 1NV3A 3N6TA 4G68A 4HE0A 4N13A 1OVBA 4QHQA 3T9XB 5I56A 2O7UA 3O6GA 1XT8A 5KZTA 1O63A 4XXUA 3Q26A 1FPGA 3MC2A 2RCBA 4YZZA 3DRHA 3CFLA 3CSGA 2XWKA 5CM6A 5I2KB 3E4RA 1VE4A 1Y4TA 2PFYA 3LV0A 1US4A 4F3SA 3TZAA 1O64A 5KCJA 1IXCA 1MY1A 1R1NA 1DMBA 1ZKBA 4LP2B 2O69A 2R8TA 2VPNA 1UTHB 2DE4A 4GVOA 4HE2A 1BIYA 4QXDA 4E0XA 1TFDA 3K6UA 3U1OA 3LSLA 1JP4A 3E13X 1LCFA 4FEBA 5ET8A 4G68C 2XXIA 1Q35A 4PAFA 1PB7A 3SEXA 3EHUA 1US5A 4EXKA 3IFAA 2P1SA 3VXCA 2PX1A 1FQEA 4G77A 4Q5TA 2HFBA 2ZZXA 3E78A 4M4GA 5HBCA 4KYDA 3N26A 3FVOA 3PPNA 3R26A 4N07A 3S2VA 1FJ9A 4AB6A 1FTJA 3BFUA 2PCRA 2OCUA 4DCYA 4FJPA 1A8FA 1IQ7A 3D4GA 3PMXA 4LZ8A 3OENA 3B6TA 1PDAA 1MM6A 2WOPA 1ZIUA 5ESYA 4GX4A 4R72A 2XXYA 3LUYA 3THIA 3G7WA 1A54A 1YCJA 4R73A 3KJ7A 1ZLQA 1SI0A 4ZEFA 4KCDA 1M5CA 2E1SA 4U4XA 4PTKA 2QVUA 4TOZA 3SZPA 3CG1A 3EN3A 3L6HA 1D3KA 4HXVA 4NAPA 3SERA 1P99A 1MH4A 3IFCA 1WODA 5DEXB 4BDMA 4F22A 3R6UA 3ZSFA 3IOUA 1A99A 4IY6A 4PP0A 4PFBA 4F18A 1NMUA 4E0WA 4OXVA 2A5TB 1B3EA 1LBBA 4RK2A 5AE4A 2ZXTA 4N81A 5K2XA 3GZGA 2F3DA 2QVRA 3HO7A 2FIXA 4F2OA 4ZEKA 2UXAA 4P9KA 4G8HA 3ZKLA 3S9LC 3FXUA 1MXUA 3TCHA 2PBWA 1SW2A 2XXKA 1TFAA 5H8QB 5CI5A 1RDYA 2Q88A 3T9VA 2MKZA 1A8EA 2RF1A 2QS3A 4BDRA 2XXWA 5EQ9A 4Z0IA 1Y3PA 3HHFA 3IR1A 4MAGA 4X04A 4P1LA 4FATA 4NF8A 4PF8A 3PPPA 1AWBA 1S9TA 3LC8A 4H8IA 3TYHA 4PQJA 1NI9A 2CEXA 1SW5A 4POWA 5EQ8A 1ELJA 1Y20A 5H8NA 1D9VA 4YMBA 1SVXB 4HCYA 1PEBA 4QFKA 4MH5A 4ZZEA 2V3TA 3G3JA 2P3VA 1NFTA 5ET5A 4PE5B 3CFZA 4PDHA 3T66A 4N6KA 4POXA 1FQBA 3TQLA 4QFPA 1M5BA 5IZZA 4EXLA 4GFRA 4GWZA 4ND9A 1XVYA 1GR2A 1INPA 4OWDA 2PFZA 3OO8A 1J1NA 3PMWA 4P1EA 1ZBMA 1URGA 3RT8A 2WOLA 3VVDA 4JB7A 1DPPA 1B46A 3E9XA 4LN5A 2FBPA 2UVIA 4LA9A 1B5IA 5I2NA 5I58A 4GLIA 4BDLA 4JWYA 2R6GE 4ELQA 1AOVA 2Q2CA 2F7AA 2XHDA 1QW0A 3B6QA 2YPNA 4PFRA 4BDOA 2R9JA 4DCXA 1NV7A 2WKYA 4OMBA 4MHFA 1JW4A 1QULA 2HHMA 4NF5B 1GV8A 3T93B 5H8FA 4YB5A 2QMWA 3O2AA 2CZKA 3FXRA 1XI6A 2Q89A 2ZYOA 3T22A 2B4MA 3MP8A 1NUWA 2RC8A 1N7WA 2HCAA 5FHMA 1NH8A 3MYUA 5J1DA 2I4CA 3O28A 2BJIA 3PGFA 4OETA 4DIGA 3WAEA 4QFOA 3M8UA 3T1BA 3KJTA 3A09A 1MPBA 4I1DA 2GH9A 3U92A 3O97A 2OWZA 4NF4A 3R7XA 1JNFA 4EF1A 5TPAB 4QSDA 5CMKA 2F97A 1ANFA 2O68A 1S7YA 2XWIA 3LSWA 2OLBA 1I6QA 5CMBA 1YAEA 4IGRA 2XXVA 1Q9DA 4QBAA 4F3PA 2WEFA 1LB9A 1PBQA 1ZJLA 4G4PA 4R2FA 2GHBA 1GVCA 3DP8A 4PE3A 2DOJA 3K1NA 5CBRA 1IEJA 2H4IA 3E3KA 4ZE9A 3MVXA 3MW0A 2FHYA 4KHZE 3CFXA 5H8FB 3QUFA 2OWSA 1OLCA 1URSA 3Q28A 4MNPA 3FV1A 2O6AA 1FBEA 4DDDA 1OIBA 1BP5A 3MSTA 4H0WA 3C9HA 1JW5A 4O94A 4N17A 3PD9A 4ELOA 4GBWA 3EPEA 1JVXA 3H3GA 4DI3D 1NUYA 3H7MA 3UK4A 3PUWE 1FPDA 2UVJA 1B7UA 4LZ7A 2QMXA 3K4UA 5JK4A 1ZMGA 4YICA 3MVYA 4DXBA 3HFUA 3IJOB 5JTYA 2DWIA 4OEUA 4RK9A 2H25A 3VFJA 2QS2A 1B7ZA 3O6PA 4NF6B 2GRVA 4IO2A 3MVZA 1IZ1A 1B5HA 1II5A 1FQFA 2DVCA 3RTFB 1I6AA 1CE2A 5A5XA 1LFIA 3FJGA 1MQJA 1B0HA 1A40A 4F19A 3VLUA 3A3CA 1KWHA 5L9MA 4R9FA 2FVZA 2ONKE 4H8JA 4GXSB 4WKMA 4HS7A 4P0GA 1EU8A 2GFEA 1YPNA 3QK6A 2V3QA 4GRKA 3IB0A 3RGYA 1IMFA 5IKBA 2W7YA 3T96B 2XXQA 4F3GA 4G61A 3BBRA 3USDA 5I2KA 3I5OA 2LAOA 2QVVA 1IITA 4JDFA 1B1XA 4OTEA 5AA2B 4KYEA 4YB7A 1FPBA 1UIVA 1IMDA 4KD5A 2F8DA 5DVJA 3MWBA 3IK6B 1H45A 5ICTA 3U94A 1JEUA 3IL1B 1UTHA 3MP6A 3M3KA 3KN7A 4TLLB 1IXHA 1BKAA 2Q74A 4ISUA 4H67A 3VVEA 1B7HA 3DELB 3B50A 4LZ5A 5ITPA 1R9QA 1SW1A 3DRKA 3HPIA 3JV9A 5BWJA 1FPJA 4FECA 4GWUA 4ESWA 2HQ0A 3G3HA 2ESNA 3TCGA 1LBXA 2RCAA 4I3EA 3RQTA 2HZKA 4OVJA 3V89B 4FBPA 5FBPA 4I62A 4F2QA 2HZLA 2V93A 1ATGA 5IZ3A 3PU5A 1JETA 1MQIA 1FTLA 1NV4A 2XX9A 4PBHA 3IJXB 1FBCA 2Y5KA 1LAHE 2WX9A 1EZ9A 4KCCA 1LB8A 4GWWA 4R6HA 3DLNA 4F31B 3DM0A 1EZOA 4PFTA 1FBFA 2UVGA 3KOSA 3Q29A 1MXZA 2WYKA 1OLAA 3UA8A 3FZVA 1LBCA 3UORA 4QFLA 3QXMA 3OSRA 1S50A 1FPFA 2CMOA 4YAHX 5TP9B 1PB9A 4OESA 4LQ2A 4F39A 3TDJA 3TEPA 1NUZA 1N76A 1B52A 2B3FA 3OEKA 3PPOA 4R6KA 3OD7A 1B3GA 4P56A 3CHGA 2Q9TA 2VT5A 1XHYA 5DEXA 3B6WA 1FCKA 4FE8A 4IO5A 4IB2A 4EQ9A 1SYHA 2WYPA 3C4MA 3OEMA 3FD3A 1RDXA 4I8CA 1XC1A 3SETA 3FV2A 4N6DA 1EH3A 2A5TA 5IZ3B 2YLNA 3MP1A 3BIGA 4F1YA 5DTBA 1EYJA 2I4BA 1I6BA 3OO6A 4XKNA 4K3FA 4XF5A 1IXIA 4AS4A 1P1UA 3WAFA 1D9YA 1LAFE 2VD3A 3K00A 4C1UA 5M2VA 2I58A 2VP1A 1QVSA 1B51A 3S9NC 1QUIA 5H8QA 1B58A 3LR1A 3K1MA 5CC2A 4NF0A 3QSLA 1P1OA 2DS9A 1B32A 1P1QA 1FBPA 1FPEA 5BUUA 2DVZA 2FIEA 1DTZA 1NH7A 2D3IA 1MM7A 4GOTA 4DZ1A 2F36A 3GBBA 3KN3A 1NKXA 2OK2A 3K6WA 4RYAA 3CVGA 4X9TA 2XX8A 3SDFA 3TTRA 3U8QA 5IGAA 4OVSA 3C32A 3DRIA 4PBQA 2FYIA 3K01A 1MY2A 2DP8A 2CZHA 3F11A 3FTOA 4NQ8A 1FPLA 2V4CA 3A3UA 2B4LA 4OEVA 1FTMA 3K1PA 4PFYA 2A5SA 3RTWB 1FRPA 3IB2A 1LBZA 3RPWA 1MQHA 2QSXA 5AA1A 3O29A 5AA2D 4EQ7A 2ZZVA 5EYGA 3FIRA 4ZEBA 2Y7WA 3KGCA 3VDFA 2I0CA 1HSEA 3KBRA 2F7CA 1QJMA 3GYYA 4GWYA 3KEIA 5L8DA 1DK4A 1AL3A 4U2RA 5ET7A 1MS7A 3TQWA 4YKKA 4AS5A 2WBDA 3RY3A 4GIZA 2F6PA 1OVTA 3PUZE 3GXAA 4MBPA 3K6VA 3UGWA 4NX1A 1XS5A 4GD5A 1B40A 1YXIA 5AA3A 2O1LA 1IMAA 3UP9A 4KR5A 2DWHA 2WOKA 4NWCA 3CR9A 1IMCA 4RY1A 4R9GA 5H8HB 1VFEA 2O51A 1B2HA 3V5AA 1CB6A 3MVWA 2QL3A 1B0LA 1B1HA 3ODBA 3MZBA 3OXNA 4NF5A 3PUXE 3V83A 2P3NA 3H6VA 1XVXA 4RNSA 4QSEA 2XXTA 4ZDMA 2GQ1A 2NWJA 1FTKA 5I59A 3OOAA 2DDKA 3FJMA 1FTOA 3U72A 4OVRA 1SD3A 1TT1A 4OFOA 3PPRA 4IO6A 2VGQA 1LFGA 2G93A 4GWSA 4JWXA 4EF2A 5LDZA 3FXQA 3IX1A 1LLSA 2F34A 2X7QA 1POY1 5TPAA 3T0JA 2V25A 4H5GA 5F1QA 4YU0A 2VD2A 1K9ZA 3IB1A 3S9MC 2DSFA 1MDQA 4GWOA 4H65A 5I5PA 5IAIA 3HN0A 3TTKA 1LGBC 2NVUB 4GL8A 2Q8MA 4ESXA 1M5EA 3UIFA 3MJNA 1FBHA 3IO6A 1RDZA 1DPEA 3CSBA 5JEIA 4MF3A 4R75A 5KDTB 5A5LA 3A29A 1Y3QA 1YTVA 1QUKA 4F1VA 3H6UA 5T3JA 4NEDA 5I59B 1H43A 5EYHA 1A55A 4PETA 4XKRA 4N91A 4XTCQ 3O9PA 2I49A 3U93A 3RNNA 5DT6A 2XXPA 1Z7NE 4KXPA 4OFLA 4P11A 4PDDA 4UA8A 4H6DA 1KZ8A 1NV6A 5H8SA 4C1TA 3TODA 1OQGA 2PT1A 3KC1A 5I84A 3FVNA 3PD8A 1NUXA 3VXBA 1D4NA 1RKMA 4PAIA 1P1NA 4ELPA 1EYIA 1LCTA 4PAKA 3DRFA 3EF7A 4NF6A 4DI4B 2O1MA 3SESA 1B3HA 1VR5A 2ZYMA 2B65A 1NV1A 1BTJA 4F29A 3IOVA 2ZYKA 3OMBA 5DVIA 4BDNA 4IR8A 4LVQA 3TCFA 4IO7A 2ZNUA 3HCQA 4XEQA 3MZ9A 1EYKA 3N6UA 4U21A 1MDP1 1JQFA 3K6XA 2HXWA 2BJJX 2KLFA 3IO4A 1K9YA 1MY0A 1LAGE 4N8GA 3ISPA 3ROJA 3FATA 4TLMB 5B7DA 5L9OA 4JBZA 3LUZA 4PCDA 1FW0A 1OQHA 5AA2A 3FGSA 4FORA 1R9LA 1NL5A 3SEYA 4JSOA 3S9EA 1GTKA 1T0KA 4FAJA 2Y7PA 5FTIA 3UN6A 1BLFA 4XKPA 1Q1KA 3BFTA 4ZS9A 1BK4A 2CEYA 2RC7A 3QUJA 1JEVA 3BKIB 2GHAA 1MXWA 4FIMA 5I57B 2XD2A 3KSXA 1B3LA 1FPKA 4N4UA 4DE8A 4F1UA 4MNCA 3LSFB 5EQ7A 3VE1B 3ZKKA 4PC9A 4PFIA 1TWYA 4UACA 1LSTA 4GF8A 1NNPA 3VV5A 4HW8A 4H5FA 3IOTA 4MMPA 4JWOA 1UTBB 3RLFE 2KR0A 4HE1A 3RPLB 2OX3A 1SQYA 4O3AA 1M5DA 2FNCA 2PVUA 4KYSA 3QAXA 3KFMA 4PFUA 1I69A
chains in the Genus database with same CATH topology
2Y84A 3CIJA 2HAVA 3HSTA 4OYVA 5TP9A 1HSJA 3EHSA 3MQ9A 2O7IA 4I9DA 3MPKA 3C35A 2E0SA 2ALUA 2G29A 2DYXA 1LFHA 4JSDA 5K2YA 4F3BA 5ELVA 2VHAA 4L17A 1MY3A 4X48A 3TMGA 3JYRA 3N94A 2RINA 1USYH 4NMYA 2P0SA 4IGTA 4X1DA 2F5XA 4LUBA 5FTHA 3W9VA 1MXXA 3ECRA 1SI1A 3SEVA 5DYHA 3GLBA 4EUOA 4GXAA 4NTLA 1NNKA 4MLVA 5EHSA 2Z8EA 1N7XA 3PUVE 2AYSA 1Y9UA 2X7PA 4U1ZA 3I6VA 2OJTA 1FQAA 2M8CA 3ILUB 5ITOA 4U1OA 4QF9A 2F78A 3OO7A 4RPNA 1VSOA 1MH3A 2F35A 3TFLA 2XD3A 5AA4B 4R2BA 1F9BA 1EZPA 2QS1A 2AL4A 5ICQA 1SDXA 4X1BA 1L5TA 4G68B 3G3GA 1Y1MA 2V84A 3SEUA 1WVJA 3DP4A 2ABHA 5I56B 4TQUQ 4N6PA 1Y3NA 2ONSA 4P0IA 4YKPA 5CMCA 2H98A 4BDQA 4EDPA 2XX7A 4IO3A 3FVGA 2Q2AA 3T9HB 5CBSA 3RYBA 2UYFA 3C36A 3B7DA 4LQ5A 4YKIA 4OHNA 1TXFA 3HHGA 3PPQA 5KCJB 4DXUA 1B5JA 3N5LA 4AB5A 3PV0E 1B6HA 1UIUA 2Q8JA 5L9SA 4RA1A 3TTNA 5HPQA 2D21A 3W15C 1QKBA 2IA4A 3OELA 2VOZA 4KPTA 2F7BA 4OQOA 3RN8A 2XXXA 1AIVA 5F7VA 1M5FA 5H8HA 2Z22A 2X26A 3K02A 3TKDA 3CG3A 4GQOA 4R74A 4WXJA 2PT2A 4ZECA 2NXOA 3ZS6A 4Q30B 2AL5A 3TELA 4U23A 4DXCA 1PB8A 4JXIA 1H76A 4G8NA 3DRJA 3CRBA 1MG1A 3DRGA 3ONMA 4KI0E 2YJPA 1R6ZA 3K0VA 3EQ1A 1SW4A 2THIA 1WDNA 3DP6A 1AH5A 3EHTA 3PMVA 1RYOA 2QS4A 1FQCA 4OERA 1H44A 2I3WA 1MY4A 3MAMA 2OZZA 3T9UA 2I6EA 3C31A 2ZNSA 4KFQA 2OWTA 4BLAA 3PAMA 1N04A 4ONYA 4XIGQ 1PBPA 3VVFA 1IIWA 4O3CA 3LVUA 4U22A 5KDTA 1LAXA 4MFIA 1IUDA 2B3BA 2HEUA 3M3LA 3Q25A 1MPDA 4RPOA 3MZ1A 3TUSA 4HCWA 5CMMA 1NNTA 4R6YA 2PYYA 3QIMA 4MLQA 4EQBA 4NWDA 4G8MA 2ANJA 3LSXA 1OMPA 4OFJA 4FEDA 3TTMA 3OO9A 3M3FA 3MUQA 3H03A 3IAZA 1MPCA 5ISUA 2ZNTA 4ZEIA 1N3WA 2PMSA 3H6WA 2XXUA 5DVFA 1JW1A 4GL0A 3G3KA 3RYAA 1DSNA 1ZTYA 2H5YA 2RC9A 3C33A 3D4CA 4NF8B 2NUVA 1MXVA 3W9WA 2Z23A 3TPAA 2Z8DA 4ZZAA 3QYTA 1IXGA 1DOTA 2H99A 3KZGA 3CI8A 5FHNA 2QRYA 5H8NB 2Y7RA 1A7LA 1AMFA 3GBAA 4IO4A 2XXHA 3KSJA 1QKAA 3TAJA 4IY5A 4ECFA 5EHMA 4M1VA 4C0RA 2FA7A 4DLDA 1SYIA 4LATA 1ZU0A 3LBSA 1Z7ME 2QPQA 3O6HA 3SKPA 4YMAA 3PUYE 2ZMBA 3SEWA 1HSLA 1DTGA 2I48A 5TU0A 3FJ7A 4NE4A 3HV1A 4U4SA 3Q27A 5I2NB 4QFNA 5I58B 3V8XB 1SBPA 1MRPA 5I57A 4THIA 1JVYA 2Y7IA 2DE2A 4QRZA 5FHOA 2I0BA 2HAUA 4LONB 1URDA 4RJZA 1MQDA 2H9BA 3KOTA 4KQPA 3MPLA 2DWJA 1N0TA 4AQ4A 2D5WA 1UTBA 2R71A 4QSCA 2I3VA 4Q8RA 1N3XA 1N84A 3G3IA 3FUZA 3C34A 3S4UA 4WEPA 2DWAA 1MQGA 4ELRA 3AXFA 1MXYA 3G3FA 4NF4B 2RKMA 4WEDA 2QJEA 5CRYA 3L6GA 2Z8FA 3FASA 1Y4CA 2CZLA 2V3UA 3KG2A 4OZ9A 1GGGA 1B4HA 1FQDA 2XXRA 1POTA 4Z7EA 4PFWA 3MBPA 3O66A 4H1XA 2DQVA 1VFDA 4G2ZA 3TTLA 2DE3A 2NOOA 2ONRA 3K2DA 3RUMA 3JZJA 1B9JA 3IORA 1H3DA 2OBGA 4Q0CA 4RXLA 3I3VA 3VLVA 2O84X 3FVKA 3ILTB 2F6GA 2Y7KA 1RYXA 2AIXA 5B70A 1B3FA 4YKJA 2IEEA 3O6IA 4OENA 4ZE8A 5HM4B 1USYE 1O7TA 5EYFA 3P7IA 5JTYB 1B4ZA 1PC3A 1NNFA 2ZYNA 1XOCA 2DXRA 2DXYA 1UQWA 1QUJA 4ZEDA 1P1WA 4O3BA 3H4ZA 4XKQA 4HTGA 4YB6A 2P2AA 3H06B 5AA4A 1B05A 1Y1ZA 5LOMA 3VLWA 3RT6B 5A5XB 2UYEA 2REGA 3H6TA 3IOWA 3KN8A 3OSQA 2REJA 2UVHA 4G68A 3N6TA 4N13A 1OVBA 4QHQA 3T9XB 5I56A 2O7UA 3O6GA 1XT8A 5KZTA 1O63A 4XXUA 3Q26A 3MC2A 2RCBA 4YZZA 3DRHA 3CFLA 3CSGA 5CM6A 5I2KB 3E4RA 1VE4A 1Y4TA 1US4A 4F3SA 3TZAA 1O64A 5KCJA 1IXCA 1MY1A 1R1NA 1DMBA 1ZKBA 4LP2B 2O69A 1UTHB 2DE4A 4GVOA 1BIYA 4E0XA 1TFDA 3K6UA 3U1OA 3LSLA 3E13X 1LCFA 4FEBA 4G68C 2XXIA 1Q35A 1PB7A 3SEXA 3EHUA 1US5A 4EXKA 2P1SA 3VXCA 2PX1A 1FQEA 4G77A 4Q5TA 2HFBA 4M4GA 5HBCA 4KYDA 3N26A 3FVOA 3PPNA 3R26A 4N07A 3S2VA 4AB6A 1FTJA 3BFUA 2OCUA 4DCYA 4FJPA 1A8FA 1IQ7A 3D4GA 3PMXA 4LZ8A 3OENA 3B6TA 1PDAA 1MM6A 2WOPA 1ZIUA 4R72A 2XXYA 3LUYA 3THIA 3G7WA 1A54A 1YCJA 4R73A 3KJ7A 1ZLQA 1SI0A 4ZEFA 4KCDA 1M5CA 2E1SA 4U4XA 4TOZA 3CG1A 3EN3A 3L6HA 1D3KA 3SERA 1P99A 1MH4A 1WODA 5DEXB 4BDMA 4F22A 3R6UA 3ZSFA 3IOUA 1A99A 4IY6A 4PP0A 4F18A 1NMUA 4E0WA 4OXVA 2A5TB 1B3EA 1LBBA 4RK2A 5AE4A 2ZXTA 5K2XA 3GZGA 3HO7A 4F2OA 4ZEKA 2UXAA 3ZKLA 4G8HA 3S9LC 3FXUA 1MXUA 3TCHA 2PBWA 1SW2A 1TFAA 5H8QB 5CI5A 2Q88A 3T9VA 1A8EA 2RF1A 2QS3A 4BDRA 2XXWA 4Z0IA 1Y3PA 3HHFA 3IR1A 4FATA 4NF8A 3PPPA 1S9TA 3LC8A 4H8IA 3TYHA 4PQJA 1SW5A 4POWA 1ELJA 1Y20A 5H8NA 1D9VA 4YMBA 1SVXB 4HCYA 1PEBA 4QFKA 4MH5A 4ZZEA 2V3TA 3G3JA 1NFTA 4PE5B 3CFZA 3T66A 4POXA 1FQBA 3TQLA 4QFPA 1M5BA 4EXLA 4GFRA 4ND9A 1XVYA 1GR2A 4OWDA 3OO8A 1J1NA 3PMWA 1ZBMA 1URGA 3RT8A 2WOLA 3VVDA 4JB7A 1DPPA 1B46A 3E9XA 2UVIA 4LA9A 1B5IA 5I2NA 5I58A 4GLIA 4BDLA 4JWYA 2R6GE 4ELQA 1AOVA 2Q2CA 2F7AA 2XHDA 1QW0A 3B6QA 2YPNA 4BDOA 2R9JA 4DCXA 2WKYA 4OMBA 1JW4A 1QULA 1GV8A 4NF5B 3T93B 5H8FA 4YB5A 2QMWA 3O2AA 3FXRA 2Q89A 2ZYOA 3T22A 2B4MA 3MP8A 2RC8A 1N7WA 2HCAA 5FHMA 1NH8A 5J1DA 2I4CA 3O28A 3PGFA 4OETA 4DIGA 3WAEA 4QFOA 3M8UA 3KJTA 3A09A 1MPBA 4I1DA 2GH9A 3U92A 3O97A 4NF4A 3R7XA 1JNFA 4EF1A 5TPAB 4QSDA 5CMKA 2F97A 1ANFA 2O68A 1S7YA 3LSWA 2OLBA 1I6QA 5CMBA 1YAEA 4IGRA 2XXVA 4F3PA 1LB9A 1PBQA 1ZJLA 4G4PA 4R2FA 2GHBA 1GVCA 3DP8A 2DOJA 3K1NA 5CBRA 1IEJA 2H4IA 3E3KA 4ZE9A 3MVXA 3MW0A 4KHZE 3CFXA 5H8FB 3QUFA 2OWSA 1OLCA 1URSA 3Q28A 3FV1A 2O6AA 4DDDA 1OIBA 1BP5A 4H0WA 3C9HA 1JW5A 3PD9A 4ELOA 3EPEA 1JVXA 3H3GA 3H7MA 3UK4A 3PUWE 2UVJA 1B7UA 4LZ7A 2QMXA 3K4UA 5JK4A 1ZMGA 4YICA 3MVYA 4DXBA 3IJOB 5JTYA 2DWIA 4OEUA 4RK9A 2H25A 3VFJA 2QS2A 1B7ZA 3O6PA 4NF6B 2GRVA 4IO2A 3MVZA 1IZ1A 1B5HA 1II5A 1FQFA 2DVCA 3RTFB 1I6AA 1CE2A 5A5XA 1LFIA 3FJGA 1MQJA 1B0HA 1A40A 4F19A 3VLUA 3A3CA 1KWHA 5L9MA 4R9FA 2ONKE 4H8JA 4GXSB 4WKMA 4HS7A 4P0GA 1EU8A 2GFEA 1YPNA 3QK6A 2V3QA 4GRKA 3IB0A 3RGYA 5IKBA 2W7YA 3T96B 2XXQA 4F3GA 3BBRA 3USDA 5I2KA 3I5OA 2LAOA 1IITA 4JDFA 1B1XA 4OTEA 5AA2B 4KYEA 4YB7A 1UIVA 4KD5A 2F8DA 5DVJA 3MWBA 3IK6B 1H45A 5ICTA 3U94A 1JEUA 3IL1B 1UTHA 3MP6A 3M3KA 3KN7A 4TLLB 1IXHA 1BKAA 4ISUA 4H67A 3VVEA 1B7HA 3DELB 4LZ5A 5ITPA 1R9QA 1SW1A 3DRKA 3HPIA 3JV9A 5BWJA 4FECA 4ESWA 2HQ0A 3G3HA 2ESNA 3TCGA 2RCAA 3RQTA 2HZKA 4OVJA 3V89B 4I62A 4F2QA 2HZLA 2V93A 1ATGA 3PU5A 1JETA 1MQIA 1FTLA 2XX9A 3IJXB 1LAHE 1EZ9A 4KCCA 1LB8A 4R6HA 3DLNA 4F31B 3DM0A 1EZOA 4PFTA 2UVGA 3KOSA 3Q29A 1MXZA 1OLAA 3UA8A 3FZVA 1LBCA 3UORA 4QFLA 3QXMA 3OSRA 1S50A 2CMOA 4YAHX 5TP9B 1PB9A 4OESA 4LQ2A 4F39A 3TDJA 3TEPA 1N76A 1B52A 2B3FA 3OEKA 3PPOA 4R6KA 3OD7A 1B3GA 3CHGA 2Q9TA 1XHYA 5DEXA 3B6WA 1FCKA 4FE8A 4IO5A 4IB2A 4EQ9A 1SYHA 3C4MA 3OEMA 3FD3A 4I8CA 1XC1A 3SETA 3FV2A 1EH3A 2A5TA 2YLNA 3MP1A 4F1YA 5DTBA 2I4BA 1I6BA 3OO6A 4XKNA 4K3FA 1IXIA 1P1UA 3WAFA 1D9YA 1LAFE 2VD3A 3K00A 4C1UA 5M2VA 2I58A 2VP1A 1QVSA 1B51A 3S9NC 1QUIA 5H8QA 1B58A 3LR1A 3K1MA 5CC2A 3QSLA 1P1OA 2DS9A 1B32A 1P1QA 5BUUA 2DVZA 1DTZA 1NH7A 2D3IA 1MM7A 4GOTA 4DZ1A 2F36A 3GBBA 3KN3A 1NKXA 2OK2A 3K6WA 4RYAA 3CVGA 4X9TA 2XX8A 3SDFA 3TTRA 3U8QA 3C32A 3DRIA 2FYIA 3K01A 1MY2A 2DP8A 3F11A 3FTOA 3A3UA 2B4LA 4OEVA 1FTMA 3K1PA 4PFYA 2A5SA 3RTWB 3IB2A 3RPWA 1MQHA 2QSXA 5AA1A 3O29A 5AA2D 4EQ7A 3FIRA 4ZEBA 2Y7WA 3KGCA 3VDFA 2I0CA 1HSEA 3KBRA 2F7CA 1QJMA 3KEIA 5L8DA 1AL3A 4U2RA 1MS7A 3TQWA 4YKKA 3RY3A 4GIZA 2F6PA 1OVTA 3PUZE 3GXAA 4MBPA 3K6VA 3UGWA 1XS5A 4GD5A 1B40A 5AA3A 2O1LA 3UP9A 4KR5A 2DWHA 2WOKA 4NWCA 3CR9A 4RY1A 4R9GA 5H8HB 1VFEA 2O51A 1B2HA 3V5AA 1CB6A 3MVWA 2QL3A 1B0LA 1B1HA 3ODBA 3MZBA 3OXNA 4NF5A 3PUXE 3V83A 3H6VA 1XVXA 4RNSA 4QSEA 2XXTA 4ZDMA 2NWJA 5I59A 1FTKA 3OOAA 3FJMA 1FTOA 3U72A 1SD3A 1TT1A 4OFOA 3PPRA 4IO6A 2VGQA 1LFGA 2G93A 4JWXA 4EF2A 3FXQA 3IX1A 1LLSA 2F34A 2X7QA 1POY1 5TPAA 2V25A 4H5GA 5F1QA 4YU0A 2VD2A 3IB1A 3S9MC 2DSFA 1MDQA 4GWOA 4H65A 5IAIA 3HN0A 3TTKA 1LGBC 2NVUB 4GL8A 4ESXA 1M5EA 3UIFA 3MJNA 3IO6A 1DPEA 3CSBA 5JEIA 4MF3A 4R75A 5KDTB 1Y3QA 1YTVA 1QUKA 4F1VA 3H6UA 4NEDA 5I59B 1H43A 1A55A 4PETA 4XKRA 4XTCQ 3O9PA 2I49A 3U93A 3RNNA 5DT6A 2XXPA 1Z7NE 4OFLA 4P11A 4UA8A 4H6DA 5H8SA 4C1TA 3TODA 1OQGA 2PT1A 5I84A 3FVNA 3PD8A 3VXBA 1D4NA 1RKMA 1P1NA 4ELPA 1LCTA 3DRFA 3EF7A 4NF6A 2O1MA 3SESA 1B3HA 1VR5A 2ZYMA 2B65A 1BTJA 4F29A 3IOVA 2ZYKA 3OMBA 5DVIA 4BDNA 4LVQA 3TCFA 4IO7A 2ZNUA 3HCQA 3MZ9A 3N6UA 4U21A 1MDP1 1JQFA 3K6XA 2HXWA 2BJJX 2KLFA 3IO4A 1MY0A 1LAGE 3FATA 4TLMB 5B7DA 5L9OA 4JBZA 1FW0A 1OQHA 5AA2A 3FGSA 4FORA 1R9LA 1NL5A 3SEYA 4JSOA 3S9EA 1GTKA 1T0KA 4FAJA 2Y7PA 5FTIA 3UN6A 1BLFA 4XKPA 1Q1KA 3BFTA 4ZS9A 2RC7A 3QUJA 1JEVA 3BKIB 2GHAA 1MXWA 4FIMA 5I57B 2XD2A 3KSXA 1B3LA 4DE8A 4F1UA 3LSFB 3VE1B 3ZKKA 1TWYA 4UACA 1LSTA 4GF8A 1NNPA 3VV5A 4HW8A 4H5FA 3IOTA 4JWOA 1UTBB 3RLFE 1SQYA 4O3AA 1M5DA 2FNCA 2PVUA 4KYSA 3QAXA 3KFMA 4PFUA 1I69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y84 A;  3CIJ A;  2HAV A;  3HST A;  4OYV A;  5TP9 A;  1HSJ A;  3EHS A;  3MQ9 A;  2O7I A;  4I9D A;  3MPK A;  3C35 A;  2E0S A;  2ALU A;  2G29 A;  2DYX A;  1LFH A;  4JSD A;  5K2Y A;  4F3B A;  5ELV A;  2VHA A;  4L17 A;  1MY3 A;  4X48 A;  3TMG A;  3JYR A;  3N94 A;  2RIN A;  1USY H;  4NMY A;  2P0S A;  4IGT A;  4X1D A;  2F5X A;  4LUB A;  5FTH A;  3W9V A;  1MXX A;  3ECR A;  1SI1 A;  3SEV A;  5DYH A;  3GLB A;  4EUO A;  4GXA A;  4NTL A;  1NNK A;  4MLV A;  5EHS A;  2Z8E A;  1N7X A;  3PUV E;  2AYS A;  1Y9U A;  2X7P A;  4U1Z A;  3I6V A;  2OJT A;  1FQA A;  2M8C A;  3ILU B;  5ITO A;  4U1O A;  4QF9 A;  2F78 A;  3OO7 A;  4RPN A;  1VSO A;  1MH3 A;  2F35 A;  3TFL A;  2XD3 A;  5AA4 B;  4R2B A;  1F9B A;  1EZP A;  2QS1 A;  2AL4 A;  5ICQ A;  1SDX A;  4X1B A;  1L5T A;  4G68 B;  3G3G A;  1Y1M A;  2V84 A;  3SEU A;  1WVJ A;  3DP4 A;  2ABH A;  5I56 B;  4TQU Q;  4N6P A;  1Y3N A;  2ONS A;  4P0I A;  4YKP A;  5CMC A;  2H98 A;  4BDQ A;  4EDP A;  2XX7 A;  4IO3 A;  3FVG A;  2Q2A A;  3T9H B;  5CBS A;  3RYB A;  2UYF A;  3C36 A;  3B7D A;  4LQ5 A;  4YKI A;  4OHN A;  1TXF A;  3HHG A;  3PPQ A;  5KCJ B;  4DXU A;  1B5J A;  3N5L A;  4AB5 A;  3PV0 E;  1B6H A;  1UIU A;  2Q8J A;  5L9S A;  4RA1 A;  3TTN A;  5HPQ A;  2D21 A;  3W15 C;  1QKB A;  2IA4 A;  3OEL A;  2VOZ A;  4KPT A;  2F7B A;  4OQO A;  3RN8 A;  2XXX A;  1AIV A;  5F7V A;  1M5F A;  5H8H A;  2Z22 A;  2X26 A;  3K02 A;  3TKD A;  3CG3 A;  4GQO A;  4R74 A;  4WXJ A;  2PT2 A;  4ZEC A;  2NXO A;  3ZS6 A;  4Q30 B;  2AL5 A;  3TEL A;  4U23 A;  4DXC A;  1PB8 A;  4JXI A;  1H76 A;  4G8N A;  3DRJ A;  3CRB A;  1MG1 A;  3DRG A;  3ONM A;  4KI0 E;  2YJP A;  1R6Z A;  3K0V A;  3EQ1 A;  1SW4 A;  2THI A;  1WDN A;  3DP6 A;  1AH5 A;  3EHT A;  3PMV A;  1RYO A;  2QS4 A;  1FQC A;  4OER A;  1H44 A;  2I3W A;  1MY4 A;  3MAM A;  2OZZ A;  3T9U A;  2I6E A;  3C31 A;  2ZNS A;  4KFQ A;  2OWT A;  4BLA A;  3PAM A;  1N04 A;  4ONY A;  4XIG Q;  1PBP A;  3VVF A;  1IIW A;  4O3C A;  3LVU A;  4U22 A;  5KDT A;  1LAX A;  4MFI A;  1IUD A;  2B3B A;  2HEU A;  3M3L A;  3Q25 A;  1MPD A;  4RPO A;  3MZ1 A;  3TUS A;  4HCW A;  5CMM A;  1NNT A;  4R6Y A;  2PYY A;  3QIM A;  4MLQ A;  4EQB A;  4NWD A;  4G8M A;  2ANJ A;  3LSX A;  1OMP A;  4OFJ A;  4FED A;  3TTM A;  3OO9 A;  3M3F A;  3MUQ A;  3H03 A;  3IAZ A;  1MPC A;  5ISU A;  2ZNT A;  4ZEI A;  1N3W A;  2PMS A;  3H6W A;  2XXU A;  5DVF A;  1JW1 A;  4GL0 A;  3G3K A;  3RYA A;  1DSN A;  1ZTY A;  2H5Y A;  2RC9 A;  3C33 A;  3D4C A;  4NF8 B;  2NUV A;  1MXV A;  3W9W A;  2Z23 A;  3TPA A;  2Z8D A;  4ZZA A;  3QYT A;  1IXG A;  1DOT A;  2H99 A;  3KZG A;  3CI8 A;  5FHN A;  2QRY A;  5H8N B;  2Y7R A;  1A7L A;  1AMF A;  3GBA A;  4IO4 A;  2XXH A;  3KSJ A;  1QKA A;  3TAJ A;  4IY5 A;  4ECF A;  5EHM A;  4M1V A;  4C0R A;  2FA7 A;  4DLD A;  1SYI A;  4LAT A;  1ZU0 A;  3LBS A;  1Z7M E;  2QPQ A;  3O6H A;  3SKP A;  4YMA A;  3PUY E;  2ZMB A;  3SEW A;  1HSL A;  1DTG A;  2I48 A;  5TU0 A;  3FJ7 A;  4NE4 A;  3HV1 A;  4U4S A;  3Q27 A;  5I2N B;  4QFN A;  5I58 B;  3V8X B;  1SBP A;  1MRP A;  5I57 A;  4THI A;  1JVY A;  2Y7I A;  2DE2 A;  4QRZ A;  5FHO A;  2I0B A;  2HAU A;  4LON B;  1URD A;  4RJZ A;  1MQD A;  2H9B A;  3KOT A;  4KQP A;  3MPL A;  2DWJ A;  1N0T A;  4AQ4 A;  2D5W A;  1UTB A;  2R71 A;  4QSC A;  2I3V A;  4Q8R A;  1N3X A;  1N84 A;  3G3I A;  3FUZ A;  3C34 A;  3S4U A;  4WEP A;  2DWA A;  1MQG A;  4ELR A;  3AXF A;  1MXY A;  3G3F A;  4NF4 B;  2RKM A;  4WED A;  2QJE A;  5CRY A;  3L6G A;  2Z8F A;  3FAS A;  1Y4C A;  2CZL A;  2V3U A;  3KG2 A;  4OZ9 A;  1GGG A;  1B4H A;  1FQD A;  2XXR A;  1POT A;  4Z7E A;  4PFW A;  3MBP A;  3O66 A;  4H1X A;  2DQV A;  1VFD A;  4G2Z A;  3TTL A;  2DE3 A;  2NOO A;  2ONR A;  3K2D A;  3RUM A;  3JZJ A;  1B9J A;  3IOR A;  1H3D A;  2OBG A;  4Q0C A;  4RXL A;  3I3V A;  3VLV A;  2O84 X;  3FVK A;  3ILT B;  2F6G A;  2Y7K A;  1RYX A;  2AIX A;  5B70 A;  1B3F A;  4YKJ A;  2IEE A;  3O6I A;  4OEN A;  4ZE8 A;  5HM4 B;  1USY E;  1O7T A;  5EYF A;  3P7I A;  5JTY B;  1B4Z A;  1PC3 A;  1NNF A;  2ZYN A;  1XOC A;  2DXR A;  2DXY A;  1UQW A;  1QUJ A;  4ZED A;  1P1W A;  4O3B A;  3H4Z A;  4XKQ A;  4HTG A;  4YB6 A;  2P2A A;  3H06 B;  5AA4 A;  1B05 A;  1Y1Z A;  5LOM A;  3VLW A;  3RT6 B;  5A5X B;  2UYE A;  2REG A;  3H6T A;  3IOW A;  3KN8 A;  3OSQ A;  2REJ A;  2UVH A;  4G68 A;  3N6T A;  4N13 A;  1OVB A;  4QHQ A;  3T9X B;  5I56 A;  2O7U A;  3O6G A;  1XT8 A;  5KZT A;  1O63 A;  4XXU A;  3Q26 A;  3MC2 A;  2RCB A;  4YZZ A;  3DRH A;  3CFL A;  3CSG A;  5CM6 A;  5I2K B;  3E4R A;  1VE4 A;  1Y4T A;  1US4 A;  4F3S A;  3TZA A;  1O64 A;  5KCJ A;  1IXC A;  1MY1 A;  1R1N A;  1DMB A;  1ZKB A;  4LP2 B;  2O69 A;  1UTH B;  2DE4 A;  4GVO A;  1BIY A;  4E0X A;  1TFD A;  3K6U A;  3U1O A;  3LSL A;  3E13 X;  1LCF A;  4FEB A;  4G68 C;  2XXI A;  1Q35 A;  1PB7 A;  3SEX A;  3EHU A;  1US5 A;  4EXK A;  2P1S A;  3VXC A;  2PX1 A;  1FQE A;  4G77 A;  4Q5T A;  2HFB A;  4M4G A;  5HBC A;  4KYD A;  3N26 A;  3FVO A;  3PPN A;  3R26 A;  4N07 A;  3S2V A;  4AB6 A;  1FTJ A;  3BFU A;  2OCU A;  4DCY A;  4FJP A;  1A8F A;  1IQ7 A;  3D4G A;  3PMX A;  4LZ8 A;  3OEN A;  3B6T A;  1PDA A;  1MM6 A;  2WOP A;  1ZIU A;  4R72 A;  2XXY A;  3LUY A;  3THI A;  3G7W A;  1A54 A;  1YCJ A;  4R73 A;  3KJ7 A;  1ZLQ A;  1SI0 A;  4ZEF A;  4KCD A;  1M5C A;  2E1S A;  4U4X A;  4TOZ A;  3CG1 A;  3EN3 A;  3L6H A;  1D3K A;  3SER A;  1P99 A;  1MH4 A;  1WOD A;  5DEX B;  4BDM A;  4F22 A;  3R6U A;  3ZSF A;  3IOU A;  1A99 A;  4IY6 A;  4PP0 A;  4F18 A;  1NMU A;  4E0W A;  4OXV A;  2A5T B;  1B3E A;  1LBB A;  4RK2 A;  5AE4 A;  2ZXT A;  5K2X A;  3GZG A;  3HO7 A;  4F2O A;  4ZEK A;  2UXA A;  3ZKL A;  4G8H A;  3S9L C;  3FXU A;  1MXU A;  3TCH A;  2PBW A;  1SW2 A;  1TFA A;  5H8Q B;  5CI5 A;  2Q88 A;  3T9V A;  1A8E A;  2RF1 A;  2QS3 A;  4BDR A;  2XXW A;  4Z0I A;  1Y3P A;  3HHF A;  3IR1 A;  4FAT A;  4NF8 A;  3PPP A;  1S9T A;  3LC8 A;  4H8I A;  3TYH A;  4PQJ A;  1SW5 A;  4POW A;  1ELJ A;  1Y20 A;  5H8N A;  1D9V A;  4YMB A;  1SVX B;  4HCY A;  1PEB A;  4QFK A;  4MH5 A;  4ZZE A;  2V3T A;  3G3J A;  1NFT A;  4PE5 B;  3CFZ A;  3T66 A;  4POX A;  1FQB A;  3TQL A;  4QFP A;  1M5B A;  4EXL A;  4GFR A;  4ND9 A;  1XVY A;  1GR2 A;  4OWD A;  3OO8 A;  1J1N A;  3PMW A;  1ZBM A;  1URG A;  3RT8 A;  2WOL A;  3VVD A;  4JB7 A;  1DPP A;  1B46 A;  3E9X A;  2UVI A;  4LA9 A;  1B5I A;  5I2N A;  5I58 A;  4GLI A;  4BDL A;  4JWY A;  2R6G E;  4ELQ A;  1AOV A;  2Q2C A;  2F7A A;  2XHD A;  1QW0 A;  3B6Q A;  2YPN A;  4BDO A;  2R9J A;  4DCX A;  2WKY A;  4OMB A;  1JW4 A;  1QUL A;  1GV8 A;  4NF5 B;  3T93 B;  5H8F A;  4YB5 A;  2QMW A;  3O2A A;  3FXR A;  2Q89 A;  2ZYO A;  3T22 A;  2B4M A;  3MP8 A;  2RC8 A;  1N7W A;  2HCA A;  5FHM A;  1NH8 A;  5J1D A;  2I4C A;  3O28 A;  3PGF A;  4OET A;  4DIG A;  3WAE A;  4QFO A;  3M8U A;  3KJT A;  3A09 A;  1MPB A;  4I1D A;  2GH9 A;  3U92 A;  3O97 A;  4NF4 A;  3R7X A;  1JNF A;  4EF1 A;  5TPA B;  4QSD A;  5CMK A;  2F97 A;  1ANF A;  2O68 A;  1S7Y A;  3LSW A;  2OLB A;  1I6Q A;  5CMB A;  1YAE A;  4IGR A;  2XXV A;  4F3P A;  1LB9 A;  1PBQ A;  1ZJL A;  4G4P A;  4R2F A;  2GHB A;  1GVC A;  3DP8 A;  2DOJ A;  3K1N A;  5CBR A;  1IEJ A;  2H4I A;  3E3K A;  4ZE9 A;  3MVX A;  3MW0 A;  4KHZ E;  3CFX A;  5H8F B;  3QUF A;  2OWS A;  1OLC A;  1URS A;  3Q28 A;  3FV1 A;  2O6A A;  4DDD A;  1OIB A;  1BP5 A;  4H0W A;  3C9H A;  1JW5 A;  3PD9 A;  4ELO A;  3EPE A;  1JVX A;  3H3G A;  3H7M A;  3UK4 A;  3PUW E;  2UVJ A;  1B7U A;  4LZ7 A;  2QMX A;  3K4U A;  5JK4 A;  1ZMG A;  4YIC A;  3MVY A;  4DXB A;  3IJO B;  5JTY A;  2DWI A;  4OEU A;  4RK9 A;  2H25 A;  3VFJ A;  2QS2 A;  1B7Z A;  3O6P A;  4NF6 B;  2GRV A;  4IO2 A;  3MVZ A;  1IZ1 A;  1B5H A;  1II5 A;  1FQF A;  2DVC A;  3RTF B;  1I6A A;  1CE2 A;  5A5X A;  1LFI A;  3FJG A;  1MQJ A;  1B0H A;  1A40 A;  4F19 A;  3VLU A;  3A3C A;  1KWH A;  5L9M A;  4R9F A;  2ONK E;  4H8J A;  4GXS B;  4WKM A;  4HS7 A;  4P0G A;  1EU8 A;  2GFE A;  1YPN A;  3QK6 A;  2V3Q A;  4GRK A;  3IB0 A;  3RGY A;  5IKB A;  2W7Y A;  3T96 B;  2XXQ A;  4F3G A;  3BBR A;  3USD A;  5I2K A;  3I5O A;  2LAO A;  1IIT A;  4JDF A;  1B1X A;  4OTE A;  5AA2 B;  4KYE A;  4YB7 A;  1UIV A;  4KD5 A;  2F8D A;  5DVJ A;  3MWB A;  3IK6 B;  1H45 A;  5ICT A;  3U94 A;  1JEU A;  3IL1 B;  1UTH A;  3MP6 A;  3M3K A;  3KN7 A;  4TLL B;  1IXH A;  1BKA A;  4ISU A;  4H67 A;  3VVE A;  1B7H A;  3DEL B;  4LZ5 A;  5ITP A;  1R9Q A;  1SW1 A;  3DRK A;  3HPI A;  3JV9 A;  5BWJ A;  4FEC A;  4ESW A;  2HQ0 A;  3G3H A;  2ESN A;  3TCG A;  2RCA A;  3RQT A;  2HZK A;  4OVJ A;  3V89 B;  4I62 A;  4F2Q A;  2HZL A;  2V93 A;  1ATG A;  3PU5 A;  1JET A;  1MQI A;  1FTL A;  2XX9 A;  3IJX B;  1LAH E;  1EZ9 A;  4KCC A;  1LB8 A;  4R6H A;  3DLN A;  4F31 B;  3DM0 A;  1EZO A;  4PFT A;  2UVG A;  3KOS A;  3Q29 A;  1MXZ A;  1OLA A;  3UA8 A;  3FZV A;  1LBC A;  3UOR A;  4QFL A;  3QXM A;  3OSR A;  1S50 A;  2CMO A;  4YAH X;  5TP9 B;  1PB9 A;  4OES A;  4LQ2 A;  4F39 A;  3TDJ A;  3TEP A;  1N76 A;  1B52 A;  2B3F A;  3OEK A;  3PPO A;  4R6K A;  3OD7 A;  1B3G A;  3CHG A;  2Q9T A;  1XHY A;  5DEX A;  3B6W A;  1FCK A;  4FE8 A;  4IO5 A;  4IB2 A;  4EQ9 A;  1SYH A;  3C4M A;  3OEM A;  3FD3 A;  4I8C A;  1XC1 A;  3SET A;  3FV2 A;  1EH3 A;  2A5T A;  2YLN A;  3MP1 A;  4F1Y A;  5DTB A;  2I4B A;  1I6B A;  3OO6 A;  4XKN A;  4K3F A;  1IXI A;  1P1U A;  3WAF A;  1D9Y A;  1LAF E;  2VD3 A;  3K00 A;  4C1U A;  5M2V A;  2I58 A;  2VP1 A;  1QVS A;  1B51 A;  3S9N C;  1QUI A;  5H8Q A;  1B58 A;  3LR1 A;  3K1M A;  5CC2 A;  3QSL A;  1P1O A;  2DS9 A;  1B32 A;  1P1Q A;  5BUU A;  2DVZ A;  1DTZ A;  1NH7 A;  2D3I A;  1MM7 A;  4GOT A;  4DZ1 A;  2F36 A;  3GBB A;  3KN3 A;  1NKX A;  2OK2 A;  3K6W A;  4RYA A;  3CVG A;  4X9T A;  2XX8 A;  3SDF A;  3TTR A;  3U8Q A;  3C32 A;  3DRI A;  2FYI A;  3K01 A;  1MY2 A;  2DP8 A;  3F11 A;  3FTO A;  3A3U A;  2B4L A;  4OEV A;  1FTM A;  3K1P A;  4PFY A;  2A5S A;  3RTW B;  3IB2 A;  3RPW A;  1MQH A;  2QSX A;  5AA1 A;  3O29 A;  5AA2 D;  4EQ7 A;  3FIR A;  4ZEB A;  2Y7W A;  3KGC A;  3VDF A;  2I0C A;  1HSE A;  3KBR A;  2F7C A;  1QJM A;  3KEI A;  5L8D A;  1AL3 A;  4U2R A;  1MS7 A;  3TQW A;  4YKK A;  3RY3 A;  4GIZ A;  2F6P A;  1OVT A;  3PUZ E;  3GXA A;  4MBP A;  3K6V A;  3UGW A;  1XS5 A;  4GD5 A;  1B40 A;  5AA3 A;  2O1L A;  3UP9 A;  4KR5 A;  2DWH A;  2WOK A;  4NWC A;  3CR9 A;  4RY1 A;  4R9G A;  5H8H B;  1VFE A;  2O51 A;  1B2H A;  3V5A A;  1CB6 A;  3MVW A;  2QL3 A;  1B0L A;  1B1H A;  3ODB A;  3MZB A;  3OXN A;  4NF5 A;  3PUX E;  3V83 A;  3H6V A;  1XVX A;  4RNS A;  4QSE A;  2XXT A;  4ZDM A;  2NWJ A;  5I59 A;  1FTK A;  3OOA A;  3FJM A;  1FTO A;  3U72 A;  1SD3 A;  1TT1 A;  4OFO A;  3PPR A;  4IO6 A;  2VGQ A;  1LFG A;  2G93 A;  4JWX A;  4EF2 A;  3FXQ A;  3IX1 A;  1LLS A;  2F34 A;  2X7Q A;  1POY 1;  5TPA A;  2V25 A;  4H5G A;  5F1Q A;  4YU0 A;  2VD2 A;  3IB1 A;  3S9M C;  2DSF A;  1MDQ A;  4GWO A;  4H65 A;  5IAI A;  3HN0 A;  3TTK A;  1LGB C;  2NVU B;  4GL8 A;  4ESX A;  1M5E A;  3UIF A;  3MJN A;  3IO6 A;  1DPE A;  3CSB A;  5JEI A;  4MF3 A;  4R75 A;  5KDT B;  1Y3Q A;  1YTV A;  1QUK A;  4F1V A;  3H6U A;  4NED A;  5I59 B;  1H43 A;  1A55 A;  4PET A;  4XKR A;  4XTC Q;  3O9P A;  2I49 A;  3U93 A;  3RNN A;  5DT6 A;  2XXP A;  1Z7N E;  4OFL A;  4P11 A;  4UA8 A;  4H6D A;  5H8S A;  4C1T A;  3TOD A;  1OQG A;  2PT1 A;  5I84 A;  3FVN A;  3PD8 A;  3VXB A;  1D4N A;  1RKM A;  1P1N A;  4ELP A;  1LCT A;  3DRF A;  3EF7 A;  4NF6 A;  2O1M A;  3SES A;  1B3H A;  1VR5 A;  2ZYM A;  2B65 A;  1BTJ A;  4F29 A;  3IOV A;  2ZYK A;  3OMB A;  5DVI A;  4BDN A;  4LVQ A;  3TCF A;  4IO7 A;  2ZNU A;  3HCQ A;  3MZ9 A;  3N6U A;  4U21 A;  1MDP 1;  1JQF A;  3K6X A;  2HXW A;  2BJJ X;  2KLF A;  3IO4 A;  1MY0 A;  1LAG E;  3FAT A;  4TLM B;  5B7D A;  5L9O A;  4JBZ A;  1FW0 A;  1OQH A;  5AA2 A;  3FGS A;  4FOR A;  1R9L A;  1NL5 A;  3SEY A;  4JSO A;  3S9E A;  1GTK A;  1T0K A;  4FAJ A;  2Y7P A;  5FTI A;  3UN6 A;  1BLF A;  4XKP A;  1Q1K A;  3BFT A;  4ZS9 A;  2RC7 A;  3QUJ A;  1JEV A;  3BKI B;  2GHA A;  1MXW A;  4FIM A;  5I57 B;  2XD2 A;  3KSX A;  1B3L A;  4DE8 A;  4F1U A;  3LSF B;  3VE1 B;  3ZKK A;  1TWY A;  4UAC A;  1LST A;  4GF8 A;  1NNP A;  3VV5 A;  4HW8 A;  4H5F A;  3IOT A;  4JWO A;  1UTB B;  3RLF E;  1SQY A;  4O3A A;  1M5D A;  2FNC A;  2PVU A;  4KYS A;  3QAX A;  3KFM A;  4PFU A;  1I69 A; 
#chains in the Genus database with same CATH topology
 1KA0 A;  2Y84 A;  3CIJ A;  2WBB A;  2HAV A;  3HST A;  4OYV A;  4GWX A;  5I3S A;  5TP9 A;  3FBP A;  1HSJ A;  3EHS A;  1LBY A;  3MQ9 A;  2O7I A;  4I9D A;  3MPK A;  1CNQ A;  3C35 A;  2E0S A;  2ALU A;  2G29 A;  2DYX A;  1LFH A;  4JSD A;  1FPI A;  5K2Y A;  4F3B A;  5ELV A;  3B8B A;  2VHA A;  4L17 A;  1MY3 A;  4X48 A;  3TMG A;  3JYR A;  3N94 A;  2RIN A;  1USY H;  4NMY A;  2P0S A;  4IGT A;  4X1D A;  2F5X A;  4LUB A;  5FTH A;  3W9V A;  1MXX A;  3ECR A;  1SI1 A;  3SEV A;  1NV2 A;  5DYH A;  3GLB A;  1LBW A;  4EUO A;  4GXA A;  4NTL A;  1NNK A;  4MLV A;  5EHS A;  2Z8E A;  5ET6 A;  3NOH A;  4O8M A;  1N7X A;  3PUV E;  2AYS A;  1Y9U A;  2X7P A;  4U1Z A;  3I6V A;  2OJT A;  1FQA A;  2M8C A;  4NN3 A;  3ILU B;  4JVD A;  5ITO A;  4U1O A;  4QF9 A;  2F78 A;  3OO7 A;  4RPN A;  1VSO A;  1MH3 A;  2F35 A;  3TFL A;  2XD3 A;  5AA4 B;  4R2B A;  1F9B A;  1EZP A;  2QS1 A;  2AL4 A;  5ICQ A;  1SDX A;  4X1B A;  1L5T A;  4G68 B;  3G3G A;  1Y1M A;  2V84 A;  3SEU A;  1WVJ A;  3DP4 A;  2ABH A;  5I56 B;  4TQU Q;  4N6P A;  1Y3N A;  2ONS A;  4P0I A;  4YKP A;  5CMC A;  3E79 A;  2HPG A;  2H98 A;  4BDQ A;  4EDP A;  2XX7 A;  4IO3 A;  3FVG A;  3EKI A;  2Q2A A;  3T9H B;  2L5V A;  5CBS A;  3RYB A;  2UYF A;  3C36 A;  3B7D A;  4LQ5 A;  4YKI A;  2JJK A;  4OHN A;  1TXF A;  3HHG A;  3PPQ A;  5KCJ B;  4DXU A;  1B5J A;  3N5L A;  4AB5 A;  1IME A;  3PV0 E;  1B6H A;  1UIU A;  2Q8J A;  5L9S A;  4RA1 A;  3TTN A;  5HPQ A;  2D21 A;  3W15 C;  1QKB A;  2XWV A;  2IA4 A;  3OEL A;  2VOZ A;  4KPT A;  4OVP A;  2XWO A;  3KC0 A;  2F7B A;  4OQO A;  3RN8 A;  2XXX A;  1AIV A;  5F7V A;  1M5F A;  5H8H A;  4PF6 A;  2Z22 A;  2X26 A;  3K02 A;  3TKD A;  5DW8 A;  3CG3 A;  4GQO A;  4R74 A;  4WXJ A;  2PT2 A;  4ZEC A;  2NXO A;  2HXR A;  3ZS6 A;  4Q30 B;  2AL5 A;  3TEL A;  4U23 A;  4DXC A;  1PB8 A;  4PGN A;  4JXI A;  1H76 A;  4G8N A;  3DRJ A;  3CRB A;  1MG1 A;  1FJ6 A;  3DRG A;  3ONM A;  5J16 A;  4KI0 E;  2YJP A;  1R6Z A;  3K0V A;  3EQ1 A;  1SW4 A;  2THI A;  3RYD A;  2QFL A;  1DBZ A;  1WDN A;  3DP6 A;  1AH5 A;  2KQZ A;  3EHT A;  1LBV A;  4GBV A;  3PMV A;  1RYO A;  2QS4 A;  1FQC A;  5LTC A;  4OER A;  1H44 A;  2I3W A;  1MY4 A;  3MAM A;  3PTY A;  2OZZ A;  3T9U A;  2I6E A;  3C31 A;  2ZNS A;  1FTA A;  4KFQ A;  2OWT A;  4BLA A;  3PAM A;  1N04 A;  4X8R A;  4ONY A;  4XIG Q;  1PBP A;  3VVF A;  1IIW A;  4O3C A;  3LVU A;  4U22 A;  5KDT A;  1LAX A;  4MFI A;  1IUD A;  1NV0 A;  2B3B A;  2HEU A;  3M3L A;  3Q25 A;  1MPD A;  4JVI A;  4MEV A;  4RPO A;  2VPO A;  3MZ1 A;  3TUS A;  4HCW A;  5CMM A;  2Y5L A;  1NNT A;  4MCO A;  4R6Y A;  2PYY A;  3QIM A;  4MLQ A;  4EQB A;  4NWD A;  4G8M A;  2ANJ A;  4XFE A;  3LSX A;  1OMP A;  1SPI A;  4OFJ A;  4FED A;  3TTM A;  3OO9 A;  3M3F A;  3MUQ A;  3H03 A;  3IAZ A;  1MPC A;  1D9Q A;  5ISU A;  2ZNT A;  4ZEI A;  1N3W A;  4I40 A;  2PMS A;  3BIH A;  4H45 A;  3H6W A;  4O7I A;  2XXU A;  5DVF A;  1JW1 A;  4GL0 A;  3QMF A;  3G3K A;  3RYA A;  4N8Y A;  1DSN A;  4UAB A;  1ZTY A;  2H5Y A;  2RC9 A;  3C33 A;  4O7M A;  4P3L A;  3D4C A;  4NF8 B;  2NUV A;  1MXV A;  3W9W A;  2Z23 A;  3TPA A;  2Z8D A;  4ZZA A;  3QYT A;  1IXG A;  1DOT A;  2H99 A;  1LEV A;  3KZG A;  3CI8 A;  5FHN A;  2QRY A;  5H8N B;  2Y7R A;  4JVC A;  1A7L A;  1AMF A;  1QGX A;  4H46 A;  3GBA A;  4IO4 A;  1YZ0 A;  2XXH A;  3KSJ A;  1QKA A;  3TAJ A;  4IY5 A;  4ECF A;  1FBG A;  5EHM A;  2F3B A;  4NGU A;  4M1V A;  4C0R A;  2XA5 A;  2FA7 A;  4DLD A;  1SYI A;  4PGP A;  5I7I A;  4MX6 A;  4LAT A;  1ZU0 A;  3LBS A;  5IM2 A;  1Z7M E;  2QPQ A;  3O6H A;  3SKP A;  4YMA A;  3PUY E;  2ZMB A;  3SEW A;  1HSL A;  1DTG A;  1YYZ A;  2I48 A;  5TU0 A;  3FJ7 A;  4NE4 A;  3HV1 A;  4U4S A;  3Q27 A;  5I2N B;  4QFN A;  5I58 B;  3V8X B;  1SBP A;  1MRP A;  5I57 A;  4THI A;  1JVY A;  2Y7I A;  4P47 A;  1NV5 A;  2DE2 A;  4QRZ A;  5FHO A;  2I0B A;  2HAU A;  1G0H A;  4LON B;  1URD A;  1DCU A;  4RJZ A;  4P8B A;  1MQD A;  2H9B A;  3KOT A;  4NHB A;  4KQP A;  3MPL A;  2DWJ A;  1N0T A;  4AQ4 A;  2D5W A;  1UTB A;  2R71 A;  4QSC A;  3RPL A;  2I3V A;  4Q8R A;  1N3X A;  1N84 A;  3G3I A;  3FUZ A;  3C34 A;  3S4U A;  4N15 A;  1G0I A;  4WEP A;  2DWA A;  1MQG A;  4MIJ A;  4ELR A;  3AXF A;  1MXY A;  3G3F A;  4NF4 B;  2RKM A;  4WED A;  2QJE A;  5CRY A;  3L6G A;  2Z8F A;  3FAS A;  4I3Y A;  1Y4C A;  2CZL A;  2V3U A;  3KG2 A;  4OZ9 A;  1GGG A;  5F24 A;  4OAN A;  1B4H A;  4OA4 A;  1FQD A;  2XXR A;  1FSA A;  1POT A;  4Z7E A;  4PFW A;  3MBP A;  3O66 A;  4H1X A;  2DQV A;  1VFD A;  4G2Z A;  3TTL A;  2DE3 A;  4NG7 A;  1KA1 A;  2NOO A;  1VDW A;  2ONR A;  3K2D A;  3RUM A;  3JZJ A;  1B9J A;  3IOR A;  1H3D A;  2OBG A;  4Q0C A;  4RXL A;  3I3V A;  3VLV A;  2O84 X;  1FBD A;  4OVT A;  3FVK A;  3ILT B;  2F6G A;  4MJO A;  2Y7K A;  1RYX A;  1IMB A;  2AIX A;  5IZ1 A;  5B70 A;  4MNI A;  1B3F A;  4YKJ A;  2IEE A;  3O6I A;  4OEN A;  4ZE8 A;  5HM4 B;  1USY E;  1O7T A;  5EYF A;  3P7I A;  5JTY B;  1B4Z A;  2ZZW A;  1PC3 A;  5EQA A;  1NNF A;  2ZYN A;  1XOC A;  4GX3 A;  2DXR A;  2DXY A;  1UQW A;  3D1R A;  1QUJ A;  4ZED A;  1P1W A;  3KBZ A;  4O3B A;  3H4Z A;  4XKQ A;  4HTG A;  4YB6 A;  2P2A A;  3H06 B;  4GX6 A;  5AA4 A;  1B05 A;  1Y1Z A;  5LOM A;  3U65 A;  3VLW A;  3RT6 B;  5A5X B;  2UYE A;  4OVQ A;  2REG A;  2CZI A;  3H6T A;  3IOW A;  3KN8 A;  3OSQ A;  3FXB A;  2REJ A;  2UVH A;  1NV3 A;  3N6T A;  4G68 A;  4HE0 A;  4N13 A;  1OVB A;  4QHQ A;  3T9X B;  5I56 A;  2O7U A;  3O6G A;  1XT8 A;  5KZT A;  1O63 A;  4XXU A;  3Q26 A;  1FPG A;  3MC2 A;  2RCB A;  4YZZ A;  3DRH A;  3CFL A;  3CSG A;  2XWK A;  5CM6 A;  5I2K B;  3E4R A;  1VE4 A;  1Y4T A;  2PFY A;  3LV0 A;  1US4 A;  4F3S A;  3TZA A;  1O64 A;  5KCJ A;  1IXC A;  1MY1 A;  1R1N A;  1DMB A;  1ZKB A;  4LP2 B;  2O69 A;  2R8T A;  2VPN A;  1UTH B;  2DE4 A;  4GVO A;  4HE2 A;  1BIY A;  4QXD A;  4E0X A;  1TFD A;  3K6U A;  3U1O A;  3LSL A;  1JP4 A;  3E13 X;  1LCF A;  4FEB A;  5ET8 A;  4G68 C;  2XXI A;  1Q35 A;  4PAF A;  1PB7 A;  3SEX A;  3EHU A;  1US5 A;  4EXK A;  3IFA A;  2P1S A;  3VXC A;  2PX1 A;  1FQE A;  4G77 A;  4Q5T A;  2HFB A;  2ZZX A;  3E78 A;  4M4G A;  5HBC A;  4KYD A;  3N26 A;  3FVO A;  3PPN A;  3R26 A;  4N07 A;  3S2V A;  1FJ9 A;  4AB6 A;  1FTJ A;  3BFU A;  2PCR A;  2OCU A;  4DCY A;  4FJP A;  1A8F A;  1IQ7 A;  3D4G A;  3PMX A;  4LZ8 A;  3OEN A;  3B6T A;  1PDA A;  1MM6 A;  2WOP A;  1ZIU A;  5ESY A;  4GX4 A;  4R72 A;  2XXY A;  3LUY A;  3THI A;  3G7W A;  1A54 A;  1YCJ A;  4R73 A;  3KJ7 A;  1ZLQ A;  1SI0 A;  4ZEF A;  4KCD A;  1M5C A;  2E1S A;  4U4X A;  4PTK A;  2QVU A;  4TOZ A;  3SZP A;  3CG1 A;  3EN3 A;  3L6H A;  1D3K A;  4HXV A;  4NAP A;  3SER A;  1P99 A;  1MH4 A;  3IFC A;  1WOD A;  5DEX B;  4BDM A;  4F22 A;  3R6U A;  3ZSF A;  3IOU A;  1A99 A;  4IY6 A;  4PP0 A;  4PFB A;  4F18 A;  1NMU A;  4E0W A;  4OXV A;  2A5T B;  1B3E A;  1LBB A;  4RK2 A;  5AE4 A;  2ZXT A;  4N81 A;  5K2X A;  3GZG A;  2F3D A;  2QVR A;  3HO7 A;  2FIX A;  4F2O A;  4ZEK A;  2UXA A;  4P9K A;  4G8H A;  3ZKL A;  3S9L C;  3FXU A;  1MXU A;  3TCH A;  2PBW A;  1SW2 A;  2XXK A;  1TFA A;  5H8Q B;  5CI5 A;  1RDY A;  2Q88 A;  3T9V A;  2MKZ A;  1A8E A;  2RF1 A;  2QS3 A;  4BDR A;  2XXW A;  5EQ9 A;  4Z0I A;  1Y3P A;  3HHF A;  3IR1 A;  4MAG A;  4X04 A;  4P1L A;  4FAT A;  4NF8 A;  4PF8 A;  3PPP A;  1AWB A;  1S9T A;  3LC8 A;  4H8I A;  3TYH A;  4PQJ A;  1NI9 A;  2CEX A;  1SW5 A;  4POW A;  5EQ8 A;  1ELJ A;  1Y20 A;  5H8N A;  1D9V A;  4YMB A;  1SVX B;  4HCY A;  1PEB A;  4QFK A;  4MH5 A;  4ZZE A;  2V3T A;  3G3J A;  2P3V A;  1NFT A;  5ET5 A;  4PE5 B;  3CFZ A;  4PDH A;  3T66 A;  4N6K A;  4POX A;  1FQB A;  3TQL A;  4QFP A;  1M5B A;  5IZZ A;  4EXL A;  4GFR A;  4GWZ A;  4ND9 A;  1XVY A;  1GR2 A;  1INP A;  4OWD A;  2PFZ A;  3OO8 A;  1J1N A;  3PMW A;  4P1E A;  1ZBM A;  1URG A;  3RT8 A;  2WOL A;  3VVD A;  4JB7 A;  1DPP A;  1B46 A;  3E9X A;  4LN5 A;  2FBP A;  2UVI A;  4LA9 A;  1B5I A;  5I2N A;  5I58 A;  4GLI A;  4BDL A;  4JWY A;  2R6G E;  4ELQ A;  1AOV A;  2Q2C A;  2F7A A;  2XHD A;  1QW0 A;  3B6Q A;  2YPN A;  4PFR A;  4BDO A;  2R9J A;  4DCX A;  1NV7 A;  2WKY A;  4OMB A;  4MHF A;  1JW4 A;  1QUL A;  2HHM A;  4NF5 B;  1GV8 A;  3T93 B;  5H8F A;  4YB5 A;  2QMW A;  3O2A A;  2CZK A;  3FXR A;  1XI6 A;  2Q89 A;  2ZYO A;  3T22 A;  2B4M A;  3MP8 A;  1NUW A;  2RC8 A;  1N7W A;  2HCA A;  5FHM A;  1NH8 A;  3MYU A;  5J1D A;  2I4C A;  3O28 A;  2BJI A;  3PGF A;  4OET A;  4DIG A;  3WAE A;  4QFO A;  3M8U A;  3T1B A;  3KJT A;  3A09 A;  1MPB A;  4I1D A;  2GH9 A;  3U92 A;  3O97 A;  2OWZ A;  4NF4 A;  3R7X A;  1JNF A;  4EF1 A;  5TPA B;  4QSD A;  5CMK A;  2F97 A;  1ANF A;  2O68 A;  1S7Y A;  2XWI A;  3LSW A;  2OLB A;  1I6Q A;  5CMB A;  1YAE A;  4IGR A;  2XXV A;  1Q9D A;  4QBA A;  4F3P A;  2WEF A;  1LB9 A;  1PBQ A;  1ZJL A;  4G4P A;  4R2F A;  2GHB A;  1GVC A;  3DP8 A;  4PE3 A;  2DOJ A;  3K1N A;  5CBR A;  1IEJ A;  2H4I A;  3E3K A;  4ZE9 A;  3MVX A;  3MW0 A;  2FHY A;  4KHZ E;  3CFX A;  5H8F B;  3QUF A;  2OWS A;  1OLC A;  1URS A;  3Q28 A;  4MNP A;  3FV1 A;  2O6A A;  1FBE A;  4DDD A;  1OIB A;  1BP5 A;  3MST A;  4H0W A;  3C9H A;  1JW5 A;  4O94 A;  4N17 A;  3PD9 A;  4ELO A;  4GBW A;  3EPE A;  1JVX A;  3H3G A;  4DI3 D;  1NUY A;  3H7M A;  3UK4 A;  3PUW E;  1FPD A;  2UVJ A;  1B7U A;  4LZ7 A;  2QMX A;  3K4U A;  5JK4 A;  1ZMG A;  4YIC A;  3MVY A;  4DXB A;  3HFU A;  3IJO B;  5JTY A;  2DWI A;  4OEU A;  4RK9 A;  2H25 A;  3VFJ A;  2QS2 A;  1B7Z A;  3O6P A;  4NF6 B;  2GRV A;  4IO2 A;  3MVZ A;  1IZ1 A;  1B5H A;  1II5 A;  1FQF A;  2DVC A;  3RTF B;  1I6A A;  1CE2 A;  5A5X A;  1LFI A;  3FJG A;  1MQJ A;  1B0H A;  1A40 A;  4F19 A;  3VLU A;  3A3C A;  1KWH A;  5L9M A;  4R9F A;  2FVZ A;  2ONK E;  4H8J A;  4GXS B;  4WKM A;  4HS7 A;  4P0G A;  1EU8 A;  2GFE A;  1YPN A;  3QK6 A;  2V3Q A;  4GRK A;  3IB0 A;  3RGY A;  1IMF A;  5IKB A;  2W7Y A;  3T96 B;  2XXQ A;  4F3G A;  4G61 A;  3BBR A;  3USD A;  5I2K A;  3I5O A;  2LAO A;  2QVV A;  1IIT A;  4JDF A;  1B1X A;  4OTE A;  5AA2 B;  4KYE A;  4YB7 A;  1FPB A;  1UIV A;  1IMD A;  4KD5 A;  2F8D A;  5DVJ A;  3MWB A;  3IK6 B;  1H45 A;  5ICT A;  3U94 A;  1JEU A;  3IL1 B;  1UTH A;  3MP6 A;  3M3K A;  3KN7 A;  4TLL B;  1IXH A;  1BKA A;  2Q74 A;  4ISU A;  4H67 A;  3VVE A;  1B7H A;  3DEL B;  3B50 A;  4LZ5 A;  5ITP A;  1R9Q A;  1SW1 A;  3DRK A;  3HPI A;  3JV9 A;  5BWJ A;  1FPJ A;  4FEC A;  4GWU A;  4ESW A;  2HQ0 A;  3G3H A;  2ESN A;  3TCG A;  1LBX A;  2RCA A;  4I3E A;  3RQT A;  2HZK A;  4OVJ A;  3V89 B;  4FBP A;  5FBP A;  4I62 A;  4F2Q A;  2HZL A;  2V93 A;  1ATG A;  5IZ3 A;  3PU5 A;  1JET A;  1MQI A;  1FTL A;  1NV4 A;  2XX9 A;  4PBH A;  3IJX B;  1FBC A;  2Y5K A;  1LAH E;  2WX9 A;  1EZ9 A;  4KCC A;  1LB8 A;  4GWW A;  4R6H A;  3DLN A;  4F31 B;  3DM0 A;  1EZO A;  4PFT A;  1FBF A;  2UVG A;  3KOS A;  3Q29 A;  1MXZ A;  2WYK A;  1OLA A;  3UA8 A;  3FZV A;  1LBC A;  3UOR A;  4QFL A;  3QXM A;  3OSR A;  1S50 A;  1FPF A;  2CMO A;  4YAH X;  5TP9 B;  1PB9 A;  4OES A;  4LQ2 A;  4F39 A;  3TDJ A;  3TEP A;  1NUZ A;  1N76 A;  1B52 A;  2B3F A;  3OEK A;  3PPO A;  4R6K A;  3OD7 A;  1B3G A;  4P56 A;  3CHG A;  2Q9T A;  2VT5 A;  1XHY A;  5DEX A;  3B6W A;  1FCK A;  4FE8 A;  4IO5 A;  4IB2 A;  4EQ9 A;  1SYH A;  2WYP A;  3C4M A;  3OEM A;  3FD3 A;  1RDX A;  4I8C A;  1XC1 A;  3SET A;  3FV2 A;  4N6D A;  1EH3 A;  2A5T A;  5IZ3 B;  2YLN A;  3MP1 A;  3BIG A;  4F1Y A;  5DTB A;  1EYJ A;  2I4B A;  1I6B A;  3OO6 A;  4XKN A;  4K3F A;  4XF5 A;  1IXI A;  4AS4 A;  1P1U A;  3WAF A;  1D9Y A;  1LAF E;  2VD3 A;  3K00 A;  4C1U A;  5M2V A;  2I58 A;  2VP1 A;  1QVS A;  1B51 A;  3S9N C;  1QUI A;  5H8Q A;  1B58 A;  3LR1 A;  3K1M A;  5CC2 A;  4NF0 A;  3QSL A;  1P1O A;  2DS9 A;  1B32 A;  1P1Q A;  1FBP A;  1FPE A;  5BUU A;  2DVZ A;  2FIE A;  1DTZ A;  1NH7 A;  2D3I A;  1MM7 A;  4GOT A;  4DZ1 A;  2F36 A;  3GBB A;  3KN3 A;  1NKX A;  2OK2 A;  3K6W A;  4RYA A;  3CVG A;  4X9T A;  2XX8 A;  3SDF A;  3TTR A;  3U8Q A;  5IGA A;  4OVS A;  3C32 A;  3DRI A;  4PBQ A;  2FYI A;  3K01 A;  1MY2 A;  2DP8 A;  2CZH A;  3F11 A;  3FTO A;  4NQ8 A;  1FPL A;  2V4C A;  3A3U A;  2B4L A;  4OEV A;  1FTM A;  3K1P A;  4PFY A;  2A5S A;  3RTW B;  1FRP A;  3IB2 A;  1LBZ A;  3RPW A;  1MQH A;  2QSX A;  5AA1 A;  3O29 A;  5AA2 D;  4EQ7 A;  2ZZV A;  5EYG A;  3FIR A;  4ZEB A;  2Y7W A;  3KGC A;  3VDF A;  2I0C A;  1HSE A;  3KBR A;  2F7C A;  1QJM A;  3GYY A;  4GWY A;  3KEI A;  5L8D A;  1DK4 A;  1AL3 A;  4U2R A;  5ET7 A;  1MS7 A;  3TQW A;  4YKK A;  4AS5 A;  2WBD A;  3RY3 A;  4GIZ A;  2F6P A;  1OVT A;  3PUZ E;  3GXA A;  4MBP A;  3K6V A;  3UGW A;  4NX1 A;  1XS5 A;  4GD5 A;  1B40 A;  1YXI A;  5AA3 A;  2O1L A;  1IMA A;  3UP9 A;  4KR5 A;  2DWH A;  2WOK A;  4NWC A;  3CR9 A;  1IMC A;  4RY1 A;  4R9G A;  5H8H B;  1VFE A;  2O51 A;  1B2H A;  3V5A A;  1CB6 A;  3MVW A;  2QL3 A;  1B0L A;  1B1H A;  3ODB A;  3MZB A;  3OXN A;  4NF5 A;  3PUX E;  3V83 A;  2P3N A;  3H6V A;  1XVX A;  4RNS A;  4QSE A;  2XXT A;  4ZDM A;  2GQ1 A;  2NWJ A;  1FTK A;  5I59 A;  3OOA A;  2DDK A;  3FJM A;  1FTO A;  3U72 A;  4OVR A;  1SD3 A;  1TT1 A;  4OFO A;  3PPR A;  4IO6 A;  2VGQ A;  1LFG A;  2G93 A;  4GWS A;  4JWX A;  4EF2 A;  5LDZ A;  3FXQ A;  3IX1 A;  1LLS A;  2F34 A;  2X7Q A;  1POY 1;  5TPA A;  3T0J A;  2V25 A;  4H5G A;  5F1Q A;  4YU0 A;  2VD2 A;  1K9Z A;  3IB1 A;  3S9M C;  2DSF A;  1MDQ A;  4GWO A;  4H65 A;  5I5P A;  5IAI A;  3HN0 A;  3TTK A;  1LGB C;  2NVU B;  4GL8 A;  2Q8M A;  4ESX A;  1M5E A;  3UIF A;  3MJN A;  1FBH A;  3IO6 A;  1RDZ A;  1DPE A;  3CSB A;  5JEI A;  4MF3 A;  4R75 A;  5KDT B;  5A5L A;  3A29 A;  1Y3Q A;  1YTV A;  1QUK A;  4F1V A;  3H6U A;  5T3J A;  4NED A;  5I59 B;  1H43 A;  5EYH A;  1A55 A;  4PET A;  4XKR A;  4N91 A;  4XTC Q;  3O9P A;  2I49 A;  3U93 A;  3RNN A;  5DT6 A;  2XXP A;  1Z7N E;  4KXP A;  4OFL A;  4P11 A;  4PDD A;  4UA8 A;  4H6D A;  1KZ8 A;  1NV6 A;  5H8S A;  4C1T A;  3TOD A;  1OQG A;  2PT1 A;  3KC1 A;  5I84 A;  3FVN A;  3PD8 A;  1NUX A;  3VXB A;  1D4N A;  1RKM A;  4PAI A;  1P1N A;  4ELP A;  1EYI A;  1LCT A;  4PAK A;  3DRF A;  3EF7 A;  4NF6 A;  4DI4 B;  2O1M A;  3SES A;  1B3H A;  1VR5 A;  2ZYM A;  2B65 A;  1NV1 A;  1BTJ A;  4F29 A;  3IOV A;  2ZYK A;  3OMB A;  5DVI A;  4BDN A;  4IR8 A;  4LVQ A;  3TCF A;  4IO7 A;  2ZNU A;  3HCQ A;  4XEQ A;  3MZ9 A;  1EYK A;  3N6U A;  4U21 A;  1MDP 1;  1JQF A;  3K6X A;  2HXW A;  2BJJ X;  2KLF A;  3IO4 A;  1K9Y A;  1MY0 A;  1LAG E;  4N8G A;  3ISP A;  3ROJ A;  3FAT A;  4TLM B;  5B7D A;  5L9O A;  4JBZ A;  3LUZ A;  4PCD A;  1FW0 A;  1OQH A;  5AA2 A;  3FGS A;  4FOR A;  1R9L A;  1NL5 A;  3SEY A;  4JSO A;  3S9E A;  1GTK A;  1T0K A;  4FAJ A;  2Y7P A;  5FTI A;  3UN6 A;  1BLF A;  4XKP A;  1Q1K A;  3BFT A;  4ZS9 A;  1BK4 A;  2CEY A;  2RC7 A;  3QUJ A;  1JEV A;  3BKI B;  2GHA A;  1MXW A;  4FIM A;  5I57 B;  2XD2 A;  3KSX A;  1B3L A;  1FPK A;  4N4U A;  4DE8 A;  4F1U A;  4MNC A;  3LSF B;  5EQ7 A;  3VE1 B;  3ZKK A;  4PC9 A;  4PFI A;  1TWY A;  4UAC A;  1LST A;  4GF8 A;  1NNP A;  3VV5 A;  4HW8 A;  4H5F A;  3IOT A;  4MMP A;  4JWO A;  1UTB B;  3RLF E;  2KR0 A;  4HE1 A;  3RPL B;  2OX3 A;  1SQY A;  4O3A A;  1M5D A;  2FNC A;  2PVU A;  4KYS A;  3QAX A;  3KFM A;  4PFU A;  1I69 A; 
#chains in the Genus database with same CATH homology
 2Y84 A;  3CIJ A;  2HAV A;  3HST A;  4OYV A;  5TP9 A;  1HSJ A;  3EHS A;  3MQ9 A;  2O7I A;  4I9D A;  3MPK A;  3C35 A;  2E0S A;  2ALU A;  2G29 A;  2DYX A;  1LFH A;  4JSD A;  5K2Y A;  4F3B A;  5ELV A;  2VHA A;  4L17 A;  1MY3 A;  4X48 A;  3TMG A;  3JYR A;  3N94 A;  2RIN A;  1USY H;  4NMY A;  2P0S A;  4IGT A;  4X1D A;  2F5X A;  4LUB A;  5FTH A;  3W9V A;  1MXX A;  3ECR A;  1SI1 A;  3SEV A;  5DYH A;  3GLB A;  4EUO A;  4GXA A;  4NTL A;  1NNK A;  4MLV A;  5EHS A;  2Z8E A;  1N7X A;  3PUV E;  2AYS A;  1Y9U A;  2X7P A;  4U1Z A;  3I6V A;  2OJT A;  1FQA A;  2M8C A;  3ILU B;  5ITO A;  4U1O A;  4QF9 A;  2F78 A;  3OO7 A;  4RPN A;  1VSO A;  1MH3 A;  2F35 A;  3TFL A;  2XD3 A;  5AA4 B;  4R2B A;  1F9B A;  1EZP A;  2QS1 A;  2AL4 A;  5ICQ A;  1SDX A;  4X1B A;  1L5T A;  4G68 B;  3G3G A;  1Y1M A;  2V84 A;  3SEU A;  1WVJ A;  3DP4 A;  2ABH A;  5I56 B;  4TQU Q;  4N6P A;  1Y3N A;  2ONS A;  4P0I A;  4YKP A;  5CMC A;  2H98 A;  4BDQ A;  4EDP A;  2XX7 A;  4IO3 A;  3FVG A;  2Q2A A;  3T9H B;  5CBS A;  3RYB A;  2UYF A;  3C36 A;  3B7D A;  4LQ5 A;  4YKI A;  4OHN A;  1TXF A;  3HHG A;  3PPQ A;  5KCJ B;  4DXU A;  1B5J A;  3N5L A;  4AB5 A;  3PV0 E;  1B6H A;  1UIU A;  2Q8J A;  5L9S A;  4RA1 A;  3TTN A;  5HPQ A;  2D21 A;  3W15 C;  1QKB A;  2IA4 A;  3OEL A;  2VOZ A;  4KPT A;  2F7B A;  4OQO A;  3RN8 A;  2XXX A;  1AIV A;  5F7V A;  1M5F A;  5H8H A;  2Z22 A;  2X26 A;  3K02 A;  3TKD A;  3CG3 A;  4GQO A;  4R74 A;  4WXJ A;  2PT2 A;  4ZEC A;  2NXO A;  3ZS6 A;  4Q30 B;  2AL5 A;  3TEL A;  4U23 A;  4DXC A;  1PB8 A;  4JXI A;  1H76 A;  4G8N A;  3DRJ A;  3CRB A;  1MG1 A;  3DRG A;  3ONM A;  4KI0 E;  2YJP A;  1R6Z A;  3K0V A;  3EQ1 A;  1SW4 A;  2THI A;  1WDN A;  3DP6 A;  1AH5 A;  3EHT A;  3PMV A;  1RYO A;  2QS4 A;  1FQC A;  4OER A;  1H44 A;  2I3W A;  1MY4 A;  3MAM A;  2OZZ A;  3T9U A;  2I6E A;  3C31 A;  2ZNS A;  4KFQ A;  2OWT A;  4BLA A;  3PAM A;  1N04 A;  4ONY A;  4XIG Q;  1PBP A;  3VVF A;  1IIW A;  4O3C A;  3LVU A;  4U22 A;  5KDT A;  1LAX A;  4MFI A;  1IUD A;  2B3B A;  2HEU A;  3M3L A;  3Q25 A;  1MPD A;  4RPO A;  3MZ1 A;  3TUS A;  4HCW A;  5CMM A;  1NNT A;  4R6Y A;  2PYY A;  3QIM A;  4MLQ A;  4EQB A;  4NWD A;  4G8M A;  2ANJ A;  3LSX A;  1OMP A;  4OFJ A;  4FED A;  3TTM A;  3OO9 A;  3M3F A;  3MUQ A;  3H03 A;  3IAZ A;  1MPC A;  5ISU A;  2ZNT A;  4ZEI A;  1N3W A;  2PMS A;  3H6W A;  2XXU A;  5DVF A;  1JW1 A;  4GL0 A;  3G3K A;  3RYA A;  1DSN A;  1ZTY A;  2H5Y A;  2RC9 A;  3C33 A;  3D4C A;  4NF8 B;  2NUV A;  1MXV A;  3W9W A;  2Z23 A;  3TPA A;  2Z8D A;  4ZZA A;  3QYT A;  1IXG A;  1DOT A;  2H99 A;  3KZG A;  3CI8 A;  5FHN A;  2QRY A;  5H8N B;  2Y7R A;  1A7L A;  1AMF A;  3GBA A;  4IO4 A;  2XXH A;  3KSJ A;  1QKA A;  3TAJ A;  4IY5 A;  4ECF A;  5EHM A;  4M1V A;  4C0R A;  2FA7 A;  4DLD A;  1SYI A;  4LAT A;  1ZU0 A;  3LBS A;  1Z7M E;  2QPQ A;  3O6H A;  3SKP A;  4YMA A;  3PUY E;  2ZMB A;  3SEW A;  1HSL A;  1DTG A;  2I48 A;  5TU0 A;  3FJ7 A;  4NE4 A;  3HV1 A;  4U4S A;  3Q27 A;  5I2N B;  4QFN A;  5I58 B;  3V8X B;  1SBP A;  1MRP A;  5I57 A;  4THI A;  1JVY A;  2Y7I A;  2DE2 A;  4QRZ A;  5FHO A;  2I0B A;  2HAU A;  4LON B;  1URD A;  4RJZ A;  1MQD A;  2H9B A;  3KOT A;  4KQP A;  3MPL A;  2DWJ A;  1N0T A;  4AQ4 A;  2D5W A;  1UTB A;  2R71 A;  4QSC A;  2I3V A;  4Q8R A;  1N3X A;  1N84 A;  3G3I A;  3FUZ A;  3C34 A;  3S4U A;  4WEP A;  2DWA A;  1MQG A;  4ELR A;  3AXF A;  1MXY A;  3G3F A;  4NF4 B;  2RKM A;  4WED A;  2QJE A;  5CRY A;  3L6G A;  2Z8F A;  3FAS A;  1Y4C A;  2CZL A;  2V3U A;  3KG2 A;  4OZ9 A;  1GGG A;  1B4H A;  1FQD A;  2XXR A;  1POT A;  4Z7E A;  4PFW A;  3MBP A;  3O66 A;  4H1X A;  2DQV A;  1VFD A;  4G2Z A;  3TTL A;  2DE3 A;  2NOO A;  2ONR A;  3K2D A;  3RUM A;  3JZJ A;  1B9J A;  3IOR A;  1H3D A;  2OBG A;  4Q0C A;  4RXL A;  3I3V A;  3VLV A;  2O84 X;  3FVK A;  3ILT B;  2F6G A;  2Y7K A;  1RYX A;  2AIX A;  5B70 A;  1B3F A;  4YKJ A;  2IEE A;  3O6I A;  4OEN A;  4ZE8 A;  5HM4 B;  1USY E;  1O7T A;  5EYF A;  3P7I A;  5JTY B;  1B4Z A;  1PC3 A;  1NNF A;  2ZYN A;  1XOC A;  2DXR A;  2DXY A;  1UQW A;  1QUJ A;  4ZED A;  1P1W A;  4O3B A;  3H4Z A;  4XKQ A;  4HTG A;  4YB6 A;  2P2A A;  3H06 B;  5AA4 A;  1B05 A;  1Y1Z A;  5LOM A;  3VLW A;  3RT6 B;  5A5X B;  2UYE A;  2REG A;  3H6T A;  3IOW A;  3KN8 A;  3OSQ A;  2REJ A;  2UVH A;  4G68 A;  3N6T A;  4N13 A;  1OVB A;  4QHQ A;  3T9X B;  5I56 A;  2O7U A;  3O6G A;  1XT8 A;  5KZT A;  1O63 A;  4XXU A;  3Q26 A;  3MC2 A;  2RCB A;  4YZZ A;  3DRH A;  3CFL A;  3CSG A;  5CM6 A;  5I2K B;  3E4R A;  1VE4 A;  1Y4T A;  1US4 A;  4F3S A;  3TZA A;  1O64 A;  5KCJ A;  1IXC A;  1MY1 A;  1R1N A;  1DMB A;  1ZKB A;  4LP2 B;  2O69 A;  1UTH B;  2DE4 A;  4GVO A;  1BIY A;  4E0X A;  1TFD A;  3K6U A;  3U1O A;  3LSL A;  3E13 X;  1LCF A;  4FEB A;  4G68 C;  2XXI A;  1Q35 A;  1PB7 A;  3SEX A;  3EHU A;  1US5 A;  4EXK A;  2P1S A;  3VXC A;  2PX1 A;  1FQE A;  4G77 A;  4Q5T A;  2HFB A;  4M4G A;  5HBC A;  4KYD A;  3N26 A;  3FVO A;  3PPN A;  3R26 A;  4N07 A;  3S2V A;  4AB6 A;  1FTJ A;  3BFU A;  2OCU A;  4DCY A;  4FJP A;  1A8F A;  1IQ7 A;  3D4G A;  3PMX A;  4LZ8 A;  3OEN A;  3B6T A;  1PDA A;  1MM6 A;  2WOP A;  1ZIU A;  4R72 A;  2XXY A;  3LUY A;  3THI A;  3G7W A;  1A54 A;  1YCJ A;  4R73 A;  3KJ7 A;  1ZLQ A;  1SI0 A;  4ZEF A;  4KCD A;  1M5C A;  2E1S A;  4U4X A;  4TOZ A;  3CG1 A;  3EN3 A;  3L6H A;  1D3K A;  3SER A;  1P99 A;  1MH4 A;  1WOD A;  5DEX B;  4BDM A;  4F22 A;  3R6U A;  3ZSF A;  3IOU A;  1A99 A;  4IY6 A;  4PP0 A;  4F18 A;  1NMU A;  4E0W A;  4OXV A;  2A5T B;  1B3E A;  1LBB A;  4RK2 A;  5AE4 A;  2ZXT A;  5K2X A;  3GZG A;  3HO7 A;  4F2O A;  4ZEK A;  2UXA A;  3ZKL A;  4G8H A;  3S9L C;  3FXU A;  1MXU A;  3TCH A;  2PBW A;  1SW2 A;  1TFA A;  5H8Q B;  5CI5 A;  2Q88 A;  3T9V A;  1A8E A;  2RF1 A;  2QS3 A;  4BDR A;  2XXW A;  4Z0I A;  1Y3P A;  3HHF A;  3IR1 A;  4FAT A;  4NF8 A;  3PPP A;  1S9T A;  3LC8 A;  4H8I A;  3TYH A;  4PQJ A;  1SW5 A;  4POW A;  1ELJ A;  1Y20 A;  5H8N A;  1D9V A;  4YMB A;  1SVX B;  4HCY A;  1PEB A;  4QFK A;  4MH5 A;  4ZZE A;  2V3T A;  3G3J A;  1NFT A;  4PE5 B;  3CFZ A;  3T66 A;  4POX A;  1FQB A;  3TQL A;  4QFP A;  1M5B A;  4EXL A;  4GFR A;  4ND9 A;  1XVY A;  1GR2 A;  4OWD A;  3OO8 A;  1J1N A;  3PMW A;  1ZBM A;  1URG A;  3RT8 A;  2WOL A;  3VVD A;  4JB7 A;  1DPP A;  1B46 A;  3E9X A;  2UVI A;  4LA9 A;  1B5I A;  5I2N A;  5I58 A;  4GLI A;  4BDL A;  4JWY A;  2R6G E;  4ELQ A;  1AOV A;  2Q2C A;  2F7A A;  2XHD A;  1QW0 A;  3B6Q A;  2YPN A;  4BDO A;  2R9J A;  4DCX A;  2WKY A;  4OMB A;  1JW4 A;  1QUL A;  1GV8 A;  4NF5 B;  3T93 B;  5H8F A;  4YB5 A;  2QMW A;  3O2A A;  3FXR A;  2Q89 A;  2ZYO A;  3T22 A;  2B4M A;  3MP8 A;  2RC8 A;  1N7W A;  2HCA A;  5FHM A;  1NH8 A;  5J1D A;  2I4C A;  3O28 A;  3PGF A;  4OET A;  4DIG A;  3WAE A;  4QFO A;  3M8U A;  3KJT A;  3A09 A;  1MPB A;  4I1D A;  2GH9 A;  3U92 A;  3O97 A;  4NF4 A;  3R7X A;  1JNF A;  4EF1 A;  5TPA B;  4QSD A;  5CMK A;  2F97 A;  1ANF A;  2O68 A;  1S7Y A;  3LSW A;  2OLB A;  1I6Q A;  5CMB A;  1YAE A;  4IGR A;  2XXV A;  4F3P A;  1LB9 A;  1PBQ A;  1ZJL A;  4G4P A;  4R2F A;  2GHB A;  1GVC A;  3DP8 A;  2DOJ A;  3K1N A;  5CBR A;  1IEJ A;  2H4I A;  3E3K A;  4ZE9 A;  3MVX A;  3MW0 A;  4KHZ E;  3CFX A;  5H8F B;  3QUF A;  2OWS A;  1OLC A;  1URS A;  3Q28 A;  3FV1 A;  2O6A A;  4DDD A;  1OIB A;  1BP5 A;  4H0W A;  3C9H A;  1JW5 A;  3PD9 A;  4ELO A;  3EPE A;  1JVX A;  3H3G A;  3H7M A;  3UK4 A;  3PUW E;  2UVJ A;  1B7U A;  4LZ7 A;  2QMX A;  3K4U A;  5JK4 A;  1ZMG A;  4YIC A;  3MVY A;  4DXB A;  3IJO B;  5JTY A;  2DWI A;  4OEU A;  4RK9 A;  2H25 A;  3VFJ A;  2QS2 A;  1B7Z A;  3O6P A;  4NF6 B;  2GRV A;  4IO2 A;  3MVZ A;  1IZ1 A;  1B5H A;  1II5 A;  1FQF A;  2DVC A;  3RTF B;  1I6A A;  1CE2 A;  5A5X A;  1LFI A;  3FJG A;  1MQJ A;  1B0H A;  1A40 A;  4F19 A;  3VLU A;  3A3C A;  1KWH A;  5L9M A;  4R9F A;  2ONK E;  4H8J A;  4GXS B;  4WKM A;  4HS7 A;  4P0G A;  1EU8 A;  2GFE A;  1YPN A;  3QK6 A;  2V3Q A;  4GRK A;  3IB0 A;  3RGY A;  5IKB A;  2W7Y A;  3T96 B;  2XXQ A;  4F3G A;  3BBR A;  3USD A;  5I2K A;  3I5O A;  2LAO A;  1IIT A;  4JDF A;  1B1X A;  4OTE A;  5AA2 B;  4KYE A;  4YB7 A;  1UIV A;  4KD5 A;  2F8D A;  5DVJ A;  3MWB A;  3IK6 B;  1H45 A;  5ICT A;  3U94 A;  1JEU A;  3IL1 B;  1UTH A;  3MP6 A;  3M3K A;  3KN7 A;  4TLL B;  1IXH A;  1BKA A;  4ISU A;  4H67 A;  3VVE A;  1B7H A;  3DEL B;  4LZ5 A;  5ITP A;  1R9Q A;  1SW1 A;  3DRK A;  3HPI A;  3JV9 A;  5BWJ A;  4FEC A;  4ESW A;  2HQ0 A;  3G3H A;  2ESN A;  3TCG A;  2RCA A;  3RQT A;  2HZK A;  4OVJ A;  3V89 B;  4I62 A;  4F2Q A;  2HZL A;  2V93 A;  1ATG A;  3PU5 A;  1JET A;  1MQI A;  1FTL A;  2XX9 A;  3IJX B;  1LAH E;  1EZ9 A;  4KCC A;  1LB8 A;  4R6H A;  3DLN A;  4F31 B;  3DM0 A;  1EZO A;  4PFT A;  2UVG A;  3KOS A;  3Q29 A;  1MXZ A;  1OLA A;  3UA8 A;  3FZV A;  1LBC A;  3UOR A;  4QFL A;  3QXM A;  3OSR A;  1S50 A;  2CMO A;  4YAH X;  5TP9 B;  1PB9 A;  4OES A;  4LQ2 A;  4F39 A;  3TDJ A;  3TEP A;  1N76 A;  1B52 A;  2B3F A;  3OEK A;  3PPO A;  4R6K A;  3OD7 A;  1B3G A;  3CHG A;  2Q9T A;  1XHY A;  5DEX A;  3B6W A;  1FCK A;  4FE8 A;  4IO5 A;  4IB2 A;  4EQ9 A;  1SYH A;  3C4M A;  3OEM A;  3FD3 A;  4I8C A;  1XC1 A;  3SET A;  3FV2 A;  1EH3 A;  2A5T A;  2YLN A;  3MP1 A;  4F1Y A;  5DTB A;  2I4B A;  1I6B A;  3OO6 A;  4XKN A;  4K3F A;  1IXI A;  1P1U A;  3WAF A;  1D9Y A;  1LAF E;  2VD3 A;  3K00 A;  4C1U A;  5M2V A;  2I58 A;  2VP1 A;  1QVS A;  1B51 A;  3S9N C;  1QUI A;  5H8Q A;  1B58 A;  3LR1 A;  3K1M A;  5CC2 A;  3QSL A;  1P1O A;  2DS9 A;  1B32 A;  1P1Q A;  5BUU A;  2DVZ A;  1DTZ A;  1NH7 A;  2D3I A;  1MM7 A;  4GOT A;  4DZ1 A;  2F36 A;  3GBB A;  3KN3 A;  1NKX A;  2OK2 A;  3K6W A;  4RYA A;  3CVG A;  4X9T A;  2XX8 A;  3SDF A;  3TTR A;  3U8Q A;  3C32 A;  3DRI A;  2FYI A;  3K01 A;  1MY2 A;  2DP8 A;  3F11 A;  3FTO A;  3A3U A;  2B4L A;  4OEV A;  1FTM A;  3K1P A;  4PFY A;  2A5S A;  3RTW B;  3IB2 A;  3RPW A;  1MQH A;  2QSX A;  5AA1 A;  3O29 A;  5AA2 D;  4EQ7 A;  3FIR A;  4ZEB A;  2Y7W A;  3KGC A;  3VDF A;  2I0C A;  1HSE A;  3KBR A;  2F7C A;  1QJM A;  3KEI A;  5L8D A;  1AL3 A;  4U2R A;  1MS7 A;  3TQW A;  4YKK A;  3RY3 A;  4GIZ A;  2F6P A;  1OVT A;  3PUZ E;  3GXA A;  4MBP A;  3K6V A;  3UGW A;  1XS5 A;  4GD5 A;  1B40 A;  5AA3 A;  2O1L A;  3UP9 A;  4KR5 A;  2DWH A;  2WOK A;  4NWC A;  3CR9 A;  4RY1 A;  4R9G A;  5H8H B;  1VFE A;  2O51 A;  1B2H A;  3V5A A;  1CB6 A;  3MVW A;  2QL3 A;  1B0L A;  1B1H A;  3ODB A;  3MZB A;  3OXN A;  4NF5 A;  3PUX E;  3V83 A;  3H6V A;  1XVX A;  4RNS A;  4QSE A;  2XXT A;  4ZDM A;  2NWJ A;  5I59 A;  1FTK A;  3OOA A;  3FJM A;  1FTO A;  3U72 A;  1SD3 A;  1TT1 A;  4OFO A;  3PPR A;  4IO6 A;  2VGQ A;  1LFG A;  2G93 A;  4JWX A;  4EF2 A;  3FXQ A;  3IX1 A;  1LLS A;  2F34 A;  2X7Q A;  1POY 1;  5TPA A;  2V25 A;  4H5G A;  5F1Q A;  4YU0 A;  2VD2 A;  3IB1 A;  3S9M C;  2DSF A;  1MDQ A;  4GWO A;  4H65 A;  5IAI A;  3HN0 A;  3TTK A;  1LGB C;  2NVU B;  4GL8 A;  4ESX A;  1M5E A;  3UIF A;  3MJN A;  3IO6 A;  1DPE A;  3CSB A;  5JEI A;  4MF3 A;  4R75 A;  5KDT B;  1Y3Q A;  1YTV A;  1QUK A;  4F1V A;  3H6U A;  4NED A;  5I59 B;  1H43 A;  1A55 A;  4PET A;  4XKR A;  4XTC Q;  3O9P A;  2I49 A;  3U93 A;  3RNN A;  5DT6 A;  2XXP A;  1Z7N E;  4OFL A;  4P11 A;  4UA8 A;  4H6D A;  5H8S A;  4C1T A;  3TOD A;  1OQG A;  2PT1 A;  5I84 A;  3FVN A;  3PD8 A;  3VXB A;  1D4N A;  1RKM A;  1P1N A;  4ELP A;  1LCT A;  3DRF A;  3EF7 A;  4NF6 A;  2O1M A;  3SES A;  1B3H A;  1VR5 A;  2ZYM A;  2B65 A;  1BTJ A;  4F29 A;  3IOV A;  2ZYK A;  3OMB A;  5DVI A;  4BDN A;  4LVQ A;  3TCF A;  4IO7 A;  2ZNU A;  3HCQ A;  3MZ9 A;  3N6U A;  4U21 A;  1MDP 1;  1JQF A;  3K6X A;  2HXW A;  2BJJ X;  2KLF A;  3IO4 A;  1MY0 A;  1LAG E;  3FAT A;  4TLM B;  5B7D A;  5L9O A;  4JBZ A;  1FW0 A;  1OQH A;  5AA2 A;  3FGS A;  4FOR A;  1R9L A;  1NL5 A;  3SEY A;  4JSO A;  3S9E A;  1GTK A;  1T0K A;  4FAJ A;  2Y7P A;  5FTI A;  3UN6 A;  1BLF A;  4XKP A;  1Q1K A;  3BFT A;  4ZS9 A;  2RC7 A;  3QUJ A;  1JEV A;  3BKI B;  2GHA A;  1MXW A;  4FIM A;  5I57 B;  2XD2 A;  3KSX A;  1B3L A;  4DE8 A;  4F1U A;  3LSF B;  3VE1 B;  3ZKK A;  1TWY A;  4UAC A;  1LST A;  4GF8 A;  1NNP A;  3VV5 A;  4HW8 A;  4H5F A;  3IOT A;  4JWO A;  1UTB B;  3RLF E;  1SQY A;  4O3A A;  1M5D A;  2FNC A;  2PVU A;  4KYS A;  3QAX A;  3KFM A;  4PFU A;  1I69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...