4GF8A

Crystal structure of the chitin oligasaccharide binding protein
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
528
structure length
528
Chain Sequence
RSELTIVPDFYPTMVRNFNPYLATNLRTTTDFIYEPLVVFNEMKGNTPVFRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRFRLSEANSNVPYEISLIPIVAEHVWKDVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQLLGKIVNSELDWTSSFVPDIDRTYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKKEALDNVDFRRAFSMALDRQTIIDIAFYGSGTVNDFASGLGYAFEAWSDEATHKKYKGFNTYDVEGSKKLLAKAGFKDVNGDGFVETPSGKSFELLIQSPNGWTDFNNTVQLAVEQLQEVGIKAKARTPEFAVYNQAMLEGTYDVAYTNYFHGADPFTYWNSGYNSALQSGDGMPRFAMHYFTDKKLDGLLDSFYKTADKNEQLAIAHGIQKIIAENQVTIPVMSGAWMYQYNTTRFTGWWSEENPKGRPSVWAGIPERLLHVLDLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Peptide ABC transporter, periplasmic peptide-binding protein
publication title Chitin catabolic cascade in the marine bacterium Vibrio cholerae: properties, structure and functions of a periplasmic chitooligosaccharide binding protein (CBP)
rcsb
source organism Vibrio cholerae o1
total genus 175
structure length 528
sequence length 528
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 4gf8A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gf8A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 4gf8A02
4ZEDA 3ODBA 3EN3A 1H44A 3FD3A 1FW0A 3OSQA 4XKNA 4M1VA 1FQEA 1D9YA 3U1OA 3IJOB 4OEVA 1NNKA 1MPCA 1H45A 5TPAB 4R74A 5AA2B 1EU8A 3RTFB 1SW4A 1VFEA 3IO6A 5M2VA 2P2AA 1SVXB 3THIA 1QKAA 2XXXA 5TP9B 3T9VA 2Q8JA 3USDA 1P1UA 4NTLA 1FQAA 2REGA 1XT8A 5ICTA 4NF5A 5KDTB 2I0CA 4MLQA 2F78A 4U21A 5AA3A 1T0KA 3DLNA 5K2XA 4OYVA 2F34A 4LONB 2F7AA 4QF9A 1QKBA 4DIGA 1QJMA 1MQIA 3ZS6A 3KG2A 1Z7ME 4X1BA 1MY1A 3SEWA 3H6VA 2AL5A 1WODA 2HZKA 1M5BA 3U94A 2OCUA 3MZBA 5H8SA 1A55A 4X9TA 1B3LA 4OESA 1A8FA 4NF6B 1OVBA 5KCJA 2ZNSA 4R2FA 1DPEA 4GRKA 2F6GA 4YB6A 4E0WA 2CMOA 2PX1A 3TCGA 4POXA 3KSJA 2DVZA 2XD2A 4TOZA 5H8NB 2XXUA 2H9BA 4OERA 3QXMA 2PBWA 2O51A 2ABHA 4P0GA 1B4HA 4OXVA 3IAZA 3PD9A 4OEUA 4ESWA 3PUWE 1AMFA 4U4SA 5F1QA 2HFBA 4ZECA 5FHNA 2DE4A 4JSOA 1A8EA 3QUFA 3IOWA 3EHUA 1ZBMA 4G8HA 4GL8A 2VD3A 4H8JA 3MAMA 3T96B 1YTVA 5DEXB 4PE5B 4N6PA 4K3FA 4GD5A 3O28A 2ZYNA 2F8DA 3IB1A 2OJTA 3KOSA 3B7DA 1DPPA 1MRPA 5JEIA 1MY4A 5I2NB 3OXNA 4RJZA 1SBPA 5I2KB 3DM0A 3KJ7A 3MUQA 3O9PA 1ZMGA 4I9DA 4Q5TA 4OMBA 3Q29A 1RYOA 3ILUB 2Y7PA 4KYEA 2F36A 3VVDA 1FTOA 2PT2A 2AYSA 1Y3NA 1NKXA 3MC2A 4IB2A 4R75A 3L6HA 3K2DA 4ONYA 3VLVA 4IO7A 3V83A 3KBRA 1LFHA 1Y3PA 1XHYA 4KYDA 3IOVA 3MP6A 1B5HA 4YICA 1QUJA 2QS2A 4RY1A 4YZZA 1N0TA 4G68A 1UTHA 2PVUA 2RC7A 3BFUA 2Z22A 4C1UA 4QSDA 1URSA 1LBBA 1JW5A 3E9XA 4YMAA 3Q26A 3TYHA 2FA7A 2RC8A 1SW5A 3ECRA 3DRGA 2O6AA 2Y84A 3C36A 4JXIA 1VFDA 3MPLA 1HSLA 3OO9A 1SI1A 4NF5B 4H1XA 4ZEFA 1R9QA 2BJJX 3MVZA 3SESA 2KLFA 3N6UA 2DE2A 4EXKA 5JTYB 4ELOA 1GR2A 3DELB 4EXLA 5H8HB 3E3KA 3TODA 3U8QA 3KSXA 1R9LA 1ZKBA 3KN3A 5DYHA 2GFEA 2YLNA 4GOTA 3CSGA 1EZ9A 2GRVA 2B65A 5DTBA 3TELA 4RPNA 1B2HA 1YPNA 1MXUA 2F5XA 5KCJB 2RF1A 3HO7A 3TQWA 3R26A 4ZEBA 1Y1MA 1AOVA 2DQVA 2RINA 4OHNA 1IXHA 3EHTA 4PFUA 2P0SA 4MLVA 4NF4B 4YB7A 4BDOA 2ESNA 2HXWA 3ONMA 5I58A 4OFOA 2I4CA 2XXIA 3K0VA 4OZ9A 2QMWA 1GTKA 2B3BA 4BDQA 3LR1A 4AQ4A 3OO7A 1LAHE 5H8NA 2GH9A 3D4CA 3UN6A 4IO3A 1DOTA 2ZYOA 1CE2A 1LAGE 1IIWA 5H8FB 3G3HA 3K6XA 1WVJA 3G3IA 3DRIA 4O3CA 1IUDA 3C4MA 2XXRA 3JZJA 5AE4A 3TEPA 1B0HA 1B1HA 4YMBA 4DXCA 5HPQA 2UVJA 4QRZA 1NH7A 4GQOA 5CM6A 2A5TB 2OZZA 2GHBA 4U2RA 1B5JA 1M5EA 4XKRA 1LFGA 2VOZA 1B05A 3I5OA 4EF2A 1MY2A 3FZVA 3FXQA 3K02A 5TU0A 1TXFA 4DCYA 5DVJA 1MDQA 1BTJA 3KFMA 4G4PA 4HW8A 2O1LA 3JYRA 4KD5A 4QFOA 3TZAA 4L17A 3MQ9A 3FJMA 1DSNA 1YCJA 4RA1A 1MXZA 3E13X 1N7WA 3W9VA 4R9GA 3TTKA 3C31A 2DWIA 4IY5A 3UK4A 1N3WA 2OLBA 2O1MA 3O6PA 2V3TA 1OMPA 5I2KA 3FV2A 3IO4A 2F6PA 3HSTA 3KGCA 4KFQA 1RKMA 5L9SA 4YKKA 4ELQA 5HM4B 1B6HA 3CRBA 1P1OA 2D21A 1Q35A 3LSFB 1MG1A 3L6GA 3PMXA 3MBPA 4F3SA 4F3BA 1H43A 3ILTB 1ZU0A 1QW0A 4NWCA 3RN8A 3KN7A 3PMVA 4NF8A 4R72A 4EDPA 4U1ZA 2DP8A 1DTGA 3ZKLA 4EQ7A 2H4IA 5ISUA 3FGSA 2IEEA 2VD2A 4R73A 4HCWA 1US5A 3C34A 4QSCA 3RQTA 3TMGA 4G68C 2R6GE 4ND9A 1TFAA 1B52A 4WEDA 1LCTA 1QVSA 2O69A 3A3CA 4H6DA 3TTLA 1ZTYA 4ZE9A 4GL0A 4F3PA 2E0SA 2PMSA 1KWHA 3HPIA 3OEMA 3VLWA 4IGRA 2QRYA 2DWAA 3V5AA 4AB6A 1ANFA 4DE8A 3N6TA 3K1PA 4WXJA 1FTLA 1PB8A 2I6EA 2YJPA 2RKMA 5JTYA 4P0IA 1FTJA 3KEIA 4F31B 4E0XA 4GF8A 5H8HA 3KZGA 1MXVA 3MP1A 3SEVA 1MXWA 3OSRA 4FATA 1B7HA 2HQ0A 2XXTA 1N84A 2M8CA 3DP4A 3O29A 4NEDA 2R9JA 3IR1A 2XX9A 5DVFA 2H98A 4IO6A 4DXUA 4NMYA 2NOOA 3MPKA 3B6QA 5I58B 1DTZA 4JWYA 4WEPA 3PMWA 3A3UA 3FVOA 1LSTA 3U93A 4NF4A 1N3XA 3FUZA 5CC2A 3DRKA 3MZ1A 5H8QB 3DRJA 2I4BA 5IAIA 3IB0A 4ELPA 3MZ9A 3TCHA 1PB9A 2E1SA 1N04A 2ZYMA 5JK4A 1MQGA 2UVGA 1B4ZA 4JBZA 5HBCA 1B3GA 3K6UA 4I1DA 3H7MA 3SERA 4U4XA 3PPNA 1UTBA 3ZKKA 2I3WA 1GVCA 3G3KA 4WKMA 5H8FA 1US4A 3IL1B 2O84X 4XIGQ 1D4NA 4LQ5A 1Y4TA 4ZZAA 1N7XA 2DXRA 3I3VA 2Q88A 2RCBA 2QJEA 2X7PA 2HAVA 1JEUA 2A5TA 1BKAA 3GBAA 1JETA 2UVHA 2P1SA 3RYAA 5EHMA 1LLSA 3UGWA 2Z8FA 4RYAA 2QS3A 4G77A 2XX8A 4PETA 2HZLA 1QUKA 4C1TA 3N26A 3ZSFA 3IOTA 3RUMA 4DDDA 4LZ7A 1FCKA 5A5XB 1UQWA 2UVIA 4QFPA 1MPBA 2VHAA 3T66A 4O3AA 5KZTA 3F11A 1HSJA 2XXQA 4F2QA 4YAHX 1YAEA 2QS4A 4NWDA 4OTEA 3BKIB 3H6WA 4F22A 2DOJA 4NF8B 3RYBA 2X26A 1TFDA 2HAUA 3HHGA 2HCAA 3FASA 2Y7IA 3IJXB 3LC8A 4KR5A 1MQDA 5L9MA 3TCFA 1BLFA 1MY0A 3UA8A 3KOTA 2Z23A 2VGQA 2WOLA 3IOUA 3GZGA 4RK9A 4X1DA 1MY3A 4YKIA 3S9MC 4YB5A 1VE4A 4FORA 4GXSB 1SYIA 4Z7EA 2NUVA 4KCCA 4QFNA 3SEXA 1S50A 4O3BA 2NXOA 2Q89A 4UA8A 2WOKA 5ITPA 4MF3A 3CG3A 2Y7RA 3OO6A 2V25A 1UIVA 1S9TA 4IY6A 2VP1A 1EZPA 2XX7A 5AA4A 3DP6A 3U92A 2XHDA 4ZS9A 4H8IA 3IB2A 3S9NC 5FTHA 4OETA 2V84A 2Y7WA 2QS1A 1B0LA 1MS7A 1EH3A 3PAMA 4IO4A 1VR5A 3HCQA 3C33A 3W15C 1UIUA 4FIMA 4ZEIA 1NNTA 1II5A 3EQ1A 2DSFA 5EHSA 3PUZE 4KHZE 4PP0A 4R2BA 5I59A 3CG1A 5CMKA 5CI5A 1MDP1 2CZLA 3OENA 4OFLA 4F1YA 1MXYA 3B6TA 3IX1A 1P1NA 4RPOA 3PUYE 4BDLA 1LGBC 3M3KA 3K1MA 2F7CA 2ONSA 1POTA 2G29A 2B4LA 1NH8A 2V3QA 1LBCA 4LVQA 2PYYA 3G7WA 5L8DA 1MQHA 4THIA 1I6QA 2NWJA 4LZ5A 4Q8RA 2AL4A 1IEJA 2I48A 1A99A 1Y9UA 3HN0A 5H8QA 2O7IA 1UTBB 4NE4A 4PFWA 3H6UA 4LATA 3VV5A 3H03A 2H99A 1B51A 5EYFA 1D3KA 2UXAA 4DZ1A 1B32A 3JV9A 2R71A 3RLFE 1NNFA 3PV0E 3OEKA 5L9OA 4XKQA 1I6AA 3P7IA 3AXFA 5ITOA 2ZMBA 4H5GA 3QYTA 1OIBA 2XXPA 3SEUA 5BWJA 1OQGA 1R1NA 1SW1A 3PUVE 1FTKA 2REJA 1ZLQA 1PBPA 1JQFA 1SD3A 1RYXA 2OBGA 2DVCA 4OFJA 3T93B 1XVYA 4DCXA 4F29A 3CHGA 1IITA 3CFLA 4ZEKA 4GWOA 1SDXA 3RPWA 1BP5A 1EZOA 1ATGA 1B46A 3TTNA 5DT6A 5FHMA 4IO2A 2OK2A 1LCFA 1IZ1A 1JW1A 5A5XA 1P1WA 4EQ9A 2ZYKA 5CMCA 3Q25A 3M3FA 4HCYA 1FQFA 4ECFA 4R9FA 2QSXA 1I69A 3DP8A 2NVUB 5DVIA 3RTWB 1SYHA 1LAFE 4OWDA 1TWYA 2FNCA 4P11A 5B70A 3C9HA 3OOAA 3N94A 4G8NA 4F3GA 2Q9TA 4HS7A 2D5WA 3GXAA 3W9WA 4BLAA 2UYFA 1LAXA 4XTCQ 3Q27A 3H4ZA 4JWOA 3LSXA 2DXYA 3SDFA 1I6BA 3TFLA 5AA4B 5CMMA 2ONRA 1JVXA 4FECA 1URGA 1POY1 1Y4CA 1MH4A 1LB8A 1QUIA 1Q1KA 1D9VA 4PQJA 2WKYA 1FQDA 4Z0IA 3UIFA 3O6GA 5I56A 2V93A 2I3VA 4Q0CA 4FEDA 3TPAA 3VLUA 3FJGA 3K00A 4ZE8A 5LOMA 3K6VA 3LSWA 4UACA 2B4MA 4OENA 4F19A 5I59B 3RY3A 2XXWA 3VXBA 1XOCA 3LUYA 4F18A 3FIRA 3FTOA 3S9LC 4TQUQ 4KPTA 5K2YA 4FE8A 3CFZA 1BIYA 2Y7KA 5CRYA 4EUOA 4C0RA 1XS5A 1J1NA 3TTRA 4F2OA 1HSEA 1B40A 2Z8DA 1GV8A 1B7UA 4ISUA 3VDFA 3V8XB 4ZZEA 2DE3A 1B7ZA 3G3GA 1N76A 4RNSA 4GXAA 1OLAA 3K1NA 4N07A 1B58A 4I8CA 1MQJA 1PBQA 2ALUA 4ELRA 3SKPA 3MP8A 1A40A 5I57A 1OLCA 5AA1A 3VVEA 4AB5A 3UORA 1B3HA 3DRHA 2OWTA 5J1DA 1FTMA 3OD7A 3CFXA 1AH5A 2D3IA 3FVNA 3R7XA 3FXUA 4PFTA 3BFTA 2H5YA 4YKPA 3O6IA 1M5DA 2GHAA 1L5TA 4X48A 5CBSA 1PDAA 3TAJA 2PT1A 1JEVA 1B1XA 1MM6A 3PD8A 1AL3A 3H6TA 1B5IA 3WAEA 1F9BA 4ESXA 1B9JA 2O68A 5FHOA 1FQCA 2XXHA 2I49A 3O66A 4G2ZA 3RNNA 1M5FA 4KI0E 4YKJA 1B3FA 3RT6B 3T9HB 2W7YA 4IGTA 4R6HA 2Z8EA 3O6HA 2F7BA 3A09A 3VXCA 2XD3A 1CB6A 2F97A 1ZJLA 2H25A 5F7VA 3CSBA 2O7UA 4JB7A 1A54A 2RCAA 1NL5A 3H06B 3Q28A 4YU0A 4I62A 1H3DA 2Q2CA 3G3JA 3EPEA 1B3EA 1USYE 3MVWA 3EHSA 4DXBA 2I58A 3MJNA 4LP2B 3PPRA 3PPPA 1PB7A 4F1VA 1TT1A 3SETA 4QFKA 4GVOA 2YPNA 3PUXE 3PGFA 3VE1B 1MH3A 3G3FA 2DYXA 2QL3A 4TLLB 1M5CA 1R6ZA 3FVGA 3TDJA 1WDNA 3OO8A 3FXRA 3HHFA 4ZDMA 5CBRA 3K4UA 4G8MA 3FV1A 3M3LA 4MH5A 2ZNUA 3T9XB 1OVTA 1AIVA 4FAJA 1VSOA 4OQOA 4HTGA 3TTMA 3EF7A 4KCDA 5I56B 1ELJA 1Z7NE 3MWBA 1NNPA 4EQBA 4KQPA 3E4RA 2QPQA 4XKPA 4Q30B 2DWJA 5IKBA 4LZ8A 1P99A 4JSDA 4BDNA 5BUUA 3FJ7A 1S7YA 3TUSA 3RT8A 3KN8A 1O7TA 3C32A 4BDRA 2WOPA 1P1QA 2IA4A 5TPAA 5AA2A 1MPDA 3H3GA 1MM7A 5CMBA 3QAXA 4JDFA 1LFIA 4PFYA 3IORA 1PC3A 5TP9A 3TQLA 2X7QA 1SI0A 5AA2D 4XXUA 4MBPA 3S9EA 4QHQA 3S4UA 3MVXA 1NFTA 3TKDA 5ELVA 5KDTA 2A5SA 1URDA 4LQ2A 3CIJA 4MFIA 3VVFA 3I6VA 1O63A 3GLBA 4FJPA 4BDMA 2LAOA 5I57B 1O64A 1Y3QA 3LBSA 4FEBA 3FVKA 1PEBA 3OMBA 4F1UA 3FATA 4U23A 2V3UA 4IO5A 1IXIA 3GBBA 4TLMB 3T9UA 2F35A 3SEYA 4DLDA 1SQYA 2QMXA 3O2AA 2FYIA 1GGGA 2ONKE 1OQHA 4NF6A 1H76A 3BBRA 1XC1A 1IXGA 2ANJA 2G93A 3RGYA 3QSLA 4H5FA 3B6WA 2UYEA 4F39A 3PPQA 4N13A 4POWA 2DWHA 3MW0A 2ZNTA 3UP9A 2DS9A 3PU5A 4H67A 3O97A 4U22A 4QFLA 1QULA 3PPOA 4R6KA 2HEUA 3CR9A 1XVXA 1LB9A 1USYH 2I0BA 4KYSA 3WAFA 1Y20A 1A7LA 3VFJA 1MXXA 4RXLA 5ICQA 1NMUA 1JVYA 2Q2AA 4OVJA 3U72A 4GIZA 4R6YA 3V89B 4H0WA 2THIA 3LSLA 3M8UA 1JNFA 5FTIA 3T22A 5DEXA 5B7DA 2RC9A 4U1OA 4JWXA 1IXCA 3D4GA 4M4GA 4H65A 3MVYA 3OELA 5I2NA 3C35A 1FQBA 4GFRA 3K01A 3N5LA 3LVUA 3QIMA 3QUJA 4EF1A 2AIXA 3HV1A 4LUBA 2B3FA 3K6WA 1ZIUA 1JW4A 3S2VA 3DRFA 3CI8A 5I84A 3KJTA 3CVGA 4RK2A 2OWSA 1Y1ZA 1DMBA 1IQ7A 2XXYA 1SW2A 2XXVA 4QSEA 3IK6B 4GLIA 3QK6A 2ZXTA 3R6UA 4G68B 4LA9A 1UTHB
chains in the Genus database with same CATH superfamily
2WEFA 1EYKA 4ZEDA 3ODBA 3EN3A 1H44A 3FD3A 1FW0A 3OSQA 4XKNA 4M1VA 4MNCA 1FQEA 1D9YA 3U1OA 3IJOB 4OEVA 1NNKA 1MPCA 1H45A 1IMFA 5TPAB 4R74A 5AA2B 1EU8A 1KZ8A 1SW4A 1VFEA 3IO6A 5M2VA 3RTFB 2P2AA 1SVXB 3THIA 1QKAA 2XXXA 4H46A 1YXIA 5TP9B 3T9VA 2Q8JA 3USDA 1P1UA 4NTLA 4GWUA 1FQAA 2REGA 1XT8A 5ICTA 3A29A 4NF5A 5KDTB 2I0CA 4MLQA 2F78A 4U21A 5AA3A 1IMAA 5DW8A 4UABA 1T0KA 3DLNA 5K2XA 4OYVA 2F34A 4LONB 2F7AA 3QMFA 4QF9A 4I3YA 1QKBA 4OANA 4DIGA 1QJMA 1MQIA 3ZS6A 3KG2A 1Z7ME 4X1BA 1MY1A 3SEWA 3EKIA 3H6VA 2AL5A 4XF5A 1WODA 2HZKA 1M5BA 3U94A 5I5PA 2OCUA 3MZBA 5H8SA 1A55A 4X9TA 5EQAA 1FBDA 1B3LA 2XA5A 4PBHA 4OESA 1A8FA 4NF6B 1OVBA 5KCJA 2ZNSA 4R2FA 1DPEA 4GRKA 2F6GA 4YB6A 4E0WA 2CMOA 2PX1A 3TCGA 4POXA 3KSJA 2DVZA 2XD2A 4TOZA 5H8NB 2XXUA 2H9BA 4OERA 3QXMA 2PBWA 2O51A 2ABHA 2QVRA 4MIJA 4P0GA 2CEXA 4MHFA 1B4HA 4OXVA 3IAZA 3PD9A 4OEUA 4ESWA 4AS5A 3PUWE 1AMFA 4U4SA 5F1QA 2HFBA 4ZECA 1NV5A 2CEYA 5FHNA 1LBVA 2DE4A 4JSOA 1A8EA 3QUFA 3IOWA 4N6KA 1FSAA 2F3BA 3EHUA 1FPDA 1ZBMA 2WBDA 4G8HA 4GL8A 2VD3A 2VPOA 1FBCA 4H8JA 3MAMA 3T96B 1YTVA 5DEXB 4PE5B 4N6PA 4K3FA 4GD5A 3O28A 2ZYNA 2F8DA 3IB1A 2OJTA 3KOSA 3B7DA 1DPPA 1MRPA 5JEIA 1MY4A 5I2NB 3OXNA 4RJZA 3GYYA 1FPFA 1KA0A 1SBPA 5I2KB 3DM0A 3KJ7A 3MUQA 3O9PA 1NV6A 1ZMGA 4I9DA 4Q5TA 4NHBA 4OMBA 3Q29A 3D1RA 1RYOA 3ILUB 2Y7PA 4KYEA 2F36A 5A5LA 4GWZA 4HE0A 3VVDA 1FTOA 2PT2A 2AYSA 1Y3NA 1NKXA 4NG7A 3MC2A 4IB2A 5IGAA 4R75A 2P3NA 1IMDA 2ZZVA 3L6HA 3K2DA 4ONYA 3VLVA 4IO7A 3LV0A 3V83A 3KBRA 4N8YA 1LFHA 1Y3PA 1XHYA 4KYDA 3IOVA 3MP6A 1K9YA 1B5HA 4YICA 1QUJA 2QS2A 4QXDA 4RY1A 4YZZA 5EQ9A 4MEVA 1N0TA 4G68A 1UTHA 2PVUA 2RC7A 3BFUA 2Z22A 4C1UA 4QSDA 1URSA 1LBBA 1JW5A 4OVTA 4H45A 4QBAA 3E9XA 4YMAA 1YYZA 3Q26A 4P9KA 3TYHA 2FA7A 2RC8A 1SW5A 3ECRA 3DRGA 2O6AA 2Y84A 3C36A 4MX6A 4JXIA 1VFDA 3MPLA 1HSLA 3BIHA 3OO9A 1SI1A 4NF5B 4H1XA 4ZEFA 1R9QA 2BJJX 3MVZA 3SESA 2KLFA 3HFUA 4PF6A 3N6UA 2DE2A 4EXKA 5EQ7A 5JTYB 4ELOA 1GR2A 3DELB 4EXLA 5H8HB 3E3KA 3TODA 3U8QA 3ISPA 3KSXA 2WYPA 4GX4A 1R9LA 2OWZA 4NF0A 1ZKBA 3KN3A 5DYHA 2GFEA 2YLNA 4GOTA 4MNIA 1INPA 3CSGA 1EZ9A 2GRVA 2B65A 5DTBA 4RPNA 1B2HA 1YPNA 1MXUA 2F5XA 3TELA 5J16A 5KCJB 2RF1A 3HO7A 2MKZA 1NUZA 2VPNA 3TQWA 3R26A 4ZEBA 1Y1MA 4HE2A 1AOVA 2DQVA 2RINA 4OHNA 1IXHA 2BJIA 5I7IA 3EHTA 4PFUA 2P0SA 3IFCA 4MLVA 4NF4B 4JVIA 4YB7A 4BDOA 4PAFA 2ESNA 2HXWA 3ONMA 5I58A 4OFOA 2I4CA 2XXIA 3K0VA 4XEQA 4OZ9A 2QMWA 1GTKA 2B3BA 4BDQA 3LR1A 4AQ4A 3OO7A 1LAHE 5H8NA 2GH9A 3D4CA 2P3VA 3UN6A 4IO3A 1DOTA 2ZYOA 1CE2A 1LAGE 1IIWA 5H8FB 3G3HA 3K6XA 1WVJA 3G3IA 3DRIA 4O3CA 1IUDA 3C4MA 2XXRA 3JZJA 2VT5A 4X04A 5AE4A 3TEPA 1B0HA 1B1HA 4PE3A 4YMBA 4DXCA 5HPQA 2UVJA 4QRZA 1NH7A 4GQOA 5CM6A 2A5TB 2OZZA 2GHBA 4U2RA 1B5JA 1M5EA 4XKRA 1LFGA 2VOZA 1B05A 3I5OA 4EF2A 1MY2A 3FZVA 3FXQA 3K02A 5TU0A 3FBPA 1TXFA 4DCYA 5DVJA 5I3SA 4O7MA 1MDQA 1BTJA 1FJ9A 3KFMA 4G4PA 3NOHA 3BIGA 4HW8A 2O1LA 3JYRA 4KD5A 4QFOA 3TZAA 4L17A 3MQ9A 3FJMA 5IZZA 1DSNA 1YCJA 4RA1A 1MXZA 2L5VA 3E13X 1N7WA 3W9VA 4R9GA 3TTKA 3C31A 2DWIA 4IY5A 3SZPA 3UK4A 1N3WA 2OLBA 2O1MA 4IR8A 3O6PA 2V3TA 1OMPA 5I2KA 3FV2A 3IO4A 2F6PA 3HSTA 3KGCA 4KFQA 1RKMA 5L9SA 4YKKA 4ELQA 5HM4B 1B6HA 3CRBA 4KXPA 4NQ8A 1P1OA 2D21A 1Q35A 3LSFB 1MG1A 4N6DA 5IM2A 3L6GA 2FIEA 4DI4B 3PMXA 3KC1A 3MBPA 4F3SA 4PAKA 4XFEA 4F3BA 1H43A 3ILTB 1FPJA 1ZU0A 1QW0A 4NWCA 3RN8A 3KN7A 3PMVA 4NF8A 4R72A 4EDPA 4U1ZA 2DP8A 1DTGA 3ZKLA 4EQ7A 2H4IA 1RDZA 5ISUA 3FGSA 2IEEA 2VD2A 4R73A 2XWOA 4NAPA 4HCWA 2Y5KA 1US5A 3C34A 4QSCA 3RQTA 3TMGA 4G68C 4PFBA 2R6GE 4ND9A 1TFAA 1B52A 4WEDA 1LCTA 1FJ6A 1FPKA 1QVSA 2O69A 3A3CA 4H6DA 3TTLA 1ZTYA 4ZE9A 4GL0A 4F3PA 2E0SA 3B50A 2PMSA 1KWHA 1LBWA 3HPIA 3OEMA 3VLWA 4IGRA 2QRYA 2DWAA 3V5AA 4AB6A 1ANFA 1EYJA 1FBPA 3N6TA 3K1PA 1DK4A 4WXJA 1FTLA 4DE8A 1FBFA 2Q74A 1PB8A 4I3EA 2I6EA 2YJPA 2RKMA 5JTYA 1D9QA 4P0IA 1FTJA 3KEIA 4F31B 4E0XA 4GF8A 5H8HA 3KZGA 1MXVA 3MP1A 3SEVA 1MXWA 3OSRA 4FATA 1B7HA 2HQ0A 2XXTA 1N84A 2M8CA 3DP4A 3O29A 4NEDA 3U65A 2R9JA 3IR1A 2XX9A 5DVFA 2H98A 4IO6A 4DXUA 4NMYA 2NOOA 3MPKA 3B6QA 5I58B 1DTZA 4JWYA 3ROJA 4WEPA 3PMWA 2ZZWA 3A3UA 3FVOA 1LSTA 3U93A 4NF4A 1N3XA 3FUZA 5CC2A 3DRKA 3MZ1A 5H8QB 5EYGA 3DRJA 1FBHA 2I4BA 5IAIA 3IB0A 3B8BA 2ZZXA 4ELPA 1FBEA 3MZ9A 3TCHA 1PB9A 5F24A 1DCUA 2E1SA 1N04A 2ZYMA 5JK4A 1MQGA 2UVGA 1B4ZA 4JBZA 5HBCA 1NV4A 4P56A 1B3GA 3K6UA 4I1DA 3H7MA 1FPBA 4U4XA 3PPNA 4N81A 3SERA 4GWYA 5ET8A 1UTBA 3ZKKA 2I3WA 1GVCA 3G3KA 4WKMA 5H8FA 1US4A 3IL1B 2O84X 4XIGQ 1D4NA 4LQ5A 1Y4TA 4ZZAA 1N7XA 2DXRA 3I3VA 2Q88A 2RCBA 2QJEA 2X7PA 2HAVA 1JEUA 1AWBA 2A5TA 1BKAA 3GBAA 1JETA 1G0IA 2UVHA 2P1SA 3RYAA 5EHMA 1LLSA 3UGWA 2Z8FA 4RYAA 2QS3A 4G77A 2XX8A 4PETA 2HZLA 1QUKA 4C1TA 3N26A 3ZSFA 1FRPA 3IOTA 3RUMA 4DDDA 1IMCA 4LZ7A 1FCKA 2Q8MA 5A5XB 1UQWA 2UVIA 4QFPA 1MPBA 2VHAA 3T66A 4O3AA 5KZTA 3F11A 1HSJA 2XXQA 4F2QA 4YAHX 1YAEA 2QS4A 4NWDA 4OTEA 3BKIB 3H6WA 2CZHA 4F22A 2DOJA 4NF8B 3RYBA 2X26A 1TFDA 2HAUA 3HHGA 2XWKA 2HCAA 4O8MA 3FASA 2Y7IA 3IJXB 3LC8A 4KR5A 1MQDA 1RDYA 5L9MA 3TCFA 4GX6A 1BLFA 5EYHA 1MY0A 3UA8A 3KOTA 2Z23A 2VGQA 2WOLA 1EYIA 3IOUA 1Q9DA 3GZGA 4RK9A 4X1DA 1MY3A 4YKIA 3S9MC 1NV3A 4YB5A 1VE4A 4FORA 4JVCA 4GXSB 1SYIA 4Z7EA 2NUVA 4KCCA 4QFNA 3SEXA 1S50A 4O3BA 2Y5LA 2PCRA 2NXOA 2Q89A 4UA8A 1NV7A 2WOKA 5ITPA 4MF3A 3CG3A 2Y7RA 3MYUA 3OO6A 3RPLB 4PGPA 2V25A 1UIVA 2DDKA 1S9TA 5ESYA 4IY6A 2VP1A 2FIXA 1EZPA 2R8TA 2XX7A 5AA4A 3DP6A 3U92A 2XHDA 4ZS9A 2FHYA 4H8IA 3IB2A 3S9NC 5FTHA 4OETA 2V84A 2Y7WA 2XWIA 2QS1A 1B0LA 1MS7A 1EH3A 3PAMA 4IO4A 1VR5A 3HCQA 3C33A 4GWSA 3W15C 1UIUA 4FIMA 4ZEIA 1NNTA 1II5A 5LDZA 3EQ1A 3E78A 1FBGA 2DSFA 5EHSA 4MMPA 3PUZE 4KHZE 4PP0A 4R2BA 5I59A 3CG1A 5CMKA 5CI5A 1MDP1 2CZLA 3OENA 4OFLA 1FPEA 4F1YA 4MNPA 1FTAA 1MXYA 3B6TA 3IX1A 1P1NA 4RPOA 3PUYE 4BDLA 1LGBC 3M3KA 3K1MA 4FBPA 2F7CA 2ONSA 1POTA 2G29A 2B4LA 1YZ0A 1NH8A 2V3QA 1LBCA 4LVQA 2PYYA 3G7WA 4HXVA 5L8DA 2F3DA 1MQHA 4THIA 3MSTA 4O94A 1I6QA 2NWJA 4LZ5A 4Q8RA 2AL4A 1IEJA 2I48A 1A99A 1Y9UA 3HN0A 5H8QA 2O7IA 1UTBB 4NE4A 4PFWA 4GWWA 3H6UA 4LATA 3VV5A 4P1LA 3H03A 4P8BA 2H99A 1B51A 5EYFA 2V4CA 1D3KA 2UXAA 4DZ1A 1B32A 3JV9A 2R71A 3RLFE 1NNFA 3PV0E 3OEKA 5L9OA 1I6AA 4XKQA 3P7IA 3AXFA 5ITOA 2ZMBA 4H5GA 3QYTA 5EQ8A 1OIBA 2XXPA 3SEUA 5BWJA 1OQGA 1R1NA 1SW1A 3PUVE 1FTKA 1CNQA 2REJA 2HPGA 1ZLQA 1PBPA 3PTYA 1JQFA 1SD3A 5ET6A 1RYXA 2OBGA 2DVCA 4OFJA 1RDXA 3T93B 4GBWA 1XVYA 4DCXA 4F29A 3CHGA 4N17A 1IITA 3CFLA 4ZEKA 4GWOA 1SDXA 1LBZA 3RPWA 1BP5A 1EZOA 1ATGA 4PBQA 1B46A 3TTNA 5DT6A 5FHMA 4IO2A 1NUYA 1LBYA 2OK2A 1LCFA 4MJOA 4I40A 1QGXA 1IZ1A 1JW1A 5A5XA 4N91A 1P1WA 4EQ9A 2ZYKA 4OVQA 5CMCA 3Q25A 3M3FA 4HCYA 2GQ1A 1FQFA 4ECFA 4R9FA 2QSXA 1I69A 3DP8A 2NVUB 5DVIA 2HXRA 3RTWB 1SYHA 1LAFE 4OWDA 1TWYA 2FNCA 4P11A 5B70A 3C9HA 3OOAA 3N94A 4G8NA 4F3GA 2Q9TA 2CZIA 4HS7A 1K9ZA 4OVPA 2D5WA 3GXAA 3W9WA 4BLAA 2UYFA 1LAXA 2XXKA 4XTCQ 3Q27A 3H4ZA 4JWOA 3LSXA 2DXYA 3SDFA 1I6BA 3TFLA 5AA4B 4X8RA 2XWVA 3T0JA 4NGUA 5CMMA 2ONRA 1JVXA 4P1EA 4PFIA 4FECA 2KR0A 1URGA 1POY1 3FXBA 1Y4CA 1MH4A 1LB8A 2WBBA 1QUIA 1Q1KA 1D9VA 3RPLA 4PQJA 2WKYA 1FQDA 4Z0IA 3UIFA 4PC9A 3O6GA 5I56A 3IFAA 2V93A 2I3VA 4Q0CA 4FEDA 3TPAA 3VLUA 3FJGA 3K00A 4ZE8A 4PAIA 5LOMA 3K6VA 3LSWA 4UACA 2B4MA 4OENA 4F19A 5I59B 3RY3A 2XXWA 3VXBA 1XOCA 3LUYA 4F18A 3FIRA 3FTOA 3S9LC 4TQUQ 4KPTA 5K2YA 4FE8A 3CFZA 1BIYA 2Y7KA 5CRYA 1NUWA 4EUOA 4C0RA 1NV2A 1IMBA 4NX1A 1XS5A 1J1NA 2WYKA 3TTRA 4F2OA 1HSEA 1B40A 2Z8DA 1GV8A 1B7UA 4ISUA 1VDWA 3V8XB 4HE1A 3VDFA 4O7IA 2DE3A 4ZZEA 1B7ZA 3G3GA 1N76A 4RNSA 4GXAA 1OLAA 3K1NA 4N07A 1B58A 4I8CA 1MQJA 1PBQA 4PDHA 2ALUA 4ELRA 3SKPA 3MP8A 1A40A 5I57A 1OLCA 5AA1A 3VVEA 4AB5A 2WX9A 3UORA 1B3HA 3DRHA 2OWTA 5J1DA 1FTMA 3OD7A 5IZ3B 3CFXA 1AH5A 2D3IA 3FVNA 3R7XA 3FXUA 4PFTA 4PTKA 3BFTA 2H5YA 4YKPA 3O6IA 1M5DA 2GHAA 1L5TA 1FPLA 4X48A 5CBSA 1PDAA 3TAJA 2PT1A 1JEVA 1B1XA 1MM6A 3PD8A 1AL3A 3H6TA 1B5IA 3WAEA 1F9BA 4ESXA 1B9JA 2O68A 4OA4A 5FHOA 1FQCA 1NI9A 5FBPA 4PCDA 2XXHA 2I49A 3O66A 4G2ZA 3RNNA 1M5FA 4KI0E 4YKJA 4P47A 1B3FA 4P3LA 3RT6B 3T9HB 2W7YA 4IGTA 4R6HA 3KBZA 5IZ1A 2Z8EA 3O6HA 2F7BA 3A09A 3VXCA 2QVVA 2XD3A 1CB6A 2F97A 1ZJLA 2H25A 2KQZA 5F7VA 3CSBA 2O7UA 4PFRA 4JB7A 1A54A 1FPGA 2RCAA 1NL5A 3H06B 3Q28A 4YU0A 4I62A 1H3DA 2Q2CA 3G3JA 3EPEA 1B3EA 1USYE 3MVWA 3EHSA 4DXBA 2I58A 3MJNA 4LP2B 3PPRA 3PPPA 2PFYA 1PB7A 4F1VA 1TT1A 3SETA 4QFKA 4GVOA 2YPNA 3PUXE 3PGFA 2HHMA 3VE1B 1MH3A 3G3FA 2DYXA 5T3JA 2QL3A 4TLLB 1M5CA 1R6ZA 3FVGA 3TDJA 1WDNA 3OO8A 3FXRA 1NV1A 3HHFA 4ZDMA 1KA1A 5CBRA 4OVRA 3K4UA 4G8MA 3FV1A 3M3LA 4MH5A 2ZNUA 3T9XB 4DI3D 1OVTA 1AIVA 4FAJA 1VSOA 4OQOA 4HTGA 3TTMA 3EF7A 4KCDA 5I56B 4PGNA 1ELJA 1Z7NE 3MWBA 1NNPA 4EQBA 4KQPA 3E4RA 2QPQA 4XKPA 1LEVA 4Q30B 2DWJA 5IKBA 4LZ8A 1P99A 4JSDA 4BDNA 5BUUA 3FJ7A 1S7YA 2QVUA 5LTCA 3TUSA 3RT8A 3KN8A 1O7TA 3C32A 4BDRA 2WOPA 1P1QA 2IA4A 5TPAA 5AA2A 1MPDA 3H3GA 1MM7A 5CMBA 3QAXA 4JDFA 1LFIA 5ET5A 4PFYA 3IORA 1PC3A 5TP9A 2JJKA 3TQLA 2X7QA 1SI0A 5AA2D 1LBXA 4XXUA 4MBPA 4N4UA 3S9EA 1IMEA 4QHQA 3S4UA 1G0HA 2OX3A 3MVXA 1NFTA 3TKDA 4GBVA 5ELVA 4JVDA 5KDTA 2A5SA 1URDA 4LQ2A 3CIJA 4MFIA 4GWXA 3VVFA 3I6VA 1O63A 3GLBA 4FJPA 4N15A 4BDMA 2LAOA 5I57B 4LN5A 1O64A 1Y3QA 3LBSA 4FEBA 4N8GA 3FVKA 1DBZA 1PEBA 3OMBA 4PDDA 4F1UA 3FATA 4U23A 2V3UA 4IO5A 1IXIA 3GBBA 4TLMB 3T9UA 2F35A 3SEYA 4DLDA 1SQYA 2QMXA 3O2AA 2FYIA 1GGGA 2ONKE 1OQHA 4NF6A 1H76A 3BBRA 1XC1A 1IXGA 2ANJA 2G93A 3RGYA 3QSLA 4MAGA 4G61A 4H5FA 3B6WA 5IZ3A 2UYEA 4F39A 3PPQA 4N13A 4POWA 2DWHA 3MW0A 2ZNTA 3UP9A 2DS9A 3PU5A 1BK4A 2FVZA 4H67A 1SPIA 3O97A 4U22A 4QFLA 1QULA 3PPOA 4R6KA 2HEUA 3CR9A 3E79A 1XVXA 1LB9A 4MCOA 4NN3A 1USYH 2I0BA 4KYSA 3WAFA 1Y20A 1A7LA 4OVSA 3VFJA 4GX3A 3RYDA 1MXXA 4RXLA 2QFLA 5ICQA 1NMUA 1JVYA 3T1BA 2Q2AA 4OVJA 3U72A 4GIZA 4R6YA 1FPIA 3V89B 4H0WA 2THIA 3LSLA 3M8UA 2FBPA 1JNFA 5FTIA 3T22A 5DEXA 4AS4A 4PF8A 5B7DA 1JP4A 2RC9A 4U1OA 4JWXA 1IXCA 1NV0A 3D4GA 4M4GA 3LUZA 4H65A 3MVYA 3OELA 5I2NA 1XI6A 3C35A 1FQBA 4GFRA 3K01A 3N5LA 3LVUA 3QIMA 3QUJA 4EF1A 2AIXA 3HV1A 4LUBA 2B3FA 3K6WA 5ET7A 2PFZA 3KC0A 1ZIUA 1JW4A 3S2VA 3DRFA 3CI8A 5I84A 3KJTA 3CVGA 4RK2A 2OWSA 1Y1ZA 1DMBA 1IQ7A 2XXYA 1SW2A 2XXVA 4QSEA 2CZKA 3IK6B 4GLIA 1NUXA 3QK6A 2ZXTA 3R6UA 4G68B 4LA9A 1UTHB
chains in the Genus database with same CATH topology
4ZEDA 3ODBA 3EN3A 1H44A 3FD3A 1FW0A 3OSQA 4XKNA 4M1VA 1FQEA 1D9YA 3U1OA 3IJOB 4OEVA 1NNKA 1MPCA 1H45A 5TPAB 4R74A 5AA2B 1EU8A 3RTFB 1SW4A 1VFEA 3IO6A 5M2VA 2P2AA 1SVXB 3THIA 1QKAA 2XXXA 5TP9B 3T9VA 2Q8JA 3USDA 1P1UA 4NTLA 1FQAA 2REGA 1XT8A 5ICTA 4NF5A 5KDTB 2I0CA 4MLQA 2F78A 4U21A 5AA3A 1T0KA 3DLNA 5K2XA 4OYVA 2F34A 4LONB 2F7AA 4QF9A 1QKBA 4DIGA 1QJMA 1MQIA 3ZS6A 3KG2A 1Z7ME 4X1BA 1MY1A 3SEWA 3H6VA 2AL5A 1WODA 2HZKA 1M5BA 3U94A 2OCUA 3MZBA 5H8SA 1A55A 4X9TA 1B3LA 4OESA 1A8FA 4NF6B 1OVBA 5KCJA 2ZNSA 4R2FA 1DPEA 4GRKA 2F6GA 4YB6A 4E0WA 2CMOA 2PX1A 3TCGA 4POXA 3KSJA 2DVZA 2XD2A 4TOZA 5H8NB 2XXUA 2H9BA 4OERA 3QXMA 2PBWA 2O51A 2ABHA 4P0GA 1B4HA 4OXVA 3IAZA 3PD9A 4OEUA 4ESWA 3PUWE 1AMFA 4U4SA 5F1QA 2HFBA 4ZECA 5FHNA 2DE4A 4JSOA 1A8EA 3QUFA 3IOWA 3EHUA 1ZBMA 4G8HA 4GL8A 2VD3A 4H8JA 3MAMA 3T96B 1YTVA 5DEXB 4PE5B 4N6PA 4K3FA 4GD5A 3O28A 2ZYNA 2F8DA 3IB1A 2OJTA 3KOSA 3B7DA 1DPPA 1MRPA 5JEIA 1MY4A 5I2NB 3OXNA 4RJZA 1SBPA 5I2KB 3DM0A 3KJ7A 3MUQA 3O9PA 1ZMGA 4I9DA 4Q5TA 4OMBA 3Q29A 1RYOA 3ILUB 2Y7PA 4KYEA 2F36A 3VVDA 1FTOA 2PT2A 2AYSA 1Y3NA 1NKXA 3MC2A 4IB2A 4R75A 3L6HA 3K2DA 4ONYA 3VLVA 4IO7A 3V83A 3KBRA 1LFHA 1Y3PA 1XHYA 4KYDA 3IOVA 3MP6A 1B5HA 4YICA 1QUJA 2QS2A 4RY1A 4YZZA 1N0TA 4G68A 1UTHA 2PVUA 2RC7A 3BFUA 2Z22A 4C1UA 4QSDA 1URSA 1LBBA 1JW5A 3E9XA 4YMAA 3Q26A 3TYHA 2FA7A 2RC8A 1SW5A 3ECRA 3DRGA 2O6AA 2Y84A 3C36A 4JXIA 1VFDA 3MPLA 1HSLA 3OO9A 1SI1A 4NF5B 4H1XA 4ZEFA 1R9QA 2BJJX 3MVZA 3SESA 2KLFA 3N6UA 2DE2A 4EXKA 5JTYB 4ELOA 1GR2A 3DELB 4EXLA 5H8HB 3E3KA 3TODA 3U8QA 3KSXA 1R9LA 1ZKBA 3KN3A 5DYHA 2GFEA 2YLNA 4GOTA 3CSGA 1EZ9A 2GRVA 2B65A 5DTBA 3TELA 4RPNA 1B2HA 1YPNA 1MXUA 2F5XA 5KCJB 2RF1A 3HO7A 3TQWA 3R26A 4ZEBA 1Y1MA 1AOVA 2DQVA 2RINA 4OHNA 1IXHA 3EHTA 4PFUA 2P0SA 4MLVA 4NF4B 4YB7A 4BDOA 2ESNA 2HXWA 3ONMA 5I58A 4OFOA 2I4CA 2XXIA 3K0VA 4OZ9A 2QMWA 1GTKA 2B3BA 4BDQA 3LR1A 4AQ4A 3OO7A 1LAHE 5H8NA 2GH9A 3D4CA 3UN6A 4IO3A 1DOTA 2ZYOA 1CE2A 1LAGE 1IIWA 5H8FB 3G3HA 3K6XA 1WVJA 3G3IA 3DRIA 4O3CA 1IUDA 3C4MA 2XXRA 3JZJA 5AE4A 3TEPA 1B0HA 1B1HA 4YMBA 4DXCA 5HPQA 2UVJA 4QRZA 1NH7A 4GQOA 5CM6A 2A5TB 2OZZA 2GHBA 4U2RA 1B5JA 1M5EA 4XKRA 1LFGA 2VOZA 1B05A 3I5OA 4EF2A 1MY2A 3FZVA 3FXQA 3K02A 5TU0A 1TXFA 4DCYA 5DVJA 1MDQA 1BTJA 3KFMA 4G4PA 4HW8A 2O1LA 3JYRA 4KD5A 4QFOA 3TZAA 4L17A 3MQ9A 3FJMA 1DSNA 1YCJA 4RA1A 1MXZA 3E13X 1N7WA 3W9VA 4R9GA 3TTKA 3C31A 2DWIA 4IY5A 3UK4A 1N3WA 2OLBA 2O1MA 3O6PA 2V3TA 1OMPA 5I2KA 3FV2A 3IO4A 2F6PA 3HSTA 3KGCA 4KFQA 1RKMA 5L9SA 4YKKA 4ELQA 5HM4B 1B6HA 3CRBA 1P1OA 2D21A 1Q35A 3LSFB 1MG1A 3L6GA 3PMXA 3MBPA 4F3SA 4F3BA 1H43A 3ILTB 1ZU0A 1QW0A 4NWCA 3RN8A 3KN7A 3PMVA 4NF8A 4R72A 4EDPA 4U1ZA 2DP8A 1DTGA 3ZKLA 4EQ7A 2H4IA 5ISUA 3FGSA 2IEEA 2VD2A 4R73A 4HCWA 1US5A 3C34A 4QSCA 3RQTA 3TMGA 4G68C 2R6GE 4ND9A 1TFAA 1B52A 4WEDA 1LCTA 1QVSA 2O69A 3A3CA 4H6DA 3TTLA 1ZTYA 4ZE9A 4GL0A 4F3PA 2E0SA 2PMSA 1KWHA 3HPIA 3OEMA 3VLWA 4IGRA 2QRYA 2DWAA 3V5AA 4AB6A 1ANFA 4DE8A 3N6TA 3K1PA 4WXJA 1FTLA 1PB8A 2I6EA 2YJPA 2RKMA 5JTYA 4P0IA 1FTJA 3KEIA 4F31B 4E0XA 4GF8A 5H8HA 3KZGA 1MXVA 3MP1A 3SEVA 1MXWA 3OSRA 4FATA 1B7HA 2HQ0A 2XXTA 1N84A 2M8CA 3DP4A 3O29A 4NEDA 2R9JA 3IR1A 2XX9A 5DVFA 2H98A 4IO6A 4DXUA 4NMYA 2NOOA 3MPKA 3B6QA 5I58B 1DTZA 4JWYA 4WEPA 3PMWA 3A3UA 3FVOA 1LSTA 3U93A 4NF4A 1N3XA 3FUZA 5CC2A 3DRKA 3MZ1A 5H8QB 3DRJA 2I4BA 5IAIA 3IB0A 4ELPA 3MZ9A 3TCHA 1PB9A 2E1SA 1N04A 2ZYMA 5JK4A 1MQGA 2UVGA 1B4ZA 4JBZA 5HBCA 1B3GA 3K6UA 4I1DA 3H7MA 3SERA 4U4XA 3PPNA 1UTBA 3ZKKA 2I3WA 1GVCA 3G3KA 4WKMA 5H8FA 1US4A 3IL1B 2O84X 4XIGQ 1D4NA 4LQ5A 1Y4TA 4ZZAA 1N7XA 2DXRA 3I3VA 2Q88A 2RCBA 2QJEA 2X7PA 2HAVA 1JEUA 2A5TA 1BKAA 3GBAA 1JETA 2UVHA 2P1SA 3RYAA 5EHMA 1LLSA 3UGWA 2Z8FA 4RYAA 2QS3A 4G77A 2XX8A 4PETA 2HZLA 1QUKA 4C1TA 3N26A 3ZSFA 3IOTA 3RUMA 4DDDA 4LZ7A 1FCKA 5A5XB 1UQWA 2UVIA 4QFPA 1MPBA 2VHAA 3T66A 4O3AA 5KZTA 3F11A 1HSJA 2XXQA 4F2QA 4YAHX 1YAEA 2QS4A 4NWDA 4OTEA 3BKIB 3H6WA 4F22A 2DOJA 4NF8B 3RYBA 2X26A 1TFDA 2HAUA 3HHGA 2HCAA 3FASA 2Y7IA 3IJXB 3LC8A 4KR5A 1MQDA 5L9MA 3TCFA 1BLFA 1MY0A 3UA8A 3KOTA 2Z23A 2VGQA 2WOLA 3IOUA 3GZGA 4RK9A 4X1DA 1MY3A 4YKIA 3S9MC 4YB5A 1VE4A 4FORA 4GXSB 1SYIA 4Z7EA 2NUVA 4KCCA 4QFNA 3SEXA 1S50A 4O3BA 2NXOA 2Q89A 4UA8A 2WOKA 5ITPA 4MF3A 3CG3A 2Y7RA 3OO6A 2V25A 1UIVA 1S9TA 4IY6A 2VP1A 1EZPA 2XX7A 5AA4A 3DP6A 3U92A 2XHDA 4ZS9A 4H8IA 3IB2A 3S9NC 5FTHA 4OETA 2V84A 2Y7WA 2QS1A 1B0LA 1MS7A 1EH3A 3PAMA 4IO4A 1VR5A 3HCQA 3C33A 3W15C 1UIUA 4FIMA 4ZEIA 1NNTA 1II5A 3EQ1A 2DSFA 5EHSA 3PUZE 4KHZE 4PP0A 4R2BA 5I59A 3CG1A 5CMKA 5CI5A 1MDP1 2CZLA 3OENA 4OFLA 4F1YA 1MXYA 3B6TA 3IX1A 1P1NA 4RPOA 3PUYE 4BDLA 1LGBC 3M3KA 3K1MA 2F7CA 2ONSA 1POTA 2G29A 2B4LA 1NH8A 2V3QA 1LBCA 4LVQA 2PYYA 3G7WA 5L8DA 1MQHA 4THIA 1I6QA 2NWJA 4LZ5A 4Q8RA 2AL4A 1IEJA 2I48A 1A99A 1Y9UA 3HN0A 5H8QA 2O7IA 1UTBB 4NE4A 4PFWA 3H6UA 4LATA 3VV5A 3H03A 2H99A 1B51A 5EYFA 1D3KA 2UXAA 4DZ1A 1B32A 3JV9A 2R71A 3RLFE 1NNFA 3PV0E 3OEKA 5L9OA 4XKQA 1I6AA 3P7IA 3AXFA 5ITOA 2ZMBA 4H5GA 3QYTA 1OIBA 2XXPA 3SEUA 5BWJA 1OQGA 1R1NA 1SW1A 3PUVE 1FTKA 2REJA 1ZLQA 1PBPA 1JQFA 1SD3A 1RYXA 2OBGA 2DVCA 4OFJA 3T93B 1XVYA 4DCXA 4F29A 3CHGA 1IITA 3CFLA 4ZEKA 4GWOA 1SDXA 3RPWA 1BP5A 1EZOA 1ATGA 1B46A 3TTNA 5DT6A 5FHMA 4IO2A 2OK2A 1LCFA 1IZ1A 1JW1A 5A5XA 1P1WA 4EQ9A 2ZYKA 5CMCA 3Q25A 3M3FA 4HCYA 1FQFA 4ECFA 4R9FA 2QSXA 1I69A 3DP8A 2NVUB 5DVIA 3RTWB 1SYHA 1LAFE 4OWDA 1TWYA 2FNCA 4P11A 5B70A 3C9HA 3OOAA 3N94A 4G8NA 4F3GA 2Q9TA 4HS7A 2D5WA 3GXAA 3W9WA 4BLAA 2UYFA 1LAXA 4XTCQ 3Q27A 3H4ZA 4JWOA 3LSXA 2DXYA 3SDFA 1I6BA 3TFLA 5AA4B 5CMMA 2ONRA 1JVXA 4FECA 1URGA 1POY1 1Y4CA 1MH4A 1LB8A 1QUIA 1Q1KA 1D9VA 4PQJA 2WKYA 1FQDA 4Z0IA 3UIFA 3O6GA 5I56A 2V93A 2I3VA 4Q0CA 4FEDA 3TPAA 3VLUA 3FJGA 3K00A 4ZE8A 5LOMA 3K6VA 3LSWA 4UACA 2B4MA 4OENA 4F19A 5I59B 3RY3A 2XXWA 3VXBA 1XOCA 3LUYA 4F18A 3FIRA 3FTOA 3S9LC 4TQUQ 4KPTA 5K2YA 4FE8A 3CFZA 1BIYA 2Y7KA 5CRYA 4EUOA 4C0RA 1XS5A 1J1NA 3TTRA 4F2OA 1HSEA 1B40A 2Z8DA 1GV8A 1B7UA 4ISUA 3VDFA 3V8XB 4ZZEA 2DE3A 1B7ZA 3G3GA 1N76A 4RNSA 4GXAA 1OLAA 3K1NA 4N07A 1B58A 4I8CA 1MQJA 1PBQA 2ALUA 4ELRA 3SKPA 3MP8A 1A40A 5I57A 1OLCA 5AA1A 3VVEA 4AB5A 3UORA 1B3HA 3DRHA 2OWTA 5J1DA 1FTMA 3OD7A 3CFXA 1AH5A 2D3IA 3FVNA 3R7XA 3FXUA 4PFTA 3BFTA 2H5YA 4YKPA 3O6IA 1M5DA 2GHAA 1L5TA 4X48A 5CBSA 1PDAA 3TAJA 2PT1A 1JEVA 1B1XA 1MM6A 3PD8A 1AL3A 3H6TA 1B5IA 3WAEA 1F9BA 4ESXA 1B9JA 2O68A 5FHOA 1FQCA 2XXHA 2I49A 3O66A 4G2ZA 3RNNA 1M5FA 4KI0E 4YKJA 1B3FA 3RT6B 3T9HB 2W7YA 4IGTA 4R6HA 2Z8EA 3O6HA 2F7BA 3A09A 3VXCA 2XD3A 1CB6A 2F97A 1ZJLA 2H25A 5F7VA 3CSBA 2O7UA 4JB7A 1A54A 2RCAA 1NL5A 3H06B 3Q28A 4YU0A 4I62A 1H3DA 2Q2CA 3G3JA 3EPEA 1B3EA 1USYE 3MVWA 3EHSA 4DXBA 2I58A 3MJNA 4LP2B 3PPRA 3PPPA 1PB7A 4F1VA 1TT1A 3SETA 4QFKA 4GVOA 2YPNA 3PUXE 3PGFA 3VE1B 1MH3A 3G3FA 2DYXA 2QL3A 4TLLB 1M5CA 1R6ZA 3FVGA 3TDJA 1WDNA 3OO8A 3FXRA 3HHFA 4ZDMA 5CBRA 3K4UA 4G8MA 3FV1A 3M3LA 4MH5A 2ZNUA 3T9XB 1OVTA 1AIVA 4FAJA 1VSOA 4OQOA 4HTGA 3TTMA 3EF7A 4KCDA 5I56B 1ELJA 1Z7NE 3MWBA 1NNPA 4EQBA 4KQPA 3E4RA 2QPQA 4XKPA 4Q30B 2DWJA 5IKBA 4LZ8A 1P99A 4JSDA 4BDNA 5BUUA 3FJ7A 1S7YA 3TUSA 3RT8A 3KN8A 1O7TA 3C32A 4BDRA 2WOPA 1P1QA 2IA4A 5TPAA 5AA2A 1MPDA 3H3GA 1MM7A 5CMBA 3QAXA 4JDFA 1LFIA 4PFYA 3IORA 1PC3A 5TP9A 3TQLA 2X7QA 1SI0A 5AA2D 4XXUA 4MBPA 3S9EA 4QHQA 3S4UA 3MVXA 1NFTA 3TKDA 5ELVA 5KDTA 2A5SA 1URDA 4LQ2A 3CIJA 4MFIA 3VVFA 3I6VA 1O63A 3GLBA 4FJPA 4BDMA 2LAOA 5I57B 1O64A 1Y3QA 3LBSA 4FEBA 3FVKA 1PEBA 3OMBA 4F1UA 3FATA 4U23A 2V3UA 4IO5A 1IXIA 3GBBA 4TLMB 3T9UA 2F35A 3SEYA 4DLDA 1SQYA 2QMXA 3O2AA 2FYIA 1GGGA 2ONKE 1OQHA 4NF6A 1H76A 3BBRA 1XC1A 1IXGA 2ANJA 2G93A 3RGYA 3QSLA 4H5FA 3B6WA 2UYEA 4F39A 3PPQA 4N13A 4POWA 2DWHA 3MW0A 2ZNTA 3UP9A 2DS9A 3PU5A 4H67A 3O97A 4U22A 4QFLA 1QULA 3PPOA 4R6KA 2HEUA 3CR9A 1XVXA 1LB9A 1USYH 2I0BA 4KYSA 3WAFA 1Y20A 1A7LA 3VFJA 1MXXA 4RXLA 5ICQA 1NMUA 1JVYA 2Q2AA 4OVJA 3U72A 4GIZA 4R6YA 3V89B 4H0WA 2THIA 3LSLA 3M8UA 1JNFA 5FTIA 3T22A 5DEXA 5B7DA 2RC9A 4U1OA 4JWXA 1IXCA 3D4GA 4M4GA 4H65A 3MVYA 3OELA 5I2NA 3C35A 1FQBA 4GFRA 3K01A 3N5LA 3LVUA 3QIMA 3QUJA 4EF1A 2AIXA 3HV1A 4LUBA 2B3FA 3K6WA 1ZIUA 1JW4A 3S2VA 3DRFA 3CI8A 5I84A 3KJTA 3CVGA 4RK2A 2OWSA 1Y1ZA 1DMBA 1IQ7A 2XXYA 1SW2A 2XXVA 4QSEA 3IK6B 4GLIA 3QK6A 2ZXTA 3R6UA 4G68B 4LA9A 1UTHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZED A;  3ODB A;  3EN3 A;  1H44 A;  3FD3 A;  1FW0 A;  3OSQ A;  4XKN A;  4M1V A;  1FQE A;  1D9Y A;  3U1O A;  3IJO B;  4OEV A;  1NNK A;  1MPC A;  1H45 A;  5TPA B;  4R74 A;  5AA2 B;  1EU8 A;  3RTF B;  1SW4 A;  1VFE A;  3IO6 A;  5M2V A;  2P2A A;  1SVX B;  3THI A;  1QKA A;  2XXX A;  5TP9 B;  3T9V A;  2Q8J A;  3USD A;  1P1U A;  4NTL A;  1FQA A;  2REG A;  1XT8 A;  5ICT A;  4NF5 A;  5KDT B;  2I0C A;  4MLQ A;  2F78 A;  4U21 A;  5AA3 A;  1T0K A;  3DLN A;  5K2X A;  4OYV A;  2F34 A;  4LON B;  2F7A A;  4QF9 A;  1QKB A;  4DIG A;  1QJM A;  1MQI A;  3ZS6 A;  3KG2 A;  1Z7M E;  4X1B A;  1MY1 A;  3SEW A;  3H6V A;  2AL5 A;  1WOD A;  2HZK A;  1M5B A;  3U94 A;  2OCU A;  3MZB A;  5H8S A;  1A55 A;  4X9T A;  1B3L A;  4OES A;  1A8F A;  4NF6 B;  1OVB A;  5KCJ A;  2ZNS A;  4R2F A;  1DPE A;  4GRK A;  2F6G A;  4YB6 A;  4E0W A;  2CMO A;  2PX1 A;  3TCG A;  4POX A;  3KSJ A;  2DVZ A;  2XD2 A;  4TOZ A;  5H8N B;  2XXU A;  2H9B A;  4OER A;  3QXM A;  2PBW A;  2O51 A;  2ABH A;  4P0G A;  1B4H A;  4OXV A;  3IAZ A;  3PD9 A;  4OEU A;  4ESW A;  3PUW E;  1AMF A;  4U4S A;  5F1Q A;  2HFB A;  4ZEC A;  5FHN A;  2DE4 A;  4JSO A;  1A8E A;  3QUF A;  3IOW A;  3EHU A;  1ZBM A;  4G8H A;  4GL8 A;  2VD3 A;  4H8J A;  3MAM A;  3T96 B;  1YTV A;  5DEX B;  4PE5 B;  4N6P A;  4K3F A;  4GD5 A;  3O28 A;  2ZYN A;  2F8D A;  3IB1 A;  2OJT A;  3KOS A;  3B7D A;  1DPP A;  1MRP A;  5JEI A;  1MY4 A;  5I2N B;  3OXN A;  4RJZ A;  1SBP A;  5I2K B;  3DM0 A;  3KJ7 A;  3MUQ A;  3O9P A;  1ZMG A;  4I9D A;  4Q5T A;  4OMB A;  3Q29 A;  1RYO A;  3ILU B;  2Y7P A;  4KYE A;  2F36 A;  3VVD A;  1FTO A;  2PT2 A;  2AYS A;  1Y3N A;  1NKX A;  3MC2 A;  4IB2 A;  4R75 A;  3L6H A;  3K2D A;  4ONY A;  3VLV A;  4IO7 A;  3V83 A;  3KBR A;  1LFH A;  1Y3P A;  1XHY A;  4KYD A;  3IOV A;  3MP6 A;  1B5H A;  4YIC A;  1QUJ A;  2QS2 A;  4RY1 A;  4YZZ A;  1N0T A;  4G68 A;  1UTH A;  2PVU A;  2RC7 A;  3BFU A;  2Z22 A;  4C1U A;  4QSD A;  1URS A;  1LBB A;  1JW5 A;  3E9X A;  4YMA A;  3Q26 A;  3TYH A;  2FA7 A;  2RC8 A;  1SW5 A;  3ECR A;  3DRG A;  2O6A A;  2Y84 A;  3C36 A;  4JXI A;  1VFD A;  3MPL A;  1HSL A;  3OO9 A;  1SI1 A;  4NF5 B;  4H1X A;  4ZEF A;  1R9Q A;  2BJJ X;  3MVZ A;  3SES A;  2KLF A;  3N6U A;  2DE2 A;  4EXK A;  5JTY B;  4ELO A;  1GR2 A;  3DEL B;  4EXL A;  5H8H B;  3E3K A;  3TOD A;  3U8Q A;  3KSX A;  1R9L A;  1ZKB A;  3KN3 A;  5DYH A;  2GFE A;  2YLN A;  4GOT A;  3CSG A;  1EZ9 A;  2GRV A;  2B65 A;  5DTB A;  3TEL A;  4RPN A;  1B2H A;  1YPN A;  1MXU A;  2F5X A;  5KCJ B;  2RF1 A;  3HO7 A;  3TQW A;  3R26 A;  4ZEB A;  1Y1M A;  1AOV A;  2DQV A;  2RIN A;  4OHN A;  1IXH A;  3EHT A;  4PFU A;  2P0S A;  4MLV A;  4NF4 B;  4YB7 A;  4BDO A;  2ESN A;  2HXW A;  3ONM A;  5I58 A;  4OFO A;  2I4C A;  2XXI A;  3K0V A;  4OZ9 A;  2QMW A;  1GTK A;  2B3B A;  4BDQ A;  3LR1 A;  4AQ4 A;  3OO7 A;  1LAH E;  5H8N A;  2GH9 A;  3D4C A;  3UN6 A;  4IO3 A;  1DOT A;  2ZYO A;  1CE2 A;  1LAG E;  1IIW A;  5H8F B;  3G3H A;  3K6X A;  1WVJ A;  3G3I A;  3DRI A;  4O3C A;  1IUD A;  3C4M A;  2XXR A;  3JZJ A;  5AE4 A;  3TEP A;  1B0H A;  1B1H A;  4YMB A;  4DXC A;  5HPQ A;  2UVJ A;  4QRZ A;  1NH7 A;  4GQO A;  5CM6 A;  2A5T B;  2OZZ A;  2GHB A;  4U2R A;  1B5J A;  1M5E A;  4XKR A;  1LFG A;  2VOZ A;  1B05 A;  3I5O A;  4EF2 A;  1MY2 A;  3FZV A;  3FXQ A;  3K02 A;  5TU0 A;  1TXF A;  4DCY A;  5DVJ A;  1MDQ A;  1BTJ A;  3KFM A;  4G4P A;  4HW8 A;  2O1L A;  3JYR A;  4KD5 A;  4QFO A;  3TZA A;  4L17 A;  3MQ9 A;  3FJM A;  1DSN A;  1YCJ A;  4RA1 A;  1MXZ A;  3E13 X;  1N7W A;  3W9V A;  4R9G A;  3TTK A;  3C31 A;  2DWI A;  4IY5 A;  3UK4 A;  1N3W A;  2OLB A;  2O1M A;  3O6P A;  2V3T A;  1OMP A;  5I2K A;  3FV2 A;  3IO4 A;  2F6P A;  3HST A;  3KGC A;  4KFQ A;  1RKM A;  5L9S A;  4YKK A;  4ELQ A;  5HM4 B;  1B6H A;  3CRB A;  1P1O A;  2D21 A;  1Q35 A;  3LSF B;  1MG1 A;  3L6G A;  3PMX A;  3MBP A;  4F3S A;  4F3B A;  1H43 A;  3ILT B;  1ZU0 A;  1QW0 A;  4NWC A;  3RN8 A;  3KN7 A;  3PMV A;  4NF8 A;  4R72 A;  4EDP A;  4U1Z A;  2DP8 A;  1DTG A;  3ZKL A;  4EQ7 A;  2H4I A;  5ISU A;  3FGS A;  2IEE A;  2VD2 A;  4R73 A;  4HCW A;  1US5 A;  3C34 A;  4QSC A;  3RQT A;  3TMG A;  4G68 C;  2R6G E;  4ND9 A;  1TFA A;  1B52 A;  4WED A;  1LCT A;  1QVS A;  2O69 A;  3A3C A;  4H6D A;  3TTL A;  1ZTY A;  4ZE9 A;  4GL0 A;  4F3P A;  2E0S A;  2PMS A;  1KWH A;  3HPI A;  3OEM A;  3VLW A;  4IGR A;  2QRY A;  2DWA A;  3V5A A;  4AB6 A;  1ANF A;  4DE8 A;  3N6T A;  3K1P A;  4WXJ A;  1FTL A;  1PB8 A;  2I6E A;  2YJP A;  2RKM A;  5JTY A;  4P0I A;  1FTJ A;  3KEI A;  4F31 B;  4E0X A;  4GF8 A;  5H8H A;  3KZG A;  1MXV A;  3MP1 A;  3SEV A;  1MXW A;  3OSR A;  4FAT A;  1B7H A;  2HQ0 A;  2XXT A;  1N84 A;  2M8C A;  3DP4 A;  3O29 A;  4NED A;  2R9J A;  3IR1 A;  2XX9 A;  5DVF A;  2H98 A;  4IO6 A;  4DXU A;  4NMY A;  2NOO A;  3MPK A;  3B6Q A;  5I58 B;  1DTZ A;  4JWY A;  4WEP A;  3PMW A;  3A3U A;  3FVO A;  1LST A;  3U93 A;  4NF4 A;  1N3X A;  3FUZ A;  5CC2 A;  3DRK A;  3MZ1 A;  5H8Q B;  3DRJ A;  2I4B A;  5IAI A;  3IB0 A;  4ELP A;  3MZ9 A;  3TCH A;  1PB9 A;  2E1S A;  1N04 A;  2ZYM A;  5JK4 A;  1MQG A;  2UVG A;  1B4Z A;  4JBZ A;  5HBC A;  1B3G A;  3K6U A;  4I1D A;  3H7M A;  3SER A;  4U4X A;  3PPN A;  1UTB A;  3ZKK A;  2I3W A;  1GVC A;  3G3K A;  4WKM A;  5H8F A;  1US4 A;  3IL1 B;  2O84 X;  4XIG Q;  1D4N A;  4LQ5 A;  1Y4T A;  4ZZA A;  1N7X A;  2DXR A;  3I3V A;  2Q88 A;  2RCB A;  2QJE A;  2X7P A;  2HAV A;  1JEU A;  2A5T A;  1BKA A;  3GBA A;  1JET A;  2UVH A;  2P1S A;  3RYA A;  5EHM A;  1LLS A;  3UGW A;  2Z8F A;  4RYA A;  2QS3 A;  4G77 A;  2XX8 A;  4PET A;  2HZL A;  1QUK A;  4C1T A;  3N26 A;  3ZSF A;  3IOT A;  3RUM A;  4DDD A;  4LZ7 A;  1FCK A;  5A5X B;  1UQW A;  2UVI A;  4QFP A;  1MPB A;  2VHA A;  3T66 A;  4O3A A;  5KZT A;  3F11 A;  1HSJ A;  2XXQ A;  4F2Q A;  4YAH X;  1YAE A;  2QS4 A;  4NWD A;  4OTE A;  3BKI B;  3H6W A;  4F22 A;  2DOJ A;  4NF8 B;  3RYB A;  2X26 A;  1TFD A;  2HAU A;  3HHG A;  2HCA A;  3FAS A;  2Y7I A;  3IJX B;  3LC8 A;  4KR5 A;  1MQD A;  5L9M A;  3TCF A;  1BLF A;  1MY0 A;  3UA8 A;  3KOT A;  2Z23 A;  2VGQ A;  2WOL A;  3IOU A;  3GZG A;  4RK9 A;  4X1D A;  1MY3 A;  4YKI A;  3S9M C;  4YB5 A;  1VE4 A;  4FOR A;  4GXS B;  1SYI A;  4Z7E A;  2NUV A;  4KCC A;  4QFN A;  3SEX A;  1S50 A;  4O3B A;  2NXO A;  2Q89 A;  4UA8 A;  2WOK A;  5ITP A;  4MF3 A;  3CG3 A;  2Y7R A;  3OO6 A;  2V25 A;  1UIV A;  1S9T A;  4IY6 A;  2VP1 A;  1EZP A;  2XX7 A;  5AA4 A;  3DP6 A;  3U92 A;  2XHD A;  4ZS9 A;  4H8I A;  3IB2 A;  3S9N C;  5FTH A;  4OET A;  2V84 A;  2Y7W A;  2QS1 A;  1B0L A;  1MS7 A;  1EH3 A;  3PAM A;  4IO4 A;  1VR5 A;  3HCQ A;  3C33 A;  3W15 C;  1UIU A;  4FIM A;  4ZEI A;  1NNT A;  1II5 A;  3EQ1 A;  2DSF A;  5EHS A;  3PUZ E;  4KHZ E;  4PP0 A;  4R2B A;  5I59 A;  3CG1 A;  5CMK A;  5CI5 A;  1MDP 1;  2CZL A;  3OEN A;  4OFL A;  4F1Y A;  1MXY A;  3B6T A;  3IX1 A;  1P1N A;  4RPO A;  3PUY E;  4BDL A;  1LGB C;  3M3K A;  3K1M A;  2F7C A;  2ONS A;  1POT A;  2G29 A;  2B4L A;  1NH8 A;  2V3Q A;  1LBC A;  4LVQ A;  2PYY A;  3G7W A;  5L8D A;  1MQH A;  4THI A;  1I6Q A;  2NWJ A;  4LZ5 A;  4Q8R A;  2AL4 A;  1IEJ A;  2I48 A;  1A99 A;  1Y9U A;  3HN0 A;  5H8Q A;  2O7I A;  1UTB B;  4NE4 A;  4PFW A;  3H6U A;  4LAT A;  3VV5 A;  3H03 A;  2H99 A;  1B51 A;  5EYF A;  1D3K A;  2UXA A;  4DZ1 A;  1B32 A;  3JV9 A;  2R71 A;  3RLF E;  1NNF A;  3PV0 E;  3OEK A;  5L9O A;  4XKQ A;  1I6A A;  3P7I A;  3AXF A;  5ITO A;  2ZMB A;  4H5G A;  3QYT A;  1OIB A;  2XXP A;  3SEU A;  5BWJ A;  1OQG A;  1R1N A;  1SW1 A;  3PUV E;  1FTK A;  2REJ A;  1ZLQ A;  1PBP A;  1JQF A;  1SD3 A;  1RYX A;  2OBG A;  2DVC A;  4OFJ A;  3T93 B;  1XVY A;  4DCX A;  4F29 A;  3CHG A;  1IIT A;  3CFL A;  4ZEK A;  4GWO A;  1SDX A;  3RPW A;  1BP5 A;  1EZO A;  1ATG A;  1B46 A;  3TTN A;  5DT6 A;  5FHM A;  4IO2 A;  2OK2 A;  1LCF A;  1IZ1 A;  1JW1 A;  5A5X A;  1P1W A;  4EQ9 A;  2ZYK A;  5CMC A;  3Q25 A;  3M3F A;  4HCY A;  1FQF A;  4ECF A;  4R9F A;  2QSX A;  1I69 A;  3DP8 A;  2NVU B;  5DVI A;  3RTW B;  1SYH A;  1LAF E;  4OWD A;  1TWY A;  2FNC A;  4P11 A;  5B70 A;  3C9H A;  3OOA A;  3N94 A;  4G8N A;  4F3G A;  2Q9T A;  4HS7 A;  2D5W A;  3GXA A;  3W9W A;  4BLA A;  2UYF A;  1LAX A;  4XTC Q;  3Q27 A;  3H4Z A;  4JWO A;  3LSX A;  2DXY A;  3SDF A;  1I6B A;  3TFL A;  5AA4 B;  5CMM A;  2ONR A;  1JVX A;  4FEC A;  1URG A;  1POY 1;  1Y4C A;  1MH4 A;  1LB8 A;  1QUI A;  1Q1K A;  1D9V A;  4PQJ A;  2WKY A;  1FQD A;  4Z0I A;  3UIF A;  3O6G A;  5I56 A;  2V93 A;  2I3V A;  4Q0C A;  4FED A;  3TPA A;  3VLU A;  3FJG A;  3K00 A;  4ZE8 A;  5LOM A;  3K6V A;  3LSW A;  4UAC A;  2B4M A;  4OEN A;  4F19 A;  5I59 B;  3RY3 A;  2XXW A;  3VXB A;  1XOC A;  3LUY A;  4F18 A;  3FIR A;  3FTO A;  3S9L C;  4TQU Q;  4KPT A;  5K2Y A;  4FE8 A;  3CFZ A;  1BIY A;  2Y7K A;  5CRY A;  4EUO A;  4C0R A;  1XS5 A;  1J1N A;  3TTR A;  4F2O A;  1HSE A;  1B40 A;  2Z8D A;  1GV8 A;  1B7U A;  4ISU A;  3VDF A;  3V8X B;  4ZZE A;  2DE3 A;  1B7Z A;  3G3G A;  1N76 A;  4RNS A;  4GXA A;  1OLA A;  3K1N A;  4N07 A;  1B58 A;  4I8C A;  1MQJ A;  1PBQ A;  2ALU A;  4ELR A;  3SKP A;  3MP8 A;  1A40 A;  5I57 A;  1OLC A;  5AA1 A;  3VVE A;  4AB5 A;  3UOR A;  1B3H A;  3DRH A;  2OWT A;  5J1D A;  1FTM A;  3OD7 A;  3CFX A;  1AH5 A;  2D3I A;  3FVN A;  3R7X A;  3FXU A;  4PFT A;  3BFT A;  2H5Y A;  4YKP A;  3O6I A;  1M5D A;  2GHA A;  1L5T A;  4X48 A;  5CBS A;  1PDA A;  3TAJ A;  2PT1 A;  1JEV A;  1B1X A;  1MM6 A;  3PD8 A;  1AL3 A;  3H6T A;  1B5I A;  3WAE A;  1F9B A;  4ESX A;  1B9J A;  2O68 A;  5FHO A;  1FQC A;  2XXH A;  2I49 A;  3O66 A;  4G2Z A;  3RNN A;  1M5F A;  4KI0 E;  4YKJ A;  1B3F A;  3RT6 B;  3T9H B;  2W7Y A;  4IGT A;  4R6H A;  2Z8E A;  3O6H A;  2F7B A;  3A09 A;  3VXC A;  2XD3 A;  1CB6 A;  2F97 A;  1ZJL A;  2H25 A;  5F7V A;  3CSB A;  2O7U A;  4JB7 A;  1A54 A;  2RCA A;  1NL5 A;  3H06 B;  3Q28 A;  4YU0 A;  4I62 A;  1H3D A;  2Q2C A;  3G3J A;  3EPE A;  1B3E A;  1USY E;  3MVW A;  3EHS A;  4DXB A;  2I58 A;  3MJN A;  4LP2 B;  3PPR A;  3PPP A;  1PB7 A;  4F1V A;  1TT1 A;  3SET A;  4QFK A;  4GVO A;  2YPN A;  3PUX E;  3PGF A;  3VE1 B;  1MH3 A;  3G3F A;  2DYX A;  2QL3 A;  4TLL B;  1M5C A;  1R6Z A;  3FVG A;  3TDJ A;  1WDN A;  3OO8 A;  3FXR A;  3HHF A;  4ZDM A;  5CBR A;  3K4U A;  4G8M A;  3FV1 A;  3M3L A;  4MH5 A;  2ZNU A;  3T9X B;  1OVT A;  1AIV A;  4FAJ A;  1VSO A;  4OQO A;  4HTG A;  3TTM A;  3EF7 A;  4KCD A;  5I56 B;  1ELJ A;  1Z7N E;  3MWB A;  1NNP A;  4EQB A;  4KQP A;  3E4R A;  2QPQ A;  4XKP A;  4Q30 B;  2DWJ A;  5IKB A;  4LZ8 A;  1P99 A;  4JSD A;  4BDN A;  5BUU A;  3FJ7 A;  1S7Y A;  3TUS A;  3RT8 A;  3KN8 A;  1O7T A;  3C32 A;  4BDR A;  2WOP A;  1P1Q A;  2IA4 A;  5TPA A;  5AA2 A;  1MPD A;  3H3G A;  1MM7 A;  5CMB A;  3QAX A;  4JDF A;  1LFI A;  4PFY A;  3IOR A;  1PC3 A;  5TP9 A;  3TQL A;  2X7Q A;  1SI0 A;  5AA2 D;  4XXU A;  4MBP A;  3S9E A;  4QHQ A;  3S4U A;  3MVX A;  1NFT A;  3TKD A;  5ELV A;  5KDT A;  2A5S A;  1URD A;  4LQ2 A;  3CIJ A;  4MFI A;  3VVF A;  3I6V A;  1O63 A;  3GLB A;  4FJP A;  4BDM A;  2LAO A;  5I57 B;  1O64 A;  1Y3Q A;  3LBS A;  4FEB A;  3FVK A;  1PEB A;  3OMB A;  4F1U A;  3FAT A;  4U23 A;  2V3U A;  4IO5 A;  1IXI A;  3GBB A;  4TLM B;  3T9U A;  2F35 A;  3SEY A;  4DLD A;  1SQY A;  2QMX A;  3O2A A;  2FYI A;  1GGG A;  2ONK E;  1OQH A;  4NF6 A;  1H76 A;  3BBR A;  1XC1 A;  1IXG A;  2ANJ A;  2G93 A;  3RGY A;  3QSL A;  4H5F A;  3B6W A;  2UYE A;  4F39 A;  3PPQ A;  4N13 A;  4POW A;  2DWH A;  3MW0 A;  2ZNT A;  3UP9 A;  2DS9 A;  3PU5 A;  4H67 A;  3O97 A;  4U22 A;  4QFL A;  1QUL A;  3PPO A;  4R6K A;  2HEU A;  3CR9 A;  1XVX A;  1LB9 A;  1USY H;  2I0B A;  4KYS A;  3WAF A;  1Y20 A;  1A7L A;  3VFJ A;  1MXX A;  4RXL A;  5ICQ A;  1NMU A;  1JVY A;  2Q2A A;  4OVJ A;  3U72 A;  4GIZ A;  4R6Y A;  3V89 B;  4H0W A;  2THI A;  3LSL A;  3M8U A;  1JNF A;  5FTI A;  3T22 A;  5DEX A;  5B7D A;  2RC9 A;  4U1O A;  4JWX A;  1IXC A;  3D4G A;  4M4G A;  4H65 A;  3MVY A;  3OEL A;  5I2N A;  3C35 A;  1FQB A;  4GFR A;  3K01 A;  3N5L A;  3LVU A;  3QIM A;  3QUJ A;  4EF1 A;  2AIX A;  3HV1 A;  4LUB A;  2B3F A;  3K6W A;  1ZIU A;  1JW4 A;  3S2V A;  3DRF A;  3CI8 A;  5I84 A;  3KJT A;  3CVG A;  4RK2 A;  2OWS A;  1Y1Z A;  1DMB A;  1IQ7 A;  2XXY A;  1SW2 A;  2XXV A;  4QSE A;  3IK6 B;  4GLI A;  3QK6 A;  2ZXT A;  3R6U A;  4G68 B;  4LA9 A;  1UTH B; 
#chains in the Genus database with same CATH topology
 2WEF A;  1EYK A;  4ZED A;  3ODB A;  3EN3 A;  1H44 A;  3FD3 A;  1FW0 A;  3OSQ A;  4XKN A;  4M1V A;  4MNC A;  1FQE A;  1D9Y A;  3U1O A;  3IJO B;  4OEV A;  1NNK A;  1MPC A;  1H45 A;  1IMF A;  5TPA B;  4R74 A;  5AA2 B;  1EU8 A;  1KZ8 A;  1SW4 A;  1VFE A;  3IO6 A;  5M2V A;  3RTF B;  2P2A A;  1SVX B;  3THI A;  1QKA A;  2XXX A;  4H46 A;  1YXI A;  5TP9 B;  3T9V A;  2Q8J A;  3USD A;  1P1U A;  4NTL A;  4GWU A;  1FQA A;  2REG A;  1XT8 A;  5ICT A;  3A29 A;  4NF5 A;  5KDT B;  2I0C A;  4MLQ A;  2F78 A;  4U21 A;  5AA3 A;  1IMA A;  5DW8 A;  4UAB A;  1T0K A;  3DLN A;  5K2X A;  4OYV A;  2F34 A;  4LON B;  2F7A A;  3QMF A;  4QF9 A;  4I3Y A;  1QKB A;  4OAN A;  4DIG A;  1QJM A;  1MQI A;  3ZS6 A;  3KG2 A;  1Z7M E;  4X1B A;  1MY1 A;  3SEW A;  3EKI A;  3H6V A;  2AL5 A;  4XF5 A;  1WOD A;  2HZK A;  1M5B A;  3U94 A;  5I5P A;  2OCU A;  3MZB A;  5H8S A;  1A55 A;  4X9T A;  5EQA A;  1FBD A;  1B3L A;  2XA5 A;  4PBH A;  4OES A;  1A8F A;  4NF6 B;  1OVB A;  5KCJ A;  2ZNS A;  4R2F A;  1DPE A;  4GRK A;  2F6G A;  4YB6 A;  4E0W A;  2CMO A;  2PX1 A;  3TCG A;  4POX A;  3KSJ A;  2DVZ A;  2XD2 A;  4TOZ A;  5H8N B;  2XXU A;  2H9B A;  4OER A;  3QXM A;  2PBW A;  2O51 A;  2ABH A;  2QVR A;  4MIJ A;  4P0G A;  2CEX A;  4MHF A;  1B4H A;  4OXV A;  3IAZ A;  3PD9 A;  4OEU A;  4ESW A;  4AS5 A;  3PUW E;  1AMF A;  4U4S A;  5F1Q A;  2HFB A;  4ZEC A;  1NV5 A;  2CEY A;  5FHN A;  1LBV A;  2DE4 A;  4JSO A;  1A8E A;  3QUF A;  3IOW A;  4N6K A;  1FSA A;  2F3B A;  3EHU A;  1FPD A;  1ZBM A;  2WBD A;  4G8H A;  4GL8 A;  2VD3 A;  2VPO A;  1FBC A;  4H8J A;  3MAM A;  3T96 B;  1YTV A;  5DEX B;  4PE5 B;  4N6P A;  4K3F A;  4GD5 A;  3O28 A;  2ZYN A;  2F8D A;  3IB1 A;  2OJT A;  3KOS A;  3B7D A;  1DPP A;  1MRP A;  5JEI A;  1MY4 A;  5I2N B;  3OXN A;  4RJZ A;  3GYY A;  1FPF A;  1KA0 A;  1SBP A;  5I2K B;  3DM0 A;  3KJ7 A;  3MUQ A;  3O9P A;  1NV6 A;  1ZMG A;  4I9D A;  4Q5T A;  4NHB A;  4OMB A;  3Q29 A;  3D1R A;  1RYO A;  3ILU B;  2Y7P A;  4KYE A;  2F36 A;  5A5L A;  4GWZ A;  4HE0 A;  3VVD A;  1FTO A;  2PT2 A;  2AYS A;  1Y3N A;  1NKX A;  4NG7 A;  3MC2 A;  4IB2 A;  5IGA A;  4R75 A;  2P3N A;  1IMD A;  2ZZV A;  3L6H A;  3K2D A;  4ONY A;  3VLV A;  4IO7 A;  3LV0 A;  3V83 A;  3KBR A;  4N8Y A;  1LFH A;  1Y3P A;  1XHY A;  4KYD A;  3IOV A;  3MP6 A;  1K9Y A;  1B5H A;  4YIC A;  1QUJ A;  2QS2 A;  4QXD A;  4RY1 A;  4YZZ A;  5EQ9 A;  4MEV A;  1N0T A;  4G68 A;  1UTH A;  2PVU A;  2RC7 A;  3BFU A;  2Z22 A;  4C1U A;  4QSD A;  1URS A;  1LBB A;  1JW5 A;  4OVT A;  4H45 A;  4QBA A;  3E9X A;  4YMA A;  1YYZ A;  3Q26 A;  4P9K A;  3TYH A;  2FA7 A;  2RC8 A;  1SW5 A;  3ECR A;  3DRG A;  2O6A A;  2Y84 A;  3C36 A;  4MX6 A;  4JXI A;  1VFD A;  3MPL A;  1HSL A;  3BIH A;  3OO9 A;  1SI1 A;  4NF5 B;  4H1X A;  4ZEF A;  1R9Q A;  2BJJ X;  3MVZ A;  3SES A;  2KLF A;  3HFU A;  4PF6 A;  3N6U A;  2DE2 A;  4EXK A;  5EQ7 A;  5JTY B;  4ELO A;  1GR2 A;  3DEL B;  4EXL A;  5H8H B;  3E3K A;  3TOD A;  3U8Q A;  3ISP A;  3KSX A;  2WYP A;  4GX4 A;  1R9L A;  2OWZ A;  4NF0 A;  1ZKB A;  3KN3 A;  5DYH A;  2GFE A;  2YLN A;  4GOT A;  4MNI A;  1INP A;  3CSG A;  1EZ9 A;  2GRV A;  2B65 A;  5DTB A;  4RPN A;  1B2H A;  1YPN A;  1MXU A;  2F5X A;  3TEL A;  5J16 A;  5KCJ B;  2RF1 A;  3HO7 A;  2MKZ A;  1NUZ A;  2VPN A;  3TQW A;  3R26 A;  4ZEB A;  1Y1M A;  4HE2 A;  1AOV A;  2DQV A;  2RIN A;  4OHN A;  1IXH A;  2BJI A;  5I7I A;  3EHT A;  4PFU A;  2P0S A;  3IFC A;  4MLV A;  4NF4 B;  4JVI A;  4YB7 A;  4BDO A;  4PAF A;  2ESN A;  2HXW A;  3ONM A;  5I58 A;  4OFO A;  2I4C A;  2XXI A;  3K0V A;  4XEQ A;  4OZ9 A;  2QMW A;  1GTK A;  2B3B A;  4BDQ A;  3LR1 A;  4AQ4 A;  3OO7 A;  1LAH E;  5H8N A;  2GH9 A;  3D4C A;  2P3V A;  3UN6 A;  4IO3 A;  1DOT A;  2ZYO A;  1CE2 A;  1LAG E;  1IIW A;  5H8F B;  3G3H A;  3K6X A;  1WVJ A;  3G3I A;  3DRI A;  4O3C A;  1IUD A;  3C4M A;  2XXR A;  3JZJ A;  2VT5 A;  4X04 A;  5AE4 A;  3TEP A;  1B0H A;  1B1H A;  4PE3 A;  4YMB A;  4DXC A;  5HPQ A;  2UVJ A;  4QRZ A;  1NH7 A;  4GQO A;  5CM6 A;  2A5T B;  2OZZ A;  2GHB A;  4U2R A;  1B5J A;  1M5E A;  4XKR A;  1LFG A;  2VOZ A;  1B05 A;  3I5O A;  4EF2 A;  1MY2 A;  3FZV A;  3FXQ A;  3K02 A;  5TU0 A;  3FBP A;  1TXF A;  4DCY A;  5DVJ A;  5I3S A;  4O7M A;  1MDQ A;  1BTJ A;  1FJ9 A;  3KFM A;  4G4P A;  3NOH A;  3BIG A;  4HW8 A;  2O1L A;  3JYR A;  4KD5 A;  4QFO A;  3TZA A;  4L17 A;  3MQ9 A;  3FJM A;  5IZZ A;  1DSN A;  1YCJ A;  4RA1 A;  1MXZ A;  2L5V A;  3E13 X;  1N7W A;  3W9V A;  4R9G A;  3TTK A;  3C31 A;  2DWI A;  4IY5 A;  3SZP A;  3UK4 A;  1N3W A;  2OLB A;  2O1M A;  4IR8 A;  3O6P A;  2V3T A;  1OMP A;  5I2K A;  3FV2 A;  3IO4 A;  2F6P A;  3HST A;  3KGC A;  4KFQ A;  1RKM A;  5L9S A;  4YKK A;  4ELQ A;  5HM4 B;  1B6H A;  3CRB A;  4KXP A;  4NQ8 A;  1P1O A;  2D21 A;  1Q35 A;  3LSF B;  1MG1 A;  4N6D A;  5IM2 A;  3L6G A;  2FIE A;  4DI4 B;  3PMX A;  3KC1 A;  3MBP A;  4F3S A;  4PAK A;  4XFE A;  4F3B A;  1H43 A;  3ILT B;  1FPJ A;  1ZU0 A;  1QW0 A;  4NWC A;  3RN8 A;  3KN7 A;  3PMV A;  4NF8 A;  4R72 A;  4EDP A;  4U1Z A;  2DP8 A;  1DTG A;  3ZKL A;  4EQ7 A;  2H4I A;  1RDZ A;  5ISU A;  3FGS A;  2IEE A;  2VD2 A;  4R73 A;  2XWO A;  4NAP A;  4HCW A;  2Y5K A;  1US5 A;  3C34 A;  4QSC A;  3RQT A;  3TMG A;  4G68 C;  4PFB A;  2R6G E;  4ND9 A;  1TFA A;  1B52 A;  4WED A;  1LCT A;  1FJ6 A;  1FPK A;  1QVS A;  2O69 A;  3A3C A;  4H6D A;  3TTL A;  1ZTY A;  4ZE9 A;  4GL0 A;  4F3P A;  2E0S A;  3B50 A;  2PMS A;  1KWH A;  1LBW A;  3HPI A;  3OEM A;  3VLW A;  4IGR A;  2QRY A;  2DWA A;  3V5A A;  4AB6 A;  1ANF A;  1EYJ A;  1FBP A;  3N6T A;  3K1P A;  1DK4 A;  4WXJ A;  1FTL A;  4DE8 A;  1FBF A;  2Q74 A;  1PB8 A;  4I3E A;  2I6E A;  2YJP A;  2RKM A;  5JTY A;  1D9Q A;  4P0I A;  1FTJ A;  3KEI A;  4F31 B;  4E0X A;  4GF8 A;  5H8H A;  3KZG A;  1MXV A;  3MP1 A;  3SEV A;  1MXW A;  3OSR A;  4FAT A;  1B7H A;  2HQ0 A;  2XXT A;  1N84 A;  2M8C A;  3DP4 A;  3O29 A;  4NED A;  3U65 A;  2R9J A;  3IR1 A;  2XX9 A;  5DVF A;  2H98 A;  4IO6 A;  4DXU A;  4NMY A;  2NOO A;  3MPK A;  3B6Q A;  5I58 B;  1DTZ A;  4JWY A;  3ROJ A;  4WEP A;  3PMW A;  2ZZW A;  3A3U A;  3FVO A;  1LST A;  3U93 A;  4NF4 A;  1N3X A;  3FUZ A;  5CC2 A;  3DRK A;  3MZ1 A;  5H8Q B;  5EYG A;  3DRJ A;  1FBH A;  2I4B A;  5IAI A;  3IB0 A;  3B8B A;  2ZZX A;  4ELP A;  1FBE A;  3MZ9 A;  3TCH A;  1PB9 A;  5F24 A;  1DCU A;  2E1S A;  1N04 A;  2ZYM A;  5JK4 A;  1MQG A;  2UVG A;  1B4Z A;  4JBZ A;  5HBC A;  1NV4 A;  4P56 A;  1B3G A;  3K6U A;  4I1D A;  3H7M A;  1FPB A;  4U4X A;  3PPN A;  4N81 A;  3SER A;  4GWY A;  5ET8 A;  1UTB A;  3ZKK A;  2I3W A;  1GVC A;  3G3K A;  4WKM A;  5H8F A;  1US4 A;  3IL1 B;  2O84 X;  4XIG Q;  1D4N A;  4LQ5 A;  1Y4T A;  4ZZA A;  1N7X A;  2DXR A;  3I3V A;  2Q88 A;  2RCB A;  2QJE A;  2X7P A;  2HAV A;  1JEU A;  1AWB A;  2A5T A;  1BKA A;  3GBA A;  1JET A;  1G0I A;  2UVH A;  2P1S A;  3RYA A;  5EHM A;  1LLS A;  3UGW A;  2Z8F A;  4RYA A;  2QS3 A;  4G77 A;  2XX8 A;  4PET A;  2HZL A;  1QUK A;  4C1T A;  3N26 A;  3ZSF A;  1FRP A;  3IOT A;  3RUM A;  4DDD A;  1IMC A;  4LZ7 A;  1FCK A;  2Q8M A;  5A5X B;  1UQW A;  2UVI A;  4QFP A;  1MPB A;  2VHA A;  3T66 A;  4O3A A;  5KZT A;  3F11 A;  1HSJ A;  2XXQ A;  4F2Q A;  4YAH X;  1YAE A;  2QS4 A;  4NWD A;  4OTE A;  3BKI B;  3H6W A;  2CZH A;  4F22 A;  2DOJ A;  4NF8 B;  3RYB A;  2X26 A;  1TFD A;  2HAU A;  3HHG A;  2XWK A;  2HCA A;  4O8M A;  3FAS A;  2Y7I A;  3IJX B;  3LC8 A;  4KR5 A;  1MQD A;  1RDY A;  5L9M A;  3TCF A;  4GX6 A;  1BLF A;  5EYH A;  1MY0 A;  3UA8 A;  3KOT A;  2Z23 A;  2VGQ A;  2WOL A;  1EYI A;  3IOU A;  1Q9D A;  3GZG A;  4RK9 A;  4X1D A;  1MY3 A;  4YKI A;  3S9M C;  1NV3 A;  4YB5 A;  1VE4 A;  4FOR A;  4JVC A;  4GXS B;  1SYI A;  4Z7E A;  2NUV A;  4KCC A;  4QFN A;  3SEX A;  1S50 A;  4O3B A;  2Y5L A;  2PCR A;  2NXO A;  2Q89 A;  4UA8 A;  1NV7 A;  2WOK A;  5ITP A;  4MF3 A;  3CG3 A;  2Y7R A;  3MYU A;  3OO6 A;  3RPL B;  4PGP A;  2V25 A;  1UIV A;  2DDK A;  1S9T A;  5ESY A;  4IY6 A;  2VP1 A;  2FIX A;  1EZP A;  2R8T A;  2XX7 A;  5AA4 A;  3DP6 A;  3U92 A;  2XHD A;  4ZS9 A;  2FHY A;  4H8I A;  3IB2 A;  3S9N C;  5FTH A;  4OET A;  2V84 A;  2Y7W A;  2XWI A;  2QS1 A;  1B0L A;  1MS7 A;  1EH3 A;  3PAM A;  4IO4 A;  1VR5 A;  3HCQ A;  3C33 A;  4GWS A;  3W15 C;  1UIU A;  4FIM A;  4ZEI A;  1NNT A;  1II5 A;  5LDZ A;  3EQ1 A;  3E78 A;  1FBG A;  2DSF A;  5EHS A;  4MMP A;  3PUZ E;  4KHZ E;  4PP0 A;  4R2B A;  5I59 A;  3CG1 A;  5CMK A;  5CI5 A;  1MDP 1;  2CZL A;  3OEN A;  4OFL A;  1FPE A;  4F1Y A;  4MNP A;  1FTA A;  1MXY A;  3B6T A;  3IX1 A;  1P1N A;  4RPO A;  3PUY E;  4BDL A;  1LGB C;  3M3K A;  3K1M A;  4FBP A;  2F7C A;  2ONS A;  1POT A;  2G29 A;  2B4L A;  1YZ0 A;  1NH8 A;  2V3Q A;  1LBC A;  4LVQ A;  2PYY A;  3G7W A;  4HXV A;  5L8D A;  2F3D A;  1MQH A;  4THI A;  3MST A;  4O94 A;  1I6Q A;  2NWJ A;  4LZ5 A;  4Q8R A;  2AL4 A;  1IEJ A;  2I48 A;  1A99 A;  1Y9U A;  3HN0 A;  5H8Q A;  2O7I A;  1UTB B;  4NE4 A;  4PFW A;  4GWW A;  3H6U A;  4LAT A;  3VV5 A;  4P1L A;  3H03 A;  4P8B A;  2H99 A;  1B51 A;  5EYF A;  2V4C A;  1D3K A;  2UXA A;  4DZ1 A;  1B32 A;  3JV9 A;  2R71 A;  3RLF E;  1NNF A;  3PV0 E;  3OEK A;  5L9O A;  1I6A A;  4XKQ A;  3P7I A;  3AXF A;  5ITO A;  2ZMB A;  4H5G A;  3QYT A;  5EQ8 A;  1OIB A;  2XXP A;  3SEU A;  5BWJ A;  1OQG A;  1R1N A;  1SW1 A;  3PUV E;  1FTK A;  1CNQ A;  2REJ A;  2HPG A;  1ZLQ A;  1PBP A;  3PTY A;  1JQF A;  1SD3 A;  5ET6 A;  1RYX A;  2OBG A;  2DVC A;  4OFJ A;  1RDX A;  3T93 B;  4GBW A;  1XVY A;  4DCX A;  4F29 A;  3CHG A;  4N17 A;  1IIT A;  3CFL A;  4ZEK A;  4GWO A;  1SDX A;  1LBZ A;  3RPW A;  1BP5 A;  1EZO A;  1ATG A;  4PBQ A;  1B46 A;  3TTN A;  5DT6 A;  5FHM A;  4IO2 A;  1NUY A;  1LBY A;  2OK2 A;  1LCF A;  4MJO A;  4I40 A;  1QGX A;  1IZ1 A;  1JW1 A;  5A5X A;  4N91 A;  1P1W A;  4EQ9 A;  2ZYK A;  4OVQ A;  5CMC A;  3Q25 A;  3M3F A;  4HCY A;  2GQ1 A;  1FQF A;  4ECF A;  4R9F A;  2QSX A;  1I69 A;  3DP8 A;  2NVU B;  5DVI A;  2HXR A;  3RTW B;  1SYH A;  1LAF E;  4OWD A;  1TWY A;  2FNC A;  4P11 A;  5B70 A;  3C9H A;  3OOA A;  3N94 A;  4G8N A;  4F3G A;  2Q9T A;  2CZI A;  4HS7 A;  1K9Z A;  4OVP A;  2D5W A;  3GXA A;  3W9W A;  4BLA A;  2UYF A;  1LAX A;  2XXK A;  4XTC Q;  3Q27 A;  3H4Z A;  4JWO A;  3LSX A;  2DXY A;  3SDF A;  1I6B A;  3TFL A;  5AA4 B;  4X8R A;  2XWV A;  3T0J A;  4NGU A;  5CMM A;  2ONR A;  1JVX A;  4P1E A;  4PFI A;  4FEC A;  2KR0 A;  1URG A;  1POY 1;  3FXB A;  1Y4C A;  1MH4 A;  1LB8 A;  2WBB A;  1QUI A;  1Q1K A;  1D9V A;  3RPL A;  4PQJ A;  2WKY A;  1FQD A;  4Z0I A;  3UIF A;  4PC9 A;  3O6G A;  5I56 A;  3IFA A;  2V93 A;  2I3V A;  4Q0C A;  4FED A;  3TPA A;  3VLU A;  3FJG A;  3K00 A;  4ZE8 A;  4PAI A;  5LOM A;  3K6V A;  3LSW A;  4UAC A;  2B4M A;  4OEN A;  4F19 A;  5I59 B;  3RY3 A;  2XXW A;  3VXB A;  1XOC A;  3LUY A;  4F18 A;  3FIR A;  3FTO A;  3S9L C;  4TQU Q;  4KPT A;  5K2Y A;  4FE8 A;  3CFZ A;  1BIY A;  2Y7K A;  5CRY A;  1NUW A;  4EUO A;  4C0R A;  1NV2 A;  1IMB A;  4NX1 A;  1XS5 A;  1J1N A;  2WYK A;  3TTR A;  4F2O A;  1HSE A;  1B40 A;  2Z8D A;  1GV8 A;  1B7U A;  4ISU A;  1VDW A;  3V8X B;  4HE1 A;  3VDF A;  4O7I A;  2DE3 A;  4ZZE A;  1B7Z A;  3G3G A;  1N76 A;  4RNS A;  4GXA A;  1OLA A;  3K1N A;  4N07 A;  1B58 A;  4I8C A;  1MQJ A;  1PBQ A;  4PDH A;  2ALU A;  4ELR A;  3SKP A;  3MP8 A;  1A40 A;  5I57 A;  1OLC A;  5AA1 A;  3VVE A;  4AB5 A;  2WX9 A;  3UOR A;  1B3H A;  3DRH A;  2OWT A;  5J1D A;  1FTM A;  3OD7 A;  5IZ3 B;  3CFX A;  1AH5 A;  2D3I A;  3FVN A;  3R7X A;  3FXU A;  4PFT A;  4PTK A;  3BFT A;  2H5Y A;  4YKP A;  3O6I A;  1M5D A;  2GHA A;  1L5T A;  1FPL A;  4X48 A;  5CBS A;  1PDA A;  3TAJ A;  2PT1 A;  1JEV A;  1B1X A;  1MM6 A;  3PD8 A;  1AL3 A;  3H6T A;  1B5I A;  3WAE A;  1F9B A;  4ESX A;  1B9J A;  2O68 A;  4OA4 A;  5FHO A;  1FQC A;  1NI9 A;  5FBP A;  4PCD A;  2XXH A;  2I49 A;  3O66 A;  4G2Z A;  3RNN A;  1M5F A;  4KI0 E;  4YKJ A;  4P47 A;  1B3F A;  4P3L A;  3RT6 B;  3T9H B;  2W7Y A;  4IGT A;  4R6H A;  3KBZ A;  5IZ1 A;  2Z8E A;  3O6H A;  2F7B A;  3A09 A;  3VXC A;  2QVV A;  2XD3 A;  1CB6 A;  2F97 A;  1ZJL A;  2H25 A;  2KQZ A;  5F7V A;  3CSB A;  2O7U A;  4PFR A;  4JB7 A;  1A54 A;  1FPG A;  2RCA A;  1NL5 A;  3H06 B;  3Q28 A;  4YU0 A;  4I62 A;  1H3D A;  2Q2C A;  3G3J A;  3EPE A;  1B3E A;  1USY E;  3MVW A;  3EHS A;  4DXB A;  2I58 A;  3MJN A;  4LP2 B;  3PPR A;  3PPP A;  2PFY A;  1PB7 A;  4F1V A;  1TT1 A;  3SET A;  4QFK A;  4GVO A;  2YPN A;  3PUX E;  3PGF A;  2HHM A;  3VE1 B;  1MH3 A;  3G3F A;  2DYX A;  5T3J A;  2QL3 A;  4TLL B;  1M5C A;  1R6Z A;  3FVG A;  3TDJ A;  1WDN A;  3OO8 A;  3FXR A;  1NV1 A;  3HHF A;  4ZDM A;  1KA1 A;  5CBR A;  4OVR A;  3K4U A;  4G8M A;  3FV1 A;  3M3L A;  4MH5 A;  2ZNU A;  3T9X B;  4DI3 D;  1OVT A;  1AIV A;  4FAJ A;  1VSO A;  4OQO A;  4HTG A;  3TTM A;  3EF7 A;  4KCD A;  5I56 B;  4PGN A;  1ELJ A;  1Z7N E;  3MWB A;  1NNP A;  4EQB A;  4KQP A;  3E4R A;  2QPQ A;  4XKP A;  1LEV A;  4Q30 B;  2DWJ A;  5IKB A;  4LZ8 A;  1P99 A;  4JSD A;  4BDN A;  5BUU A;  3FJ7 A;  1S7Y A;  2QVU A;  5LTC A;  3TUS A;  3RT8 A;  3KN8 A;  1O7T A;  3C32 A;  4BDR A;  2WOP A;  1P1Q A;  2IA4 A;  5TPA A;  5AA2 A;  1MPD A;  3H3G A;  1MM7 A;  5CMB A;  3QAX A;  4JDF A;  1LFI A;  5ET5 A;  4PFY A;  3IOR A;  1PC3 A;  5TP9 A;  2JJK A;  3TQL A;  2X7Q A;  1SI0 A;  5AA2 D;  1LBX A;  4XXU A;  4MBP A;  4N4U A;  3S9E A;  1IME A;  4QHQ A;  3S4U A;  1G0H A;  2OX3 A;  3MVX A;  1NFT A;  3TKD A;  4GBV A;  5ELV A;  4JVD A;  5KDT A;  2A5S A;  1URD A;  4LQ2 A;  3CIJ A;  4MFI A;  4GWX A;  3VVF A;  3I6V A;  1O63 A;  3GLB A;  4FJP A;  4N15 A;  4BDM A;  2LAO A;  5I57 B;  4LN5 A;  1O64 A;  1Y3Q A;  3LBS A;  4FEB A;  4N8G A;  3FVK A;  1DBZ A;  1PEB A;  3OMB A;  4PDD A;  4F1U A;  3FAT A;  4U23 A;  2V3U A;  4IO5 A;  1IXI A;  3GBB A;  4TLM B;  3T9U A;  2F35 A;  3SEY A;  4DLD A;  1SQY A;  2QMX A;  3O2A A;  2FYI A;  1GGG A;  2ONK E;  1OQH A;  4NF6 A;  1H76 A;  3BBR A;  1XC1 A;  1IXG A;  2ANJ A;  2G93 A;  3RGY A;  3QSL A;  4MAG A;  4G61 A;  4H5F A;  3B6W A;  5IZ3 A;  2UYE A;  4F39 A;  3PPQ A;  4N13 A;  4POW A;  2DWH A;  3MW0 A;  2ZNT A;  3UP9 A;  2DS9 A;  3PU5 A;  1BK4 A;  2FVZ A;  4H67 A;  1SPI A;  3O97 A;  4U22 A;  4QFL A;  1QUL A;  3PPO A;  4R6K A;  2HEU A;  3CR9 A;  3E79 A;  1XVX A;  1LB9 A;  4MCO A;  4NN3 A;  1USY H;  2I0B A;  4KYS A;  3WAF A;  1Y20 A;  1A7L A;  4OVS A;  3VFJ A;  4GX3 A;  3RYD A;  1MXX A;  4RXL A;  2QFL A;  5ICQ A;  1NMU A;  1JVY A;  3T1B A;  2Q2A A;  4OVJ A;  3U72 A;  4GIZ A;  4R6Y A;  1FPI A;  3V89 B;  4H0W A;  2THI A;  3LSL A;  3M8U A;  2FBP A;  1JNF A;  5FTI A;  3T22 A;  5DEX A;  4AS4 A;  4PF8 A;  5B7D A;  1JP4 A;  2RC9 A;  4U1O A;  4JWX A;  1IXC A;  1NV0 A;  3D4G A;  4M4G A;  3LUZ A;  4H65 A;  3MVY A;  3OEL A;  5I2N A;  1XI6 A;  3C35 A;  1FQB A;  4GFR A;  3K01 A;  3N5L A;  3LVU A;  3QIM A;  3QUJ A;  4EF1 A;  2AIX A;  3HV1 A;  4LUB A;  2B3F A;  3K6W A;  5ET7 A;  2PFZ A;  3KC0 A;  1ZIU A;  1JW4 A;  3S2V A;  3DRF A;  3CI8 A;  5I84 A;  3KJT A;  3CVG A;  4RK2 A;  2OWS A;  1Y1Z A;  1DMB A;  1IQ7 A;  2XXY A;  1SW2 A;  2XXV A;  4QSE A;  2CZK A;  3IK6 B;  4GLI A;  1NUX A;  3QK6 A;  2ZXT A;  3R6U A;  4G68 B;  4LA9 A;  1UTH B; 
#chains in the Genus database with same CATH homology
 4ZED A;  3ODB A;  3EN3 A;  1H44 A;  3FD3 A;  1FW0 A;  3OSQ A;  4XKN A;  4M1V A;  1FQE A;  1D9Y A;  3U1O A;  3IJO B;  4OEV A;  1NNK A;  1MPC A;  1H45 A;  5TPA B;  4R74 A;  5AA2 B;  1EU8 A;  3RTF B;  1SW4 A;  1VFE A;  3IO6 A;  5M2V A;  2P2A A;  1SVX B;  3THI A;  1QKA A;  2XXX A;  5TP9 B;  3T9V A;  2Q8J A;  3USD A;  1P1U A;  4NTL A;  1FQA A;  2REG A;  1XT8 A;  5ICT A;  4NF5 A;  5KDT B;  2I0C A;  4MLQ A;  2F78 A;  4U21 A;  5AA3 A;  1T0K A;  3DLN A;  5K2X A;  4OYV A;  2F34 A;  4LON B;  2F7A A;  4QF9 A;  1QKB A;  4DIG A;  1QJM A;  1MQI A;  3ZS6 A;  3KG2 A;  1Z7M E;  4X1B A;  1MY1 A;  3SEW A;  3H6V A;  2AL5 A;  1WOD A;  2HZK A;  1M5B A;  3U94 A;  2OCU A;  3MZB A;  5H8S A;  1A55 A;  4X9T A;  1B3L A;  4OES A;  1A8F A;  4NF6 B;  1OVB A;  5KCJ A;  2ZNS A;  4R2F A;  1DPE A;  4GRK A;  2F6G A;  4YB6 A;  4E0W A;  2CMO A;  2PX1 A;  3TCG A;  4POX A;  3KSJ A;  2DVZ A;  2XD2 A;  4TOZ A;  5H8N B;  2XXU A;  2H9B A;  4OER A;  3QXM A;  2PBW A;  2O51 A;  2ABH A;  4P0G A;  1B4H A;  4OXV A;  3IAZ A;  3PD9 A;  4OEU A;  4ESW A;  3PUW E;  1AMF A;  4U4S A;  5F1Q A;  2HFB A;  4ZEC A;  5FHN A;  2DE4 A;  4JSO A;  1A8E A;  3QUF A;  3IOW A;  3EHU A;  1ZBM A;  4G8H A;  4GL8 A;  2VD3 A;  4H8J A;  3MAM A;  3T96 B;  1YTV A;  5DEX B;  4PE5 B;  4N6P A;  4K3F A;  4GD5 A;  3O28 A;  2ZYN A;  2F8D A;  3IB1 A;  2OJT A;  3KOS A;  3B7D A;  1DPP A;  1MRP A;  5JEI A;  1MY4 A;  5I2N B;  3OXN A;  4RJZ A;  1SBP A;  5I2K B;  3DM0 A;  3KJ7 A;  3MUQ A;  3O9P A;  1ZMG A;  4I9D A;  4Q5T A;  4OMB A;  3Q29 A;  1RYO A;  3ILU B;  2Y7P A;  4KYE A;  2F36 A;  3VVD A;  1FTO A;  2PT2 A;  2AYS A;  1Y3N A;  1NKX A;  3MC2 A;  4IB2 A;  4R75 A;  3L6H A;  3K2D A;  4ONY A;  3VLV A;  4IO7 A;  3V83 A;  3KBR A;  1LFH A;  1Y3P A;  1XHY A;  4KYD A;  3IOV A;  3MP6 A;  1B5H A;  4YIC A;  1QUJ A;  2QS2 A;  4RY1 A;  4YZZ A;  1N0T A;  4G68 A;  1UTH A;  2PVU A;  2RC7 A;  3BFU A;  2Z22 A;  4C1U A;  4QSD A;  1URS A;  1LBB A;  1JW5 A;  3E9X A;  4YMA A;  3Q26 A;  3TYH A;  2FA7 A;  2RC8 A;  1SW5 A;  3ECR A;  3DRG A;  2O6A A;  2Y84 A;  3C36 A;  4JXI A;  1VFD A;  3MPL A;  1HSL A;  3OO9 A;  1SI1 A;  4NF5 B;  4H1X A;  4ZEF A;  1R9Q A;  2BJJ X;  3MVZ A;  3SES A;  2KLF A;  3N6U A;  2DE2 A;  4EXK A;  5JTY B;  4ELO A;  1GR2 A;  3DEL B;  4EXL A;  5H8H B;  3E3K A;  3TOD A;  3U8Q A;  3KSX A;  1R9L A;  1ZKB A;  3KN3 A;  5DYH A;  2GFE A;  2YLN A;  4GOT A;  3CSG A;  1EZ9 A;  2GRV A;  2B65 A;  5DTB A;  3TEL A;  4RPN A;  1B2H A;  1YPN A;  1MXU A;  2F5X A;  5KCJ B;  2RF1 A;  3HO7 A;  3TQW A;  3R26 A;  4ZEB A;  1Y1M A;  1AOV A;  2DQV A;  2RIN A;  4OHN A;  1IXH A;  3EHT A;  4PFU A;  2P0S A;  4MLV A;  4NF4 B;  4YB7 A;  4BDO A;  2ESN A;  2HXW A;  3ONM A;  5I58 A;  4OFO A;  2I4C A;  2XXI A;  3K0V A;  4OZ9 A;  2QMW A;  1GTK A;  2B3B A;  4BDQ A;  3LR1 A;  4AQ4 A;  3OO7 A;  1LAH E;  5H8N A;  2GH9 A;  3D4C A;  3UN6 A;  4IO3 A;  1DOT A;  2ZYO A;  1CE2 A;  1LAG E;  1IIW A;  5H8F B;  3G3H A;  3K6X A;  1WVJ A;  3G3I A;  3DRI A;  4O3C A;  1IUD A;  3C4M A;  2XXR A;  3JZJ A;  5AE4 A;  3TEP A;  1B0H A;  1B1H A;  4YMB A;  4DXC A;  5HPQ A;  2UVJ A;  4QRZ A;  1NH7 A;  4GQO A;  5CM6 A;  2A5T B;  2OZZ A;  2GHB A;  4U2R A;  1B5J A;  1M5E A;  4XKR A;  1LFG A;  2VOZ A;  1B05 A;  3I5O A;  4EF2 A;  1MY2 A;  3FZV A;  3FXQ A;  3K02 A;  5TU0 A;  1TXF A;  4DCY A;  5DVJ A;  1MDQ A;  1BTJ A;  3KFM A;  4G4P A;  4HW8 A;  2O1L A;  3JYR A;  4KD5 A;  4QFO A;  3TZA A;  4L17 A;  3MQ9 A;  3FJM A;  1DSN A;  1YCJ A;  4RA1 A;  1MXZ A;  3E13 X;  1N7W A;  3W9V A;  4R9G A;  3TTK A;  3C31 A;  2DWI A;  4IY5 A;  3UK4 A;  1N3W A;  2OLB A;  2O1M A;  3O6P A;  2V3T A;  1OMP A;  5I2K A;  3FV2 A;  3IO4 A;  2F6P A;  3HST A;  3KGC A;  4KFQ A;  1RKM A;  5L9S A;  4YKK A;  4ELQ A;  5HM4 B;  1B6H A;  3CRB A;  1P1O A;  2D21 A;  1Q35 A;  3LSF B;  1MG1 A;  3L6G A;  3PMX A;  3MBP A;  4F3S A;  4F3B A;  1H43 A;  3ILT B;  1ZU0 A;  1QW0 A;  4NWC A;  3RN8 A;  3KN7 A;  3PMV A;  4NF8 A;  4R72 A;  4EDP A;  4U1Z A;  2DP8 A;  1DTG A;  3ZKL A;  4EQ7 A;  2H4I A;  5ISU A;  3FGS A;  2IEE A;  2VD2 A;  4R73 A;  4HCW A;  1US5 A;  3C34 A;  4QSC A;  3RQT A;  3TMG A;  4G68 C;  2R6G E;  4ND9 A;  1TFA A;  1B52 A;  4WED A;  1LCT A;  1QVS A;  2O69 A;  3A3C A;  4H6D A;  3TTL A;  1ZTY A;  4ZE9 A;  4GL0 A;  4F3P A;  2E0S A;  2PMS A;  1KWH A;  3HPI A;  3OEM A;  3VLW A;  4IGR A;  2QRY A;  2DWA A;  3V5A A;  4AB6 A;  1ANF A;  4DE8 A;  3N6T A;  3K1P A;  4WXJ A;  1FTL A;  1PB8 A;  2I6E A;  2YJP A;  2RKM A;  5JTY A;  4P0I A;  1FTJ A;  3KEI A;  4F31 B;  4E0X A;  4GF8 A;  5H8H A;  3KZG A;  1MXV A;  3MP1 A;  3SEV A;  1MXW A;  3OSR A;  4FAT A;  1B7H A;  2HQ0 A;  2XXT A;  1N84 A;  2M8C A;  3DP4 A;  3O29 A;  4NED A;  2R9J A;  3IR1 A;  2XX9 A;  5DVF A;  2H98 A;  4IO6 A;  4DXU A;  4NMY A;  2NOO A;  3MPK A;  3B6Q A;  5I58 B;  1DTZ A;  4JWY A;  4WEP A;  3PMW A;  3A3U A;  3FVO A;  1LST A;  3U93 A;  4NF4 A;  1N3X A;  3FUZ A;  5CC2 A;  3DRK A;  3MZ1 A;  5H8Q B;  3DRJ A;  2I4B A;  5IAI A;  3IB0 A;  4ELP A;  3MZ9 A;  3TCH A;  1PB9 A;  2E1S A;  1N04 A;  2ZYM A;  5JK4 A;  1MQG A;  2UVG A;  1B4Z A;  4JBZ A;  5HBC A;  1B3G A;  3K6U A;  4I1D A;  3H7M A;  3SER A;  4U4X A;  3PPN A;  1UTB A;  3ZKK A;  2I3W A;  1GVC A;  3G3K A;  4WKM A;  5H8F A;  1US4 A;  3IL1 B;  2O84 X;  4XIG Q;  1D4N A;  4LQ5 A;  1Y4T A;  4ZZA A;  1N7X A;  2DXR A;  3I3V A;  2Q88 A;  2RCB A;  2QJE A;  2X7P A;  2HAV A;  1JEU A;  2A5T A;  1BKA A;  3GBA A;  1JET A;  2UVH A;  2P1S A;  3RYA A;  5EHM A;  1LLS A;  3UGW A;  2Z8F A;  4RYA A;  2QS3 A;  4G77 A;  2XX8 A;  4PET A;  2HZL A;  1QUK A;  4C1T A;  3N26 A;  3ZSF A;  3IOT A;  3RUM A;  4DDD A;  4LZ7 A;  1FCK A;  5A5X B;  1UQW A;  2UVI A;  4QFP A;  1MPB A;  2VHA A;  3T66 A;  4O3A A;  5KZT A;  3F11 A;  1HSJ A;  2XXQ A;  4F2Q A;  4YAH X;  1YAE A;  2QS4 A;  4NWD A;  4OTE A;  3BKI B;  3H6W A;  4F22 A;  2DOJ A;  4NF8 B;  3RYB A;  2X26 A;  1TFD A;  2HAU A;  3HHG A;  2HCA A;  3FAS A;  2Y7I A;  3IJX B;  3LC8 A;  4KR5 A;  1MQD A;  5L9M A;  3TCF A;  1BLF A;  1MY0 A;  3UA8 A;  3KOT A;  2Z23 A;  2VGQ A;  2WOL A;  3IOU A;  3GZG A;  4RK9 A;  4X1D A;  1MY3 A;  4YKI A;  3S9M C;  4YB5 A;  1VE4 A;  4FOR A;  4GXS B;  1SYI A;  4Z7E A;  2NUV A;  4KCC A;  4QFN A;  3SEX A;  1S50 A;  4O3B A;  2NXO A;  2Q89 A;  4UA8 A;  2WOK A;  5ITP A;  4MF3 A;  3CG3 A;  2Y7R A;  3OO6 A;  2V25 A;  1UIV A;  1S9T A;  4IY6 A;  2VP1 A;  1EZP A;  2XX7 A;  5AA4 A;  3DP6 A;  3U92 A;  2XHD A;  4ZS9 A;  4H8I A;  3IB2 A;  3S9N C;  5FTH A;  4OET A;  2V84 A;  2Y7W A;  2QS1 A;  1B0L A;  1MS7 A;  1EH3 A;  3PAM A;  4IO4 A;  1VR5 A;  3HCQ A;  3C33 A;  3W15 C;  1UIU A;  4FIM A;  4ZEI A;  1NNT A;  1II5 A;  3EQ1 A;  2DSF A;  5EHS A;  3PUZ E;  4KHZ E;  4PP0 A;  4R2B A;  5I59 A;  3CG1 A;  5CMK A;  5CI5 A;  1MDP 1;  2CZL A;  3OEN A;  4OFL A;  4F1Y A;  1MXY A;  3B6T A;  3IX1 A;  1P1N A;  4RPO A;  3PUY E;  4BDL A;  1LGB C;  3M3K A;  3K1M A;  2F7C A;  2ONS A;  1POT A;  2G29 A;  2B4L A;  1NH8 A;  2V3Q A;  1LBC A;  4LVQ A;  2PYY A;  3G7W A;  5L8D A;  1MQH A;  4THI A;  1I6Q A;  2NWJ A;  4LZ5 A;  4Q8R A;  2AL4 A;  1IEJ A;  2I48 A;  1A99 A;  1Y9U A;  3HN0 A;  5H8Q A;  2O7I A;  1UTB B;  4NE4 A;  4PFW A;  3H6U A;  4LAT A;  3VV5 A;  3H03 A;  2H99 A;  1B51 A;  5EYF A;  1D3K A;  2UXA A;  4DZ1 A;  1B32 A;  3JV9 A;  2R71 A;  3RLF E;  1NNF A;  3PV0 E;  3OEK A;  5L9O A;  4XKQ A;  1I6A A;  3P7I A;  3AXF A;  5ITO A;  2ZMB A;  4H5G A;  3QYT A;  1OIB A;  2XXP A;  3SEU A;  5BWJ A;  1OQG A;  1R1N A;  1SW1 A;  3PUV E;  1FTK A;  2REJ A;  1ZLQ A;  1PBP A;  1JQF A;  1SD3 A;  1RYX A;  2OBG A;  2DVC A;  4OFJ A;  3T93 B;  1XVY A;  4DCX A;  4F29 A;  3CHG A;  1IIT A;  3CFL A;  4ZEK A;  4GWO A;  1SDX A;  3RPW A;  1BP5 A;  1EZO A;  1ATG A;  1B46 A;  3TTN A;  5DT6 A;  5FHM A;  4IO2 A;  2OK2 A;  1LCF A;  1IZ1 A;  1JW1 A;  5A5X A;  1P1W A;  4EQ9 A;  2ZYK A;  5CMC A;  3Q25 A;  3M3F A;  4HCY A;  1FQF A;  4ECF A;  4R9F A;  2QSX A;  1I69 A;  3DP8 A;  2NVU B;  5DVI A;  3RTW B;  1SYH A;  1LAF E;  4OWD A;  1TWY A;  2FNC A;  4P11 A;  5B70 A;  3C9H A;  3OOA A;  3N94 A;  4G8N A;  4F3G A;  2Q9T A;  4HS7 A;  2D5W A;  3GXA A;  3W9W A;  4BLA A;  2UYF A;  1LAX A;  4XTC Q;  3Q27 A;  3H4Z A;  4JWO A;  3LSX A;  2DXY A;  3SDF A;  1I6B A;  3TFL A;  5AA4 B;  5CMM A;  2ONR A;  1JVX A;  4FEC A;  1URG A;  1POY 1;  1Y4C A;  1MH4 A;  1LB8 A;  1QUI A;  1Q1K A;  1D9V A;  4PQJ A;  2WKY A;  1FQD A;  4Z0I A;  3UIF A;  3O6G A;  5I56 A;  2V93 A;  2I3V A;  4Q0C A;  4FED A;  3TPA A;  3VLU A;  3FJG A;  3K00 A;  4ZE8 A;  5LOM A;  3K6V A;  3LSW A;  4UAC A;  2B4M A;  4OEN A;  4F19 A;  5I59 B;  3RY3 A;  2XXW A;  3VXB A;  1XOC A;  3LUY A;  4F18 A;  3FIR A;  3FTO A;  3S9L C;  4TQU Q;  4KPT A;  5K2Y A;  4FE8 A;  3CFZ A;  1BIY A;  2Y7K A;  5CRY A;  4EUO A;  4C0R A;  1XS5 A;  1J1N A;  3TTR A;  4F2O A;  1HSE A;  1B40 A;  2Z8D A;  1GV8 A;  1B7U A;  4ISU A;  3VDF A;  3V8X B;  4ZZE A;  2DE3 A;  1B7Z A;  3G3G A;  1N76 A;  4RNS A;  4GXA A;  1OLA A;  3K1N A;  4N07 A;  1B58 A;  4I8C A;  1MQJ A;  1PBQ A;  2ALU A;  4ELR A;  3SKP A;  3MP8 A;  1A40 A;  5I57 A;  1OLC A;  5AA1 A;  3VVE A;  4AB5 A;  3UOR A;  1B3H A;  3DRH A;  2OWT A;  5J1D A;  1FTM A;  3OD7 A;  3CFX A;  1AH5 A;  2D3I A;  3FVN A;  3R7X A;  3FXU A;  4PFT A;  3BFT A;  2H5Y A;  4YKP A;  3O6I A;  1M5D A;  2GHA A;  1L5T A;  4X48 A;  5CBS A;  1PDA A;  3TAJ A;  2PT1 A;  1JEV A;  1B1X A;  1MM6 A;  3PD8 A;  1AL3 A;  3H6T A;  1B5I A;  3WAE A;  1F9B A;  4ESX A;  1B9J A;  2O68 A;  5FHO A;  1FQC A;  2XXH A;  2I49 A;  3O66 A;  4G2Z A;  3RNN A;  1M5F A;  4KI0 E;  4YKJ A;  1B3F A;  3RT6 B;  3T9H B;  2W7Y A;  4IGT A;  4R6H A;  2Z8E A;  3O6H A;  2F7B A;  3A09 A;  3VXC A;  2XD3 A;  1CB6 A;  2F97 A;  1ZJL A;  2H25 A;  5F7V A;  3CSB A;  2O7U A;  4JB7 A;  1A54 A;  2RCA A;  1NL5 A;  3H06 B;  3Q28 A;  4YU0 A;  4I62 A;  1H3D A;  2Q2C A;  3G3J A;  3EPE A;  1B3E A;  1USY E;  3MVW A;  3EHS A;  4DXB A;  2I58 A;  3MJN A;  4LP2 B;  3PPR A;  3PPP A;  1PB7 A;  4F1V A;  1TT1 A;  3SET A;  4QFK A;  4GVO A;  2YPN A;  3PUX E;  3PGF A;  3VE1 B;  1MH3 A;  3G3F A;  2DYX A;  2QL3 A;  4TLL B;  1M5C A;  1R6Z A;  3FVG A;  3TDJ A;  1WDN A;  3OO8 A;  3FXR A;  3HHF A;  4ZDM A;  5CBR A;  3K4U A;  4G8M A;  3FV1 A;  3M3L A;  4MH5 A;  2ZNU A;  3T9X B;  1OVT A;  1AIV A;  4FAJ A;  1VSO A;  4OQO A;  4HTG A;  3TTM A;  3EF7 A;  4KCD A;  5I56 B;  1ELJ A;  1Z7N E;  3MWB A;  1NNP A;  4EQB A;  4KQP A;  3E4R A;  2QPQ A;  4XKP A;  4Q30 B;  2DWJ A;  5IKB A;  4LZ8 A;  1P99 A;  4JSD A;  4BDN A;  5BUU A;  3FJ7 A;  1S7Y A;  3TUS A;  3RT8 A;  3KN8 A;  1O7T A;  3C32 A;  4BDR A;  2WOP A;  1P1Q A;  2IA4 A;  5TPA A;  5AA2 A;  1MPD A;  3H3G A;  1MM7 A;  5CMB A;  3QAX A;  4JDF A;  1LFI A;  4PFY A;  3IOR A;  1PC3 A;  5TP9 A;  3TQL A;  2X7Q A;  1SI0 A;  5AA2 D;  4XXU A;  4MBP A;  3S9E A;  4QHQ A;  3S4U A;  3MVX A;  1NFT A;  3TKD A;  5ELV A;  5KDT A;  2A5S A;  1URD A;  4LQ2 A;  3CIJ A;  4MFI A;  3VVF A;  3I6V A;  1O63 A;  3GLB A;  4FJP A;  4BDM A;  2LAO A;  5I57 B;  1O64 A;  1Y3Q A;  3LBS A;  4FEB A;  3FVK A;  1PEB A;  3OMB A;  4F1U A;  3FAT A;  4U23 A;  2V3U A;  4IO5 A;  1IXI A;  3GBB A;  4TLM B;  3T9U A;  2F35 A;  3SEY A;  4DLD A;  1SQY A;  2QMX A;  3O2A A;  2FYI A;  1GGG A;  2ONK E;  1OQH A;  4NF6 A;  1H76 A;  3BBR A;  1XC1 A;  1IXG A;  2ANJ A;  2G93 A;  3RGY A;  3QSL A;  4H5F A;  3B6W A;  2UYE A;  4F39 A;  3PPQ A;  4N13 A;  4POW A;  2DWH A;  3MW0 A;  2ZNT A;  3UP9 A;  2DS9 A;  3PU5 A;  4H67 A;  3O97 A;  4U22 A;  4QFL A;  1QUL A;  3PPO A;  4R6K A;  2HEU A;  3CR9 A;  1XVX A;  1LB9 A;  1USY H;  2I0B A;  4KYS A;  3WAF A;  1Y20 A;  1A7L A;  3VFJ A;  1MXX A;  4RXL A;  5ICQ A;  1NMU A;  1JVY A;  2Q2A A;  4OVJ A;  3U72 A;  4GIZ A;  4R6Y A;  3V89 B;  4H0W A;  2THI A;  3LSL A;  3M8U A;  1JNF A;  5FTI A;  3T22 A;  5DEX A;  5B7D A;  2RC9 A;  4U1O A;  4JWX A;  1IXC A;  3D4G A;  4M4G A;  4H65 A;  3MVY A;  3OEL A;  5I2N A;  3C35 A;  1FQB A;  4GFR A;  3K01 A;  3N5L A;  3LVU A;  3QIM A;  3QUJ A;  4EF1 A;  2AIX A;  3HV1 A;  4LUB A;  2B3F A;  3K6W A;  1ZIU A;  1JW4 A;  3S2V A;  3DRF A;  3CI8 A;  5I84 A;  3KJT A;  3CVG A;  4RK2 A;  2OWS A;  1Y1Z A;  1DMB A;  1IQ7 A;  2XXY A;  1SW2 A;  2XXV A;  4QSE A;  3IK6 B;  4GLI A;  3QK6 A;  2ZXT A;  3R6U A;  4G68 B;  4LA9 A;  1UTH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...