4GF8A

Crystal structure of the chitin oligasaccharide binding protein
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
528
structure length
528
Chain Sequence
RSELTIVPDFYPTMVRNFNPYLATNLRTTTDFIYEPLVVFNEMKGNTPVFRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRFRLSEANSNVPYEISLIPIVAEHVWKDVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQLLGKIVNSELDWTSSFVPDIDRTYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKKEALDNVDFRRAFSMALDRQTIIDIAFYGSGTVNDFASGLGYAFEAWSDEATHKKYKGFNTYDVEGSKKLLAKAGFKDVNGDGFVETPSGKSFELLIQSPNGWTDFNNTVQLAVEQLQEVGIKAKARTPEFAVYNQAMLEGTYDVAYTNYFHGADPFTYWNSGYNSALQSGDGMPRFAMHYFTDKKLDGLLDSFYKTADKNEQLAIAHGIQKIIAENQVTIPVMSGAWMYQYNTTRFTGWWSEENPKGRPSVWAGIPERLLHVLDLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chitin catabolic cascade in the marine bacterium Vibrio cholerae: properties, structure and functions of a periplasmic chitooligosaccharide binding protein (CBP)
rcsb
source organism Vibrio cholerae o1
molecule tags Transport protein
molecule keywords Peptide ABC transporter, periplasmic peptide-binding protein
total genus 175
structure length 528
sequence length 528
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 4gf8A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gf8A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 4gf8A02
4R6YA 2XXXA 1B4HA 2XXQA 3R6UA 3G3IA 4G68C 3JV9A 4MF3A 1AOVA 5DVFA 4DZ1A 1JEVA 1DMBA 3MZ9A 1JW1A 1NKXA 4OENA 5I2KB 4Q0CA 3QXMA 5AA1A 3LR1A 4OESA 5FHOA 4ESXA 4G2ZA 2F78A 2Y7WA 1BKAA 4FATA 3EF7A 3QIMA 3E3KA 3KZGA 4ESWA 3RLFE 2DE2A 1MXVA 1XT8A 1QKAA 2D21A 5KDTB 3TFLA 2Z8EA 3RGYA 2HZKA 3N26A 4XIGQ 1N84A 1AL3A 3C35A 1UTHB 3IO4A 4H5FA 5H8FA 1MY3A 4XKNA 1GR2A 4I9DA 2REGA 2QMWA 1B5IA 3QUJA 3RNNA 5FHMA 4RYAA 3IL1B 3UORA 2YJPA 3LSLA 1EZOA 4NF8B 5ELVA 3FV1A 2DQVA 2FNCA 1Q1KA 4F1UA 1T0KA 2OWTA 2ANJA 4XKRA 3ECRA 1SDXA 5TPAB 3TTLA 4DE8A 3G3JA 1S7YA 1XOCA 1JVYA 5JTYB 5B7DA 4I1DA 3MVXA 3UP9A 5TP9B 4EQBA 3MWBA 3PPQA 3S9NC 4Z7EA 4DCYA 1ZU0A 1Z7NE 4YU0A 1LFIA 3K00A 3GZGA 3EPEA 3M3FA 4OQOA 4EQ7A 3O28A 3DRJA 3IOTA 1A8EA 4QFNA 2RINA 4U21A 1OVTA 2ZXTA 1PEBA 4NWDA 3Q29A 2Q8JA 3SDFA 2WOLA 2QS2A 2F6PA 1JQFA 4IO4A 1UIUA 5AA2A 3H3GA 3PPPA 5AA4B 2XD2A 2Z23A 2DS9A 3DRHA 1M5DA 1I69A 3R26A 3G3FA 4H6DA 1WDNA 1VFEA 2H5YA 2PVUA 4RA1A 3PD9A 5DEXA 5AA2B 1POTA 1MQDA 1FTKA 4EDPA 3TTKA 4U2RA 5ITPA 4TQUQ 1PC3A 2I3VA 5CBRA 4N07A 4GFRA 3E13X 4F1YA 4GXAA 1B58A 2F36A 2DWAA 4FORA 5H8FB 4ZEBA 3IORA 2VD3A 1FCKA 4ZZEA 1SW1A 2V3UA 2ZMBA 3BFTA 2I49A 3MQ9A 3RTWB 5A5XB 1PBQA 4DCXA 4RY1A 1FQEA 2AYSA 2I0CA 2PT2A 3HSTA 3N94A 1YTVA 1ZJLA 3TEPA 2XX9A 1IXHA 4OFLA 1B0LA 1Z7ME 1OLCA 2OK2A 2DWIA 1XVYA 1B3HA 3HN0A 4FEBA 4YB5A 5I84A 4R73A 4OEUA 4XKQA 3PMVA 4BDLA 1N7XA 4GQOA 3C33A 3FXUA 5IAIA 3KJ7A 2O7IA 4EQ9A 3W9WA 3N5LA 2RCAA 1MDQA 2B4MA 2V93A 4IY6A 4GL8A 3PUYE 2ONKE 4ZZAA 5BWJA 3FIRA 4WEDA 2XXTA 4YMBA 2RKMA 3ZS6A 1QJMA 3C31A 3E4RA 3CFXA 3TELA 5I56A 5JK4A 1DSNA 3MPLA 4M1VA 1EH3A 5I58B 5BUUA 3BFUA 4I8CA 3K1NA 4JSDA 3KN3A 4NWCA 2Q89A 2G93A 1YCJA 2VD2A 4OXVA 1MS7A 5L9MA 5ISUA 4DXCA 3H6VA 3MC2A 1RYXA 2DWHA 1N0TA 4GWOA 1VSOA 1FQAA 3A3UA 4R75A 1MPDA 5DTBA 2DP8A 3CG1A 4MFIA 1LSTA 2A5TA 2GFEA 2DE3A 4QHQA 1N3WA 4YB7A 5CM6A 1Q35A 4P0GA 2ZNTA 4KFQA 3CR9A 5LOMA 3THIA 3VV5A 1LLSA 3MAMA 1D9YA 3TMGA 3IO6A 3Q25A 1LFHA 1R9LA 2NVUB 3DRGA 4FAJA 1J1NA 1B5JA 2XXHA 4M4GA 1IXCA 4WXJA 5FHNA 1USYH 3L6GA 3LUYA 1HSJA 3PPRA 2XXUA 2GH9A 2NXOA 4ZEKA 1BIYA 3I6VA 3Q26A 1SVXB 3TDJA 1IITA 2DXRA 2W7YA 4H67A 4OFJA 4AQ4A 1GTKA 4ZE9A 1FTOA 4DIGA 2O84X 3QYTA 2BJJX 3MVWA 2UYEA 4X1BA 2NWJA 3OO7A 1MPCA 4OTEA 5I2NA 2V3QA 3WAFA 4H0WA 1MXUA 2HZLA 2DWJA 1LAHE 1N7WA 3H03A 3PPOA 5TP9A 3ZKLA 3MP8A 3K02A 1D3KA 3BBRA 4JDFA 4F18A 5AA2D 3K1MA 1VR5A 5DYHA 4G77A 4IO7A 3QK6A 1LCFA 1US5A 2Z22A 3IK6B 1MXWA 3MZ1A 4OWDA 5EYFA 3VXBA 4DLDA 1FTJA 3CFZA 4KYEA 2I4BA 2D3IA 1LBCA 2XX7A 3EHSA 2F8DA 4HCYA 1WVJA 4E0XA 4F3BA 5FTIA 3ONMA 3M8UA 1JW5A 3IX1A 3KEIA 5DEXB 1UTHA 3HV1A 2O51A 3K6WA 1B5HA 3EN3A 4MLVA 2ZYMA 5KDTA 2UVHA 1AMFA 1UTBA 3A3CA 3OO6A 1SYIA 5ICQA 2XHDA 3HCQA 4MLQA 1N3XA 3H6UA 4ELOA 5L9OA 2WOPA 2DVCA 4ISUA 4YKIA 3MZBA 3IOWA 5DVIA 4PFWA 1JETA 5H8SA 4F3PA 3FVGA 4HW8A 5I56B 4QFPA 5JEIA 3T22A 1IEJA 3C34A 3H6WA 4JWOA 1N04A 1LAFE 2O69A 3CI8A 2DXYA 3MJNA 2X26A 3C9HA 2PBWA 3KBRA 4LP2B 3VXCA 3CSBA 4LA9A 3TQWA 3TTRA 3K0VA 2DVZA 4PQJA 3MVYA 4DXBA 2E0SA 2HXWA 4G8MA 4JSOA 3UN6A 3V83A 1ELJA 3OMBA 2V3TA 3OO9A 1P99A 4IGTA 4R2BA 4Q8RA 1B3LA 1MPBA 3IB2A 2Q2AA 3CRBA 3G3HA 3PPNA 1P1QA 4LQ5A 3T96B 3U1OA 3VLUA 3C32A 4NF5B 4LZ5A 3UIFA 1H3DA 1LBBA 4U4SA 3O6IA 1HSLA 4IB2A 5KCJB 5KCJA 3D4CA 3F11A 2THIA 3BKIB 1LB9A 3KN7A 4HTGA 2Z8FA 3TCGA 4KI0E 3RUMA 1MM7A 1ZBMA 2QL3A 3VE1B 3VVFA 3B6QA 3S9LC 2DYXA 1D4NA 2QS1A 4U1OA 3GBAA 5H8NA 4BDRA 2VHAA 3K4UA 2ESNA 2QS3A 4ELPA 4PE5B 1JW4A 3TUSA 4KQPA 3MPKA 4OEVA 3TCFA 4YKPA 5EHSA 1OQGA 3U72A 3TYHA 4L17A 1MM6A 2AIXA 1EU8A 2YPNA 3OELA 4LUBA 4OMBA 1P1NA 2QSXA 3SERA 4P11A 3H6TA 3TZAA 2PX1A 3MBPA 1XS5A 3PD8A 4IGRA 5ICTA 2F7BA 2H98A 1B3FA 3RY3A 3T66A 1NNKA 2ALUA 2ZYOA 1FTMA 2F7AA 4GVOA 4LZ8A 3H06B 4OZ9A 4EXLA 2AL4A 1IQ7A 2UVJA 1URSA 1A8FA 3FUZA 4ZS9A 3N6TA 3SETA 3KOTA 5I2KA 5I59B 5I59A 5JTYA 1FQFA 1TXFA 4GLIA 1MQGA 2XX8A 3DRFA 3O66A 5CRYA 1Y1MA 1B7HA 1FQDA 4KCCA 4WEPA 5CC2A 4N6PA 1ZMGA 1NNTA 1EZPA 1JNFA 4RPOA 5CMKA 1R1NA 3SKPA 1URDA 1QULA 4BDNA 5K2XA 4F2OA 4OFOA 3L6HA 4G8HA 4GL0A 3KGCA 4WKMA 3WAEA 2GHBA 3SEWA 2RC8A 3PGFA 1IZ1A 2VGQA 1URGA 2RC9A 1B0HA 3CIJA 3H7MA 4FEDA 4C1TA 3K2DA 4E0WA 2O7UA 1QKBA 2XXVA 3C4MA 2LAOA 4QSEA 3VFJA 4NF4B 1B1XA 3GBBA 4RNSA 5CMBA 1SYHA 5KZTA 4POWA 2RCBA 4FECA 3ILTB 2PYYA 4NEDA 3UA8A 4EUOA 1MY0A 3G3GA 2ZNSA 3RT6B 1F9BA 1B3EA 3VDFA 1MDP1 2Y7RA 3S9EA 1AIVA 4ONYA 1Y1ZA 3B7DA 3M3KA 4IY5A 4AB6A 3K01A 4C0RA 2R6GE 1LB8A 1TFAA 2VP1A 2XXYA 3VLVA 5CBSA 3TTNA 3V8XB 1DTZA 1QVSA 1QW0A 2I4CA 2QS4A 2GRVA 2QRYA 2X7QA 4F19A 4F1VA 3N6UA 4KYSA 4YZZA 3KJTA 1DTGA 1LAXA 4LVQA 4PETA 5AA4A 1EZ9A 3PAMA 1HSEA 3IOVA 5L9SA 1R9QA 2ONSA 1MY4A 1YPNA 3KOSA 4FIMA 3UGWA 1M5EA 3IB1A 3W9VA 2B3FA 1IXIA 3OO8A 3O97A 2YLNA 4OHNA 1NNPA 1SQYA 2HAVA 4PFUA 3K6VA 5DT6A 5H8HA 3Q28A 4N13A 1RKMA 2B65A 3SEVA 3KSJA 2ZNUA 3LSWA 4NMYA 4OETA 1MQIA 3FVNA 3HHFA 4TLLB 3OXNA 4P0IA 4YB6A 1L5TA 1UIVA 1I6AA 3E9XA 4YICA 1MH3A 3DM0A 3GLBA 5TPAA 2WOKA 3SEYA 2FA7A 1AH5A 3CSGA 4JXIA 2X7PA 5TU0A 3DLNA 4YKKA 4BDOA 4F2QA 4H1XA 1I6BA 2H9BA 1Y9UA 4DDDA 1TWYA 3B6WA 2QPQA 2ZYKA 3DELB 3EHTA 1B05A 2OBGA 3PMWA 3HPIA 3O29A 4GF8A 3IB0A 4OVJA 3ODBA 3VVDA 4QRZA 3QUFA 5DVJA 3MP1A 3OSQA 3T9UA 5F7VA 4R74A 4FJPA 3SEXA 3OOAA 1ZKBA 3TQLA 4Q5TA 1LFGA 3IAZA 3R7XA 2PMSA 5J1DA 1MXZA 1ZTYA 1A40A 3FATA 3TODA 1B1HA 1SW4A 2REJA 3C36A 4JWXA 4R6KA 3G7WA 3RPWA 5I58A 3EQ1A 1BTJA 2HCAA 4GRKA 1FQCA 3O6GA 4IO2A 4KR5A 1SW2A 1WODA 4JWYA 1H45A 1A7LA 5I57B 4H5GA 1R6ZA 4TOZA 1OMPA 2A5TB 2OCUA 4RJZA 4YMAA 2O68A 3LSXA 1ANFA 1DOTA 1B2HA 5CMMA 2Y84A 1PDAA 3DP8A 4QF9A 2FYIA 1M5FA 1OQHA 2H4IA 2KLFA 3IOUA 4ECFA 1B9JA 1A55A 1NMUA 3U92A 1ZIUA 2Y7IA 3U94A 3S4UA 3SEUA 5IKBA 4O3BA 4NF6A 4MH5A 2P2AA 4NF6B 1JEUA 1PBPA 1XVXA 1H43A 2A5SA 1MRPA 1KWHA 1QUIA 3O6HA 5CMCA 4F31B 4ZEDA 5H8NB 2HEUA 1BP5A 4JBZA 4H8IA 1FTLA 4K3FA 3RN8A 4BDQA 3HO7A 1Y3PA 1S9TA 3FVKA 3MP6A 2XD3A 4F3SA 4IO5A 5B70A 4IO3A 3IR1A 2XXWA 3FJGA 4X48A 5L8DA 5I57A 3FTOA 1MH4A 4GXSB 5H8QA 1GGGA 3LVUA 2G29A 3CFLA 3K6XA 2WKYA 3O2AA 1P1WA 3PUXE 4Z0IA 3ILUB 4KPTA 1N76A 2HFBA 5AE4A 5HPQA 4LATA 4OYVA 1CB6A 1VFDA 1POY1 5AA3A 1B7ZA 3RYAA 1O63A 4ZEIA 3A09A 4UACA 1SBPA 1B32A 2XXIA 4O3AA 2Q2CA 3PMXA 4ND9A 3KFMA 5EHMA 5K2YA 1GV8A 4I62A 3I5OA 4KD5A 3O9PA 4HCWA 4LQ2A 3USDA 4G68A 2F6GA 1D9VA 2Z8DA 1P1UA 4NF8A 1FW0A 1MY1A 1B40A 1IIWA 1PB8A 1MG1A 4ZE8A 5HM4B 2OZZA 3KSXA 1B51A 3M3LA 3FD3A 3MW0A 3OENA 4NE4A 4ELRA 4EXKA 1II5A 2I3WA 3TKDA 4BLAA 4LONB 3RTFB 2PT1A 2Y7KA 3JZJA 3TAJA 3K6UA 1P1OA 4EF1A 1NNFA 1Y3QA 4U23A 1RYOA 1TFDA 1Y4TA 2P0SA 4Q30B 4O3CA 4QSCA 1NL5A 4R9GA 2VOZA 1UTBB 3DP6A 4U22A 5H8QB 3TCHA 1US4A 2UYFA 3IJXB 5FTHA 1USYE 4GD5A 1H44A 2QJEA 1VE4A 2UVGA 3FGSA 3JYRA 2ONRA 3FVOA 4AB5A 1FQBA 4G8NA 2IA4A 1BLFA 2QMXA 1IUDA 2XXRA 1YAEA 4F29A 1Y20A 1B6HA 3MVZA 1NH7A 1SD3A 4ZECA 1TT1A 3Q27A 1MQHA 2IEEA 2O1MA 2B4LA 4QFLA 2OLBA 2NUVA 4R6HA 2HQ0A 1ZLQA 1LGBC 2O6AA 2V25A 3T9HB 3QAXA 2F5XA 2HAUA 1O7TA 4U1ZA 3HHGA 4NTLA 3H4ZA 3LSFB 1LAGE 1B52A 4GOTA 3V89B 3W15C 3DRIA 3P7IA 5A5XA 3TTMA 3TPAA 2H25A 3OEMA 4YKJA 3VVEA 4BDMA 1A99A 4TLMB 1B4ZA 3CHGA 4FE8A 3OEKA 4F22A 2GHAA 5F1QA 1O64A 2UXAA 4H8JA 3FXQA 4QFOA 1B46A 3RT8A 4RXLA 3SESA 4C1UA 2ABHA 2M8CA 3LC8A 4R9FA 3G3KA 1PB7A 2E1SA 4R2FA 1MXXA 3FJMA 4IO6A 3KG2A 4HS7A 1SI0A 2F35A 4PP0A 4ZDMA 2P1SA 2I0BA 3KN8A 3U8QA 2AL5A 2F7CA 4F3GA 5I2NB 3D4GA 4EF2A 3OD7A 5HBCA 3FJ7A 5ITOA 1MQJA 3FZVA 4POXA 4X1DA 1NH8A 3ZKKA 2RF1A 3PV0E 3T93B 4LZ7A 3I3VA 3VLWA 4RPNA 3DRKA 5H8HB 3GXAA 4PFYA 1OIBA 1SI1A 2RC7A 4UA8A 2B3BA 1QUJA 3V5AA 4R72A 1SW5A 1B7UA 4G4PA 4XTCQ 4G68B 1IXGA 3O6PA 2DE4A 1NFTA 1CE2A 2D5WA 1Y4CA 2DOJA 2F34A 2CZLA 2O1LA 3RYBA 2XXPA 4GIZA 3FXRA 2CMOA 1Y3NA 3IJOB 4NF5A 3PUZE 1QUKA 3CVGA 2I48A 4PFTA 4DXUA 1M5BA 2V84A 4YAHX 1OVBA 4OERA 1ATGA 1MY2A 3FV2A 3LBSA 3T9XB 2R71A 3PUVE 1MXYA 2UVIA 4XKPA 2NOOA 2I58A 2R9JA 3ZSFA 1DPEA 1LCTA 4RK9A 1B3GA 3PUWE 1XHYA 3MUQA 4RK2A 4X9TA 1A54A 1I6QA 1M5CA 2Q9TA 1H76A 3FASA 4ELQA 3CG3A 5CI5A 1GVCA 3AXFA 2OJTA 2ZYNA 4NF4A 3B6TA 4U4XA 3S2VA 2F97A 4ZEFA 2Y7PA 4JB7A 1PB9A 3PU5A 3UK4A 4H65A 1UQWA 4KYDA 3K1PA 3OSRA 3EHUA 2Q88A 4KHZE 1DPPA 3RQTA 4QFKA 1XC1A 3U93A 4QSDA 1OLAA 3DP4A 1JVXA 4XXUA 2OWSA 2I6EA 3QSLA 4THIA 3T9VA 4F39A 4MBPA 5M2VA 1S50A 2H99A 3S9MC 2DSFA 4KCDA
chains in the Genus database with same CATH superfamily
4R6YA 2XXQA 4MF3A 1NKXA 5I2KB 5AA1A 3E3KA 3KZGA 4ESWA 1XT8A 3N26A 3C35A 1MY3A 3RNNA 5FHMA 1FPJA 1NV2A 1FBDA 1SDXA 3ECRA 5TPAB 5B7DA 4DE8A 5TP9B 1FPGA 4Z7EA 4YU0A 3EPEA 4EQ7A 2RINA 1OVTA 4UABA 3Q29A 2Q8JA 2WOLA 3PPPA 3TTNA 5BWJA 2PVUA 5AA2B 1FTKA 4EDPA 4U2RA 5CBRA 4F1YA 2F36A 4FORA 5H8FB 4ZZEA 5A5XB 1YYZA 4OVTA 4PDHA 1NUZA 3N94A 1ZJLA 4N81A 5I3SA 2DWIA 1XVYA 4YB5A 5I84A 4GQOA 3C33A 2O7IA 4IR8A 4ZZAA 3PUYE 2ONKE 3FIRA 4WEDA 4GBWA 2RKMA 3C31A 3CFXA 3TELA 5I56A 5JK4A 1DSNA 1NUXA 4M1VA 5I58B 4OVPA 4JSDA 5ISUA 3MC2A 1RYXA 1FQAA 4PDDA 1MPDA 5DTBA 2DP8A 5CM6A 2DE3A 4YB7A 1Q35A 2ZNTA 3TMGA 4FAJA 2KQZA 1B5JA 3HFUA 1USYH 3L6GA 1HSJA 3PPRA 2NXOA 4ZEKA 3Q26A 2W7YA 4OFJA 3MSTA 4ZE9A 2O84X 2UYEA 1MPCA 1YXIA 2V3QA 3WAFA 4H0WA 2HZLA 5TP9A 3K02A 3BBRA 4JDFA 1VR5A 5DYHA 3IK6B 5EYFA 3VXBA 2I4BA 2XX7A 1WVJA 3M8UA 1UTBA 3A3CA 1N3XA 2WOPA 2DVCA 3IOWA 5DVIA 4PFWA 2QVVA 4HW8A 3FVGA 3T22A 3H6WA 2O69A 2X26A 3KBRA 1NV5A 3TTRA 3MVYA 2HPGA 2HXWA 3B50A 4PGPA 5IZ3A 5KCJA 3F11A 3BKIB 3KN7A 1LB9A 3IFCA 2QL3A 3ISPA 2FBPA 3GBAA 5H8NA 2VHAA 4MAGA 4KQPA 3U72A 1FPLA 2YPNA 1SPIA 3H6TA 1XS5A 4NHBA 1B3FA 3RY3A 2ALUA 1FTMA 1IQ7A 4ZS9A 3FUZA 1A8FA 3KOTA 4GLIA 5CRYA 5ET6A 4WEPA 5CC2A 4N6PA 1ZMGA 1EZPA 1JNFA 1NI9A 3L6HA 4FEDA 1IZ1A 5J1DA 4E0WA 4GWWA 3K2DA 2O7UA 2XXVA 2LAOA 3VFJA 1B1XA 4POWA 2RCBA 3RT6B 2L5VA 1F9BA 1B3EA 5IZ1A 3B7DA 4AB6A 2XXYA 2JJKA 4F1VA 3N6UA 2WX9A 3PAMA 2MKZA 1R9QA 1YPNA 3KOSA 3IB1A 2B3FA 1SQYA 4PFUA 5ESYA 4OETA 1MQIA 4P0IA 3DLNA 4BDOA 1Y9UA 4DDDA 2QPQA 3DELB 2QVRA 3EHTA 3VVDA 3HPIA 3QUFA 3MP1A 1LFGA 1A40A 1SW4A 4JWXA 3RPWA 4MHFA 1BTJA 1LBXA 5I7IA 1OMPA 2OCUA 1OQHA 3IOUA 4ECFA 1NMUA 3NOHA 2Y7IA 3SEUA 5IGAA 4O3BA 1NV1A 3ROJA 4ZEDA 1BP5A 4JBZA 2XD3A 4F3SA 3IR1A 3FTOA 5H8QA 3LVUA 2G29A 3CFLA 3TZAA 1P1WA 2HFBA 4LATA 4F2QA 3RYAA 4ESXA 5K2YA 3I5OA 1P1UA 4NF8A 4KYDA 1PB8A 3KSXA 5HM4B 4EXKA 3MW0A 2I3WA 2Y7KA 1FRPA 1Q9DA 1LEVA 1Y3QA 4U23A 4PFBA 2P0SA 4O3CA 3KC1A 1USYE 4X04A 1H44A 3FVOA 4AB5A 1BLFA 2XXRA 4F29A 1NH7A 4MIJA 2CEXA 1TT1A 3Q27A 1MQHA 4GBVA 2OLBA 2O6AA 4U1ZA 2HAUA 1B52A 1FPEA 3P7IA 4NGUA 4YKJA 4FE8A 1FPBA 2GHAA 4O7IA 1NV0A 1O64A 2ABHA 2M8CA 3LC8A 2OX3A 4R9FA 3G3KA 1SI0A 2I0BA 3KN8A 3U8QA 5ITOA 1KA1A 3FZVA 4POXA 4X1DA 1INPA 2RF1A 4GWZA 4P9KA 1OIBA 4R72A 2DE4A 1Y4CA 4GIZA 2DOJA 2CMOA 3FV2A 3T9XB 4XKPA 2NOOA 3ZSFA 2Q74A 1B3GA 1IMAA 1M5CA 1H76A 2OJTA 2ZYNA 4O94A 4JB7A 1PB9A 3PU5A 3E78A 2Q88A 3U93A 4XXUA 4MBPA 5M2VA 1S50A 3S9MC 4MNIA 2XXXA 1B4HA 3JV9A 5DVFA 1JEVA 1G0IA 4Q0CA 3QXMA 4OESA 2F78A 2Y7WA 1BKAA 3EF7A 3QIMA 2KR0A 2D21A 3RGYA 3RPLB 2HZKA 1N84A 1AL3A 3IO4A 5H8FA 4I9DA 2YJPA 5ELVA 2DQVA 1QGXA 4XKRA 3G3JA 1S7YA 5JTYB 5A5LA 4EQBA 3PPQA 3S9NC 4DCYA 3K00A 4PAFA 3M3FA 3DRJA 3IOTA 4QFNA 4U21A 1PEBA 2F6PA 1I69A 1WDNA 2H5YA 3PD9A 5DEXA 1POTA 1PC3A 1YZ0A 4ZEBA 3IORA 3MQ9A 3RTWB 4RY1A 1FQEA 2I0CA 3TEPA 1IXHA 1OLCA 2F3DA 4FEBA 3PMVA 2B4MA 4OVSA 4GL8A 4YMBA 3BFUA 3K1NA 4OXVA 1YCJA 4N15A 1MS7A 3KC0A 4H45A 4PBQA 4MFIA 2A5TA 4QHQA 4PFRA 1IMDA 3VV5A 3MAMA 4P56A 2BJIA 1IXCA 5FHNA 3I6VA 3TDJA 4AQ4A 3QYTA 2BJJX 3MVWA 4OTEA 2DWJA 3ZKLA 3MP8A 5AA2D 4DLDA 1FTJA 4KYEA 4HCYA 4MEVA 4F3BA 5FTIA 4PBHA 5DEXB 2O51A 3K6WA 4MLVA 2ZYMA 5KDTA 2UVHA 4HE0A 3A29A 3HCQA 4NG7A 4MLQA 4ELOA 3MZBA 1JETA 5I56B 4QFPA 1IEJA 4HE1A 4JWOA 1LAFE 3CI8A 2PBWA 1RDZA 3VXCA 3TQWA 4LA9A 4PQJA 3V83A 4JSOA 2V3TA 4IGTA 1B3LA 1MPBA 3PPNA 3T96B 1P1QA 1IMBA 4NF5B 3UIFA 4U4SA 5KCJB 2THIA 2Z8FA 3TCGA 4KI0E 1ZBMA 2DYXA 4X8RA 2XWVA 4NQ8A 5F24A 3TCFA 1OQGA 4AS4A 3OELA 1NV3A 2PX1A 1NNKA 2F7AA 4KXPA 3H06B 4OZ9A 2UVJA 1FQFA 1TXFA 1MQGA 3DRFA 1B7HA 1FQDA 4KCCA 5K2XA 4OFOA 3SEWA 4MNCA 3PGFA 3H7MA 3C4MA 3GBBA 4RNSA 4EUOA 3S9EA 1Y1ZA 3M3KA 3K01A 2R6GE 3VLVA 3V8XB 1QW0A 2QS4A 2X7QA 4F19A 4YZZA 3KJTA 4PETA 2FIEA 5AA4A 2ONSA 4FIMA 3UGWA 3OO8A 1K9YA 2YLNA 4N13A 1RKMA 3SEVA 4GX6A 4TLLB 1L5TA 4MNPA 4YICA 3DM0A 2FA7A 4GX4A 1AH5A 4JXIA 5TU0A 3RYDA 2H9BA 1TWYA 1B05A 2OBGA 3O29A 2OWZA 4DI3D 3OSQA 3OOAA 1ZKBA 4Q5TA 3IAZA 3R7XA 1B1HA 4R6KA 2HCAA 1FQCA 5LDZA 4JWYA 2XWOA 3LSXA 1DOTA 1B2HA 5CMMA 1PDAA 2H4IA 1M5FA 2KLFA 3U92A 3U94A 3S4UA 5J16A 3EKIA 2P2AA 2A5SA 1MRPA 3O6HA 5H8NB 4I3EA 4BDQA 4H8IA 2Q8MA 3MP6A 4IO5A 4IO3A 2XXWA 5I57A 4X48A 4GXSB 3O2AA 4F22A 5EYGA 5AE4A 3ILUB 1CB6A 1VFDA 1POY1 1B7ZA 4ZEIA 3VE1B 1B32A 5EHMA 2XXIA 1FJ6A 2Q2CA 5IM2A 4KD5A 4LQ2A 4G68A 2Z8DA 3OO9A 1MY1A 1B40A 5F7VA 4ZE8A 2OZZA 1B51A 4ELRA 3TKDA 4BLAA 4LONB 3RTFB 3JZJA 3TAJA 1FSAA 1P1OA 3RPLA 1NV7A 1NNFA 1TFDA 1Y4TA 5AA3A 4R9GA 4GX3A 1NL5A 3DP6A 4U22A 5FTHA 3IJXB 1VDWA 2QJEA 2UVGA 4MJOA 1KZ8A 2ONRA 4PE3A 4JVDA 2O1MA 4QFLA 4R6HA 2HQ0A 5EQ8A 4YKIA 1LAGE 4GOTA 3V89B 1LBVA 2ZZVA 1B4ZA 2P3VA 1B46A 3RT8A 5EQ9A 4R2FA 1MXXA 3FJMA 2F35A 4ZDMA 2AL5A 5I2NB 3OD7A 5HBCA 5FBPA 1MQJA 4LZ7A 5H8HB 1SI1A 2RC7A 4QBAA 4HXVA 1IXGA 2F34A 2O1LA 1CE2A 2D5WA 2CZLA 1EYJA 4PAIA 3PUZE 4YAHX 1ATGA 1MY2A 3LBSA 2R71A 1MXYA 4OVRA 4RK9A 1XHYA 3MUQA 4PC9A 4GWYA 5CI5A 1GVCA 3AXFA 4NF4A 3B6TA 2Y7PA 3UK4A 3K1PA 4QFKA 3DP4A 2OWSA 3T9VA 2H99A 2DSFA 4KCDA 4EQ9A 2XWKA 1DMBA 4OENA 3LR1A 2CZKA 1MXVA 1QKAA 4XKNA 1GR2A 2REGA 2QMWA 2VT5A 1B5IA 3QUJA 3IL1B 1EZOA 3LSLA 4NF8B 1T0KA 3FV1A 4XFEA 4F1UA 2PFZA 2OWTA 4GWUA 2ANJA 3TTLA 1JVYA 3MVXA 1FJ9A 1Z7NE 1A8EA 4NWDA 3SDFA 2QS2A 1JQFA 4IO4A 3H3GA 5AA4B 2XD2A 2Z23A 4AS5A 3D1RA 1M5DA 3SETA 4H6DA 1VFEA 4TQUQ 2I3VA 4GFRA 2WYPA 4GXAA 4HE2A 2DWAA 2VD3A 1SW1A 2V3UA 3BFTA 4QXDA 1PBQA 3HSTA 1YTVA 1IMCA 1D9QA 4OFLA 1B0LA 1Z7ME 4NN3A 4BDLA 3KJ7A 3N5LA 2RCAA 1FBEA 1MDQA 4IY6A 3ZS6A 2GQ1A 1QJMA 5BUUA 4I8CA 1G0HA 2VD2A 5L9MA 3H6VA 4P1EA 2DWHA 3A3UA 4R75A 3CG1A 2GFEA 4OANA 4P0GA 3CR9A 1LLSA 1D9YA 3IO6A 3Q25A 2Y5LA 1NV6A 3LUZA 3MYUA 3DRGA 4P1LA 1J1NA 2XXHA 4WXJA 5ET8A 2XWIA 3LUYA 2XXUA 1SVXB 5T3JA 2ZZWA 2DXRA 1GTKA 1FTOA 4DIGA 4LN5A 1RDYA 3OO7A 5LOMA 1LAHE 3H03A 3PPOA 1D3KA 3K1MA 3QK6A 1LBCA 3EHSA 2F8DA 2PFYA 3ONMA 1JP4A 1JW5A 3HV1A 1B5HA 1AMFA 2FHYA 3OO6A 1SYIA 5ICQA 2XHDA 3H6UA 5L9OA 1XI6A 5H8SA 5JEIA 3C34A 1N04A 1KA0A 3C9HA 2DVZA 2E0SA 3UN6A 1ELJA 3OMBA 1P99A 4Q8RA 3IB2A 2Q2AA 4LQ5A 3U1OA 1FPDA 4LZ5A 1FBFA 4IB2A 2WEFA 4HTGA 4PF8A 1D4NA 2QS1A 4U1OA 4BDRA 1LBWA 3K4UA 2QS3A 3MPKA 4YKPA 5EHSA 4L17A 1MM6A 4LUBA 1P1NA 3SERA 3MBPA 3PD8A 4IGRA 5ICTA 2F7BA 5DW8A 2ZYOA 4GVOA 2AL4A 5I59B 5JTYA 2XX8A 1Y1MA 3FXBA 1NNTA 4RPOA 1R1NA 3SKPA 5ET5A 4WKMA 1URGA 1B0HA 3CIJA 4GWXA 4QSEA 1EYIA 4FECA 3ILTB 3UA8A 1MY0A 2ZNSA 1AIVA 4ONYA 4IY5A 4XF5A 1DTZA 2QRYA 2VPOA 4KYSA 1DTGA 1LAXA 3FBPA 1EZ9A 1RDXA 1MY4A 2HHMA 3W9VA 3O97A 1NNPA 3Q28A 2B65A 4P8BA 2ZNUA 4NMYA 3HHFA 3E9XA 1MH3A 2WOKA 3SEYA 3CSGA 4YKKA 4H1XA 1I6BA 3PMWA 4GF8A 3IB0A 4QRZA 5DVJA 3T9UA 3TQLA 2PMSA 1MXZA 1ZTYA 3FATA 3C36A 2REJA 3EQ1A 4IO2A 1SW2A 1H45A 1A7LA 4H5GA 4TOZA 2O68A 1ANFA 5IKBA 1XVXA 1PBPA 1DCUA 1KWHA 1QUIA 4F31B 2HEUA 4K3FA 1FTLA 3HO7A 1Y3PA 1S9TA 3FVKA 5B70A 5L8DA 1FBCA 3K6XA 2WKYA 4Z0IA 4KPTA 1N76A 4OYVA 3A09A 4UACA 4ND9A 4I62A 3USDA 1D9VA 1IIWA 3M3LA 4NE4A 3OENA 4EF1A 3K6UA 4N8GA 4PGNA 4QSCA 2VOZA 2UYFA 3FGSA 4I3YA 1FQBA 4G8NA 1DBZA 1FBHA 2QMXA 1IUDA 2QVUA 1B6HA 4ZECA 2V4CA 2F5XA 1O7TA 3HHGA 3LSFB 3W15C 3DRIA 5A5XA 3TPAA 2ZZXA 3OEMA 4TLMB 3CHGA 2UXAA 4H8JA 3FXQA 2QFLA 4RXLA 4O7MA 4C1UA 2E1SA 3KG2A 4HS7A 4PP0A 2P1SA 2F7CA 4H46A 1NH8A 3ZKKA 3PV0E 3T93B 3I3VA 3GXAA 4PFYA 1QUJA 4PTKA 1B7UA 2XXPA 3IJOB 1Y3NA 4NF5A 1QUKA 2I48A 4PFTA 1M5BA 2V84A 3PUVE 2R9JA 1DPEA 5I5PA 4RK2A 1I6QA 2Q9TA 3CG3A 3SZPA 4U4XA 3S2VA 2F97A 4OVQA 4KHZE 4QSDA 1OLAA 3U65A 1JVXA 4F39A 3QSLA 4THIA 3BIHA 3R6UA 3G3IA 4G68C 1AOVA 4DZ1A 3MZ9A 1JW1A 1EYKA 3PTYA 5FHOA 4G2ZA 4FATA 2DE2A 5KDTB 3TFLA 2Z8EA 4XIGQ 1UTHB 4H5FA 4N6DA 4RYAA 4DI4B 3UORA 4N4UA 2FNCA 1Q1KA 1XOCA 4I1DA 3UP9A 3MWBA 1ZU0A 5IZ3B 1LFIA 4OQOA 3GZGA 3O28A 2ZXTA 1UIUA 2DS9A 3DRHA 3R26A 4N6KA 3RLFE 3G3FA 4RA1A 1MQDA 3TTKA 5ITPA 4N07A 3E13X 1B58A 4P47A 3WAEA 1FCKA 2ZMBA 2I49A 2WYKA 4DCXA 2AYSA 2PT2A 3LV0A 2WBBA 2XX9A 3IFAA 3B8BA 2OK2A 3HN0A 1B3HA 4R73A 2F3BA 4OEUA 4XKQA 1N7XA 5IAIA 3FXUA 4OA4A 3W9WA 2V93A 2XXTA 3E4RA 3MPLA 1EH3A 2WBDA 1IMFA 3KN3A 4NWCA 2Q89A 2G93A 4DXCA 1N0TA 4GWOA 1VSOA 3T1BA 1LSTA 1N3WA 3THIA 4PFIA 1NUWA 1LFHA 1R9LA 2NVUB 2Y5KA 4M4GA 4MX6A 2GH9A 1BIYA 1IITA 4N8YA 4H67A 4X1BA 2NWJA 5I2NA 1MXUA 1N7WA 2CZHA 4F18A 4G77A 4IO7A 1LCFA 1US5A 2Z22A 1MXWA 3MZ1A 4OWDA 3CFZA 3T0JA 2D3IA 4E0XA 5ET7A 3IX1A 3KEIA 2FIXA 2VPNA 1UTHA 1FPIA 3EN3A 4ISUA 4F3PA 2P3NA 1NUYA 2DXYA 3MJNA 4LP2B 3CSBA 4DXBA 3K0VA 4G8MA 4R2BA 1DK4A 3CRBA 3G3HA 3VLUA 3C32A 1H3DA 1LBBA 3O6IA 1HSLA 3D4CA 3RUMA 1MM7A 3VVFA 3S9LC 3B6QA 4P3LA 4XEQA 2ESNA 4PE5B 1JW4A 3TUSA 4OEVA 3TYHA 2AIXA 1EU8A 4OMBA 2QSXA 4P11A 2H98A 3T66A 4LZ8A 4EXLA 1URSA 2R8TA 3N6TA 5I59A 5I2KA 3O66A 4PF6A 5CMKA 2PCRA 1URDA 1QULA 4BDNA 4F2OA 4G8HA 4GL0A 3KGCA 2GHBA 2RC8A 4C1TA 2VGQA 2RC9A 1QKBA 1NV4A 4NF4B 5CMBA 1SYHA 5KZTA 2PYYA 4NEDA 3G3GA 3VDFA 1MDP1 2Y7RA 4C0RA 2VP1A 1LB8A 1TFAA 5EQ7A 5CBSA 1LBYA 1QVSA 2I4CA 2GRVA 4PCDA 1FBPA 4LVQA 1HSEA 3IOVA 5L9SA 1K9ZA 1M5EA 4GWSA 1IXIA 4OHNA 3BIGA 2HAVA 5DT6A 3K6VA 5H8HA 3KSJA 3LSWA 4N91A 3FVNA 3OXNA 4YB6A 1UIVA 1I6AA 3GLBA 5TPAA 2X7PA 2XA5A 3B6WA 2ZYKA 4OVJA 3ODBA 4R74A 4FJPA 3SEXA 4O8MA 4NX1A 3TODA 5I58A 3G7WA 4GRKA 4KR5A 3O6GA 1LBZA 4MCOA 3GYYA 1WODA 5I57B 1R6ZA 2A5TB 4RJZA 4YMAA 1IMEA 2Y84A 3DP8A 4QF9A 2FYIA 1B9JA 1A55A 1ZIUA 4NF6A 4MH5A 4NF6B 1JEUA 1H43A 5EQAA 5CMCA 1CNQA 3RN8A 1BK4A 3FJGA 1MH4A 1GGGA 3PUXE 5HPQA 1FBGA 1O63A 2XXKA 1SBPA 5AA2A 4JVCA 4O3AA 3PMXA 1GV8A 3KFMA 3O9PA 4HCWA 2F6GA 1FW0A 1MG1A 3FD3A 1II5A 3E79A 2PT1A 4JVIA 2HXRA 1RYOA 4Q30B 4NF0A 5H8QB 1UTBB 3TCHA 1US4A 4GD5A 1VE4A 3JYRA 2IA4A 1YAEA 2CZIA 1Y20A 5EYHA 3MVZA 1SD3A 4MMPA 2IEEA 2B4LA 2NUVA 1ZLQA 1LGBC 2V25A 3T9HB 3QAXA 4NTLA 3H4ZA 2FVZA 3TTMA 2H25A 3VVEA 4BDMA 1A99A 2CEYA 3OEKA 5F1QA 4QFOA 4NAPA 3SESA 1PB7A 4IO6A 4F3GA 3D4GA 4EF2A 1FPKA 3FJ7A 1FPFA 3VLWA 4RPNA 3DRKA 4PAKA 4UA8A 2B3BA 3V5AA 4XTCQ 1SW5A 4G4PA 5IZZA 4G68B 4N17A 3O6PA 4ELPA 1NFTA 3KBZA 1AWBA 3RYBA 3QMFA 3FXRA 5LTCA 2DDKA 3CVGA 4DXUA 1OVBA 4OERA 1FTAA 4FBPA 2UVIA 2I58A 1LCTA 4G61A 3PUWE 4X9TA 4ELQA 1A54A 3FASA 4ZEFA 4H65A 1UQWA 3OSRA 3EHUA 1DPPA 3RQTA 1XC1A 4I40A 2I6EA 4KFQA
chains in the Genus database with same CATH topology
4R6YA 2XXXA 1B4HA 2XXQA 3R6UA 3G3IA 4G68C 3JV9A 4MF3A 1AOVA 5DVFA 4DZ1A 1JEVA 1DMBA 3MZ9A 1JW1A 1NKXA 4OENA 5I2KB 4Q0CA 3QXMA 5AA1A 3LR1A 4OESA 5FHOA 4ESXA 4G2ZA 2F78A 2Y7WA 1BKAA 4FATA 3EF7A 3QIMA 3E3KA 3KZGA 4ESWA 3RLFE 2DE2A 1MXVA 1XT8A 1QKAA 2D21A 5KDTB 3TFLA 2Z8EA 3RGYA 2HZKA 3N26A 4XIGQ 1N84A 1AL3A 3C35A 1UTHB 3IO4A 4H5FA 5H8FA 1MY3A 4XKNA 1GR2A 4I9DA 2REGA 2QMWA 1B5IA 3QUJA 3RNNA 5FHMA 4RYAA 3IL1B 3UORA 2YJPA 3LSLA 1EZOA 4NF8B 5ELVA 3FV1A 2DQVA 2FNCA 1Q1KA 4F1UA 1T0KA 2OWTA 2ANJA 4XKRA 3ECRA 1SDXA 5TPAB 3TTLA 4DE8A 3G3JA 1S7YA 1XOCA 1JVYA 5JTYB 5B7DA 4I1DA 3MVXA 3UP9A 5TP9B 4EQBA 3MWBA 3PPQA 3S9NC 4Z7EA 4DCYA 1ZU0A 1Z7NE 4YU0A 1LFIA 3K00A 3GZGA 3EPEA 3M3FA 4OQOA 4EQ7A 3O28A 3DRJA 3IOTA 1A8EA 4QFNA 2RINA 4U21A 1OVTA 2ZXTA 1PEBA 4NWDA 3Q29A 2Q8JA 3SDFA 2WOLA 2QS2A 2F6PA 1JQFA 4IO4A 1UIUA 5AA2A 3H3GA 3PPPA 5AA4B 2XD2A 2Z23A 2DS9A 3DRHA 1M5DA 1I69A 3R26A 3G3FA 4H6DA 1WDNA 1VFEA 2H5YA 2PVUA 4RA1A 3PD9A 5DEXA 5AA2B 1POTA 1MQDA 1FTKA 4EDPA 3TTKA 4U2RA 5ITPA 4TQUQ 1PC3A 2I3VA 5CBRA 4N07A 4GFRA 3E13X 4F1YA 4GXAA 1B58A 2F36A 2DWAA 4FORA 5H8FB 4ZEBA 3IORA 2VD3A 1FCKA 4ZZEA 1SW1A 2V3UA 2ZMBA 3BFTA 2I49A 3MQ9A 3RTWB 5A5XB 1PBQA 4DCXA 4RY1A 1FQEA 2AYSA 2I0CA 2PT2A 3HSTA 3N94A 1YTVA 1ZJLA 3TEPA 2XX9A 1IXHA 4OFLA 1B0LA 1Z7ME 1OLCA 2OK2A 2DWIA 1XVYA 1B3HA 3HN0A 4FEBA 4YB5A 5I84A 4R73A 4OEUA 4XKQA 3PMVA 4BDLA 1N7XA 4GQOA 3C33A 3FXUA 5IAIA 3KJ7A 2O7IA 4EQ9A 3W9WA 3N5LA 2RCAA 1MDQA 2B4MA 2V93A 4IY6A 4GL8A 3PUYE 2ONKE 4ZZAA 5BWJA 3FIRA 4WEDA 2XXTA 4YMBA 2RKMA 3ZS6A 1QJMA 3C31A 3E4RA 3CFXA 3TELA 5I56A 5JK4A 1DSNA 3MPLA 4M1VA 1EH3A 5I58B 5BUUA 3BFUA 4I8CA 3K1NA 4JSDA 3KN3A 4NWCA 2Q89A 2G93A 1YCJA 2VD2A 4OXVA 1MS7A 5L9MA 5ISUA 4DXCA 3H6VA 3MC2A 1RYXA 2DWHA 1N0TA 4GWOA 1VSOA 1FQAA 3A3UA 4R75A 1MPDA 5DTBA 2DP8A 3CG1A 4MFIA 1LSTA 2A5TA 2GFEA 2DE3A 4QHQA 1N3WA 4YB7A 5CM6A 1Q35A 4P0GA 2ZNTA 4KFQA 3CR9A 5LOMA 3THIA 3VV5A 1LLSA 3MAMA 1D9YA 3TMGA 3IO6A 3Q25A 1LFHA 1R9LA 2NVUB 3DRGA 4FAJA 1J1NA 1B5JA 2XXHA 4M4GA 1IXCA 4WXJA 5FHNA 1USYH 3L6GA 3LUYA 1HSJA 3PPRA 2XXUA 2GH9A 2NXOA 4ZEKA 1BIYA 3I6VA 3Q26A 1SVXB 3TDJA 1IITA 2DXRA 2W7YA 4H67A 4OFJA 4AQ4A 1GTKA 4ZE9A 1FTOA 4DIGA 2O84X 3QYTA 2BJJX 3MVWA 2UYEA 4X1BA 2NWJA 3OO7A 1MPCA 4OTEA 5I2NA 2V3QA 3WAFA 4H0WA 1MXUA 2HZLA 2DWJA 1LAHE 1N7WA 3H03A 3PPOA 5TP9A 3ZKLA 3MP8A 3K02A 1D3KA 3BBRA 4JDFA 4F18A 5AA2D 3K1MA 1VR5A 5DYHA 4G77A 4IO7A 3QK6A 1LCFA 1US5A 2Z22A 3IK6B 1MXWA 3MZ1A 4OWDA 5EYFA 3VXBA 4DLDA 1FTJA 3CFZA 4KYEA 2I4BA 2D3IA 1LBCA 2XX7A 3EHSA 2F8DA 4HCYA 1WVJA 4E0XA 4F3BA 5FTIA 3ONMA 3M8UA 1JW5A 3IX1A 3KEIA 5DEXB 1UTHA 3HV1A 2O51A 3K6WA 1B5HA 3EN3A 4MLVA 2ZYMA 5KDTA 2UVHA 1AMFA 1UTBA 3A3CA 3OO6A 1SYIA 5ICQA 2XHDA 3HCQA 4MLQA 1N3XA 3H6UA 4ELOA 5L9OA 2WOPA 2DVCA 4ISUA 4YKIA 3MZBA 3IOWA 5DVIA 4PFWA 1JETA 5H8SA 4F3PA 3FVGA 4HW8A 5I56B 4QFPA 5JEIA 3T22A 1IEJA 3C34A 3H6WA 4JWOA 1N04A 1LAFE 2O69A 3CI8A 2DXYA 3MJNA 2X26A 3C9HA 2PBWA 3KBRA 4LP2B 3VXCA 3CSBA 4LA9A 3TQWA 3TTRA 3K0VA 2DVZA 4PQJA 3MVYA 4DXBA 2E0SA 2HXWA 4G8MA 4JSOA 3UN6A 3V83A 1ELJA 3OMBA 2V3TA 3OO9A 1P99A 4IGTA 4R2BA 4Q8RA 1B3LA 1MPBA 3IB2A 2Q2AA 3CRBA 3G3HA 3PPNA 1P1QA 4LQ5A 3T96B 3U1OA 3VLUA 3C32A 4NF5B 4LZ5A 3UIFA 1H3DA 1LBBA 4U4SA 3O6IA 1HSLA 4IB2A 5KCJB 5KCJA 3D4CA 3F11A 2THIA 3BKIB 1LB9A 3KN7A 4HTGA 2Z8FA 3TCGA 4KI0E 3RUMA 1MM7A 1ZBMA 2QL3A 3VE1B 3VVFA 3B6QA 3S9LC 2DYXA 1D4NA 2QS1A 4U1OA 3GBAA 5H8NA 4BDRA 2VHAA 3K4UA 2ESNA 2QS3A 4ELPA 4PE5B 1JW4A 3TUSA 4KQPA 3MPKA 4OEVA 3TCFA 4YKPA 5EHSA 1OQGA 3U72A 3TYHA 4L17A 1MM6A 2AIXA 1EU8A 2YPNA 3OELA 4LUBA 4OMBA 1P1NA 2QSXA 3SERA 4P11A 3H6TA 3TZAA 2PX1A 3MBPA 1XS5A 3PD8A 4IGRA 5ICTA 2F7BA 2H98A 1B3FA 3RY3A 3T66A 1NNKA 2ALUA 2ZYOA 1FTMA 2F7AA 4GVOA 4LZ8A 3H06B 4OZ9A 4EXLA 2AL4A 1IQ7A 2UVJA 1URSA 1A8FA 3FUZA 4ZS9A 3N6TA 3SETA 3KOTA 5I2KA 5I59B 5I59A 5JTYA 1FQFA 1TXFA 4GLIA 1MQGA 2XX8A 3DRFA 3O66A 5CRYA 1Y1MA 1B7HA 1FQDA 4KCCA 4WEPA 5CC2A 4N6PA 1ZMGA 1NNTA 1EZPA 1JNFA 4RPOA 5CMKA 1R1NA 3SKPA 1URDA 1QULA 4BDNA 5K2XA 4F2OA 4OFOA 3L6HA 4G8HA 4GL0A 3KGCA 4WKMA 3WAEA 2GHBA 3SEWA 2RC8A 3PGFA 1IZ1A 2VGQA 1URGA 2RC9A 1B0HA 3CIJA 3H7MA 4FEDA 4C1TA 3K2DA 4E0WA 2O7UA 1QKBA 2XXVA 3C4MA 2LAOA 4QSEA 3VFJA 4NF4B 1B1XA 3GBBA 4RNSA 5CMBA 1SYHA 5KZTA 4POWA 2RCBA 4FECA 3ILTB 2PYYA 4NEDA 3UA8A 4EUOA 1MY0A 3G3GA 2ZNSA 3RT6B 1F9BA 1B3EA 3VDFA 1MDP1 2Y7RA 3S9EA 1AIVA 4ONYA 1Y1ZA 3B7DA 3M3KA 4IY5A 4AB6A 3K01A 4C0RA 2R6GE 1LB8A 1TFAA 2VP1A 2XXYA 3VLVA 5CBSA 3TTNA 3V8XB 1DTZA 1QVSA 1QW0A 2I4CA 2QS4A 2GRVA 2QRYA 2X7QA 4F19A 4F1VA 3N6UA 4KYSA 4YZZA 3KJTA 1DTGA 1LAXA 4LVQA 4PETA 5AA4A 1EZ9A 3PAMA 1HSEA 3IOVA 5L9SA 1R9QA 2ONSA 1MY4A 1YPNA 3KOSA 4FIMA 3UGWA 1M5EA 3IB1A 3W9VA 2B3FA 1IXIA 3OO8A 3O97A 2YLNA 4OHNA 1NNPA 1SQYA 2HAVA 4PFUA 3K6VA 5DT6A 5H8HA 3Q28A 4N13A 1RKMA 2B65A 3SEVA 3KSJA 2ZNUA 3LSWA 4NMYA 4OETA 1MQIA 3FVNA 3HHFA 4TLLB 3OXNA 4P0IA 4YB6A 1L5TA 1UIVA 1I6AA 3E9XA 4YICA 1MH3A 3DM0A 3GLBA 5TPAA 2WOKA 3SEYA 2FA7A 1AH5A 3CSGA 4JXIA 2X7PA 5TU0A 3DLNA 4YKKA 4BDOA 4F2QA 4H1XA 1I6BA 2H9BA 1Y9UA 4DDDA 1TWYA 3B6WA 2QPQA 2ZYKA 3DELB 3EHTA 1B05A 2OBGA 3PMWA 3HPIA 3O29A 4GF8A 3IB0A 4OVJA 3ODBA 3VVDA 4QRZA 3QUFA 5DVJA 3MP1A 3OSQA 3T9UA 5F7VA 4R74A 4FJPA 3SEXA 3OOAA 1ZKBA 3TQLA 4Q5TA 1LFGA 3IAZA 3R7XA 2PMSA 5J1DA 1MXZA 1ZTYA 1A40A 3FATA 3TODA 1B1HA 1SW4A 2REJA 3C36A 4JWXA 4R6KA 3G7WA 3RPWA 5I58A 3EQ1A 1BTJA 2HCAA 4GRKA 1FQCA 3O6GA 4IO2A 4KR5A 1SW2A 1WODA 4JWYA 1H45A 1A7LA 5I57B 4H5GA 1R6ZA 4TOZA 1OMPA 2A5TB 2OCUA 4RJZA 4YMAA 2O68A 3LSXA 1ANFA 1DOTA 1B2HA 5CMMA 2Y84A 1PDAA 3DP8A 4QF9A 2FYIA 1M5FA 1OQHA 2H4IA 2KLFA 3IOUA 4ECFA 1B9JA 1A55A 1NMUA 3U92A 1ZIUA 2Y7IA 3U94A 3S4UA 3SEUA 5IKBA 4O3BA 4NF6A 4MH5A 2P2AA 4NF6B 1JEUA 1PBPA 1XVXA 1H43A 2A5SA 1MRPA 1KWHA 1QUIA 3O6HA 5CMCA 4F31B 4ZEDA 5H8NB 2HEUA 1BP5A 4JBZA 4H8IA 1FTLA 4K3FA 3RN8A 4BDQA 3HO7A 1Y3PA 1S9TA 3FVKA 3MP6A 2XD3A 4F3SA 4IO5A 5B70A 4IO3A 3IR1A 2XXWA 3FJGA 4X48A 5L8DA 5I57A 3FTOA 1MH4A 4GXSB 5H8QA 1GGGA 3LVUA 2G29A 3CFLA 3K6XA 2WKYA 3O2AA 1P1WA 3PUXE 4Z0IA 3ILUB 4KPTA 1N76A 2HFBA 5AE4A 5HPQA 4LATA 4OYVA 1CB6A 1VFDA 1POY1 5AA3A 1B7ZA 3RYAA 1O63A 4ZEIA 3A09A 4UACA 1SBPA 1B32A 2XXIA 4O3AA 2Q2CA 3PMXA 4ND9A 3KFMA 5EHMA 5K2YA 1GV8A 4I62A 3I5OA 4KD5A 3O9PA 4HCWA 4LQ2A 3USDA 4G68A 2F6GA 1D9VA 2Z8DA 1P1UA 4NF8A 1FW0A 1MY1A 1B40A 1IIWA 1PB8A 1MG1A 4ZE8A 5HM4B 2OZZA 3KSXA 1B51A 3M3LA 3FD3A 3MW0A 3OENA 4NE4A 4ELRA 4EXKA 1II5A 2I3WA 3TKDA 4BLAA 4LONB 3RTFB 2PT1A 2Y7KA 3JZJA 3TAJA 3K6UA 1P1OA 4EF1A 1NNFA 1Y3QA 4U23A 1RYOA 1TFDA 1Y4TA 2P0SA 4Q30B 4O3CA 4QSCA 1NL5A 4R9GA 2VOZA 1UTBB 3DP6A 4U22A 5H8QB 3TCHA 1US4A 2UYFA 3IJXB 5FTHA 1USYE 4GD5A 1H44A 2QJEA 1VE4A 2UVGA 3FGSA 3JYRA 2ONRA 3FVOA 4AB5A 1FQBA 4G8NA 2IA4A 1BLFA 2QMXA 1IUDA 2XXRA 1YAEA 4F29A 1Y20A 1B6HA 3MVZA 1NH7A 1SD3A 4ZECA 1TT1A 3Q27A 1MQHA 2IEEA 2O1MA 2B4LA 4QFLA 2OLBA 2NUVA 4R6HA 2HQ0A 1ZLQA 1LGBC 2O6AA 2V25A 3T9HB 3QAXA 2F5XA 2HAUA 1O7TA 4U1ZA 3HHGA 4NTLA 3H4ZA 3LSFB 1LAGE 1B52A 4GOTA 3V89B 3W15C 3DRIA 3P7IA 5A5XA 3TTMA 3TPAA 2H25A 3OEMA 4YKJA 3VVEA 4BDMA 1A99A 4TLMB 1B4ZA 3CHGA 4FE8A 3OEKA 4F22A 2GHAA 5F1QA 1O64A 2UXAA 4H8JA 3FXQA 4QFOA 1B46A 3RT8A 4RXLA 3SESA 4C1UA 2ABHA 2M8CA 3LC8A 4R9FA 3G3KA 1PB7A 2E1SA 4R2FA 1MXXA 3FJMA 4IO6A 3KG2A 4HS7A 1SI0A 2F35A 4PP0A 4ZDMA 2P1SA 2I0BA 3KN8A 3U8QA 2AL5A 2F7CA 4F3GA 5I2NB 3D4GA 4EF2A 3OD7A 5HBCA 3FJ7A 5ITOA 1MQJA 3FZVA 4POXA 4X1DA 1NH8A 3ZKKA 2RF1A 3PV0E 3T93B 4LZ7A 3I3VA 3VLWA 4RPNA 3DRKA 5H8HB 3GXAA 4PFYA 1OIBA 1SI1A 2RC7A 4UA8A 2B3BA 1QUJA 3V5AA 4R72A 1SW5A 1B7UA 4G4PA 4XTCQ 4G68B 1IXGA 3O6PA 2DE4A 1NFTA 1CE2A 2D5WA 1Y4CA 2DOJA 2F34A 2CZLA 2O1LA 3RYBA 2XXPA 4GIZA 3FXRA 2CMOA 1Y3NA 3IJOB 4NF5A 3PUZE 1QUKA 3CVGA 2I48A 4PFTA 4DXUA 1M5BA 2V84A 4YAHX 1OVBA 4OERA 1ATGA 1MY2A 3FV2A 3LBSA 3T9XB 2R71A 3PUVE 1MXYA 2UVIA 4XKPA 2NOOA 2I58A 2R9JA 3ZSFA 1DPEA 1LCTA 4RK9A 1B3GA 3PUWE 1XHYA 3MUQA 4RK2A 4X9TA 1A54A 1I6QA 1M5CA 2Q9TA 1H76A 3FASA 4ELQA 3CG3A 5CI5A 1GVCA 3AXFA 2OJTA 2ZYNA 4NF4A 3B6TA 4U4XA 3S2VA 2F97A 4ZEFA 2Y7PA 4JB7A 1PB9A 3PU5A 3UK4A 4H65A 1UQWA 4KYDA 3K1PA 3OSRA 3EHUA 2Q88A 4KHZE 1DPPA 3RQTA 4QFKA 1XC1A 3U93A 4QSDA 1OLAA 3DP4A 1JVXA 4XXUA 2OWSA 2I6EA 3QSLA 4THIA 3T9VA 4F39A 4MBPA 5M2VA 1S50A 2H99A 3S9MC 2DSFA 4KCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6Y A;  2XXX A;  1B4H A;  2XXQ A;  3R6U A;  3G3I A;  4G68 C;  3JV9 A;  4MF3 A;  1AOV A;  5DVF A;  4DZ1 A;  1JEV A;  1DMB A;  3MZ9 A;  1JW1 A;  1NKX A;  4OEN A;  5I2K B;  4Q0C A;  3QXM A;  5AA1 A;  3LR1 A;  4OES A;  5FHO A;  4ESX A;  4G2Z A;  2F78 A;  2Y7W A;  1BKA A;  4FAT A;  3EF7 A;  3QIM A;  3E3K A;  3KZG A;  4ESW A;  3RLF E;  2DE2 A;  1MXV A;  1XT8 A;  1QKA A;  2D21 A;  5KDT B;  3TFL A;  2Z8E A;  3RGY A;  2HZK A;  3N26 A;  4XIG Q;  1N84 A;  1AL3 A;  3C35 A;  1UTH B;  3IO4 A;  4H5F A;  5H8F A;  1MY3 A;  4XKN A;  1GR2 A;  4I9D A;  2REG A;  2QMW A;  1B5I A;  3QUJ A;  3RNN A;  5FHM A;  4RYA A;  3IL1 B;  3UOR A;  2YJP A;  3LSL A;  1EZO A;  4NF8 B;  5ELV A;  3FV1 A;  2DQV A;  2FNC A;  1Q1K A;  4F1U A;  1T0K A;  2OWT A;  2ANJ A;  4XKR A;  3ECR A;  1SDX A;  5TPA B;  3TTL A;  4DE8 A;  3G3J A;  1S7Y A;  1XOC A;  1JVY A;  5JTY B;  5B7D A;  4I1D A;  3MVX A;  3UP9 A;  5TP9 B;  4EQB A;  3MWB A;  3PPQ A;  3S9N C;  4Z7E A;  4DCY A;  1ZU0 A;  1Z7N E;  4YU0 A;  1LFI A;  3K00 A;  3GZG A;  3EPE A;  3M3F A;  4OQO A;  4EQ7 A;  3O28 A;  3DRJ A;  3IOT A;  1A8E A;  4QFN A;  2RIN A;  4U21 A;  1OVT A;  2ZXT A;  1PEB A;  4NWD A;  3Q29 A;  2Q8J A;  3SDF A;  2WOL A;  2QS2 A;  2F6P A;  1JQF A;  4IO4 A;  1UIU A;  5AA2 A;  3H3G A;  3PPP A;  5AA4 B;  2XD2 A;  2Z23 A;  2DS9 A;  3DRH A;  1M5D A;  1I69 A;  3R26 A;  3G3F A;  4H6D A;  1WDN A;  1VFE A;  2H5Y A;  2PVU A;  4RA1 A;  3PD9 A;  5DEX A;  5AA2 B;  1POT A;  1MQD A;  1FTK A;  4EDP A;  3TTK A;  4U2R A;  5ITP A;  4TQU Q;  1PC3 A;  2I3V A;  5CBR A;  4N07 A;  4GFR A;  3E13 X;  4F1Y A;  4GXA A;  1B58 A;  2F36 A;  2DWA A;  4FOR A;  5H8F B;  4ZEB A;  3IOR A;  2VD3 A;  1FCK A;  4ZZE A;  1SW1 A;  2V3U A;  2ZMB A;  3BFT A;  2I49 A;  3MQ9 A;  3RTW B;  5A5X B;  1PBQ A;  4DCX A;  4RY1 A;  1FQE A;  2AYS A;  2I0C A;  2PT2 A;  3HST A;  3N94 A;  1YTV A;  1ZJL A;  3TEP A;  2XX9 A;  1IXH A;  4OFL A;  1B0L A;  1Z7M E;  1OLC A;  2OK2 A;  2DWI A;  1XVY A;  1B3H A;  3HN0 A;  4FEB A;  4YB5 A;  5I84 A;  4R73 A;  4OEU A;  4XKQ A;  3PMV A;  4BDL A;  1N7X A;  4GQO A;  3C33 A;  3FXU A;  5IAI A;  3KJ7 A;  2O7I A;  4EQ9 A;  3W9W A;  3N5L A;  2RCA A;  1MDQ A;  2B4M A;  2V93 A;  4IY6 A;  4GL8 A;  3PUY E;  2ONK E;  4ZZA A;  5BWJ A;  3FIR A;  4WED A;  2XXT A;  4YMB A;  2RKM A;  3ZS6 A;  1QJM A;  3C31 A;  3E4R A;  3CFX A;  3TEL A;  5I56 A;  5JK4 A;  1DSN A;  3MPL A;  4M1V A;  1EH3 A;  5I58 B;  5BUU A;  3BFU A;  4I8C A;  3K1N A;  4JSD A;  3KN3 A;  4NWC A;  2Q89 A;  2G93 A;  1YCJ A;  2VD2 A;  4OXV A;  1MS7 A;  5L9M A;  5ISU A;  4DXC A;  3H6V A;  3MC2 A;  1RYX A;  2DWH A;  1N0T A;  4GWO A;  1VSO A;  1FQA A;  3A3U A;  4R75 A;  1MPD A;  5DTB A;  2DP8 A;  3CG1 A;  4MFI A;  1LST A;  2A5T A;  2GFE A;  2DE3 A;  4QHQ A;  1N3W A;  4YB7 A;  5CM6 A;  1Q35 A;  4P0G A;  2ZNT A;  4KFQ A;  3CR9 A;  5LOM A;  3THI A;  3VV5 A;  1LLS A;  3MAM A;  1D9Y A;  3TMG A;  3IO6 A;  3Q25 A;  1LFH A;  1R9L A;  2NVU B;  3DRG A;  4FAJ A;  1J1N A;  1B5J A;  2XXH A;  4M4G A;  1IXC A;  4WXJ A;  5FHN A;  1USY H;  3L6G A;  3LUY A;  1HSJ A;  3PPR A;  2XXU A;  2GH9 A;  2NXO A;  4ZEK A;  1BIY A;  3I6V A;  3Q26 A;  1SVX B;  3TDJ A;  1IIT A;  2DXR A;  2W7Y A;  4H67 A;  4OFJ A;  4AQ4 A;  1GTK A;  4ZE9 A;  1FTO A;  4DIG A;  2O84 X;  3QYT A;  2BJJ X;  3MVW A;  2UYE A;  4X1B A;  2NWJ A;  3OO7 A;  1MPC A;  4OTE A;  5I2N A;  2V3Q A;  3WAF A;  4H0W A;  1MXU A;  2HZL A;  2DWJ A;  1LAH E;  1N7W A;  3H03 A;  3PPO A;  5TP9 A;  3ZKL A;  3MP8 A;  3K02 A;  1D3K A;  3BBR A;  4JDF A;  4F18 A;  5AA2 D;  3K1M A;  1VR5 A;  5DYH A;  4G77 A;  4IO7 A;  3QK6 A;  1LCF A;  1US5 A;  2Z22 A;  3IK6 B;  1MXW A;  3MZ1 A;  4OWD A;  5EYF A;  3VXB A;  4DLD A;  1FTJ A;  3CFZ A;  4KYE A;  2I4B A;  2D3I A;  1LBC A;  2XX7 A;  3EHS A;  2F8D A;  4HCY A;  1WVJ A;  4E0X A;  4F3B A;  5FTI A;  3ONM A;  3M8U A;  1JW5 A;  3IX1 A;  3KEI A;  5DEX B;  1UTH A;  3HV1 A;  2O51 A;  3K6W A;  1B5H A;  3EN3 A;  4MLV A;  2ZYM A;  5KDT A;  2UVH A;  1AMF A;  1UTB A;  3A3C A;  3OO6 A;  1SYI A;  5ICQ A;  2XHD A;  3HCQ A;  4MLQ A;  1N3X A;  3H6U A;  4ELO A;  5L9O A;  2WOP A;  2DVC A;  4ISU A;  4YKI A;  3MZB A;  3IOW A;  5DVI A;  4PFW A;  1JET A;  5H8S A;  4F3P A;  3FVG A;  4HW8 A;  5I56 B;  4QFP A;  5JEI A;  3T22 A;  1IEJ A;  3C34 A;  3H6W A;  4JWO A;  1N04 A;  1LAF E;  2O69 A;  3CI8 A;  2DXY A;  3MJN A;  2X26 A;  3C9H A;  2PBW A;  3KBR A;  4LP2 B;  3VXC A;  3CSB A;  4LA9 A;  3TQW A;  3TTR A;  3K0V A;  2DVZ A;  4PQJ A;  3MVY A;  4DXB A;  2E0S A;  2HXW A;  4G8M A;  4JSO A;  3UN6 A;  3V83 A;  1ELJ A;  3OMB A;  2V3T A;  3OO9 A;  1P99 A;  4IGT A;  4R2B A;  4Q8R A;  1B3L A;  1MPB A;  3IB2 A;  2Q2A A;  3CRB A;  3G3H A;  3PPN A;  1P1Q A;  4LQ5 A;  3T96 B;  3U1O A;  3VLU A;  3C32 A;  4NF5 B;  4LZ5 A;  3UIF A;  1H3D A;  1LBB A;  4U4S A;  3O6I A;  1HSL A;  4IB2 A;  5KCJ B;  5KCJ A;  3D4C A;  3F11 A;  2THI A;  3BKI B;  1LB9 A;  3KN7 A;  4HTG A;  2Z8F A;  3TCG A;  4KI0 E;  3RUM A;  1MM7 A;  1ZBM A;  2QL3 A;  3VE1 B;  3VVF A;  3B6Q A;  3S9L C;  2DYX A;  1D4N A;  2QS1 A;  4U1O A;  3GBA A;  5H8N A;  4BDR A;  2VHA A;  3K4U A;  2ESN A;  2QS3 A;  4ELP A;  4PE5 B;  1JW4 A;  3TUS A;  4KQP A;  3MPK A;  4OEV A;  3TCF A;  4YKP A;  5EHS A;  1OQG A;  3U72 A;  3TYH A;  4L17 A;  1MM6 A;  2AIX A;  1EU8 A;  2YPN A;  3OEL A;  4LUB A;  4OMB A;  1P1N A;  2QSX A;  3SER A;  4P11 A;  3H6T A;  3TZA A;  2PX1 A;  3MBP A;  1XS5 A;  3PD8 A;  4IGR A;  5ICT A;  2F7B A;  2H98 A;  1B3F A;  3RY3 A;  3T66 A;  1NNK A;  2ALU A;  2ZYO A;  1FTM A;  2F7A A;  4GVO A;  4LZ8 A;  3H06 B;  4OZ9 A;  4EXL A;  2AL4 A;  1IQ7 A;  2UVJ A;  1URS A;  1A8F A;  3FUZ A;  4ZS9 A;  3N6T A;  3SET A;  3KOT A;  5I2K A;  5I59 B;  5I59 A;  5JTY A;  1FQF A;  1TXF A;  4GLI A;  1MQG A;  2XX8 A;  3DRF A;  3O66 A;  5CRY A;  1Y1M A;  1B7H A;  1FQD A;  4KCC A;  4WEP A;  5CC2 A;  4N6P A;  1ZMG A;  1NNT A;  1EZP A;  1JNF A;  4RPO A;  5CMK A;  1R1N A;  3SKP A;  1URD A;  1QUL A;  4BDN A;  5K2X A;  4F2O A;  4OFO A;  3L6H A;  4G8H A;  4GL0 A;  3KGC A;  4WKM A;  3WAE A;  2GHB A;  3SEW A;  2RC8 A;  3PGF A;  1IZ1 A;  2VGQ A;  1URG A;  2RC9 A;  1B0H A;  3CIJ A;  3H7M A;  4FED A;  4C1T A;  3K2D A;  4E0W A;  2O7U A;  1QKB A;  2XXV A;  3C4M A;  2LAO A;  4QSE A;  3VFJ A;  4NF4 B;  1B1X A;  3GBB A;  4RNS A;  5CMB A;  1SYH A;  5KZT A;  4POW A;  2RCB A;  4FEC A;  3ILT B;  2PYY A;  4NED A;  3UA8 A;  4EUO A;  1MY0 A;  3G3G A;  2ZNS A;  3RT6 B;  1F9B A;  1B3E A;  3VDF A;  1MDP 1;  2Y7R A;  3S9E A;  1AIV A;  4ONY A;  1Y1Z A;  3B7D A;  3M3K A;  4IY5 A;  4AB6 A;  3K01 A;  4C0R A;  2R6G E;  1LB8 A;  1TFA A;  2VP1 A;  2XXY A;  3VLV A;  5CBS A;  3TTN A;  3V8X B;  1DTZ A;  1QVS A;  1QW0 A;  2I4C A;  2QS4 A;  2GRV A;  2QRY A;  2X7Q A;  4F19 A;  4F1V A;  3N6U A;  4KYS A;  4YZZ A;  3KJT A;  1DTG A;  1LAX A;  4LVQ A;  4PET A;  5AA4 A;  1EZ9 A;  3PAM A;  1HSE A;  3IOV A;  5L9S A;  1R9Q A;  2ONS A;  1MY4 A;  1YPN A;  3KOS A;  4FIM A;  3UGW A;  1M5E A;  3IB1 A;  3W9V A;  2B3F A;  1IXI A;  3OO8 A;  3O97 A;  2YLN A;  4OHN A;  1NNP A;  1SQY A;  2HAV A;  4PFU A;  3K6V A;  5DT6 A;  5H8H A;  3Q28 A;  4N13 A;  1RKM A;  2B65 A;  3SEV A;  3KSJ A;  2ZNU A;  3LSW A;  4NMY A;  4OET A;  1MQI A;  3FVN A;  3HHF A;  4TLL B;  3OXN A;  4P0I A;  4YB6 A;  1L5T A;  1UIV A;  1I6A A;  3E9X A;  4YIC A;  1MH3 A;  3DM0 A;  3GLB A;  5TPA A;  2WOK A;  3SEY A;  2FA7 A;  1AH5 A;  3CSG A;  4JXI A;  2X7P A;  5TU0 A;  3DLN A;  4YKK A;  4BDO A;  4F2Q A;  4H1X A;  1I6B A;  2H9B A;  1Y9U A;  4DDD A;  1TWY A;  3B6W A;  2QPQ A;  2ZYK A;  3DEL B;  3EHT A;  1B05 A;  2OBG A;  3PMW A;  3HPI A;  3O29 A;  4GF8 A;  3IB0 A;  4OVJ A;  3ODB A;  3VVD A;  4QRZ A;  3QUF A;  5DVJ A;  3MP1 A;  3OSQ A;  3T9U A;  5F7V A;  4R74 A;  4FJP A;  3SEX A;  3OOA A;  1ZKB A;  3TQL A;  4Q5T A;  1LFG A;  3IAZ A;  3R7X A;  2PMS A;  5J1D A;  1MXZ A;  1ZTY A;  1A40 A;  3FAT A;  3TOD A;  1B1H A;  1SW4 A;  2REJ A;  3C36 A;  4JWX A;  4R6K A;  3G7W A;  3RPW A;  5I58 A;  3EQ1 A;  1BTJ A;  2HCA A;  4GRK A;  1FQC A;  3O6G A;  4IO2 A;  4KR5 A;  1SW2 A;  1WOD A;  4JWY A;  1H45 A;  1A7L A;  5I57 B;  4H5G A;  1R6Z A;  4TOZ A;  1OMP A;  2A5T B;  2OCU A;  4RJZ A;  4YMA A;  2O68 A;  3LSX A;  1ANF A;  1DOT A;  1B2H A;  5CMM A;  2Y84 A;  1PDA A;  3DP8 A;  4QF9 A;  2FYI A;  1M5F A;  1OQH A;  2H4I A;  2KLF A;  3IOU A;  4ECF A;  1B9J A;  1A55 A;  1NMU A;  3U92 A;  1ZIU A;  2Y7I A;  3U94 A;  3S4U A;  3SEU A;  5IKB A;  4O3B A;  4NF6 A;  4MH5 A;  2P2A A;  4NF6 B;  1JEU A;  1PBP A;  1XVX A;  1H43 A;  2A5S A;  1MRP A;  1KWH A;  1QUI A;  3O6H A;  5CMC A;  4F31 B;  4ZED A;  5H8N B;  2HEU A;  1BP5 A;  4JBZ A;  4H8I A;  1FTL A;  4K3F A;  3RN8 A;  4BDQ A;  3HO7 A;  1Y3P A;  1S9T A;  3FVK A;  3MP6 A;  2XD3 A;  4F3S A;  4IO5 A;  5B70 A;  4IO3 A;  3IR1 A;  2XXW A;  3FJG A;  4X48 A;  5L8D A;  5I57 A;  3FTO A;  1MH4 A;  4GXS B;  5H8Q A;  1GGG A;  3LVU A;  2G29 A;  3CFL A;  3K6X A;  2WKY A;  3O2A A;  1P1W A;  3PUX E;  4Z0I A;  3ILU B;  4KPT A;  1N76 A;  2HFB A;  5AE4 A;  5HPQ A;  4LAT A;  4OYV A;  1CB6 A;  1VFD A;  1POY 1;  5AA3 A;  1B7Z A;  3RYA A;  1O63 A;  4ZEI A;  3A09 A;  4UAC A;  1SBP A;  1B32 A;  2XXI A;  4O3A A;  2Q2C A;  3PMX A;  4ND9 A;  3KFM A;  5EHM A;  5K2Y A;  1GV8 A;  4I62 A;  3I5O A;  4KD5 A;  3O9P A;  4HCW A;  4LQ2 A;  3USD A;  4G68 A;  2F6G A;  1D9V A;  2Z8D A;  1P1U A;  4NF8 A;  1FW0 A;  1MY1 A;  1B40 A;  1IIW A;  1PB8 A;  1MG1 A;  4ZE8 A;  5HM4 B;  2OZZ A;  3KSX A;  1B51 A;  3M3L A;  3FD3 A;  3MW0 A;  3OEN A;  4NE4 A;  4ELR A;  4EXK A;  1II5 A;  2I3W A;  3TKD A;  4BLA A;  4LON B;  3RTF B;  2PT1 A;  2Y7K A;  3JZJ A;  3TAJ A;  3K6U A;  1P1O A;  4EF1 A;  1NNF A;  1Y3Q A;  4U23 A;  1RYO A;  1TFD A;  1Y4T A;  2P0S A;  4Q30 B;  4O3C A;  4QSC A;  1NL5 A;  4R9G A;  2VOZ A;  1UTB B;  3DP6 A;  4U22 A;  5H8Q B;  3TCH A;  1US4 A;  2UYF A;  3IJX B;  5FTH A;  1USY E;  4GD5 A;  1H44 A;  2QJE A;  1VE4 A;  2UVG A;  3FGS A;  3JYR A;  2ONR A;  3FVO A;  4AB5 A;  1FQB A;  4G8N A;  2IA4 A;  1BLF A;  2QMX A;  1IUD A;  2XXR A;  1YAE A;  4F29 A;  1Y20 A;  1B6H A;  3MVZ A;  1NH7 A;  1SD3 A;  4ZEC A;  1TT1 A;  3Q27 A;  1MQH A;  2IEE A;  2O1M A;  2B4L A;  4QFL A;  2OLB A;  2NUV A;  4R6H A;  2HQ0 A;  1ZLQ A;  1LGB C;  2O6A A;  2V25 A;  3T9H B;  3QAX A;  2F5X A;  2HAU A;  1O7T A;  4U1Z A;  3HHG A;  4NTL A;  3H4Z A;  3LSF B;  1LAG E;  1B52 A;  4GOT A;  3V89 B;  3W15 C;  3DRI A;  3P7I A;  5A5X A;  3TTM A;  3TPA A;  2H25 A;  3OEM A;  4YKJ A;  3VVE A;  4BDM A;  1A99 A;  4TLM B;  1B4Z A;  3CHG A;  4FE8 A;  3OEK A;  4F22 A;  2GHA A;  5F1Q A;  1O64 A;  2UXA A;  4H8J A;  3FXQ A;  4QFO A;  1B46 A;  3RT8 A;  4RXL A;  3SES A;  4C1U A;  2ABH A;  2M8C A;  3LC8 A;  4R9F A;  3G3K A;  1PB7 A;  2E1S A;  4R2F A;  1MXX A;  3FJM A;  4IO6 A;  3KG2 A;  4HS7 A;  1SI0 A;  2F35 A;  4PP0 A;  4ZDM A;  2P1S A;  2I0B A;  3KN8 A;  3U8Q A;  2AL5 A;  2F7C A;  4F3G A;  5I2N B;  3D4G A;  4EF2 A;  3OD7 A;  5HBC A;  3FJ7 A;  5ITO A;  1MQJ A;  3FZV A;  4POX A;  4X1D A;  1NH8 A;  3ZKK A;  2RF1 A;  3PV0 E;  3T93 B;  4LZ7 A;  3I3V A;  3VLW A;  4RPN A;  3DRK A;  5H8H B;  3GXA A;  4PFY A;  1OIB A;  1SI1 A;  2RC7 A;  4UA8 A;  2B3B A;  1QUJ A;  3V5A A;  4R72 A;  1SW5 A;  1B7U A;  4G4P A;  4XTC Q;  4G68 B;  1IXG A;  3O6P A;  2DE4 A;  1NFT A;  1CE2 A;  2D5W A;  1Y4C A;  2DOJ A;  2F34 A;  2CZL A;  2O1L A;  3RYB A;  2XXP A;  4GIZ A;  3FXR A;  2CMO A;  1Y3N A;  3IJO B;  4NF5 A;  3PUZ E;  1QUK A;  3CVG A;  2I48 A;  4PFT A;  4DXU A;  1M5B A;  2V84 A;  4YAH X;  1OVB A;  4OER A;  1ATG A;  1MY2 A;  3FV2 A;  3LBS A;  3T9X B;  2R71 A;  3PUV E;  1MXY A;  2UVI A;  4XKP A;  2NOO A;  2I58 A;  2R9J A;  3ZSF A;  1DPE A;  1LCT A;  4RK9 A;  1B3G A;  3PUW E;  1XHY A;  3MUQ A;  4RK2 A;  4X9T A;  1A54 A;  1I6Q A;  1M5C A;  2Q9T A;  1H76 A;  3FAS A;  4ELQ A;  3CG3 A;  5CI5 A;  1GVC A;  3AXF A;  2OJT A;  2ZYN A;  4NF4 A;  3B6T A;  4U4X A;  3S2V A;  2F97 A;  4ZEF A;  2Y7P A;  4JB7 A;  1PB9 A;  3PU5 A;  3UK4 A;  4H65 A;  1UQW A;  4KYD A;  3K1P A;  3OSR A;  3EHU A;  2Q88 A;  4KHZ E;  1DPP A;  3RQT A;  4QFK A;  1XC1 A;  3U93 A;  4QSD A;  1OLA A;  3DP4 A;  1JVX A;  4XXU A;  2OWS A;  2I6E A;  3QSL A;  4THI A;  3T9V A;  4F39 A;  4MBP A;  5M2V A;  1S50 A;  2H99 A;  3S9M C;  2DSF A;  4KCD A; 
#chains in the Genus database with same CATH topology
 4R6Y A;  2XXQ A;  4MF3 A;  1NKX A;  5I2K B;  5AA1 A;  3E3K A;  3KZG A;  4ESW A;  1XT8 A;  3N26 A;  3C35 A;  1MY3 A;  3RNN A;  5FHM A;  1FPJ A;  1NV2 A;  1FBD A;  1SDX A;  3ECR A;  5TPA B;  5B7D A;  4DE8 A;  5TP9 B;  1FPG A;  4Z7E A;  4YU0 A;  3EPE A;  4EQ7 A;  2RIN A;  1OVT A;  4UAB A;  3Q29 A;  2Q8J A;  2WOL A;  3PPP A;  3TTN A;  5BWJ A;  2PVU A;  5AA2 B;  1FTK A;  4EDP A;  4U2R A;  5CBR A;  4F1Y A;  2F36 A;  4FOR A;  5H8F B;  4ZZE A;  5A5X B;  1YYZ A;  4OVT A;  4PDH A;  1NUZ A;  3N94 A;  1ZJL A;  4N81 A;  5I3S A;  2DWI A;  1XVY A;  4YB5 A;  5I84 A;  4GQO A;  3C33 A;  2O7I A;  4IR8 A;  4ZZA A;  3PUY E;  2ONK E;  3FIR A;  4WED A;  4GBW A;  2RKM A;  3C31 A;  3CFX A;  3TEL A;  5I56 A;  5JK4 A;  1DSN A;  1NUX A;  4M1V A;  5I58 B;  4OVP A;  4JSD A;  5ISU A;  3MC2 A;  1RYX A;  1FQA A;  4PDD A;  1MPD A;  5DTB A;  2DP8 A;  5CM6 A;  2DE3 A;  4YB7 A;  1Q35 A;  2ZNT A;  3TMG A;  4FAJ A;  2KQZ A;  1B5J A;  3HFU A;  1USY H;  3L6G A;  1HSJ A;  3PPR A;  2NXO A;  4ZEK A;  3Q26 A;  2W7Y A;  4OFJ A;  3MST A;  4ZE9 A;  2O84 X;  2UYE A;  1MPC A;  1YXI A;  2V3Q A;  3WAF A;  4H0W A;  2HZL A;  5TP9 A;  3K02 A;  3BBR A;  4JDF A;  1VR5 A;  5DYH A;  3IK6 B;  5EYF A;  3VXB A;  2I4B A;  2XX7 A;  1WVJ A;  3M8U A;  1UTB A;  3A3C A;  1N3X A;  2WOP A;  2DVC A;  3IOW A;  5DVI A;  4PFW A;  2QVV A;  4HW8 A;  3FVG A;  3T22 A;  3H6W A;  2O69 A;  2X26 A;  3KBR A;  1NV5 A;  3TTR A;  3MVY A;  2HPG A;  2HXW A;  3B50 A;  4PGP A;  5IZ3 A;  5KCJ A;  3F11 A;  3BKI B;  3KN7 A;  1LB9 A;  3IFC A;  2QL3 A;  3ISP A;  2FBP A;  3GBA A;  5H8N A;  2VHA A;  4MAG A;  4KQP A;  3U72 A;  1FPL A;  2YPN A;  1SPI A;  3H6T A;  1XS5 A;  4NHB A;  1B3F A;  3RY3 A;  2ALU A;  1FTM A;  1IQ7 A;  4ZS9 A;  3FUZ A;  1A8F A;  3KOT A;  4GLI A;  5CRY A;  5ET6 A;  4WEP A;  5CC2 A;  4N6P A;  1ZMG A;  1EZP A;  1JNF A;  1NI9 A;  3L6H A;  4FED A;  1IZ1 A;  5J1D A;  4E0W A;  4GWW A;  3K2D A;  2O7U A;  2XXV A;  2LAO A;  3VFJ A;  1B1X A;  4POW A;  2RCB A;  3RT6 B;  2L5V A;  1F9B A;  1B3E A;  5IZ1 A;  3B7D A;  4AB6 A;  2XXY A;  2JJK A;  4F1V A;  3N6U A;  2WX9 A;  3PAM A;  2MKZ A;  1R9Q A;  1YPN A;  3KOS A;  3IB1 A;  2B3F A;  1SQY A;  4PFU A;  5ESY A;  4OET A;  1MQI A;  4P0I A;  3DLN A;  4BDO A;  1Y9U A;  4DDD A;  2QPQ A;  3DEL B;  2QVR A;  3EHT A;  3VVD A;  3HPI A;  3QUF A;  3MP1 A;  1LFG A;  1A40 A;  1SW4 A;  4JWX A;  3RPW A;  4MHF A;  1BTJ A;  1LBX A;  5I7I A;  1OMP A;  2OCU A;  1OQH A;  3IOU A;  4ECF A;  1NMU A;  3NOH A;  2Y7I A;  3SEU A;  5IGA A;  4O3B A;  1NV1 A;  3ROJ A;  4ZED A;  1BP5 A;  4JBZ A;  2XD3 A;  4F3S A;  3IR1 A;  3FTO A;  5H8Q A;  3LVU A;  2G29 A;  3CFL A;  3TZA A;  1P1W A;  2HFB A;  4LAT A;  4F2Q A;  3RYA A;  4ESX A;  5K2Y A;  3I5O A;  1P1U A;  4NF8 A;  4KYD A;  1PB8 A;  3KSX A;  5HM4 B;  4EXK A;  3MW0 A;  2I3W A;  2Y7K A;  1FRP A;  1Q9D A;  1LEV A;  1Y3Q A;  4U23 A;  4PFB A;  2P0S A;  4O3C A;  3KC1 A;  1USY E;  4X04 A;  1H44 A;  3FVO A;  4AB5 A;  1BLF A;  2XXR A;  4F29 A;  1NH7 A;  4MIJ A;  2CEX A;  1TT1 A;  3Q27 A;  1MQH A;  4GBV A;  2OLB A;  2O6A A;  4U1Z A;  2HAU A;  1B52 A;  1FPE A;  3P7I A;  4NGU A;  4YKJ A;  4FE8 A;  1FPB A;  2GHA A;  4O7I A;  1NV0 A;  1O64 A;  2ABH A;  2M8C A;  3LC8 A;  2OX3 A;  4R9F A;  3G3K A;  1SI0 A;  2I0B A;  3KN8 A;  3U8Q A;  5ITO A;  1KA1 A;  3FZV A;  4POX A;  4X1D A;  1INP A;  2RF1 A;  4GWZ A;  4P9K A;  1OIB A;  4R72 A;  2DE4 A;  1Y4C A;  4GIZ A;  2DOJ A;  2CMO A;  3FV2 A;  3T9X B;  4XKP A;  2NOO A;  3ZSF A;  2Q74 A;  1B3G A;  1IMA A;  1M5C A;  1H76 A;  2OJT A;  2ZYN A;  4O94 A;  4JB7 A;  1PB9 A;  3PU5 A;  3E78 A;  2Q88 A;  3U93 A;  4XXU A;  4MBP A;  5M2V A;  1S50 A;  3S9M C;  4MNI A;  2XXX A;  1B4H A;  3JV9 A;  5DVF A;  1JEV A;  1G0I A;  4Q0C A;  3QXM A;  4OES A;  2F78 A;  2Y7W A;  1BKA A;  3EF7 A;  3QIM A;  2KR0 A;  2D21 A;  3RGY A;  3RPL B;  2HZK A;  1N84 A;  1AL3 A;  3IO4 A;  5H8F A;  4I9D A;  2YJP A;  5ELV A;  2DQV A;  1QGX A;  4XKR A;  3G3J A;  1S7Y A;  5JTY B;  5A5L A;  4EQB A;  3PPQ A;  3S9N C;  4DCY A;  3K00 A;  4PAF A;  3M3F A;  3DRJ A;  3IOT A;  4QFN A;  4U21 A;  1PEB A;  2F6P A;  1I69 A;  1WDN A;  2H5Y A;  3PD9 A;  5DEX A;  1POT A;  1PC3 A;  1YZ0 A;  4ZEB A;  3IOR A;  3MQ9 A;  3RTW B;  4RY1 A;  1FQE A;  2I0C A;  3TEP A;  1IXH A;  1OLC A;  2F3D A;  4FEB A;  3PMV A;  2B4M A;  4OVS A;  4GL8 A;  4YMB A;  3BFU A;  3K1N A;  4OXV A;  1YCJ A;  4N15 A;  1MS7 A;  3KC0 A;  4H45 A;  4PBQ A;  4MFI A;  2A5T A;  4QHQ A;  4PFR A;  1IMD A;  3VV5 A;  3MAM A;  4P56 A;  2BJI A;  1IXC A;  5FHN A;  3I6V A;  3TDJ A;  4AQ4 A;  3QYT A;  2BJJ X;  3MVW A;  4OTE A;  2DWJ A;  3ZKL A;  3MP8 A;  5AA2 D;  4DLD A;  1FTJ A;  4KYE A;  4HCY A;  4MEV A;  4F3B A;  5FTI A;  4PBH A;  5DEX B;  2O51 A;  3K6W A;  4MLV A;  2ZYM A;  5KDT A;  2UVH A;  4HE0 A;  3A29 A;  3HCQ A;  4NG7 A;  4MLQ A;  4ELO A;  3MZB A;  1JET A;  5I56 B;  4QFP A;  1IEJ A;  4HE1 A;  4JWO A;  1LAF E;  3CI8 A;  2PBW A;  1RDZ A;  3VXC A;  3TQW A;  4LA9 A;  4PQJ A;  3V83 A;  4JSO A;  2V3T A;  4IGT A;  1B3L A;  1MPB A;  3PPN A;  3T96 B;  1P1Q A;  1IMB A;  4NF5 B;  3UIF A;  4U4S A;  5KCJ B;  2THI A;  2Z8F A;  3TCG A;  4KI0 E;  1ZBM A;  2DYX A;  4X8R A;  2XWV A;  4NQ8 A;  5F24 A;  3TCF A;  1OQG A;  4AS4 A;  3OEL A;  1NV3 A;  2PX1 A;  1NNK A;  2F7A A;  4KXP A;  3H06 B;  4OZ9 A;  2UVJ A;  1FQF A;  1TXF A;  1MQG A;  3DRF A;  1B7H A;  1FQD A;  4KCC A;  5K2X A;  4OFO A;  3SEW A;  4MNC A;  3PGF A;  3H7M A;  3C4M A;  3GBB A;  4RNS A;  4EUO A;  3S9E A;  1Y1Z A;  3M3K A;  3K01 A;  2R6G E;  3VLV A;  3V8X B;  1QW0 A;  2QS4 A;  2X7Q A;  4F19 A;  4YZZ A;  3KJT A;  4PET A;  2FIE A;  5AA4 A;  2ONS A;  4FIM A;  3UGW A;  3OO8 A;  1K9Y A;  2YLN A;  4N13 A;  1RKM A;  3SEV A;  4GX6 A;  4TLL B;  1L5T A;  4MNP A;  4YIC A;  3DM0 A;  2FA7 A;  4GX4 A;  1AH5 A;  4JXI A;  5TU0 A;  3RYD A;  2H9B A;  1TWY A;  1B05 A;  2OBG A;  3O29 A;  2OWZ A;  4DI3 D;  3OSQ A;  3OOA A;  1ZKB A;  4Q5T A;  3IAZ A;  3R7X A;  1B1H A;  4R6K A;  2HCA A;  1FQC A;  5LDZ A;  4JWY A;  2XWO A;  3LSX A;  1DOT A;  1B2H A;  5CMM A;  1PDA A;  2H4I A;  1M5F A;  2KLF A;  3U92 A;  3U94 A;  3S4U A;  5J16 A;  3EKI A;  2P2A A;  2A5S A;  1MRP A;  3O6H A;  5H8N B;  4I3E A;  4BDQ A;  4H8I A;  2Q8M A;  3MP6 A;  4IO5 A;  4IO3 A;  2XXW A;  5I57 A;  4X48 A;  4GXS B;  3O2A A;  4F22 A;  5EYG A;  5AE4 A;  3ILU B;  1CB6 A;  1VFD A;  1POY 1;  1B7Z A;  4ZEI A;  3VE1 B;  1B32 A;  5EHM A;  2XXI A;  1FJ6 A;  2Q2C A;  5IM2 A;  4KD5 A;  4LQ2 A;  4G68 A;  2Z8D A;  3OO9 A;  1MY1 A;  1B40 A;  5F7V A;  4ZE8 A;  2OZZ A;  1B51 A;  4ELR A;  3TKD A;  4BLA A;  4LON B;  3RTF B;  3JZJ A;  3TAJ A;  1FSA A;  1P1O A;  3RPL A;  1NV7 A;  1NNF A;  1TFD A;  1Y4T A;  5AA3 A;  4R9G A;  4GX3 A;  1NL5 A;  3DP6 A;  4U22 A;  5FTH A;  3IJX B;  1VDW A;  2QJE A;  2UVG A;  4MJO A;  1KZ8 A;  2ONR A;  4PE3 A;  4JVD A;  2O1M A;  4QFL A;  4R6H A;  2HQ0 A;  5EQ8 A;  4YKI A;  1LAG E;  4GOT A;  3V89 B;  1LBV A;  2ZZV A;  1B4Z A;  2P3V A;  1B46 A;  3RT8 A;  5EQ9 A;  4R2F A;  1MXX A;  3FJM A;  2F35 A;  4ZDM A;  2AL5 A;  5I2N B;  3OD7 A;  5HBC A;  5FBP A;  1MQJ A;  4LZ7 A;  5H8H B;  1SI1 A;  2RC7 A;  4QBA A;  4HXV A;  1IXG A;  2F34 A;  2O1L A;  1CE2 A;  2D5W A;  2CZL A;  1EYJ A;  4PAI A;  3PUZ E;  4YAH X;  1ATG A;  1MY2 A;  3LBS A;  2R71 A;  1MXY A;  4OVR A;  4RK9 A;  1XHY A;  3MUQ A;  4PC9 A;  4GWY A;  5CI5 A;  1GVC A;  3AXF A;  4NF4 A;  3B6T A;  2Y7P A;  3UK4 A;  3K1P A;  4QFK A;  3DP4 A;  2OWS A;  3T9V A;  2H99 A;  2DSF A;  4KCD A;  4EQ9 A;  2XWK A;  1DMB A;  4OEN A;  3LR1 A;  2CZK A;  1MXV A;  1QKA A;  4XKN A;  1GR2 A;  2REG A;  2QMW A;  2VT5 A;  1B5I A;  3QUJ A;  3IL1 B;  1EZO A;  3LSL A;  4NF8 B;  1T0K A;  3FV1 A;  4XFE A;  4F1U A;  2PFZ A;  2OWT A;  4GWU A;  2ANJ A;  3TTL A;  1JVY A;  3MVX A;  1FJ9 A;  1Z7N E;  1A8E A;  4NWD A;  3SDF A;  2QS2 A;  1JQF A;  4IO4 A;  3H3G A;  5AA4 B;  2XD2 A;  2Z23 A;  4AS5 A;  3D1R A;  1M5D A;  3SET A;  4H6D A;  1VFE A;  4TQU Q;  2I3V A;  4GFR A;  2WYP A;  4GXA A;  4HE2 A;  2DWA A;  2VD3 A;  1SW1 A;  2V3U A;  3BFT A;  4QXD A;  1PBQ A;  3HST A;  1YTV A;  1IMC A;  1D9Q A;  4OFL A;  1B0L A;  1Z7M E;  4NN3 A;  4BDL A;  3KJ7 A;  3N5L A;  2RCA A;  1FBE A;  1MDQ A;  4IY6 A;  3ZS6 A;  2GQ1 A;  1QJM A;  5BUU A;  4I8C A;  1G0H A;  2VD2 A;  5L9M A;  3H6V A;  4P1E A;  2DWH A;  3A3U A;  4R75 A;  3CG1 A;  2GFE A;  4OAN A;  4P0G A;  3CR9 A;  1LLS A;  1D9Y A;  3IO6 A;  3Q25 A;  2Y5L A;  1NV6 A;  3LUZ A;  3MYU A;  3DRG A;  4P1L A;  1J1N A;  2XXH A;  4WXJ A;  5ET8 A;  2XWI A;  3LUY A;  2XXU A;  1SVX B;  5T3J A;  2ZZW A;  2DXR A;  1GTK A;  1FTO A;  4DIG A;  4LN5 A;  1RDY A;  3OO7 A;  5LOM A;  1LAH E;  3H03 A;  3PPO A;  1D3K A;  3K1M A;  3QK6 A;  1LBC A;  3EHS A;  2F8D A;  2PFY A;  3ONM A;  1JP4 A;  1JW5 A;  3HV1 A;  1B5H A;  1AMF A;  2FHY A;  3OO6 A;  1SYI A;  5ICQ A;  2XHD A;  3H6U A;  5L9O A;  1XI6 A;  5H8S A;  5JEI A;  3C34 A;  1N04 A;  1KA0 A;  3C9H A;  2DVZ A;  2E0S A;  3UN6 A;  1ELJ A;  3OMB A;  1P99 A;  4Q8R A;  3IB2 A;  2Q2A A;  4LQ5 A;  3U1O A;  1FPD A;  4LZ5 A;  1FBF A;  4IB2 A;  2WEF A;  4HTG A;  4PF8 A;  1D4N A;  2QS1 A;  4U1O A;  4BDR A;  1LBW A;  3K4U A;  2QS3 A;  3MPK A;  4YKP A;  5EHS A;  4L17 A;  1MM6 A;  4LUB A;  1P1N A;  3SER A;  3MBP A;  3PD8 A;  4IGR A;  5ICT A;  2F7B A;  5DW8 A;  2ZYO A;  4GVO A;  2AL4 A;  5I59 B;  5JTY A;  2XX8 A;  1Y1M A;  3FXB A;  1NNT A;  4RPO A;  1R1N A;  3SKP A;  5ET5 A;  4WKM A;  1URG A;  1B0H A;  3CIJ A;  4GWX A;  4QSE A;  1EYI A;  4FEC A;  3ILT B;  3UA8 A;  1MY0 A;  2ZNS A;  1AIV A;  4ONY A;  4IY5 A;  4XF5 A;  1DTZ A;  2QRY A;  2VPO A;  4KYS A;  1DTG A;  1LAX A;  3FBP A;  1EZ9 A;  1RDX A;  1MY4 A;  2HHM A;  3W9V A;  3O97 A;  1NNP A;  3Q28 A;  2B65 A;  4P8B A;  2ZNU A;  4NMY A;  3HHF A;  3E9X A;  1MH3 A;  2WOK A;  3SEY A;  3CSG A;  4YKK A;  4H1X A;  1I6B A;  3PMW A;  4GF8 A;  3IB0 A;  4QRZ A;  5DVJ A;  3T9U A;  3TQL A;  2PMS A;  1MXZ A;  1ZTY A;  3FAT A;  3C36 A;  2REJ A;  3EQ1 A;  4IO2 A;  1SW2 A;  1H45 A;  1A7L A;  4H5G A;  4TOZ A;  2O68 A;  1ANF A;  5IKB A;  1XVX A;  1PBP A;  1DCU A;  1KWH A;  1QUI A;  4F31 B;  2HEU A;  4K3F A;  1FTL A;  3HO7 A;  1Y3P A;  1S9T A;  3FVK A;  5B70 A;  5L8D A;  1FBC A;  3K6X A;  2WKY A;  4Z0I A;  4KPT A;  1N76 A;  4OYV A;  3A09 A;  4UAC A;  4ND9 A;  4I62 A;  3USD A;  1D9V A;  1IIW A;  3M3L A;  4NE4 A;  3OEN A;  4EF1 A;  3K6U A;  4N8G A;  4PGN A;  4QSC A;  2VOZ A;  2UYF A;  3FGS A;  4I3Y A;  1FQB A;  4G8N A;  1DBZ A;  1FBH A;  2QMX A;  1IUD A;  2QVU A;  1B6H A;  4ZEC A;  2V4C A;  2F5X A;  1O7T A;  3HHG A;  3LSF B;  3W15 C;  3DRI A;  5A5X A;  3TPA A;  2ZZX A;  3OEM A;  4TLM B;  3CHG A;  2UXA A;  4H8J A;  3FXQ A;  2QFL A;  4RXL A;  4O7M A;  4C1U A;  2E1S A;  3KG2 A;  4HS7 A;  4PP0 A;  2P1S A;  2F7C A;  4H46 A;  1NH8 A;  3ZKK A;  3PV0 E;  3T93 B;  3I3V A;  3GXA A;  4PFY A;  1QUJ A;  4PTK A;  1B7U A;  2XXP A;  3IJO B;  1Y3N A;  4NF5 A;  1QUK A;  2I48 A;  4PFT A;  1M5B A;  2V84 A;  3PUV E;  2R9J A;  1DPE A;  5I5P A;  4RK2 A;  1I6Q A;  2Q9T A;  3CG3 A;  3SZP A;  4U4X A;  3S2V A;  2F97 A;  4OVQ A;  4KHZ E;  4QSD A;  1OLA A;  3U65 A;  1JVX A;  4F39 A;  3QSL A;  4THI A;  3BIH A;  3R6U A;  3G3I A;  4G68 C;  1AOV A;  4DZ1 A;  3MZ9 A;  1JW1 A;  1EYK A;  3PTY A;  5FHO A;  4G2Z A;  4FAT A;  2DE2 A;  5KDT B;  3TFL A;  2Z8E A;  4XIG Q;  1UTH B;  4H5F A;  4N6D A;  4RYA A;  4DI4 B;  3UOR A;  4N4U A;  2FNC A;  1Q1K A;  1XOC A;  4I1D A;  3UP9 A;  3MWB A;  1ZU0 A;  5IZ3 B;  1LFI A;  4OQO A;  3GZG A;  3O28 A;  2ZXT A;  1UIU A;  2DS9 A;  3DRH A;  3R26 A;  4N6K A;  3RLF E;  3G3F A;  4RA1 A;  1MQD A;  3TTK A;  5ITP A;  4N07 A;  3E13 X;  1B58 A;  4P47 A;  3WAE A;  1FCK A;  2ZMB A;  2I49 A;  2WYK A;  4DCX A;  2AYS A;  2PT2 A;  3LV0 A;  2WBB A;  2XX9 A;  3IFA A;  3B8B A;  2OK2 A;  3HN0 A;  1B3H A;  4R73 A;  2F3B A;  4OEU A;  4XKQ A;  1N7X A;  5IAI A;  3FXU A;  4OA4 A;  3W9W A;  2V93 A;  2XXT A;  3E4R A;  3MPL A;  1EH3 A;  2WBD A;  1IMF A;  3KN3 A;  4NWC A;  2Q89 A;  2G93 A;  4DXC A;  1N0T A;  4GWO A;  1VSO A;  3T1B A;  1LST A;  1N3W A;  3THI A;  4PFI A;  1NUW A;  1LFH A;  1R9L A;  2NVU B;  2Y5K A;  4M4G A;  4MX6 A;  2GH9 A;  1BIY A;  1IIT A;  4N8Y A;  4H67 A;  4X1B A;  2NWJ A;  5I2N A;  1MXU A;  1N7W A;  2CZH A;  4F18 A;  4G77 A;  4IO7 A;  1LCF A;  1US5 A;  2Z22 A;  1MXW A;  3MZ1 A;  4OWD A;  3CFZ A;  3T0J A;  2D3I A;  4E0X A;  5ET7 A;  3IX1 A;  3KEI A;  2FIX A;  2VPN A;  1UTH A;  1FPI A;  3EN3 A;  4ISU A;  4F3P A;  2P3N A;  1NUY A;  2DXY A;  3MJN A;  4LP2 B;  3CSB A;  4DXB A;  3K0V A;  4G8M A;  4R2B A;  1DK4 A;  3CRB A;  3G3H A;  3VLU A;  3C32 A;  1H3D A;  1LBB A;  3O6I A;  1HSL A;  3D4C A;  3RUM A;  1MM7 A;  3VVF A;  3S9L C;  3B6Q A;  4P3L A;  4XEQ A;  2ESN A;  4PE5 B;  1JW4 A;  3TUS A;  4OEV A;  3TYH A;  2AIX A;  1EU8 A;  4OMB A;  2QSX A;  4P11 A;  2H98 A;  3T66 A;  4LZ8 A;  4EXL A;  1URS A;  2R8T A;  3N6T A;  5I59 A;  5I2K A;  3O66 A;  4PF6 A;  5CMK A;  2PCR A;  1URD A;  1QUL A;  4BDN A;  4F2O A;  4G8H A;  4GL0 A;  3KGC A;  2GHB A;  2RC8 A;  4C1T A;  2VGQ A;  2RC9 A;  1QKB A;  1NV4 A;  4NF4 B;  5CMB A;  1SYH A;  5KZT A;  2PYY A;  4NED A;  3G3G A;  3VDF A;  1MDP 1;  2Y7R A;  4C0R A;  2VP1 A;  1LB8 A;  1TFA A;  5EQ7 A;  5CBS A;  1LBY A;  1QVS A;  2I4C A;  2GRV A;  4PCD A;  1FBP A;  4LVQ A;  1HSE A;  3IOV A;  5L9S A;  1K9Z A;  1M5E A;  4GWS A;  1IXI A;  4OHN A;  3BIG A;  2HAV A;  5DT6 A;  3K6V A;  5H8H A;  3KSJ A;  3LSW A;  4N91 A;  3FVN A;  3OXN A;  4YB6 A;  1UIV A;  1I6A A;  3GLB A;  5TPA A;  2X7P A;  2XA5 A;  3B6W A;  2ZYK A;  4OVJ A;  3ODB A;  4R74 A;  4FJP A;  3SEX A;  4O8M A;  4NX1 A;  3TOD A;  5I58 A;  3G7W A;  4GRK A;  4KR5 A;  3O6G A;  1LBZ A;  4MCO A;  3GYY A;  1WOD A;  5I57 B;  1R6Z A;  2A5T B;  4RJZ A;  4YMA A;  1IME A;  2Y84 A;  3DP8 A;  4QF9 A;  2FYI A;  1B9J A;  1A55 A;  1ZIU A;  4NF6 A;  4MH5 A;  4NF6 B;  1JEU A;  1H43 A;  5EQA A;  5CMC A;  1CNQ A;  3RN8 A;  1BK4 A;  3FJG A;  1MH4 A;  1GGG A;  3PUX E;  5HPQ A;  1FBG A;  1O63 A;  2XXK A;  1SBP A;  5AA2 A;  4JVC A;  4O3A A;  3PMX A;  1GV8 A;  3KFM A;  3O9P A;  4HCW A;  2F6G A;  1FW0 A;  1MG1 A;  3FD3 A;  1II5 A;  3E79 A;  2PT1 A;  4JVI A;  2HXR A;  1RYO A;  4Q30 B;  4NF0 A;  5H8Q B;  1UTB B;  3TCH A;  1US4 A;  4GD5 A;  1VE4 A;  3JYR A;  2IA4 A;  1YAE A;  2CZI A;  1Y20 A;  5EYH A;  3MVZ A;  1SD3 A;  4MMP A;  2IEE A;  2B4L A;  2NUV A;  1ZLQ A;  1LGB C;  2V25 A;  3T9H B;  3QAX A;  4NTL A;  3H4Z A;  2FVZ A;  3TTM A;  2H25 A;  3VVE A;  4BDM A;  1A99 A;  2CEY A;  3OEK A;  5F1Q A;  4QFO A;  4NAP A;  3SES A;  1PB7 A;  4IO6 A;  4F3G A;  3D4G A;  4EF2 A;  1FPK A;  3FJ7 A;  1FPF A;  3VLW A;  4RPN A;  3DRK A;  4PAK A;  4UA8 A;  2B3B A;  3V5A A;  4XTC Q;  1SW5 A;  4G4P A;  5IZZ A;  4G68 B;  4N17 A;  3O6P A;  4ELP A;  1NFT A;  3KBZ A;  1AWB A;  3RYB A;  3QMF A;  3FXR A;  5LTC A;  2DDK A;  3CVG A;  4DXU A;  1OVB A;  4OER A;  1FTA A;  4FBP A;  2UVI A;  2I58 A;  1LCT A;  4G61 A;  3PUW E;  4X9T A;  4ELQ A;  1A54 A;  3FAS A;  4ZEF A;  4H65 A;  1UQW A;  3OSR A;  3EHU A;  1DPP A;  3RQT A;  1XC1 A;  4I40 A;  2I6E A;  4KFQ A; 
#chains in the Genus database with same CATH homology
 4R6Y A;  2XXX A;  1B4H A;  2XXQ A;  3R6U A;  3G3I A;  4G68 C;  3JV9 A;  4MF3 A;  1AOV A;  5DVF A;  4DZ1 A;  1JEV A;  1DMB A;  3MZ9 A;  1JW1 A;  1NKX A;  4OEN A;  5I2K B;  4Q0C A;  3QXM A;  5AA1 A;  3LR1 A;  4OES A;  5FHO A;  4ESX A;  4G2Z A;  2F78 A;  2Y7W A;  1BKA A;  4FAT A;  3EF7 A;  3QIM A;  3E3K A;  3KZG A;  4ESW A;  3RLF E;  2DE2 A;  1MXV A;  1XT8 A;  1QKA A;  2D21 A;  5KDT B;  3TFL A;  2Z8E A;  3RGY A;  2HZK A;  3N26 A;  4XIG Q;  1N84 A;  1AL3 A;  3C35 A;  1UTH B;  3IO4 A;  4H5F A;  5H8F A;  1MY3 A;  4XKN A;  1GR2 A;  4I9D A;  2REG A;  2QMW A;  1B5I A;  3QUJ A;  3RNN A;  5FHM A;  4RYA A;  3IL1 B;  3UOR A;  2YJP A;  3LSL A;  1EZO A;  4NF8 B;  5ELV A;  3FV1 A;  2DQV A;  2FNC A;  1Q1K A;  4F1U A;  1T0K A;  2OWT A;  2ANJ A;  4XKR A;  3ECR A;  1SDX A;  5TPA B;  3TTL A;  4DE8 A;  3G3J A;  1S7Y A;  1XOC A;  1JVY A;  5JTY B;  5B7D A;  4I1D A;  3MVX A;  3UP9 A;  5TP9 B;  4EQB A;  3MWB A;  3PPQ A;  3S9N C;  4Z7E A;  4DCY A;  1ZU0 A;  1Z7N E;  4YU0 A;  1LFI A;  3K00 A;  3GZG A;  3EPE A;  3M3F A;  4OQO A;  4EQ7 A;  3O28 A;  3DRJ A;  3IOT A;  1A8E A;  4QFN A;  2RIN A;  4U21 A;  1OVT A;  2ZXT A;  1PEB A;  4NWD A;  3Q29 A;  2Q8J A;  3SDF A;  2WOL A;  2QS2 A;  2F6P A;  1JQF A;  4IO4 A;  1UIU A;  5AA2 A;  3H3G A;  3PPP A;  5AA4 B;  2XD2 A;  2Z23 A;  2DS9 A;  3DRH A;  1M5D A;  1I69 A;  3R26 A;  3G3F A;  4H6D A;  1WDN A;  1VFE A;  2H5Y A;  2PVU A;  4RA1 A;  3PD9 A;  5DEX A;  5AA2 B;  1POT A;  1MQD A;  1FTK A;  4EDP A;  3TTK A;  4U2R A;  5ITP A;  4TQU Q;  1PC3 A;  2I3V A;  5CBR A;  4N07 A;  4GFR A;  3E13 X;  4F1Y A;  4GXA A;  1B58 A;  2F36 A;  2DWA A;  4FOR A;  5H8F B;  4ZEB A;  3IOR A;  2VD3 A;  1FCK A;  4ZZE A;  1SW1 A;  2V3U A;  2ZMB A;  3BFT A;  2I49 A;  3MQ9 A;  3RTW B;  5A5X B;  1PBQ A;  4DCX A;  4RY1 A;  1FQE A;  2AYS A;  2I0C A;  2PT2 A;  3HST A;  3N94 A;  1YTV A;  1ZJL A;  3TEP A;  2XX9 A;  1IXH A;  4OFL A;  1B0L A;  1Z7M E;  1OLC A;  2OK2 A;  2DWI A;  1XVY A;  1B3H A;  3HN0 A;  4FEB A;  4YB5 A;  5I84 A;  4R73 A;  4OEU A;  4XKQ A;  3PMV A;  4BDL A;  1N7X A;  4GQO A;  3C33 A;  3FXU A;  5IAI A;  3KJ7 A;  2O7I A;  4EQ9 A;  3W9W A;  3N5L A;  2RCA A;  1MDQ A;  2B4M A;  2V93 A;  4IY6 A;  4GL8 A;  3PUY E;  2ONK E;  4ZZA A;  5BWJ A;  3FIR A;  4WED A;  2XXT A;  4YMB A;  2RKM A;  3ZS6 A;  1QJM A;  3C31 A;  3E4R A;  3CFX A;  3TEL A;  5I56 A;  5JK4 A;  1DSN A;  3MPL A;  4M1V A;  1EH3 A;  5I58 B;  5BUU A;  3BFU A;  4I8C A;  3K1N A;  4JSD A;  3KN3 A;  4NWC A;  2Q89 A;  2G93 A;  1YCJ A;  2VD2 A;  4OXV A;  1MS7 A;  5L9M A;  5ISU A;  4DXC A;  3H6V A;  3MC2 A;  1RYX A;  2DWH A;  1N0T A;  4GWO A;  1VSO A;  1FQA A;  3A3U A;  4R75 A;  1MPD A;  5DTB A;  2DP8 A;  3CG1 A;  4MFI A;  1LST A;  2A5T A;  2GFE A;  2DE3 A;  4QHQ A;  1N3W A;  4YB7 A;  5CM6 A;  1Q35 A;  4P0G A;  2ZNT A;  4KFQ A;  3CR9 A;  5LOM A;  3THI A;  3VV5 A;  1LLS A;  3MAM A;  1D9Y A;  3TMG A;  3IO6 A;  3Q25 A;  1LFH A;  1R9L A;  2NVU B;  3DRG A;  4FAJ A;  1J1N A;  1B5J A;  2XXH A;  4M4G A;  1IXC A;  4WXJ A;  5FHN A;  1USY H;  3L6G A;  3LUY A;  1HSJ A;  3PPR A;  2XXU A;  2GH9 A;  2NXO A;  4ZEK A;  1BIY A;  3I6V A;  3Q26 A;  1SVX B;  3TDJ A;  1IIT A;  2DXR A;  2W7Y A;  4H67 A;  4OFJ A;  4AQ4 A;  1GTK A;  4ZE9 A;  1FTO A;  4DIG A;  2O84 X;  3QYT A;  2BJJ X;  3MVW A;  2UYE A;  4X1B A;  2NWJ A;  3OO7 A;  1MPC A;  4OTE A;  5I2N A;  2V3Q A;  3WAF A;  4H0W A;  1MXU A;  2HZL A;  2DWJ A;  1LAH E;  1N7W A;  3H03 A;  3PPO A;  5TP9 A;  3ZKL A;  3MP8 A;  3K02 A;  1D3K A;  3BBR A;  4JDF A;  4F18 A;  5AA2 D;  3K1M A;  1VR5 A;  5DYH A;  4G77 A;  4IO7 A;  3QK6 A;  1LCF A;  1US5 A;  2Z22 A;  3IK6 B;  1MXW A;  3MZ1 A;  4OWD A;  5EYF A;  3VXB A;  4DLD A;  1FTJ A;  3CFZ A;  4KYE A;  2I4B A;  2D3I A;  1LBC A;  2XX7 A;  3EHS A;  2F8D A;  4HCY A;  1WVJ A;  4E0X A;  4F3B A;  5FTI A;  3ONM A;  3M8U A;  1JW5 A;  3IX1 A;  3KEI A;  5DEX B;  1UTH A;  3HV1 A;  2O51 A;  3K6W A;  1B5H A;  3EN3 A;  4MLV A;  2ZYM A;  5KDT A;  2UVH A;  1AMF A;  1UTB A;  3A3C A;  3OO6 A;  1SYI A;  5ICQ A;  2XHD A;  3HCQ A;  4MLQ A;  1N3X A;  3H6U A;  4ELO A;  5L9O A;  2WOP A;  2DVC A;  4ISU A;  4YKI A;  3MZB A;  3IOW A;  5DVI A;  4PFW A;  1JET A;  5H8S A;  4F3P A;  3FVG A;  4HW8 A;  5I56 B;  4QFP A;  5JEI A;  3T22 A;  1IEJ A;  3C34 A;  3H6W A;  4JWO A;  1N04 A;  1LAF E;  2O69 A;  3CI8 A;  2DXY A;  3MJN A;  2X26 A;  3C9H A;  2PBW A;  3KBR A;  4LP2 B;  3VXC A;  3CSB A;  4LA9 A;  3TQW A;  3TTR A;  3K0V A;  2DVZ A;  4PQJ A;  3MVY A;  4DXB A;  2E0S A;  2HXW A;  4G8M A;  4JSO A;  3UN6 A;  3V83 A;  1ELJ A;  3OMB A;  2V3T A;  3OO9 A;  1P99 A;  4IGT A;  4R2B A;  4Q8R A;  1B3L A;  1MPB A;  3IB2 A;  2Q2A A;  3CRB A;  3G3H A;  3PPN A;  1P1Q A;  4LQ5 A;  3T96 B;  3U1O A;  3VLU A;  3C32 A;  4NF5 B;  4LZ5 A;  3UIF A;  1H3D A;  1LBB A;  4U4S A;  3O6I A;  1HSL A;  4IB2 A;  5KCJ B;  5KCJ A;  3D4C A;  3F11 A;  2THI A;  3BKI B;  1LB9 A;  3KN7 A;  4HTG A;  2Z8F A;  3TCG A;  4KI0 E;  3RUM A;  1MM7 A;  1ZBM A;  2QL3 A;  3VE1 B;  3VVF A;  3B6Q A;  3S9L C;  2DYX A;  1D4N A;  2QS1 A;  4U1O A;  3GBA A;  5H8N A;  4BDR A;  2VHA A;  3K4U A;  2ESN A;  2QS3 A;  4ELP A;  4PE5 B;  1JW4 A;  3TUS A;  4KQP A;  3MPK A;  4OEV A;  3TCF A;  4YKP A;  5EHS A;  1OQG A;  3U72 A;  3TYH A;  4L17 A;  1MM6 A;  2AIX A;  1EU8 A;  2YPN A;  3OEL A;  4LUB A;  4OMB A;  1P1N A;  2QSX A;  3SER A;  4P11 A;  3H6T A;  3TZA A;  2PX1 A;  3MBP A;  1XS5 A;  3PD8 A;  4IGR A;  5ICT A;  2F7B A;  2H98 A;  1B3F A;  3RY3 A;  3T66 A;  1NNK A;  2ALU A;  2ZYO A;  1FTM A;  2F7A A;  4GVO A;  4LZ8 A;  3H06 B;  4OZ9 A;  4EXL A;  2AL4 A;  1IQ7 A;  2UVJ A;  1URS A;  1A8F A;  3FUZ A;  4ZS9 A;  3N6T A;  3SET A;  3KOT A;  5I2K A;  5I59 B;  5I59 A;  5JTY A;  1FQF A;  1TXF A;  4GLI A;  1MQG A;  2XX8 A;  3DRF A;  3O66 A;  5CRY A;  1Y1M A;  1B7H A;  1FQD A;  4KCC A;  4WEP A;  5CC2 A;  4N6P A;  1ZMG A;  1NNT A;  1EZP A;  1JNF A;  4RPO A;  5CMK A;  1R1N A;  3SKP A;  1URD A;  1QUL A;  4BDN A;  5K2X A;  4F2O A;  4OFO A;  3L6H A;  4G8H A;  4GL0 A;  3KGC A;  4WKM A;  3WAE A;  2GHB A;  3SEW A;  2RC8 A;  3PGF A;  1IZ1 A;  2VGQ A;  1URG A;  2RC9 A;  1B0H A;  3CIJ A;  3H7M A;  4FED A;  4C1T A;  3K2D A;  4E0W A;  2O7U A;  1QKB A;  2XXV A;  3C4M A;  2LAO A;  4QSE A;  3VFJ A;  4NF4 B;  1B1X A;  3GBB A;  4RNS A;  5CMB A;  1SYH A;  5KZT A;  4POW A;  2RCB A;  4FEC A;  3ILT B;  2PYY A;  4NED A;  3UA8 A;  4EUO A;  1MY0 A;  3G3G A;  2ZNS A;  3RT6 B;  1F9B A;  1B3E A;  3VDF A;  1MDP 1;  2Y7R A;  3S9E A;  1AIV A;  4ONY A;  1Y1Z A;  3B7D A;  3M3K A;  4IY5 A;  4AB6 A;  3K01 A;  4C0R A;  2R6G E;  1LB8 A;  1TFA A;  2VP1 A;  2XXY A;  3VLV A;  5CBS A;  3TTN A;  3V8X B;  1DTZ A;  1QVS A;  1QW0 A;  2I4C A;  2QS4 A;  2GRV A;  2QRY A;  2X7Q A;  4F19 A;  4F1V A;  3N6U A;  4KYS A;  4YZZ A;  3KJT A;  1DTG A;  1LAX A;  4LVQ A;  4PET A;  5AA4 A;  1EZ9 A;  3PAM A;  1HSE A;  3IOV A;  5L9S A;  1R9Q A;  2ONS A;  1MY4 A;  1YPN A;  3KOS A;  4FIM A;  3UGW A;  1M5E A;  3IB1 A;  3W9V A;  2B3F A;  1IXI A;  3OO8 A;  3O97 A;  2YLN A;  4OHN A;  1NNP A;  1SQY A;  2HAV A;  4PFU A;  3K6V A;  5DT6 A;  5H8H A;  3Q28 A;  4N13 A;  1RKM A;  2B65 A;  3SEV A;  3KSJ A;  2ZNU A;  3LSW A;  4NMY A;  4OET A;  1MQI A;  3FVN A;  3HHF A;  4TLL B;  3OXN A;  4P0I A;  4YB6 A;  1L5T A;  1UIV A;  1I6A A;  3E9X A;  4YIC A;  1MH3 A;  3DM0 A;  3GLB A;  5TPA A;  2WOK A;  3SEY A;  2FA7 A;  1AH5 A;  3CSG A;  4JXI A;  2X7P A;  5TU0 A;  3DLN A;  4YKK A;  4BDO A;  4F2Q A;  4H1X A;  1I6B A;  2H9B A;  1Y9U A;  4DDD A;  1TWY A;  3B6W A;  2QPQ A;  2ZYK A;  3DEL B;  3EHT A;  1B05 A;  2OBG A;  3PMW A;  3HPI A;  3O29 A;  4GF8 A;  3IB0 A;  4OVJ A;  3ODB A;  3VVD A;  4QRZ A;  3QUF A;  5DVJ A;  3MP1 A;  3OSQ A;  3T9U A;  5F7V A;  4R74 A;  4FJP A;  3SEX A;  3OOA A;  1ZKB A;  3TQL A;  4Q5T A;  1LFG A;  3IAZ A;  3R7X A;  2PMS A;  5J1D A;  1MXZ A;  1ZTY A;  1A40 A;  3FAT A;  3TOD A;  1B1H A;  1SW4 A;  2REJ A;  3C36 A;  4JWX A;  4R6K A;  3G7W A;  3RPW A;  5I58 A;  3EQ1 A;  1BTJ A;  2HCA A;  4GRK A;  1FQC A;  3O6G A;  4IO2 A;  4KR5 A;  1SW2 A;  1WOD A;  4JWY A;  1H45 A;  1A7L A;  5I57 B;  4H5G A;  1R6Z A;  4TOZ A;  1OMP A;  2A5T B;  2OCU A;  4RJZ A;  4YMA A;  2O68 A;  3LSX A;  1ANF A;  1DOT A;  1B2H A;  5CMM A;  2Y84 A;  1PDA A;  3DP8 A;  4QF9 A;  2FYI A;  1M5F A;  1OQH A;  2H4I A;  2KLF A;  3IOU A;  4ECF A;  1B9J A;  1A55 A;  1NMU A;  3U92 A;  1ZIU A;  2Y7I A;  3U94 A;  3S4U A;  3SEU A;  5IKB A;  4O3B A;  4NF6 A;  4MH5 A;  2P2A A;  4NF6 B;  1JEU A;  1PBP A;  1XVX A;  1H43 A;  2A5S A;  1MRP A;  1KWH A;  1QUI A;  3O6H A;  5CMC A;  4F31 B;  4ZED A;  5H8N B;  2HEU A;  1BP5 A;  4JBZ A;  4H8I A;  1FTL A;  4K3F A;  3RN8 A;  4BDQ A;  3HO7 A;  1Y3P A;  1S9T A;  3FVK A;  3MP6 A;  2XD3 A;  4F3S A;  4IO5 A;  5B70 A;  4IO3 A;  3IR1 A;  2XXW A;  3FJG A;  4X48 A;  5L8D A;  5I57 A;  3FTO A;  1MH4 A;  4GXS B;  5H8Q A;  1GGG A;  3LVU A;  2G29 A;  3CFL A;  3K6X A;  2WKY A;  3O2A A;  1P1W A;  3PUX E;  4Z0I A;  3ILU B;  4KPT A;  1N76 A;  2HFB A;  5AE4 A;  5HPQ A;  4LAT A;  4OYV A;  1CB6 A;  1VFD A;  1POY 1;  5AA3 A;  1B7Z A;  3RYA A;  1O63 A;  4ZEI A;  3A09 A;  4UAC A;  1SBP A;  1B32 A;  2XXI A;  4O3A A;  2Q2C A;  3PMX A;  4ND9 A;  3KFM A;  5EHM A;  5K2Y A;  1GV8 A;  4I62 A;  3I5O A;  4KD5 A;  3O9P A;  4HCW A;  4LQ2 A;  3USD A;  4G68 A;  2F6G A;  1D9V A;  2Z8D A;  1P1U A;  4NF8 A;  1FW0 A;  1MY1 A;  1B40 A;  1IIW A;  1PB8 A;  1MG1 A;  4ZE8 A;  5HM4 B;  2OZZ A;  3KSX A;  1B51 A;  3M3L A;  3FD3 A;  3MW0 A;  3OEN A;  4NE4 A;  4ELR A;  4EXK A;  1II5 A;  2I3W A;  3TKD A;  4BLA A;  4LON B;  3RTF B;  2PT1 A;  2Y7K A;  3JZJ A;  3TAJ A;  3K6U A;  1P1O A;  4EF1 A;  1NNF A;  1Y3Q A;  4U23 A;  1RYO A;  1TFD A;  1Y4T A;  2P0S A;  4Q30 B;  4O3C A;  4QSC A;  1NL5 A;  4R9G A;  2VOZ A;  1UTB B;  3DP6 A;  4U22 A;  5H8Q B;  3TCH A;  1US4 A;  2UYF A;  3IJX B;  5FTH A;  1USY E;  4GD5 A;  1H44 A;  2QJE A;  1VE4 A;  2UVG A;  3FGS A;  3JYR A;  2ONR A;  3FVO A;  4AB5 A;  1FQB A;  4G8N A;  2IA4 A;  1BLF A;  2QMX A;  1IUD A;  2XXR A;  1YAE A;  4F29 A;  1Y20 A;  1B6H A;  3MVZ A;  1NH7 A;  1SD3 A;  4ZEC A;  1TT1 A;  3Q27 A;  1MQH A;  2IEE A;  2O1M A;  2B4L A;  4QFL A;  2OLB A;  2NUV A;  4R6H A;  2HQ0 A;  1ZLQ A;  1LGB C;  2O6A A;  2V25 A;  3T9H B;  3QAX A;  2F5X A;  2HAU A;  1O7T A;  4U1Z A;  3HHG A;  4NTL A;  3H4Z A;  3LSF B;  1LAG E;  1B52 A;  4GOT A;  3V89 B;  3W15 C;  3DRI A;  3P7I A;  5A5X A;  3TTM A;  3TPA A;  2H25 A;  3OEM A;  4YKJ A;  3VVE A;  4BDM A;  1A99 A;  4TLM B;  1B4Z A;  3CHG A;  4FE8 A;  3OEK A;  4F22 A;  2GHA A;  5F1Q A;  1O64 A;  2UXA A;  4H8J A;  3FXQ A;  4QFO A;  1B46 A;  3RT8 A;  4RXL A;  3SES A;  4C1U A;  2ABH A;  2M8C A;  3LC8 A;  4R9F A;  3G3K A;  1PB7 A;  2E1S A;  4R2F A;  1MXX A;  3FJM A;  4IO6 A;  3KG2 A;  4HS7 A;  1SI0 A;  2F35 A;  4PP0 A;  4ZDM A;  2P1S A;  2I0B A;  3KN8 A;  3U8Q A;  2AL5 A;  2F7C A;  4F3G A;  5I2N B;  3D4G A;  4EF2 A;  3OD7 A;  5HBC A;  3FJ7 A;  5ITO A;  1MQJ A;  3FZV A;  4POX A;  4X1D A;  1NH8 A;  3ZKK A;  2RF1 A;  3PV0 E;  3T93 B;  4LZ7 A;  3I3V A;  3VLW A;  4RPN A;  3DRK A;  5H8H B;  3GXA A;  4PFY A;  1OIB A;  1SI1 A;  2RC7 A;  4UA8 A;  2B3B A;  1QUJ A;  3V5A A;  4R72 A;  1SW5 A;  1B7U A;  4G4P A;  4XTC Q;  4G68 B;  1IXG A;  3O6P A;  2DE4 A;  1NFT A;  1CE2 A;  2D5W A;  1Y4C A;  2DOJ A;  2F34 A;  2CZL A;  2O1L A;  3RYB A;  2XXP A;  4GIZ A;  3FXR A;  2CMO A;  1Y3N A;  3IJO B;  4NF5 A;  3PUZ E;  1QUK A;  3CVG A;  2I48 A;  4PFT A;  4DXU A;  1M5B A;  2V84 A;  4YAH X;  1OVB A;  4OER A;  1ATG A;  1MY2 A;  3FV2 A;  3LBS A;  3T9X B;  2R71 A;  3PUV E;  1MXY A;  2UVI A;  4XKP A;  2NOO A;  2I58 A;  2R9J A;  3ZSF A;  1DPE A;  1LCT A;  4RK9 A;  1B3G A;  3PUW E;  1XHY A;  3MUQ A;  4RK2 A;  4X9T A;  1A54 A;  1I6Q A;  1M5C A;  2Q9T A;  1H76 A;  3FAS A;  4ELQ A;  3CG3 A;  5CI5 A;  1GVC A;  3AXF A;  2OJT A;  2ZYN A;  4NF4 A;  3B6T A;  4U4X A;  3S2V A;  2F97 A;  4ZEF A;  2Y7P A;  4JB7 A;  1PB9 A;  3PU5 A;  3UK4 A;  4H65 A;  1UQW A;  4KYD A;  3K1P A;  3OSR A;  3EHU A;  2Q88 A;  4KHZ E;  1DPP A;  3RQT A;  4QFK A;  1XC1 A;  3U93 A;  4QSD A;  1OLA A;  3DP4 A;  1JVX A;  4XXU A;  2OWS A;  2I6E A;  3QSL A;  4THI A;  3T9V A;  4F39 A;  4MBP A;  5M2V A;  1S50 A;  2H99 A;  3S9M C;  2DSF A;  4KCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...