1B5JA

Oligo-peptide binding protein (oppa) complexed with kqk
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 185
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b5jA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b5jA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b5jA02
3VLUA 3PPRA 2Q2AA 5I56B 4IB2A 3G3FA 1Y3NA 2RCBA 3RTWB 2F34A 1HSLA 1N3WA 4LQ2A 1B32A 4POXA 1M5BA 3CRBA 2Z23A 5DEXA 4YKKA 3MVZA 4OFOA 4LONB 2QPQA 3MVXA 4NWCA 4Z0IA 3LBSA 2AL5A 4U2RA 2HCAA 1B40A 3ECRA 1LAHE 1PBPA 4G68B 2DXYA 2X7PA 5HBCA 4ECFA 2F7AA 1B5IA 2UVIA 3E4RA 4R6KA 2G29A 3PUWE 2NWJA 1Q35A 3FVNA 4U1ZA 4BDLA 4R9FA 5B7DA 2REGA 4QSDA 2XXIA 1HSJA 5AA2D 4OEUA 2QRYA 3PUZE 4BLAA 1LAXA 3GLBA 3O2AA 1S7YA 1P1UA 4N6PA 3IOWA 3C33A 4E0XA 2I58A 1MQHA 4GL0A 4Q0CA 1B51A 4M4GA 4KHZE 1SD3A 3RQTA 3MC2A 4LZ7A 1PB8A 2QS2A 5I2KB 2G93A 3A3CA 3ILUB 4EQ7A 5L9MA 2ZYMA 1OQHA 1ATGA 2ZNSA 3OENA 3K6XA 2Y7PA 5FHMA 1NNFA 4XKQA 3TTNA 3U92A 4WEPA 2B65A 4F31B 4R2BA 3EHTA 1NNTA 5KCJB 1QVSA 4H1XA 1AMFA 1FW0A 1N3XA 2HQ0A 3MVWA 1N84A 1DMBA 2P2AA 2UYEA 5F1QA 1MPDA 4E0WA 2YPNA 3PUYE 3PUXE 2ZYOA 3DELB 1MRPA 3I6VA 1USYH 4HCWA 3R6UA 5AE4A 2HFBA 4JBZA 3H6UA 4F3BA 3K1MA 2GFEA 3S9MC 2I3VA 4RNSA 2F6PA 5BUUA 3MP6A 4U22A 3TTMA 1OLCA 5ICQA 3R26A 3HHGA 4BDOA 3VLVA 4GLIA 2O68A 2KLFA 1DTGA 4OQOA 4OETA 5KZTA 1O64A 2VHAA 4RPOA 1O63A 1SYHA 1EU8A 1LLSA 3R7XA 2ABHA 1IXCA 1TT1A 2OK2A 4BDNA 4Q8RA 1ZLQA 1QW0A 5I59B 2QSXA 4KPTA 3V5AA 3HV1A 3LR1A 1FQCA 1MY3A 2A5TB 5CI5A 2Q89A 1F9BA 2WKYA 4F2QA 2UXAA 1CB6A 1QUIA 2BJJX 2YJPA 3JYRA 3L6GA 3DRIA 1TFAA 3VVEA 3OSRA 1B5JA 3H6VA 4DLDA 1FTOA 3HHFA 2ALUA 3SERA 1JQFA 4NF6A 3B6WA 2I4BA 3IO6A 5I58B 1MS7A 2ESNA 3H3GA 1NH7A 4ZZAA 2I0BA 4FECA 2QMWA 4IO7A 1PEBA 2X7QA 3ZSFA 1Y3QA 3SDFA 2DVCA 3FJ7A 2XHDA 3C36A 2VD2A 4EDPA 1B1XA 2ZYNA 4P0IA 1Y3PA 3LSFB 3UORA 4N07A 1SW5A 1XT8A 2PX1A 5H8QA 2ZNTA 4X9TA 2FA7A 2XXVA 3H03A 5HPQA 3IOUA 4DZ1A 1MQIA 4HW8A 1ZMGA 4ND9A 3OO6A 3FJMA 3W9VA 3OEMA 4LZ8A 4F39A 1POY1 5JEIA 1LCFA 4GXAA 3V8XB 3FJGA 4NF5B 4ELPA 3O97A 1D4NA 1D3KA 1QJMA 3PPOA 1DSNA 2UYFA 3Q25A 4I62A 3KSJA 4P0GA 4JSDA 5TP9A 2V3QA 4OFLA 3CSGA 3Q29A 2Q88A 5AA2B 1UTHA 4NF5A 3T9XB 3K6VA 4GIZA 1Z7ME 3K1PA 5J1DA 3H7MA 3Q26A 1PDAA 2Q8JA 1I6QA 1FQEA 4QSCA 4LP2B 3ZKKA 1M5DA 1AH5A 3FTOA 1UTBA 1H45A 4C1UA 1SW4A 3KN8A 2IEEA 3L6HA 2E0SA 4UACA 1EZPA 3RPWA 2PBWA 3UK4A 4YAHX 1R6ZA 4KCCA 1JW5A 2AL4A 2FNCA 2A5SA 5H8HB 1MXWA 2R71A 2B4LA 4G4PA 4YB7A 3B7DA 3H6WA 1DPPA 1VE4A 2F35A 3QK6A 4F3PA 4NTLA 5DT6A 4RK9A 1WVJA 4MF3A 1H76A 1H43A 5HM4B 3T9UA 1OVBA 3DP4A 4XKNA 3SETA 4KYDA 1QKAA 1WDNA 3O6IA 3QUJA 4GL8A 2ZMBA 1LB8A 3SKPA 4KFQA 3MPKA 2I4CA 1GVCA 3CSBA 3TPAA 2ZXTA 4U1OA 4FEDA 1NNKA 3T9HB 4R9GA 3OO7A 1B9JA 1Y1MA 5DTBA 3KOTA 3LSLA 3T93B 1N76A 1SYIA 2Y7RA 4XXUA 4TLLB 3PV0E 2XD2A 4I1DA 3PD9A 3GBBA 4NWDA 3QXMA 3BKIB 1BTJA 1I6BA 2B3BA 3F11A 1B0HA 4BDQA 4NE4A 1R1NA 5DEXB 4F3GA 1SW1A 4KR5A 4F2OA 3CFZA 2RKMA 1M5EA 3W9WA 4MLQA 5FHNA 3DRJA 3HCQA 1IXHA 1PBQA 3CG1A 1LBBA 1O7TA 3OELA 3IO4A 2VP1A 4QF9A 4TLMB 1LBCA 2V3TA 1SI0A 1FQFA 3MP8A 3TUSA 5K2XA 4G8HA 2XXPA 2XXTA 3UGWA 2D3IA 1WODA 4IO2A 3RY3A 4M1VA 3TFLA 2H9BA 2RC9A 4FJPA 3OO8A 2F6GA 4RK2A 3UP9A 4QFNA 4EF1A 4ZEIA 3UA8A 4BDRA 5CMBA 4IO3A 4C0RA 3ZKLA 4HCYA 4GF8A 1N0TA 4Z7EA 1B7HA 1IITA 3O28A 3AXFA 3PPQA 3O6HA 3KSXA 2R9JA 4L17A 5L9OA 1POTA 2REJA 4RPNA 3HPIA 1NH8A 3H06B 3JZJA 2PVUA 3DM0A 2HZLA 3VDFA 3BFUA 2DE4A 3G3HA 3IJXB 3MP1A 3M8UA 4AQ4A 2DQVA 3B6QA 5A5XA 2V93A 5H8FA 1P1NA 5KDTA 3OSQA 2ONRA 2CMOA 2UVJA 3DRGA 5CMCA 2XD3A 2PYYA 4OVJA 4EQBA 2RC7A 3K6UA 2OCUA 3LSWA 2Y84A 1MQJA 2OWSA 3USDA 4POWA 3PAMA 3IOVA 3PU5A 4G8MA 3A3UA 3TCFA 3KG2A 4LVQA 3FVKA 1MPBA 1URDA 4JWYA 1B7UA 1B3HA 2DXRA 1JVXA 2P1SA 1JNFA 4IGRA 3PMVA 1MXVA 5ISUA 1USYE 3EHSA 3PMXA 3IB1A 3C31A 4R6YA 3TEPA 2QS3A 1B3LA 4PFYA 5H8SA 3TAJA 2I3WA 1US5A 1VFEA 2RCAA 4O3CA 1D9VA 1I69A 2Z8EA 3ODBA 4LATA 5AA3A 3OMBA 3PMWA 4YB5A 5I57A 1JETA 4H6DA 1OMPA 5I2NA 1MPCA 4H5FA 4AB6A 4NF4A 4OTEA 1IXGA 2PT1A 4R72A 3IK6B 5H8NA 1ELJA 4OXVA 2P0SA 1Y4TA 3IX1A 3T66A 5IKBA 5CM6A 2HAUA 5K2YA 1A55A 4IO4A 3M3KA 4DXCA 1MM6A 4IO5A 3FUZA 2DE2A 3FVOA 2GRVA 1LCTA 1XS5A 3DRFA 1ZKBA 4MFIA 5FHOA 4F19A 3GXAA 4GWOA 3D4CA 3M3LA 4F18A 4ZEKA 3KOSA 4FIMA 2H5YA 3RGYA 2RF1A 2O51A 4WEDA 1MXUA 1UIUA 5CRYA 1TXFA 1R9QA 3TTRA 5AA4A 4KYSA 1P1WA 3S2VA 4EXLA 1RKMA 3WAEA 2O69A 4NF6B 3CFLA 2XX7A 3GBAA 4KI0E 1URGA 2B3FA 1RYOA 4GVOA 4YB6A 4O3AA 1DTZA 1MQDA 4TOZA 3CIJA 1QUKA 3O29A 4PE5B 1B7ZA 3VE1B 1AL3A 2F78A 4DCXA 2XX8A 2DWHA 3CI8A 1NL5A 3QYTA 4U4XA 2X26A 1OLAA 3C32A 3M3FA 4H0WA 1MY2A 1J1NA 4ZEBA 3K02A 2V25A 4MH5A 3LC8A 4OYVA 3FVGA 4RA1A 1DOTA 5CMMA 4DE8A 5H8QB 2O84X 4OENA 4YMAA 3D4GA 3TQLA 4QRZA 1JW4A 1B0LA 1II5A 2XXUA 4ZZEA 2D5WA 3KFMA 1N7XA 3C34A 3MZ9A 1RYXA 1ZTYA 4WKMA 2Z22A 4U23A 3HSTA 4BDMA 2UVGA 1BP5A 2I6EA 1MY0A 3HN0A 1JVYA 2F7BA 2R6GE 3FASA 3N5LA 2NOOA 1M5CA 5EHSA 1IZ1A 4ZS9A 4LA9A 5TP9B 3UIFA 1LFIA 1LB9A 1XHYA 3HO7A 4THIA 1UTHB 4G68C 4YU0A 4PFTA 3KJ7A 4H5GA 4R74A 3DP6A 1A54A 5M2VA 3VV5A 1ANFA 3TKDA 4ISUA 3S9LC 5DVFA 3IOTA 1PB9A 1P99A 5DYHA 4MBPA 1UTBB 4RY1A 1LAGE 4QHQA 1XVXA 3SEVA 3PD8A 1S50A 3K0VA 5ITPA 3Q27A 1Q1KA 2F8DA 2F36A 2FYIA 3VXBA 1P1QA 4KQPA 2AIXA 1QULA 1R9LA 2XX9A 3JV9A 1B2HA 4ZEDA 2WOLA 5L8DA 1ZIUA 4YMBA 2GHBA 4IY6A 1MXZA 3B6TA 2DWAA 3RYBA 2B4MA 3K2DA 3K6WA 3MPLA 3FXRA 1GR2A 2ANJA 1XC1A 3IB2A 2DYXA 2QS1A 4UA8A 1A8FA 4NF8A 4O3BA 5CC2A 4F22A 3N26A 1MY4A 2Y7KA 3KGCA 1GV8A 1B4HA 3BFTA 3OOAA 1AIVA 4IGTA 3QIMA 3KN7A 1PC3A 2O6AA 1B6HA 3KZGA 1M5FA 2H25A 4OEVA 4EF2A 2XXYA 4DIGA 4NEDA 2DP8A 3PPPA 1KWHA 1SI1A 4DXBA 4PQJA 1GGGA 3PUVE 2LAOA 3V83A 4EQ9A 1MXXA 3KJTA 2XXWA 4IY5A 4LUBA 2PT2A 5ICTA 2Y7IA 2XXHA 5JTYA 2HAVA 1FTJA 4PP0A 4ZEFA 3T9VA 1H44A 3QSLA 5TPAA 1SBPA 1IQ7A 3SEWA 3FXQA 2ZNUA 4KCDA 3FGSA 1JW1A 3RT6B 4XIGQ 1MY1A 5B70A 1B1HA 4N13A 3RN8A 4JWXA 3VLWA 4ELOA 3G3IA 4G8NA 3FV2A 3WAFA 1YAEA 2Z8FA 2O7UA 2VOZA 4R2FA 2ONKE 2XXQA 2OLBA 4FE8A 4DCYA 3ONMA 3CFXA 4LZ5A 3FXUA 2DWJA 3UN6A 1NNPA 4OESA 2E1SA 2OJTA 3G3JA 4OZ9A 1B5HA 1IUDA 1FTKA 2NVUB 2OWTA 1VR5A 4PFWA 2V84A 3IJOB 2Z8DA 1HSEA 2I48A 1Z7NE 5I56A 3MAMA 3G3KA 4IO6A 4QFKA 4JSOA 2H99A 4GXSB 3S9NC 1VSOA 4ESXA 1B3FA 4ZE9A 4P11A 5I84A 4DXUA 3K01A 3S9EA 2HEUA 3RUMA 1JEUA 4KD5A 4YKIA 1A40A 5JK4A 2WOPA 1Y4CA 1B58A 3H6TA 1A8EA 4U21A 2DOJA 3EPEA 3MW0A 1MG1A 3MBPA 3MQ9A 2W7YA 4G68A 2XXXA 1ZBMA 5A5XB 3U94A 1UQWA 2QMXA 4X1DA 5H8FB 5KDTB 5IAIA 3RTFB 4QSEA 4F1VA 3O9PA 3E13X 4K3FA 3TZAA 2CZLA 4C1TA 4FORA 2OZZA 3K00A 3C35A 3G7WA 4FAJA 4XKPA 2D21A 4YICA 3VVDA 1SDXA 1B3EA 2I0CA 3O66A 4F29A 4ELRA 3N94A 1CE2A 3K1NA 3C9HA 3N6TA 4FEBA 3C4MA 1BIYA 1D9YA 2XXRA 3FZVA 4I9DA 3MUQA 5CMKA 4ELQA 4OWDA 1I6AA 4HTGA 4AB5A 5I2KA 1YTVA 3CG3A 2HZKA 3E9XA 3EHUA 3W15C 2ONSA 3U1OA 4F1UA 4GFRA 3RNNA 3E3KA 3EQ1A 5I57B 5I2NB 4U4SA 3MWBA 1XOCA 3KBRA 4NF4B 4ZE8A 5EYFA 5DVJA 1EZ9A 1TFDA 5H8NB 3OO9A 1FCKA 5KCJA 4H67A 5FTHA 1PB7A 1Y9UA 3TMGA 4OHNA 1BKAA 1MXYA 1ZJLA 1B4ZA 2NXOA 5CBRA 3EF7A 4OMBA 1T0KA 1US4A 1P1OA 4GOTA 2H4IA 1ZU0A 4R73A 1FTMA 1UIVA 4F3SA 4H8IA 1SW2A 2PMSA 4X1BA 2H98A 1SQYA 1YPNA 1AOVA 3BBRA 4QFOA 1SVXB 3QUFA 5AA4B 3TELA 3VVFA 2OBGA 2DE3A 2DSFA 3DLNA 2QL3A 1VFDA 4JXIA 3DP8A 1NKXA 4G77A 3K4UA 4GRKA 1QKBA 1A99A 2V3UA 5LOMA 1IXIA 1MH3A 3RYAA 5I59A 2HXWA 3IR1A 5ITOA 3TODA 3SEUA 1LFGA 1OIBA 1S9TA 1H3DA 3DRHA 3I5OA 2A5TA 1MH4A 4KYEA 3T96B 3U72A 3TTLA 5BWJA 3O6PA 3IB0A 3SEXA 3V89B 1FQBA 4Q30B 1EZOA 3LSXA 2VGQA 3FD3A 4YZZA 4QFLA 1IIWA 4R75A 1N7WA 4H65A 3CR9A 3SEYA 1B3GA 3PPNA 4F1YA 3P7IA 5I58A 3LUYA 3TQWA 1MDP1 3O6GA 1BLFA 2Q9TA 2F7CA 3G3GA 3MZ1A 3TCGA 4HS7A 2IA4A 3OXNA 4RJZA 3PGFA 1URSA 2O1MA 5L9SA 3Q28A 4G2ZA 1B52A 4Q5TA 2QJEA 4YKJA 1OQGA 2M8CA 1NMUA 3TCHA 3DRKA 1FTLA 3LVUA 5ELVA 2DWIA 4H8JA 3CHGA 3KN3A 4NMYA 1JEVA 3MVYA 3TTKA 2DS9A 1GTKA 2Y7WA 2F5XA 3U8QA 3FV1A 4JB7A 1DPEA 2RINA 1Y1ZA 5DVIA 4OERA 5FTIA 1L5TA 4ESWA 3I3VA 4ZDMA 3GZGA 2QS4A 1LAFE 1B46A 1TWYA 5AA2A 3A09A 2UVHA 1NFTA 5TU0A 4PETA 4NF8B 3QAXA 3FIRA 4XKRA 1Y20A 5CBSA 3THIA 2VD3A 4XTCQ 4DDDA 3SESA 2NUVA 4RYAA 4X48A 1B05A 4GD5A 1A7LA 3N6UA 1EH3A 1FQAA 1XVYA 3OD7A 3ZS6A 4I8CA 1QUJA 3RT8A 4YKPA 3MJNA 1YCJA 4FATA 1FQDA 4LQ5A 3U93A 2GHAA 2O7IA 4MLVA 4EXKA 5H8HA 1N04A 3S4UA 3TYHA 2GH9A 3VFJA 3H4ZA 4JDFA 5EHMA 1MM7A 5JTYB 1MQGA 2RC8A 3IAZA 3CVGA 4QFPA 3FATA 4PFUA 5TPAB 2WOKA 4OFJA 1OVTA 4JWOA 3IORA 4GQOA 2O1LA 4WXJA 1LSTA 1LFHA 2DVZA 3OEKA 3EN3A 2F97A 4ZECA 1IEJA 2YLNA 3VXCA 4TQUQ 3ILTB 3KEIA 4ONYA 5AA1A 3TDJA 5F7VA 4EUOA 1MDQA 2THIA 3T22A 3IL1B 4R6HA 2I49A 2AYSA 2ZYKA 2Q2CA 3RLFE 1LGBC 4RXLA 3MZBA
chains in the Genus database with same CATH superfamily
3VLUA 3PPRA 2Q2AA 1K9YA 5I56B 4IB2A 3G3FA 1Y3NA 4P3LA 2RCBA 2FIXA 4PAIA 3RTWB 2F34A 1HSLA 1N3WA 4LQ2A 1B32A 1FPEA 4POXA 1M5BA 3CRBA 2Z23A 5DEXA 4YKKA 3MVZA 4OFOA 4LONB 2QPQA 3MVXA 4NWCA 3IFCA 4Z0IA 3LBSA 2AL5A 4U2RA 2HCAA 1B40A 3ECRA 4N6KA 1LAHE 1PBPA 4G68B 2DXYA 2X7PA 5HBCA 4ECFA 2F7AA 1B5IA 2UVIA 3E4RA 5IZ3B 4R6KA 2G29A 3PUWE 2KR0A 1Q35A 4NG7A 3FVNA 2NWJA 4U1ZA 4BDLA 5EQ7A 4R9FA 5B7DA 2REGA 4QSDA 2XXIA 1HSJA 4LN5A 5AA2D 4XEQA 4OEUA 2QRYA 3PUZE 4BLAA 1LAXA 3GLBA 3O2AA 4NGUA 1S7YA 1P1UA 4N6PA 3IOWA 3HFUA 3C33A 4E0XA 2I58A 1MQHA 4GL0A 4Q0CA 1B51A 4M4GA 4KHZE 1SD3A 3RQTA 3MC2A 4LZ7A 1PB8A 2QS2A 5T3JA 5I2KB 4XF5A 2G93A 3A3CA 2WBDA 3ILUB 4EQ7A 5L9MA 2ZYMA 1OQHA 1ATGA 2ZNSA 3OENA 3K6XA 2Y7PA 5FHMA 1NNFA 4NX1A 4XKQA 3TTNA 5EQ9A 3U92A 4WEPA 2B65A 1NV0A 4HXVA 4F31B 4R2BA 3EHTA 1NNTA 5KCJB 5F24A 1QVSA 4H1XA 1AMFA 1FW0A 1N3XA 2HQ0A 3MVWA 1N84A 1DMBA 3E78A 2P2AA 2UYEA 5F1QA 1MPDA 4E0WA 2YPNA 3PUYE 3PUXE 2ZYOA 3DELB 1MRPA 3I6VA 1USYH 4HCWA 3R6UA 1IMCA 5AE4A 2HFBA 2WX9A 4JBZA 3H6UA 4F3BA 3K1MA 2GFEA 3S9MC 2I3VA 1EYJA 4RNSA 1NV4A 1SPIA 2F6PA 4HE0A 2CEYA 5BUUA 3MP6A 4U22A 3TTMA 1OLCA 5ICQA 4G61A 3R26A 3HHGA 4BDOA 1FBDA 3VLVA 2ZZXA 4GLIA 2O68A 2KLFA 1DTGA 4OQOA 4OETA 5KZTA 1O64A 2VHAA 4RPOA 1O63A 1SYHA 1EU8A 1LLSA 1NV7A 1EYIA 3R7XA 1FBPA 1IXCA 2ABHA 1TT1A 2OK2A 4BDNA 4Q8RA 1ZLQA 1QW0A 5I59B 3SZPA 1LEVA 2QSXA 4KPTA 4P1EA 3V5AA 3HV1A 3LR1A 1FQCA 1MY3A 2A5TB 5CI5A 2Q89A 1F9BA 3KBZA 2WKYA 4F2QA 1RDZA 2UXAA 1CB6A 2F3DA 1QUIA 2BJJX 2YJPA 3JYRA 1NV3A 3L6GA 3DRIA 1TFAA 4HE2A 3VVEA 3OSRA 1B5JA 3H6VA 4DLDA 1FTOA 3HHFA 4N8GA 2ALUA 1DCUA 3SERA 1JQFA 4GWWA 4NF6A 3B6WA 2I4BA 2Y5KA 3IO6A 5I58B 4NQ8A 5I7IA 1MS7A 2ESNA 3H3GA 1NH7A 4ZZAA 2I0BA 4FECA 2QMWA 4IO7A 1PEBA 2X7QA 3ZSFA 1Y3QA 3SDFA 2DVCA 3FJ7A 2XHDA 3C36A 2VD2A 4EDPA 1B1XA 3RPLB 3EKIA 4XFEA 2ZYNA 4P0IA 1Y3PA 3LSFB 5A5LA 3UORA 4N07A 1FPKA 1SW5A 1XT8A 2PX1A 4X8RA 5H8QA 2HHMA 4MCOA 2ZNTA 4NHBA 4X9TA 2FA7A 2XXVA 1FPIA 3H03A 5HPQA 3IOUA 4DZ1A 1MQIA 4HW8A 1QGXA 1ZMGA 2GQ1A 4ND9A 5EQ8A 3OO6A 2VPNA 3FJMA 3W9VA 3OEMA 4LZ8A 4F39A 1POY1 5JEIA 1LCFA 4GXAA 3V8XB 3FJGA 4NF5B 4ELPA 3O97A 4PFIA 1D4NA 4GWYA 1D3KA 1QJMA 3PPOA 1DSNA 2UYFA 4P0GA 3Q25A 3KSJA 4I62A 4JSDA 5TP9A 2V3QA 4OFLA 4MNPA 3B50A 3CSGA 3Q29A 2Q88A 5AA2B 1UTHA 4NF5A 3T9XB 3K6VA 4GIZA 1Z7ME 4JVCA 3K1PA 5J1DA 3H7MA 3Q26A 1PDAA 2Q8JA 1I6QA 5IGAA 1FQEA 4QSCA 1NUYA 4LP2B 1M5DA 3ZKKA 1AH5A 3FTOA 1UTBA 1VDWA 1H45A 4C1UA 5IZZA 1SW4A 3KN8A 4PAKA 3GYYA 2IEEA 3L6HA 4P1LA 2E0SA 4UACA 1EZPA 5ET8A 3RPWA 2PBWA 3UK4A 4YAHX 1R6ZA 4KCCA 1JW5A 2AL4A 2FNCA 2Y5LA 2A5SA 5H8HB 1MXWA 1IMDA 3NOHA 2R71A 2B4LA 4G4PA 4YB7A 3B7DA 3H6WA 1DPPA 1IMAA 4GBVA 1VE4A 2F35A 2FIEA 3QK6A 4F3PA 4NTLA 5DT6A 4RK9A 1WVJA 4MF3A 1H76A 3BIHA 1H43A 5HM4B 3T9UA 1OVBA 3DP4A 4XKNA 4OVRA 2BJIA 3SETA 4KYDA 1QKAA 1WDNA 4O8MA 3O6IA 3T0JA 3QUJA 4GL8A 4MNIA 4IR8A 2ZMBA 1NV2A 1LB8A 3SKPA 4KFQA 3MPKA 2I4CA 3B8BA 1GVCA 3CSBA 4H46A 1IMFA 3TPAA 2ZXTA 4U1OA 3RYDA 3QMFA 4FEDA 2QVRA 1NNKA 1XI6A 3T9HB 1G0HA 4R9GA 4PC9A 3OO7A 1B9JA 1CNQA 1Y1MA 5DTBA 3KOTA 3LSLA 3T93B 1N76A 1SYIA 2Y7RA 5EYHA 4XXUA 4TLLB 3PV0E 2XD2A 1INPA 4H45A 4I1DA 3IFAA 3PD9A 3GBBA 2DDKA 4NWDA 3QXMA 2QVVA 3BKIB 1BTJA 1I6BA 2B3BA 4PCDA 4DI4B 3F11A 4OVQA 1B0HA 4BDQA 4NE4A 1IMEA 2CZHA 1R1NA 5DEXB 4F3GA 1SW1A 4KR5A 4MAGA 4F2OA 2FBPA 3CFZA 2RKMA 1M5EA 4N91A 4I3EA 3W9WA 4MLQA 5FHNA 1Q9DA 3DRJA 4PF8A 3HCQA 1IXHA 1PBQA 3CG1A 1LBBA 1O7TA 3OELA 3IO4A 2VP1A 4QF9A 4TLMB 1LBCA 2V3TA 1SI0A 1FQFA 3MP8A 4MNCA 2MKZA 3TUSA 5K2XA 4G8HA 1AWBA 2XXPA 2XXTA 3MSTA 3UGWA 2D3IA 1WODA 4IO2A 3RY3A 4M1VA 3TFLA 2H9BA 2RC9A 4FJPA 3OO8A 2F6GA 4RK2A 3UP9A 4QFNA 4EF1A 4ZEIA 3UA8A 4BDRA 5CMBA 4IO3A 4C0RA 3ZKLA 4HCYA 1K9ZA 4GF8A 1N0TA 4GX4A 4Z7EA 1B7HA 1IITA 3O28A 3AXFA 3PPQA 3O6HA 2XWOA 3KSXA 2R9JA 4L17A 5L9OA 1NV6A 1POTA 3T1BA 1FPBA 2REJA 2VPOA 4N17A 4RPNA 3HPIA 1NH8A 3H06B 3JZJA 2PVUA 1KA1A 3DM0A 2HZLA 3VDFA 3BFUA 2DE4A 3G3HA 3IJXB 3MP1A 3M8UA 4AQ4A 2DQVA 3B6QA 5A5XA 5LTCA 2V93A 5H8FA 1P1NA 3KC1A 5KDTA 5I5PA 3OSQA 4AS4A 2ONRA 2CMOA 2UVJA 3DRGA 4GWZA 5CMCA 2XD3A 2PYYA 4OVJA 4EQBA 2RC7A 3K6UA 2OCUA 3LSWA 2Y84A 4N6DA 1MQJA 2OWSA 3USDA 4OVPA 4POWA 3PAMA 3IOVA 3PU5A 4G8MA 4GWUA 3A3UA 3TCFA 3KG2A 4LVQA 3FVKA 1MPBA 1URDA 4JWYA 1B7UA 1B3HA 2DXRA 1JVXA 2P1SA 1JNFA 4IGRA 3PMVA 1MXVA 5ISUA 1USYE 3EHSA 3PMXA 3IB1A 3C31A 4R6YA 3TEPA 2QS3A 1B3LA 4PFYA 5H8SA 3TAJA 2I3WA 1US5A 1VFEA 2RCAA 4O3CA 1D9VA 2CEXA 2P3VA 1I69A 2Z8EA 3ODBA 4LATA 5AA3A 3OMBA 3PMWA 4YB5A 1G0IA 5I57A 1JETA 4H6DA 1OMPA 5I2NA 1YYZA 4P56A 1FBEA 1MPCA 4MEVA 4H5FA 4AB6A 4NF4A 4OTEA 1KA0A 4PF6A 1IXGA 2PT1A 4R72A 3IK6B 2PCRA 5H8NA 1ELJA 4OXVA 2P0SA 1Y4TA 3IX1A 3T66A 5IKBA 5CM6A 2HAUA 5K2YA 1A55A 4IO4A 3M3KA 4DXCA 1MM6A 4IO5A 3FUZA 2DE2A 3FVOA 2GRVA 1LCTA 1XS5A 4GX3A 3DRFA 1ZKBA 4MFIA 5FHOA 4F19A 3GXAA 4GWOA 3D4CA 3M3LA 4F18A 4ZEKA 3KOSA 4FIMA 2WYPA 2H5YA 3RGYA 2RF1A 2O51A 4WEDA 1MXUA 3MYUA 1UIUA 5CRYA 1TXFA 1R9QA 3TTRA 5AA4A 4KYSA 1P1WA 3S2VA 4EXLA 1RKMA 4PBHA 3WAEA 2O69A 4DI3D 4NF6B 3CFLA 4OA4A 2XX7A 3GBAA 4KI0E 1FPGA 5ESYA 5FBPA 1URGA 2B3FA 1RYOA 4GVOA 4YB6A 4O3AA 1DTZA 1MQDA 4TOZA 3CIJA 1QUKA 3O29A 4PE5B 1B7ZA 3VE1B 1AL3A 2XA5A 2F78A 4NN3A 4DCXA 2XX8A 2DWHA 3CI8A 4NAPA 4N81A 1NL5A 3QYTA 4U4XA 2X26A 1OLAA 3C32A 3M3FA 4H0WA 1MY2A 1J1NA 4ZEBA 3K02A 2V25A 4MH5A 3LC8A 4OYVA 3FVGA 4RA1A 1DOTA 3FXBA 5CMMA 4DE8A 5H8QB 2O84X 2PFYA 4O7IA 4OENA 4YMAA 2XXKA 3D4GA 3TQLA 2FHYA 4QRZA 1JW4A 1FBHA 1B0LA 1II5A 2XXUA 4ZZEA 2D5WA 3KFMA 1N7XA 3D1RA 3C34A 3MZ9A 1RYXA 1ZTYA 4P8BA 4WKMA 2Z22A 4U23A 3HSTA 4BDMA 2UVGA 3PTYA 1BP5A 2I6EA 1MY0A 3HN0A 1JVYA 2F7BA 3ROJA 4OVSA 2R6GE 3FASA 3N5LA 2NOOA 1M5CA 5EHSA 4PE3A 1IZ1A 4ZS9A 4LA9A 5TP9B 3UIFA 1LFIA 1LB9A 4I3YA 1XHYA 1FJ9A 3BIGA 3HO7A 4THIA 1UTHB 4G68C 4YU0A 4PFTA 3KJ7A 4H5GA 4R74A 3DP6A 1A54A 5M2VA 3VV5A 1ANFA 3TKDA 4ISUA 3S9LC 5DVFA 4N8YA 1FBFA 3IOTA 1PB9A 1P99A 5DYHA 4MBPA 1UTBB 4RY1A 1LAGE 4QHQA 1XVXA 3SEVA 3PD8A 1S50A 3K0VA 5ITPA 1RDXA 3Q27A 1Q1KA 2F8DA 2F36A 2FYIA 3VXBA 1P1QA 4KQPA 2AIXA 1QULA 1R9LA 2XX9A 3JV9A 1B2HA 1NUWA 4ZEDA 2WOLA 5L8DA 1ZIUA 4YMBA 2GHBA 4IY6A 1MXZA 3B6TA 2VT5A 2DWAA 3RYBA 2B4MA 3K2DA 3K6WA 3MPLA 4PBQA 3FXRA 1GR2A 2ANJA 1XC1A 3IB2A 2DYXA 2QS1A 4UA8A 1A8FA 4NF8A 4O3BA 5CC2A 4F22A 3N26A 1MY4A 5I3SA 2Y7KA 3KGCA 1GV8A 4UABA 2Q74A 1B4HA 2QVUA 3BFTA 3OOAA 1AIVA 1D9QA 1FSAA 4IGTA 3QIMA 3KN7A 1PC3A 2O6AA 1B6HA 3KZGA 1M5FA 2H25A 4OEVA 4EF2A 2XXYA 4DIGA 4NEDA 2DP8A 3PPPA 1KWHA 1SI1A 3ISPA 4DXBA 4PQJA 1GGGA 3PUVE 2LAOA 4JVDA 4GWSA 1LBZA 3V83A 4EQ9A 1MXXA 4PDHA 3KJTA 2XXWA 4IY5A 4LUBA 2PT2A 5ICTA 2Y7IA 3U65A 2XXHA 5JTYA 2HAVA 1FTJA 4PP0A 2WYKA 4ZEFA 3T9VA 1H44A 3QSLA 1SBPA 5TPAA 1IQ7A 3SEWA 3FXQA 4NF0A 2ZNUA 4KCDA 1RDYA 3FGSA 1JW1A 3RT6B 4XIGQ 1MY1A 5B70A 1B1HA 1DK4A 2L5VA 4N13A 3RN8A 4JWXA 3VLWA 4ELOA 3G3IA 4G8NA 4MIJA 2XWKA 3FV2A 2XWVA 3WAFA 1YAEA 2Z8FA 2O7UA 2VOZA 4R2FA 2ONKE 2XXQA 2OLBA 4FE8A 4DCYA 3ONMA 1FPFA 3CFXA 4LZ5A 1BK4A 5IM2A 3FXUA 2DWJA 2XWIA 3UN6A 1NNPA 4OESA 2E1SA 2OJTA 3G3JA 1NUXA 4OZ9A 1B5HA 1IUDA 1FTKA 1EYKA 2NVUB 2OWTA 1VR5A 4PFWA 1FRPA 2V84A 3IJOB 3KC0A 2Z8DA 4JVIA 1HSEA 2I48A 1Z7NE 5I56A 1FJ6A 4IO6A 3G3KA 3MAMA 4QFKA 4JSOA 2H99A 4GXSB 3S9NC 1VSOA 4GWXA 4ESXA 1B3FA 4ZE9A 4P11A 2OX3A 4MJOA 5I84A 4DXUA 3K01A 3S9EA 2HEUA 3RUMA 4GBWA 1JEUA 4KD5A 4YKIA 1A40A 5JK4A 4PGNA 4OVTA 2WOPA 4N15A 1Y4CA 1B58A 3H6TA 4QBAA 1A8EA 4U21A 2DOJA 3EPEA 3MW0A 1MG1A 3MBPA 3MQ9A 2W7YA 4G68A 2XXXA 1ZBMA 5A5XB 3U94A 1UQWA 2QMXA 4X1DA 5H8FB 5KDTB 5IZ3A 5IAIA 3RTFB 4QSEA 4F1VA 3O9PA 3E13X 4K3FA 3TZAA 2CZLA 4PFRA 4C1TA 4FORA 2OZZA 3K00A 2JJKA 3C35A 3G7WA 4FAJA 4XKPA 4PGPA 2D21A 4YICA 3VVDA 1SDXA 1B3EA 2I0CA 3O66A 4F29A 4ELRA 3N94A 1CE2A 3K1NA 3C9HA 3N6TA 4FEBA 3C4MA 1BIYA 1D9YA 2XXRA 3FZVA 4I9DA 3MUQA 5CMKA 4ELQA 4OWDA 1I6AA 4HTGA 4AB5A 5I2KA 1NV1A 1YTVA 3CG3A 2HZKA 4O7MA 3E9XA 3EHUA 4PDDA 3W15C 2ONSA 3U1OA 4F1UA 4GFRA 3RNNA 3E3KA 3EQ1A 5I57B 5I2NB 4U4SA 3MWBA 1XOCA 3KBRA 4NF4B 4ZE8A 5EYFA 5DVJA 1EZ9A 1TFDA 5H8NB 3OO9A 1FCKA 5KCJA 4H67A 5FTHA 1PB7A 1Y9UA 3TMGA 4OHNA 1BKAA 1MXYA 1ZJLA 1B4ZA 2NXOA 5CBRA 5ET5A 4PTKA 3EF7A 4PAFA 4FBPA 4OMBA 5IZ1A 1T0KA 1US4A 1P1OA 4GOTA 2H4IA 1ZU0A 4R73A 1FTMA 1UIVA 4F3SA 4H8IA 1NV5A 1SW2A 2PMSA 4X1BA 2H98A 1SQYA 1YPNA 1AOVA 3BBRA 4QFOA 4N4UA 3FBPA 1SVXB 3QUFA 5AA4B 3TELA 3VVFA 1YXIA 4P47A 2OBGA 2DE3A 2DSFA 3DLNA 2QL3A 1FTAA 1VFDA 4JXIA 3DP8A 2WBBA 1NKXA 4G77A 3K4UA 4GRKA 1QKBA 1A99A 2V3UA 5LOMA 1IXIA 1MH3A 2CZIA 3RYAA 2HPGA 5I59A 2HXWA 3IR1A 5ITOA 3TODA 3SEUA 1LFGA 1LBXA 1OIBA 1S9TA 1H3DA 1FBCA 3A29A 3DRHA 3I5OA 2A5TA 1MH4A 4KYEA 3T96B 3U72A 1IMBA 3TTLA 5BWJA 3O6PA 3IB0A 3SEXA 3V89B 2QFLA 1FQBA 4Q30B 1EZOA 3LSXA 2VGQA 3FD3A 4YZZA 4QFLA 1IIWA 1KZ8A 4R75A 2FVZA 1N7WA 4H65A 2CZKA 3CR9A 3SEYA 1B3GA 3PPNA 4F1YA 3P7IA 5I58A 3LUYA 1NUZA 3TQWA 1MDP1 3O6GA 1BLFA 2Q9TA 2F7CA 4P9KA 3G3GA 3MZ1A 3TCGA 4HS7A 2IA4A 3OXNA 4RJZA 3PGFA 1URSA 2O1MA 3RPLA 3Q28A 5L9SA 4G2ZA 1B52A 4Q5TA 2QJEA 4YKJA 1OQGA 2M8CA 1NMUA 3TCHA 3DRKA 1FTLA 4QXDA 5J16A 3LVUA 5ELVA 2DWIA 1FPDA 4H8JA 3CHGA 2HXRA 3E79A 4NMYA 3KN3A 1JEVA 1LBYA 3MVYA 2R8TA 3TTKA 1YZ0A 2DS9A 1GTKA 2Y7WA 2F5XA 1JP4A 4MHFA 3U8QA 2PFZA 2ZZVA 3FV1A 4JB7A 4OANA 4KXPA 1DPEA 2RINA 2ZZWA 1Y1ZA 5DVIA 4OERA 5FTIA 1L5TA 4ESWA 3I3VA 4ZDMA 3GZGA 2QS4A 1LAFE 1B46A 1TWYA 5AA2A 3A09A 5EYGA 2UVHA 1NFTA 5TU0A 4PETA 4NF8B 3QAXA 3FIRA 4XKRA 1Y20A 5CBSA 3THIA 2VD3A 4XTCQ 4DDDA 3SESA 5EQAA 2NUVA 4RYAA 4X48A 1B05A 2V4CA 4GD5A 1A7LA 2P3NA 2KQZA 3N6UA 1EH3A 4MX6A 1FQAA 1XVYA 3OD7A 3ZS6A 4I8CA 1QUJA 3RT8A 4HE1A 4YKPA 3MJNA 1YCJA 4FATA 1FQDA 4LQ5A 3U93A 2GHAA 1LBWA 2O7IA 4MLVA 1LBVA 4EXKA 5H8HA 1N04A 3S4UA 2WEFA 3TYHA 2GH9A 3VFJA 3H4ZA 4JDFA 5EHMA 1MM7A 5JTYB 1MQGA 2RC8A 3IAZA 3CVGA 4QFPA 5DW8A 3FATA 2Q8MA 4PFUA 5TPAB 2WOKA 4OFJA 1OVTA 4JWOA 3IORA 4MMPA 4GQOA 3LUZA 2O1LA 4WXJA 1LSTA 1LFHA 1FPJA 2DVZA 1FPLA 3OEKA 3EN3A 2F97A 4ZECA 1IEJA 2YLNA 3VXCA 4TQUQ 3ILTB 4O94A 3KEIA 5LDZA 4ONYA 1FBGA 5AA1A 3TDJA 4PFBA 5F7VA 3LV0A 2F3BA 4EUOA 2OWZA 1MDQA 2THIA 4I40A 5ET7A 4AS5A 4X04A 3T22A 3IL1B 4R6HA 2I49A 2AYSA 1DBZA 1NI9A 2ZYKA 2Q2CA 3RLFE 1LGBC 4RXLA 4GX6A 3MZBA 5ET6A
chains in the Genus database with same CATH topology
3VLUA 3PPRA 2Q2AA 5I56B 4IB2A 3G3FA 1Y3NA 2RCBA 3RTWB 2F34A 1HSLA 1N3WA 4LQ2A 1B32A 4POXA 1M5BA 3CRBA 2Z23A 5DEXA 4YKKA 3MVZA 4OFOA 4LONB 2QPQA 3MVXA 4NWCA 4Z0IA 3LBSA 2AL5A 4U2RA 2HCAA 1B40A 3ECRA 1LAHE 1PBPA 4G68B 2DXYA 2X7PA 5HBCA 4ECFA 2F7AA 1B5IA 2UVIA 3E4RA 4R6KA 2G29A 3PUWE 2NWJA 1Q35A 3FVNA 4U1ZA 4BDLA 4R9FA 5B7DA 2REGA 4QSDA 2XXIA 1HSJA 5AA2D 4OEUA 2QRYA 3PUZE 4BLAA 1LAXA 3GLBA 3O2AA 1S7YA 1P1UA 4N6PA 3IOWA 3C33A 4E0XA 2I58A 1MQHA 4GL0A 4Q0CA 1B51A 4M4GA 4KHZE 1SD3A 3RQTA 3MC2A 4LZ7A 1PB8A 2QS2A 5I2KB 2G93A 3A3CA 3ILUB 4EQ7A 5L9MA 2ZYMA 1OQHA 1ATGA 2ZNSA 3OENA 3K6XA 2Y7PA 5FHMA 1NNFA 4XKQA 3TTNA 3U92A 4WEPA 2B65A 4F31B 4R2BA 3EHTA 1NNTA 5KCJB 1QVSA 4H1XA 1AMFA 1FW0A 1N3XA 2HQ0A 3MVWA 1N84A 1DMBA 2P2AA 2UYEA 5F1QA 1MPDA 4E0WA 2YPNA 3PUYE 3PUXE 2ZYOA 3DELB 1MRPA 3I6VA 1USYH 4HCWA 3R6UA 5AE4A 2HFBA 4JBZA 3H6UA 4F3BA 3K1MA 2GFEA 3S9MC 2I3VA 4RNSA 2F6PA 5BUUA 3MP6A 4U22A 3TTMA 1OLCA 5ICQA 3R26A 3HHGA 4BDOA 3VLVA 4GLIA 2O68A 2KLFA 1DTGA 4OQOA 4OETA 5KZTA 1O64A 2VHAA 4RPOA 1O63A 1SYHA 1EU8A 1LLSA 3R7XA 2ABHA 1IXCA 1TT1A 2OK2A 4BDNA 4Q8RA 1ZLQA 1QW0A 5I59B 2QSXA 4KPTA 3V5AA 3HV1A 3LR1A 1FQCA 1MY3A 2A5TB 5CI5A 2Q89A 1F9BA 2WKYA 4F2QA 2UXAA 1CB6A 1QUIA 2BJJX 2YJPA 3JYRA 3L6GA 3DRIA 1TFAA 3VVEA 3OSRA 1B5JA 3H6VA 4DLDA 1FTOA 3HHFA 2ALUA 3SERA 1JQFA 4NF6A 3B6WA 2I4BA 3IO6A 5I58B 1MS7A 2ESNA 3H3GA 1NH7A 4ZZAA 2I0BA 4FECA 2QMWA 4IO7A 1PEBA 2X7QA 3ZSFA 1Y3QA 3SDFA 2DVCA 3FJ7A 2XHDA 3C36A 2VD2A 4EDPA 1B1XA 2ZYNA 4P0IA 1Y3PA 3LSFB 3UORA 4N07A 1SW5A 1XT8A 2PX1A 5H8QA 2ZNTA 4X9TA 2FA7A 2XXVA 3H03A 5HPQA 3IOUA 4DZ1A 1MQIA 4HW8A 1ZMGA 4ND9A 3OO6A 3FJMA 3W9VA 3OEMA 4LZ8A 4F39A 1POY1 5JEIA 1LCFA 4GXAA 3V8XB 3FJGA 4NF5B 4ELPA 3O97A 1D4NA 1D3KA 1QJMA 3PPOA 1DSNA 2UYFA 3Q25A 4I62A 3KSJA 4P0GA 4JSDA 5TP9A 2V3QA 4OFLA 3CSGA 3Q29A 2Q88A 5AA2B 1UTHA 4NF5A 3T9XB 3K6VA 4GIZA 1Z7ME 3K1PA 5J1DA 3H7MA 3Q26A 1PDAA 2Q8JA 1I6QA 1FQEA 4QSCA 4LP2B 3ZKKA 1M5DA 1AH5A 3FTOA 1UTBA 1H45A 4C1UA 1SW4A 3KN8A 2IEEA 3L6HA 2E0SA 4UACA 1EZPA 3RPWA 2PBWA 3UK4A 4YAHX 1R6ZA 4KCCA 1JW5A 2AL4A 2FNCA 2A5SA 5H8HB 1MXWA 2R71A 2B4LA 4G4PA 4YB7A 3B7DA 3H6WA 1DPPA 1VE4A 2F35A 3QK6A 4F3PA 4NTLA 5DT6A 4RK9A 1WVJA 4MF3A 1H76A 1H43A 5HM4B 3T9UA 1OVBA 3DP4A 4XKNA 3SETA 4KYDA 1QKAA 1WDNA 3O6IA 3QUJA 4GL8A 2ZMBA 1LB8A 3SKPA 4KFQA 3MPKA 2I4CA 1GVCA 3CSBA 3TPAA 2ZXTA 4U1OA 4FEDA 1NNKA 3T9HB 4R9GA 3OO7A 1B9JA 1Y1MA 5DTBA 3KOTA 3LSLA 3T93B 1N76A 1SYIA 2Y7RA 4XXUA 4TLLB 3PV0E 2XD2A 4I1DA 3PD9A 3GBBA 4NWDA 3QXMA 3BKIB 1BTJA 1I6BA 2B3BA 3F11A 1B0HA 4BDQA 4NE4A 1R1NA 5DEXB 4F3GA 1SW1A 4KR5A 4F2OA 3CFZA 2RKMA 1M5EA 3W9WA 4MLQA 5FHNA 3DRJA 3HCQA 1IXHA 1PBQA 3CG1A 1LBBA 1O7TA 3OELA 3IO4A 2VP1A 4QF9A 4TLMB 1LBCA 2V3TA 1SI0A 1FQFA 3MP8A 3TUSA 5K2XA 4G8HA 2XXPA 2XXTA 3UGWA 2D3IA 1WODA 4IO2A 3RY3A 4M1VA 3TFLA 2H9BA 2RC9A 4FJPA 3OO8A 2F6GA 4RK2A 3UP9A 4QFNA 4EF1A 4ZEIA 3UA8A 4BDRA 5CMBA 4IO3A 4C0RA 3ZKLA 4HCYA 4GF8A 1N0TA 4Z7EA 1B7HA 1IITA 3O28A 3AXFA 3PPQA 3O6HA 3KSXA 2R9JA 4L17A 5L9OA 1POTA 2REJA 4RPNA 3HPIA 1NH8A 3H06B 3JZJA 2PVUA 3DM0A 2HZLA 3VDFA 3BFUA 2DE4A 3G3HA 3IJXB 3MP1A 3M8UA 4AQ4A 2DQVA 3B6QA 5A5XA 2V93A 5H8FA 1P1NA 5KDTA 3OSQA 2ONRA 2CMOA 2UVJA 3DRGA 5CMCA 2XD3A 2PYYA 4OVJA 4EQBA 2RC7A 3K6UA 2OCUA 3LSWA 2Y84A 1MQJA 2OWSA 3USDA 4POWA 3PAMA 3IOVA 3PU5A 4G8MA 3A3UA 3TCFA 3KG2A 4LVQA 3FVKA 1MPBA 1URDA 4JWYA 1B7UA 1B3HA 2DXRA 1JVXA 2P1SA 1JNFA 4IGRA 3PMVA 1MXVA 5ISUA 1USYE 3EHSA 3PMXA 3IB1A 3C31A 4R6YA 3TEPA 2QS3A 1B3LA 4PFYA 5H8SA 3TAJA 2I3WA 1US5A 1VFEA 2RCAA 4O3CA 1D9VA 1I69A 2Z8EA 3ODBA 4LATA 5AA3A 3OMBA 3PMWA 4YB5A 5I57A 1JETA 4H6DA 1OMPA 5I2NA 1MPCA 4H5FA 4AB6A 4NF4A 4OTEA 1IXGA 2PT1A 4R72A 3IK6B 5H8NA 1ELJA 4OXVA 2P0SA 1Y4TA 3IX1A 3T66A 5IKBA 5CM6A 2HAUA 5K2YA 1A55A 4IO4A 3M3KA 4DXCA 1MM6A 4IO5A 3FUZA 2DE2A 3FVOA 2GRVA 1LCTA 1XS5A 3DRFA 1ZKBA 4MFIA 5FHOA 4F19A 3GXAA 4GWOA 3D4CA 3M3LA 4F18A 4ZEKA 3KOSA 4FIMA 2H5YA 3RGYA 2RF1A 2O51A 4WEDA 1MXUA 1UIUA 5CRYA 1TXFA 1R9QA 3TTRA 5AA4A 4KYSA 1P1WA 3S2VA 4EXLA 1RKMA 3WAEA 2O69A 4NF6B 3CFLA 2XX7A 3GBAA 4KI0E 1URGA 2B3FA 1RYOA 4GVOA 4YB6A 4O3AA 1DTZA 1MQDA 4TOZA 3CIJA 1QUKA 3O29A 4PE5B 1B7ZA 3VE1B 1AL3A 2F78A 4DCXA 2XX8A 2DWHA 3CI8A 1NL5A 3QYTA 4U4XA 2X26A 1OLAA 3C32A 3M3FA 4H0WA 1MY2A 1J1NA 4ZEBA 3K02A 2V25A 4MH5A 3LC8A 4OYVA 3FVGA 4RA1A 1DOTA 5CMMA 4DE8A 5H8QB 2O84X 4OENA 4YMAA 3D4GA 3TQLA 4QRZA 1JW4A 1B0LA 1II5A 2XXUA 4ZZEA 2D5WA 3KFMA 1N7XA 3C34A 3MZ9A 1RYXA 1ZTYA 4WKMA 2Z22A 4U23A 3HSTA 4BDMA 2UVGA 1BP5A 2I6EA 1MY0A 3HN0A 1JVYA 2F7BA 2R6GE 3FASA 3N5LA 2NOOA 1M5CA 5EHSA 1IZ1A 4ZS9A 4LA9A 5TP9B 3UIFA 1LFIA 1LB9A 1XHYA 3HO7A 4THIA 1UTHB 4G68C 4YU0A 4PFTA 3KJ7A 4H5GA 4R74A 3DP6A 1A54A 5M2VA 3VV5A 1ANFA 3TKDA 4ISUA 3S9LC 5DVFA 3IOTA 1PB9A 1P99A 5DYHA 4MBPA 1UTBB 4RY1A 1LAGE 4QHQA 1XVXA 3SEVA 3PD8A 1S50A 3K0VA 5ITPA 3Q27A 1Q1KA 2F8DA 2F36A 2FYIA 3VXBA 1P1QA 4KQPA 2AIXA 1QULA 1R9LA 2XX9A 3JV9A 1B2HA 4ZEDA 2WOLA 5L8DA 1ZIUA 4YMBA 2GHBA 4IY6A 1MXZA 3B6TA 2DWAA 3RYBA 2B4MA 3K2DA 3K6WA 3MPLA 3FXRA 1GR2A 2ANJA 1XC1A 3IB2A 2DYXA 2QS1A 4UA8A 1A8FA 4NF8A 4O3BA 5CC2A 4F22A 3N26A 1MY4A 2Y7KA 3KGCA 1GV8A 1B4HA 3BFTA 3OOAA 1AIVA 4IGTA 3QIMA 3KN7A 1PC3A 2O6AA 1B6HA 3KZGA 1M5FA 2H25A 4OEVA 4EF2A 2XXYA 4DIGA 4NEDA 2DP8A 3PPPA 1KWHA 1SI1A 4DXBA 4PQJA 1GGGA 3PUVE 2LAOA 3V83A 4EQ9A 1MXXA 3KJTA 2XXWA 4IY5A 4LUBA 2PT2A 5ICTA 2Y7IA 2XXHA 5JTYA 2HAVA 1FTJA 4PP0A 4ZEFA 3T9VA 1H44A 3QSLA 5TPAA 1SBPA 1IQ7A 3SEWA 3FXQA 2ZNUA 4KCDA 3FGSA 1JW1A 3RT6B 4XIGQ 1MY1A 5B70A 1B1HA 4N13A 3RN8A 4JWXA 3VLWA 4ELOA 3G3IA 4G8NA 3FV2A 3WAFA 1YAEA 2Z8FA 2O7UA 2VOZA 4R2FA 2ONKE 2XXQA 2OLBA 4FE8A 4DCYA 3ONMA 3CFXA 4LZ5A 3FXUA 2DWJA 3UN6A 1NNPA 4OESA 2E1SA 2OJTA 3G3JA 4OZ9A 1B5HA 1IUDA 1FTKA 2NVUB 2OWTA 1VR5A 4PFWA 2V84A 3IJOB 2Z8DA 1HSEA 2I48A 1Z7NE 5I56A 3MAMA 3G3KA 4IO6A 4QFKA 4JSOA 2H99A 4GXSB 3S9NC 1VSOA 4ESXA 1B3FA 4ZE9A 4P11A 5I84A 4DXUA 3K01A 3S9EA 2HEUA 3RUMA 1JEUA 4KD5A 4YKIA 1A40A 5JK4A 2WOPA 1Y4CA 1B58A 3H6TA 1A8EA 4U21A 2DOJA 3EPEA 3MW0A 1MG1A 3MBPA 3MQ9A 2W7YA 4G68A 2XXXA 1ZBMA 5A5XB 3U94A 1UQWA 2QMXA 4X1DA 5H8FB 5KDTB 5IAIA 3RTFB 4QSEA 4F1VA 3O9PA 3E13X 4K3FA 3TZAA 2CZLA 4C1TA 4FORA 2OZZA 3K00A 3C35A 3G7WA 4FAJA 4XKPA 2D21A 4YICA 3VVDA 1SDXA 1B3EA 2I0CA 3O66A 4F29A 4ELRA 3N94A 1CE2A 3K1NA 3C9HA 3N6TA 4FEBA 3C4MA 1BIYA 1D9YA 2XXRA 3FZVA 4I9DA 3MUQA 5CMKA 4ELQA 4OWDA 1I6AA 4HTGA 4AB5A 5I2KA 1YTVA 3CG3A 2HZKA 3E9XA 3EHUA 3W15C 2ONSA 3U1OA 4F1UA 4GFRA 3RNNA 3E3KA 3EQ1A 5I57B 5I2NB 4U4SA 3MWBA 1XOCA 3KBRA 4NF4B 4ZE8A 5EYFA 5DVJA 1EZ9A 1TFDA 5H8NB 3OO9A 1FCKA 5KCJA 4H67A 5FTHA 1PB7A 1Y9UA 3TMGA 4OHNA 1BKAA 1MXYA 1ZJLA 1B4ZA 2NXOA 5CBRA 3EF7A 4OMBA 1T0KA 1US4A 1P1OA 4GOTA 2H4IA 1ZU0A 4R73A 1FTMA 1UIVA 4F3SA 4H8IA 1SW2A 2PMSA 4X1BA 2H98A 1SQYA 1YPNA 1AOVA 3BBRA 4QFOA 1SVXB 3QUFA 5AA4B 3TELA 3VVFA 2OBGA 2DE3A 2DSFA 3DLNA 2QL3A 1VFDA 4JXIA 3DP8A 1NKXA 4G77A 3K4UA 4GRKA 1QKBA 1A99A 2V3UA 5LOMA 1IXIA 1MH3A 3RYAA 5I59A 2HXWA 3IR1A 5ITOA 3TODA 3SEUA 1LFGA 1OIBA 1S9TA 1H3DA 3DRHA 3I5OA 2A5TA 1MH4A 4KYEA 3T96B 3U72A 3TTLA 5BWJA 3O6PA 3IB0A 3SEXA 3V89B 1FQBA 4Q30B 1EZOA 3LSXA 2VGQA 3FD3A 4YZZA 4QFLA 1IIWA 4R75A 1N7WA 4H65A 3CR9A 3SEYA 1B3GA 3PPNA 4F1YA 3P7IA 5I58A 3LUYA 3TQWA 1MDP1 3O6GA 1BLFA 2Q9TA 2F7CA 3G3GA 3MZ1A 3TCGA 4HS7A 2IA4A 3OXNA 4RJZA 3PGFA 1URSA 2O1MA 5L9SA 3Q28A 4G2ZA 1B52A 4Q5TA 2QJEA 4YKJA 1OQGA 2M8CA 1NMUA 3TCHA 3DRKA 1FTLA 3LVUA 5ELVA 2DWIA 4H8JA 3CHGA 3KN3A 4NMYA 1JEVA 3MVYA 3TTKA 2DS9A 1GTKA 2Y7WA 2F5XA 3U8QA 3FV1A 4JB7A 1DPEA 2RINA 1Y1ZA 5DVIA 4OERA 5FTIA 1L5TA 4ESWA 3I3VA 4ZDMA 3GZGA 2QS4A 1LAFE 1B46A 1TWYA 5AA2A 3A09A 2UVHA 1NFTA 5TU0A 4PETA 4NF8B 3QAXA 3FIRA 4XKRA 1Y20A 5CBSA 3THIA 2VD3A 4XTCQ 4DDDA 3SESA 2NUVA 4RYAA 4X48A 1B05A 4GD5A 1A7LA 3N6UA 1EH3A 1FQAA 1XVYA 3OD7A 3ZS6A 4I8CA 1QUJA 3RT8A 4YKPA 3MJNA 1YCJA 4FATA 1FQDA 4LQ5A 3U93A 2GHAA 2O7IA 4MLVA 4EXKA 5H8HA 1N04A 3S4UA 3TYHA 2GH9A 3VFJA 3H4ZA 4JDFA 5EHMA 1MM7A 5JTYB 1MQGA 2RC8A 3IAZA 3CVGA 4QFPA 3FATA 4PFUA 5TPAB 2WOKA 4OFJA 1OVTA 4JWOA 3IORA 4GQOA 2O1LA 4WXJA 1LSTA 1LFHA 2DVZA 3OEKA 3EN3A 2F97A 4ZECA 1IEJA 2YLNA 3VXCA 4TQUQ 3ILTB 3KEIA 4ONYA 5AA1A 3TDJA 5F7VA 4EUOA 1MDQA 2THIA 3T22A 3IL1B 4R6HA 2I49A 2AYSA 2ZYKA 2Q2CA 3RLFE 1LGBC 4RXLA 3MZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLU A;  3PPR A;  2Q2A A;  5I56 B;  4IB2 A;  3G3F A;  1Y3N A;  2RCB A;  3RTW B;  2F34 A;  1HSL A;  1N3W A;  4LQ2 A;  1B32 A;  4POX A;  1M5B A;  3CRB A;  2Z23 A;  5DEX A;  4YKK A;  3MVZ A;  4OFO A;  4LON B;  2QPQ A;  3MVX A;  4NWC A;  4Z0I A;  3LBS A;  2AL5 A;  4U2R A;  2HCA A;  1B40 A;  3ECR A;  1LAH E;  1PBP A;  4G68 B;  2DXY A;  2X7P A;  5HBC A;  4ECF A;  2F7A A;  1B5I A;  2UVI A;  3E4R A;  4R6K A;  2G29 A;  3PUW E;  2NWJ A;  1Q35 A;  3FVN A;  4U1Z A;  4BDL A;  4R9F A;  5B7D A;  2REG A;  4QSD A;  2XXI A;  1HSJ A;  5AA2 D;  4OEU A;  2QRY A;  3PUZ E;  4BLA A;  1LAX A;  3GLB A;  3O2A A;  1S7Y A;  1P1U A;  4N6P A;  3IOW A;  3C33 A;  4E0X A;  2I58 A;  1MQH A;  4GL0 A;  4Q0C A;  1B51 A;  4M4G A;  4KHZ E;  1SD3 A;  3RQT A;  3MC2 A;  4LZ7 A;  1PB8 A;  2QS2 A;  5I2K B;  2G93 A;  3A3C A;  3ILU B;  4EQ7 A;  5L9M A;  2ZYM A;  1OQH A;  1ATG A;  2ZNS A;  3OEN A;  3K6X A;  2Y7P A;  5FHM A;  1NNF A;  4XKQ A;  3TTN A;  3U92 A;  4WEP A;  2B65 A;  4F31 B;  4R2B A;  3EHT A;  1NNT A;  5KCJ B;  1QVS A;  4H1X A;  1AMF A;  1FW0 A;  1N3X A;  2HQ0 A;  3MVW A;  1N84 A;  1DMB A;  2P2A A;  2UYE A;  5F1Q A;  1MPD A;  4E0W A;  2YPN A;  3PUY E;  3PUX E;  2ZYO A;  3DEL B;  1MRP A;  3I6V A;  1USY H;  4HCW A;  3R6U A;  5AE4 A;  2HFB A;  4JBZ A;  3H6U A;  4F3B A;  3K1M A;  2GFE A;  3S9M C;  2I3V A;  4RNS A;  2F6P A;  5BUU A;  3MP6 A;  4U22 A;  3TTM A;  1OLC A;  5ICQ A;  3R26 A;  3HHG A;  4BDO A;  3VLV A;  4GLI A;  2O68 A;  2KLF A;  1DTG A;  4OQO A;  4OET A;  5KZT A;  1O64 A;  2VHA A;  4RPO A;  1O63 A;  1SYH A;  1EU8 A;  1LLS A;  3R7X A;  2ABH A;  1IXC A;  1TT1 A;  2OK2 A;  4BDN A;  4Q8R A;  1ZLQ A;  1QW0 A;  5I59 B;  2QSX A;  4KPT A;  3V5A A;  3HV1 A;  3LR1 A;  1FQC A;  1MY3 A;  2A5T B;  5CI5 A;  2Q89 A;  1F9B A;  2WKY A;  4F2Q A;  2UXA A;  1CB6 A;  1QUI A;  2BJJ X;  2YJP A;  3JYR A;  3L6G A;  3DRI A;  1TFA A;  3VVE A;  3OSR A;  1B5J A;  3H6V A;  4DLD A;  1FTO A;  3HHF A;  2ALU A;  3SER A;  1JQF A;  4NF6 A;  3B6W A;  2I4B A;  3IO6 A;  5I58 B;  1MS7 A;  2ESN A;  3H3G A;  1NH7 A;  4ZZA A;  2I0B A;  4FEC A;  2QMW A;  4IO7 A;  1PEB A;  2X7Q A;  3ZSF A;  1Y3Q A;  3SDF A;  2DVC A;  3FJ7 A;  2XHD A;  3C36 A;  2VD2 A;  4EDP A;  1B1X A;  2ZYN A;  4P0I A;  1Y3P A;  3LSF B;  3UOR A;  4N07 A;  1SW5 A;  1XT8 A;  2PX1 A;  5H8Q A;  2ZNT A;  4X9T A;  2FA7 A;  2XXV A;  3H03 A;  5HPQ A;  3IOU A;  4DZ1 A;  1MQI A;  4HW8 A;  1ZMG A;  4ND9 A;  3OO6 A;  3FJM A;  3W9V A;  3OEM A;  4LZ8 A;  4F39 A;  1POY 1;  5JEI A;  1LCF A;  4GXA A;  3V8X B;  3FJG A;  4NF5 B;  4ELP A;  3O97 A;  1D4N A;  1D3K A;  1QJM A;  3PPO A;  1DSN A;  2UYF A;  3Q25 A;  4I62 A;  3KSJ A;  4P0G A;  4JSD A;  5TP9 A;  2V3Q A;  4OFL A;  3CSG A;  3Q29 A;  2Q88 A;  5AA2 B;  1UTH A;  4NF5 A;  3T9X B;  3K6V A;  4GIZ A;  1Z7M E;  3K1P A;  5J1D A;  3H7M A;  3Q26 A;  1PDA A;  2Q8J A;  1I6Q A;  1FQE A;  4QSC A;  4LP2 B;  3ZKK A;  1M5D A;  1AH5 A;  3FTO A;  1UTB A;  1H45 A;  4C1U A;  1SW4 A;  3KN8 A;  2IEE A;  3L6H A;  2E0S A;  4UAC A;  1EZP A;  3RPW A;  2PBW A;  3UK4 A;  4YAH X;  1R6Z A;  4KCC A;  1JW5 A;  2AL4 A;  2FNC A;  2A5S A;  5H8H B;  1MXW A;  2R71 A;  2B4L A;  4G4P A;  4YB7 A;  3B7D A;  3H6W A;  1DPP A;  1VE4 A;  2F35 A;  3QK6 A;  4F3P A;  4NTL A;  5DT6 A;  4RK9 A;  1WVJ A;  4MF3 A;  1H76 A;  1H43 A;  5HM4 B;  3T9U A;  1OVB A;  3DP4 A;  4XKN A;  3SET A;  4KYD A;  1QKA A;  1WDN A;  3O6I A;  3QUJ A;  4GL8 A;  2ZMB A;  1LB8 A;  3SKP A;  4KFQ A;  3MPK A;  2I4C A;  1GVC A;  3CSB A;  3TPA A;  2ZXT A;  4U1O A;  4FED A;  1NNK A;  3T9H B;  4R9G A;  3OO7 A;  1B9J A;  1Y1M A;  5DTB A;  3KOT A;  3LSL A;  3T93 B;  1N76 A;  1SYI A;  2Y7R A;  4XXU A;  4TLL B;  3PV0 E;  2XD2 A;  4I1D A;  3PD9 A;  3GBB A;  4NWD A;  3QXM A;  3BKI B;  1BTJ A;  1I6B A;  2B3B A;  3F11 A;  1B0H A;  4BDQ A;  4NE4 A;  1R1N A;  5DEX B;  4F3G A;  1SW1 A;  4KR5 A;  4F2O A;  3CFZ A;  2RKM A;  1M5E A;  3W9W A;  4MLQ A;  5FHN A;  3DRJ A;  3HCQ A;  1IXH A;  1PBQ A;  3CG1 A;  1LBB A;  1O7T A;  3OEL A;  3IO4 A;  2VP1 A;  4QF9 A;  4TLM B;  1LBC A;  2V3T A;  1SI0 A;  1FQF A;  3MP8 A;  3TUS A;  5K2X A;  4G8H A;  2XXP A;  2XXT A;  3UGW A;  2D3I A;  1WOD A;  4IO2 A;  3RY3 A;  4M1V A;  3TFL A;  2H9B A;  2RC9 A;  4FJP A;  3OO8 A;  2F6G A;  4RK2 A;  3UP9 A;  4QFN A;  4EF1 A;  4ZEI A;  3UA8 A;  4BDR A;  5CMB A;  4IO3 A;  4C0R A;  3ZKL A;  4HCY A;  4GF8 A;  1N0T A;  4Z7E A;  1B7H A;  1IIT A;  3O28 A;  3AXF A;  3PPQ A;  3O6H A;  3KSX A;  2R9J A;  4L17 A;  5L9O A;  1POT A;  2REJ A;  4RPN A;  3HPI A;  1NH8 A;  3H06 B;  3JZJ A;  2PVU A;  3DM0 A;  2HZL A;  3VDF A;  3BFU A;  2DE4 A;  3G3H A;  3IJX B;  3MP1 A;  3M8U A;  4AQ4 A;  2DQV A;  3B6Q A;  5A5X A;  2V93 A;  5H8F A;  1P1N A;  5KDT A;  3OSQ A;  2ONR A;  2CMO A;  2UVJ A;  3DRG A;  5CMC A;  2XD3 A;  2PYY A;  4OVJ A;  4EQB A;  2RC7 A;  3K6U A;  2OCU A;  3LSW A;  2Y84 A;  1MQJ A;  2OWS A;  3USD A;  4POW A;  3PAM A;  3IOV A;  3PU5 A;  4G8M A;  3A3U A;  3TCF A;  3KG2 A;  4LVQ A;  3FVK A;  1MPB A;  1URD A;  4JWY A;  1B7U A;  1B3H A;  2DXR A;  1JVX A;  2P1S A;  1JNF A;  4IGR A;  3PMV A;  1MXV A;  5ISU A;  1USY E;  3EHS A;  3PMX A;  3IB1 A;  3C31 A;  4R6Y A;  3TEP A;  2QS3 A;  1B3L A;  4PFY A;  5H8S A;  3TAJ A;  2I3W A;  1US5 A;  1VFE A;  2RCA A;  4O3C A;  1D9V A;  1I69 A;  2Z8E A;  3ODB A;  4LAT A;  5AA3 A;  3OMB A;  3PMW A;  4YB5 A;  5I57 A;  1JET A;  4H6D A;  1OMP A;  5I2N A;  1MPC A;  4H5F A;  4AB6 A;  4NF4 A;  4OTE A;  1IXG A;  2PT1 A;  4R72 A;  3IK6 B;  5H8N A;  1ELJ A;  4OXV A;  2P0S A;  1Y4T A;  3IX1 A;  3T66 A;  5IKB A;  5CM6 A;  2HAU A;  5K2Y A;  1A55 A;  4IO4 A;  3M3K A;  4DXC A;  1MM6 A;  4IO5 A;  3FUZ A;  2DE2 A;  3FVO A;  2GRV A;  1LCT A;  1XS5 A;  3DRF A;  1ZKB A;  4MFI A;  5FHO A;  4F19 A;  3GXA A;  4GWO A;  3D4C A;  3M3L A;  4F18 A;  4ZEK A;  3KOS A;  4FIM A;  2H5Y A;  3RGY A;  2RF1 A;  2O51 A;  4WED A;  1MXU A;  1UIU A;  5CRY A;  1TXF A;  1R9Q A;  3TTR A;  5AA4 A;  4KYS A;  1P1W A;  3S2V A;  4EXL A;  1RKM A;  3WAE A;  2O69 A;  4NF6 B;  3CFL A;  2XX7 A;  3GBA A;  4KI0 E;  1URG A;  2B3F A;  1RYO A;  4GVO A;  4YB6 A;  4O3A A;  1DTZ A;  1MQD A;  4TOZ A;  3CIJ A;  1QUK A;  3O29 A;  4PE5 B;  1B7Z A;  3VE1 B;  1AL3 A;  2F78 A;  4DCX A;  2XX8 A;  2DWH A;  3CI8 A;  1NL5 A;  3QYT A;  4U4X A;  2X26 A;  1OLA A;  3C32 A;  3M3F A;  4H0W A;  1MY2 A;  1J1N A;  4ZEB A;  3K02 A;  2V25 A;  4MH5 A;  3LC8 A;  4OYV A;  3FVG A;  4RA1 A;  1DOT A;  5CMM A;  4DE8 A;  5H8Q B;  2O84 X;  4OEN A;  4YMA A;  3D4G A;  3TQL A;  4QRZ A;  1JW4 A;  1B0L A;  1II5 A;  2XXU A;  4ZZE A;  2D5W A;  3KFM A;  1N7X A;  3C34 A;  3MZ9 A;  1RYX A;  1ZTY A;  4WKM A;  2Z22 A;  4U23 A;  3HST A;  4BDM A;  2UVG A;  1BP5 A;  2I6E A;  1MY0 A;  3HN0 A;  1JVY A;  2F7B A;  2R6G E;  3FAS A;  3N5L A;  2NOO A;  1M5C A;  5EHS A;  1IZ1 A;  4ZS9 A;  4LA9 A;  5TP9 B;  3UIF A;  1LFI A;  1LB9 A;  1XHY A;  3HO7 A;  4THI A;  1UTH B;  4G68 C;  4YU0 A;  4PFT A;  3KJ7 A;  4H5G A;  4R74 A;  3DP6 A;  1A54 A;  5M2V A;  3VV5 A;  1ANF A;  3TKD A;  4ISU A;  3S9L C;  5DVF A;  3IOT A;  1PB9 A;  1P99 A;  5DYH A;  4MBP A;  1UTB B;  4RY1 A;  1LAG E;  4QHQ A;  1XVX A;  3SEV A;  3PD8 A;  1S50 A;  3K0V A;  5ITP A;  3Q27 A;  1Q1K A;  2F8D A;  2F36 A;  2FYI A;  3VXB A;  1P1Q A;  4KQP A;  2AIX A;  1QUL A;  1R9L A;  2XX9 A;  3JV9 A;  1B2H A;  4ZED A;  2WOL A;  5L8D A;  1ZIU A;  4YMB A;  2GHB A;  4IY6 A;  1MXZ A;  3B6T A;  2DWA A;  3RYB A;  2B4M A;  3K2D A;  3K6W A;  3MPL A;  3FXR A;  1GR2 A;  2ANJ A;  1XC1 A;  3IB2 A;  2DYX A;  2QS1 A;  4UA8 A;  1A8F A;  4NF8 A;  4O3B A;  5CC2 A;  4F22 A;  3N26 A;  1MY4 A;  2Y7K A;  3KGC A;  1GV8 A;  1B4H A;  3BFT A;  3OOA A;  1AIV A;  4IGT A;  3QIM A;  3KN7 A;  1PC3 A;  2O6A A;  1B6H A;  3KZG A;  1M5F A;  2H25 A;  4OEV A;  4EF2 A;  2XXY A;  4DIG A;  4NED A;  2DP8 A;  3PPP A;  1KWH A;  1SI1 A;  4DXB A;  4PQJ A;  1GGG A;  3PUV E;  2LAO A;  3V83 A;  4EQ9 A;  1MXX A;  3KJT A;  2XXW A;  4IY5 A;  4LUB A;  2PT2 A;  5ICT A;  2Y7I A;  2XXH A;  5JTY A;  2HAV A;  1FTJ A;  4PP0 A;  4ZEF A;  3T9V A;  1H44 A;  3QSL A;  5TPA A;  1SBP A;  1IQ7 A;  3SEW A;  3FXQ A;  2ZNU A;  4KCD A;  3FGS A;  1JW1 A;  3RT6 B;  4XIG Q;  1MY1 A;  5B70 A;  1B1H A;  4N13 A;  3RN8 A;  4JWX A;  3VLW A;  4ELO A;  3G3I A;  4G8N A;  3FV2 A;  3WAF A;  1YAE A;  2Z8F A;  2O7U A;  2VOZ A;  4R2F A;  2ONK E;  2XXQ A;  2OLB A;  4FE8 A;  4DCY A;  3ONM A;  3CFX A;  4LZ5 A;  3FXU A;  2DWJ A;  3UN6 A;  1NNP A;  4OES A;  2E1S A;  2OJT A;  3G3J A;  4OZ9 A;  1B5H A;  1IUD A;  1FTK A;  2NVU B;  2OWT A;  1VR5 A;  4PFW A;  2V84 A;  3IJO B;  2Z8D A;  1HSE A;  2I48 A;  1Z7N E;  5I56 A;  3MAM A;  3G3K A;  4IO6 A;  4QFK A;  4JSO A;  2H99 A;  4GXS B;  3S9N C;  1VSO A;  4ESX A;  1B3F A;  4ZE9 A;  4P11 A;  5I84 A;  4DXU A;  3K01 A;  3S9E A;  2HEU A;  3RUM A;  1JEU A;  4KD5 A;  4YKI A;  1A40 A;  5JK4 A;  2WOP A;  1Y4C A;  1B58 A;  3H6T A;  1A8E A;  4U21 A;  2DOJ A;  3EPE A;  3MW0 A;  1MG1 A;  3MBP A;  3MQ9 A;  2W7Y A;  4G68 A;  2XXX A;  1ZBM A;  5A5X B;  3U94 A;  1UQW A;  2QMX A;  4X1D A;  5H8F B;  5KDT B;  5IAI A;  3RTF B;  4QSE A;  4F1V A;  3O9P A;  3E13 X;  4K3F A;  3TZA A;  2CZL A;  4C1T A;  4FOR A;  2OZZ A;  3K00 A;  3C35 A;  3G7W A;  4FAJ A;  4XKP A;  2D21 A;  4YIC A;  3VVD A;  1SDX A;  1B3E A;  2I0C A;  3O66 A;  4F29 A;  4ELR A;  3N94 A;  1CE2 A;  3K1N A;  3C9H A;  3N6T A;  4FEB A;  3C4M A;  1BIY A;  1D9Y A;  2XXR A;  3FZV A;  4I9D A;  3MUQ A;  5CMK A;  4ELQ A;  4OWD A;  1I6A A;  4HTG A;  4AB5 A;  5I2K A;  1YTV A;  3CG3 A;  2HZK A;  3E9X A;  3EHU A;  3W15 C;  2ONS A;  3U1O A;  4F1U A;  4GFR A;  3RNN A;  3E3K A;  3EQ1 A;  5I57 B;  5I2N B;  4U4S A;  3MWB A;  1XOC A;  3KBR A;  4NF4 B;  4ZE8 A;  5EYF A;  5DVJ A;  1EZ9 A;  1TFD A;  5H8N B;  3OO9 A;  1FCK A;  5KCJ A;  4H67 A;  5FTH A;  1PB7 A;  1Y9U A;  3TMG A;  4OHN A;  1BKA A;  1MXY A;  1ZJL A;  1B4Z A;  2NXO A;  5CBR A;  3EF7 A;  4OMB A;  1T0K A;  1US4 A;  1P1O A;  4GOT A;  2H4I A;  1ZU0 A;  4R73 A;  1FTM A;  1UIV A;  4F3S A;  4H8I A;  1SW2 A;  2PMS A;  4X1B A;  2H98 A;  1SQY A;  1YPN A;  1AOV A;  3BBR A;  4QFO A;  1SVX B;  3QUF A;  5AA4 B;  3TEL A;  3VVF A;  2OBG A;  2DE3 A;  2DSF A;  3DLN A;  2QL3 A;  1VFD A;  4JXI A;  3DP8 A;  1NKX A;  4G77 A;  3K4U A;  4GRK A;  1QKB A;  1A99 A;  2V3U A;  5LOM A;  1IXI A;  1MH3 A;  3RYA A;  5I59 A;  2HXW A;  3IR1 A;  5ITO A;  3TOD A;  3SEU A;  1LFG A;  1OIB A;  1S9T A;  1H3D A;  3DRH A;  3I5O A;  2A5T A;  1MH4 A;  4KYE A;  3T96 B;  3U72 A;  3TTL A;  5BWJ A;  3O6P A;  3IB0 A;  3SEX A;  3V89 B;  1FQB A;  4Q30 B;  1EZO A;  3LSX A;  2VGQ A;  3FD3 A;  4YZZ A;  4QFL A;  1IIW A;  4R75 A;  1N7W A;  4H65 A;  3CR9 A;  3SEY A;  1B3G A;  3PPN A;  4F1Y A;  3P7I A;  5I58 A;  3LUY A;  3TQW A;  1MDP 1;  3O6G A;  1BLF A;  2Q9T A;  2F7C A;  3G3G A;  3MZ1 A;  3TCG A;  4HS7 A;  2IA4 A;  3OXN A;  4RJZ A;  3PGF A;  1URS A;  2O1M A;  5L9S A;  3Q28 A;  4G2Z A;  1B52 A;  4Q5T A;  2QJE A;  4YKJ A;  1OQG A;  2M8C A;  1NMU A;  3TCH A;  3DRK A;  1FTL A;  3LVU A;  5ELV A;  2DWI A;  4H8J A;  3CHG A;  3KN3 A;  4NMY A;  1JEV A;  3MVY A;  3TTK A;  2DS9 A;  1GTK A;  2Y7W A;  2F5X A;  3U8Q A;  3FV1 A;  4JB7 A;  1DPE A;  2RIN A;  1Y1Z A;  5DVI A;  4OER A;  5FTI A;  1L5T A;  4ESW A;  3I3V A;  4ZDM A;  3GZG A;  2QS4 A;  1LAF E;  1B46 A;  1TWY A;  5AA2 A;  3A09 A;  2UVH A;  1NFT A;  5TU0 A;  4PET A;  4NF8 B;  3QAX A;  3FIR A;  4XKR A;  1Y20 A;  5CBS A;  3THI A;  2VD3 A;  4XTC Q;  4DDD A;  3SES A;  2NUV A;  4RYA A;  4X48 A;  1B05 A;  4GD5 A;  1A7L A;  3N6U A;  1EH3 A;  1FQA A;  1XVY A;  3OD7 A;  3ZS6 A;  4I8C A;  1QUJ A;  3RT8 A;  4YKP A;  3MJN A;  1YCJ A;  4FAT A;  1FQD A;  4LQ5 A;  3U93 A;  2GHA A;  2O7I A;  4MLV A;  4EXK A;  5H8H A;  1N04 A;  3S4U A;  3TYH A;  2GH9 A;  3VFJ A;  3H4Z A;  4JDF A;  5EHM A;  1MM7 A;  5JTY B;  1MQG A;  2RC8 A;  3IAZ A;  3CVG A;  4QFP A;  3FAT A;  4PFU A;  5TPA B;  2WOK A;  4OFJ A;  1OVT A;  4JWO A;  3IOR A;  4GQO A;  2O1L A;  4WXJ A;  1LST A;  1LFH A;  2DVZ A;  3OEK A;  3EN3 A;  2F97 A;  4ZEC A;  1IEJ A;  2YLN A;  3VXC A;  4TQU Q;  3ILT B;  3KEI A;  4ONY A;  5AA1 A;  3TDJ A;  5F7V A;  4EUO A;  1MDQ A;  2THI A;  3T22 A;  3IL1 B;  4R6H A;  2I49 A;  2AYS A;  2ZYK A;  2Q2C A;  3RLF E;  1LGB C;  4RXL A;  3MZB A; 
#chains in the Genus database with same CATH topology
 3VLU A;  3PPR A;  2Q2A A;  1K9Y A;  5I56 B;  4IB2 A;  3G3F A;  1Y3N A;  4P3L A;  2RCB A;  2FIX A;  4PAI A;  3RTW B;  2F34 A;  1HSL A;  1N3W A;  4LQ2 A;  1B32 A;  1FPE A;  4POX A;  1M5B A;  3CRB A;  2Z23 A;  5DEX A;  4YKK A;  3MVZ A;  4OFO A;  4LON B;  2QPQ A;  3MVX A;  4NWC A;  3IFC A;  4Z0I A;  3LBS A;  2AL5 A;  4U2R A;  2HCA A;  1B40 A;  3ECR A;  4N6K A;  1LAH E;  1PBP A;  4G68 B;  2DXY A;  2X7P A;  5HBC A;  4ECF A;  2F7A A;  1B5I A;  2UVI A;  3E4R A;  5IZ3 B;  4R6K A;  2G29 A;  3PUW E;  2KR0 A;  1Q35 A;  4NG7 A;  3FVN A;  2NWJ A;  4U1Z A;  4BDL A;  5EQ7 A;  4R9F A;  5B7D A;  2REG A;  4QSD A;  2XXI A;  1HSJ A;  4LN5 A;  5AA2 D;  4XEQ A;  4OEU A;  2QRY A;  3PUZ E;  4BLA A;  1LAX A;  3GLB A;  3O2A A;  4NGU A;  1S7Y A;  1P1U A;  4N6P A;  3IOW A;  3HFU A;  3C33 A;  4E0X A;  2I58 A;  1MQH A;  4GL0 A;  4Q0C A;  1B51 A;  4M4G A;  4KHZ E;  1SD3 A;  3RQT A;  3MC2 A;  4LZ7 A;  1PB8 A;  2QS2 A;  5T3J A;  5I2K B;  4XF5 A;  2G93 A;  3A3C A;  2WBD A;  3ILU B;  4EQ7 A;  5L9M A;  2ZYM A;  1OQH A;  1ATG A;  2ZNS A;  3OEN A;  3K6X A;  2Y7P A;  5FHM A;  1NNF A;  4NX1 A;  4XKQ A;  3TTN A;  5EQ9 A;  3U92 A;  4WEP A;  2B65 A;  1NV0 A;  4HXV A;  4F31 B;  4R2B A;  3EHT A;  1NNT A;  5KCJ B;  5F24 A;  1QVS A;  4H1X A;  1AMF A;  1FW0 A;  1N3X A;  2HQ0 A;  3MVW A;  1N84 A;  1DMB A;  3E78 A;  2P2A A;  2UYE A;  5F1Q A;  1MPD A;  4E0W A;  2YPN A;  3PUY E;  3PUX E;  2ZYO A;  3DEL B;  1MRP A;  3I6V A;  1USY H;  4HCW A;  3R6U A;  1IMC A;  5AE4 A;  2HFB A;  2WX9 A;  4JBZ A;  3H6U A;  4F3B A;  3K1M A;  2GFE A;  3S9M C;  2I3V A;  1EYJ A;  4RNS A;  1NV4 A;  1SPI A;  2F6P A;  4HE0 A;  2CEY A;  5BUU A;  3MP6 A;  4U22 A;  3TTM A;  1OLC A;  5ICQ A;  4G61 A;  3R26 A;  3HHG A;  4BDO A;  1FBD A;  3VLV A;  2ZZX A;  4GLI A;  2O68 A;  2KLF A;  1DTG A;  4OQO A;  4OET A;  5KZT A;  1O64 A;  2VHA A;  4RPO A;  1O63 A;  1SYH A;  1EU8 A;  1LLS A;  1NV7 A;  1EYI A;  3R7X A;  1FBP A;  1IXC A;  2ABH A;  1TT1 A;  2OK2 A;  4BDN A;  4Q8R A;  1ZLQ A;  1QW0 A;  5I59 B;  3SZP A;  1LEV A;  2QSX A;  4KPT A;  4P1E A;  3V5A A;  3HV1 A;  3LR1 A;  1FQC A;  1MY3 A;  2A5T B;  5CI5 A;  2Q89 A;  1F9B A;  3KBZ A;  2WKY A;  4F2Q A;  1RDZ A;  2UXA A;  1CB6 A;  2F3D A;  1QUI A;  2BJJ X;  2YJP A;  3JYR A;  1NV3 A;  3L6G A;  3DRI A;  1TFA A;  4HE2 A;  3VVE A;  3OSR A;  1B5J A;  3H6V A;  4DLD A;  1FTO A;  3HHF A;  4N8G A;  2ALU A;  1DCU A;  3SER A;  1JQF A;  4GWW A;  4NF6 A;  3B6W A;  2I4B A;  2Y5K A;  3IO6 A;  5I58 B;  4NQ8 A;  5I7I A;  1MS7 A;  2ESN A;  3H3G A;  1NH7 A;  4ZZA A;  2I0B A;  4FEC A;  2QMW A;  4IO7 A;  1PEB A;  2X7Q A;  3ZSF A;  1Y3Q A;  3SDF A;  2DVC A;  3FJ7 A;  2XHD A;  3C36 A;  2VD2 A;  4EDP A;  1B1X A;  3RPL B;  3EKI A;  4XFE A;  2ZYN A;  4P0I A;  1Y3P A;  3LSF B;  5A5L A;  3UOR A;  4N07 A;  1FPK A;  1SW5 A;  1XT8 A;  2PX1 A;  4X8R A;  5H8Q A;  2HHM A;  4MCO A;  2ZNT A;  4NHB A;  4X9T A;  2FA7 A;  2XXV A;  1FPI A;  3H03 A;  5HPQ A;  3IOU A;  4DZ1 A;  1MQI A;  4HW8 A;  1QGX A;  1ZMG A;  2GQ1 A;  4ND9 A;  5EQ8 A;  3OO6 A;  2VPN A;  3FJM A;  3W9V A;  3OEM A;  4LZ8 A;  4F39 A;  1POY 1;  5JEI A;  1LCF A;  4GXA A;  3V8X B;  3FJG A;  4NF5 B;  4ELP A;  3O97 A;  4PFI A;  1D4N A;  4GWY A;  1D3K A;  1QJM A;  3PPO A;  1DSN A;  2UYF A;  4P0G A;  3Q25 A;  3KSJ A;  4I62 A;  4JSD A;  5TP9 A;  2V3Q A;  4OFL A;  4MNP A;  3B50 A;  3CSG A;  3Q29 A;  2Q88 A;  5AA2 B;  1UTH A;  4NF5 A;  3T9X B;  3K6V A;  4GIZ A;  1Z7M E;  4JVC A;  3K1P A;  5J1D A;  3H7M A;  3Q26 A;  1PDA A;  2Q8J A;  1I6Q A;  5IGA A;  1FQE A;  4QSC A;  1NUY A;  4LP2 B;  1M5D A;  3ZKK A;  1AH5 A;  3FTO A;  1UTB A;  1VDW A;  1H45 A;  4C1U A;  5IZZ A;  1SW4 A;  3KN8 A;  4PAK A;  3GYY A;  2IEE A;  3L6H A;  4P1L A;  2E0S A;  4UAC A;  1EZP A;  5ET8 A;  3RPW A;  2PBW A;  3UK4 A;  4YAH X;  1R6Z A;  4KCC A;  1JW5 A;  2AL4 A;  2FNC A;  2Y5L A;  2A5S A;  5H8H B;  1MXW A;  1IMD A;  3NOH A;  2R71 A;  2B4L A;  4G4P A;  4YB7 A;  3B7D A;  3H6W A;  1DPP A;  1IMA A;  4GBV A;  1VE4 A;  2F35 A;  2FIE A;  3QK6 A;  4F3P A;  4NTL A;  5DT6 A;  4RK9 A;  1WVJ A;  4MF3 A;  1H76 A;  3BIH A;  1H43 A;  5HM4 B;  3T9U A;  1OVB A;  3DP4 A;  4XKN A;  4OVR A;  2BJI A;  3SET A;  4KYD A;  1QKA A;  1WDN A;  4O8M A;  3O6I A;  3T0J A;  3QUJ A;  4GL8 A;  4MNI A;  4IR8 A;  2ZMB A;  1NV2 A;  1LB8 A;  3SKP A;  4KFQ A;  3MPK A;  2I4C A;  3B8B A;  1GVC A;  3CSB A;  4H46 A;  1IMF A;  3TPA A;  2ZXT A;  4U1O A;  3RYD A;  3QMF A;  4FED A;  2QVR A;  1NNK A;  1XI6 A;  3T9H B;  1G0H A;  4R9G A;  4PC9 A;  3OO7 A;  1B9J A;  1CNQ A;  1Y1M A;  5DTB A;  3KOT A;  3LSL A;  3T93 B;  1N76 A;  1SYI A;  2Y7R A;  5EYH A;  4XXU A;  4TLL B;  3PV0 E;  2XD2 A;  1INP A;  4H45 A;  4I1D A;  3IFA A;  3PD9 A;  3GBB A;  2DDK A;  4NWD A;  3QXM A;  2QVV A;  3BKI B;  1BTJ A;  1I6B A;  2B3B A;  4PCD A;  4DI4 B;  3F11 A;  4OVQ A;  1B0H A;  4BDQ A;  4NE4 A;  1IME A;  2CZH A;  1R1N A;  5DEX B;  4F3G A;  1SW1 A;  4KR5 A;  4MAG A;  4F2O A;  2FBP A;  3CFZ A;  2RKM A;  1M5E A;  4N91 A;  4I3E A;  3W9W A;  4MLQ A;  5FHN A;  1Q9D A;  3DRJ A;  4PF8 A;  3HCQ A;  1IXH A;  1PBQ A;  3CG1 A;  1LBB A;  1O7T A;  3OEL A;  3IO4 A;  2VP1 A;  4QF9 A;  4TLM B;  1LBC A;  2V3T A;  1SI0 A;  1FQF A;  3MP8 A;  4MNC A;  2MKZ A;  3TUS A;  5K2X A;  4G8H A;  1AWB A;  2XXP A;  2XXT A;  3MST A;  3UGW A;  2D3I A;  1WOD A;  4IO2 A;  3RY3 A;  4M1V A;  3TFL A;  2H9B A;  2RC9 A;  4FJP A;  3OO8 A;  2F6G A;  4RK2 A;  3UP9 A;  4QFN A;  4EF1 A;  4ZEI A;  3UA8 A;  4BDR A;  5CMB A;  4IO3 A;  4C0R A;  3ZKL A;  4HCY A;  1K9Z A;  4GF8 A;  1N0T A;  4GX4 A;  4Z7E A;  1B7H A;  1IIT A;  3O28 A;  3AXF A;  3PPQ A;  3O6H A;  2XWO A;  3KSX A;  2R9J A;  4L17 A;  5L9O A;  1NV6 A;  1POT A;  3T1B A;  1FPB A;  2REJ A;  2VPO A;  4N17 A;  4RPN A;  3HPI A;  1NH8 A;  3H06 B;  3JZJ A;  2PVU A;  1KA1 A;  3DM0 A;  2HZL A;  3VDF A;  3BFU A;  2DE4 A;  3G3H A;  3IJX B;  3MP1 A;  3M8U A;  4AQ4 A;  2DQV A;  3B6Q A;  5A5X A;  5LTC A;  2V93 A;  5H8F A;  1P1N A;  3KC1 A;  5KDT A;  5I5P A;  3OSQ A;  4AS4 A;  2ONR A;  2CMO A;  2UVJ A;  3DRG A;  4GWZ A;  5CMC A;  2XD3 A;  2PYY A;  4OVJ A;  4EQB A;  2RC7 A;  3K6U A;  2OCU A;  3LSW A;  2Y84 A;  4N6D A;  1MQJ A;  2OWS A;  3USD A;  4OVP A;  4POW A;  3PAM A;  3IOV A;  3PU5 A;  4G8M A;  4GWU A;  3A3U A;  3TCF A;  3KG2 A;  4LVQ A;  3FVK A;  1MPB A;  1URD A;  4JWY A;  1B7U A;  1B3H A;  2DXR A;  1JVX A;  2P1S A;  1JNF A;  4IGR A;  3PMV A;  1MXV A;  5ISU A;  1USY E;  3EHS A;  3PMX A;  3IB1 A;  3C31 A;  4R6Y A;  3TEP A;  2QS3 A;  1B3L A;  4PFY A;  5H8S A;  3TAJ A;  2I3W A;  1US5 A;  1VFE A;  2RCA A;  4O3C A;  1D9V A;  2CEX A;  2P3V A;  1I69 A;  2Z8E A;  3ODB A;  4LAT A;  5AA3 A;  3OMB A;  3PMW A;  4YB5 A;  1G0I A;  5I57 A;  1JET A;  4H6D A;  1OMP A;  5I2N A;  1YYZ A;  4P56 A;  1FBE A;  1MPC A;  4MEV A;  4H5F A;  4AB6 A;  4NF4 A;  4OTE A;  1KA0 A;  4PF6 A;  1IXG A;  2PT1 A;  4R72 A;  3IK6 B;  2PCR A;  5H8N A;  1ELJ A;  4OXV A;  2P0S A;  1Y4T A;  3IX1 A;  3T66 A;  5IKB A;  5CM6 A;  2HAU A;  5K2Y A;  1A55 A;  4IO4 A;  3M3K A;  4DXC A;  1MM6 A;  4IO5 A;  3FUZ A;  2DE2 A;  3FVO A;  2GRV A;  1LCT A;  1XS5 A;  4GX3 A;  3DRF A;  1ZKB A;  4MFI A;  5FHO A;  4F19 A;  3GXA A;  4GWO A;  3D4C A;  3M3L A;  4F18 A;  4ZEK A;  3KOS A;  4FIM A;  2WYP A;  2H5Y A;  3RGY A;  2RF1 A;  2O51 A;  4WED A;  1MXU A;  3MYU A;  1UIU A;  5CRY A;  1TXF A;  1R9Q A;  3TTR A;  5AA4 A;  4KYS A;  1P1W A;  3S2V A;  4EXL A;  1RKM A;  4PBH A;  3WAE A;  2O69 A;  4DI3 D;  4NF6 B;  3CFL A;  4OA4 A;  2XX7 A;  3GBA A;  4KI0 E;  1FPG A;  5ESY A;  5FBP A;  1URG A;  2B3F A;  1RYO A;  4GVO A;  4YB6 A;  4O3A A;  1DTZ A;  1MQD A;  4TOZ A;  3CIJ A;  1QUK A;  3O29 A;  4PE5 B;  1B7Z A;  3VE1 B;  1AL3 A;  2XA5 A;  2F78 A;  4NN3 A;  4DCX A;  2XX8 A;  2DWH A;  3CI8 A;  4NAP A;  4N81 A;  1NL5 A;  3QYT A;  4U4X A;  2X26 A;  1OLA A;  3C32 A;  3M3F A;  4H0W A;  1MY2 A;  1J1N A;  4ZEB A;  3K02 A;  2V25 A;  4MH5 A;  3LC8 A;  4OYV A;  3FVG A;  4RA1 A;  1DOT A;  3FXB A;  5CMM A;  4DE8 A;  5H8Q B;  2O84 X;  2PFY A;  4O7I A;  4OEN A;  4YMA A;  2XXK A;  3D4G A;  3TQL A;  2FHY A;  4QRZ A;  1JW4 A;  1FBH A;  1B0L A;  1II5 A;  2XXU A;  4ZZE A;  2D5W A;  3KFM A;  1N7X A;  3D1R A;  3C34 A;  3MZ9 A;  1RYX A;  1ZTY A;  4P8B A;  4WKM A;  2Z22 A;  4U23 A;  3HST A;  4BDM A;  2UVG A;  3PTY A;  1BP5 A;  2I6E A;  1MY0 A;  3HN0 A;  1JVY A;  2F7B A;  3ROJ A;  4OVS A;  2R6G E;  3FAS A;  3N5L A;  2NOO A;  1M5C A;  5EHS A;  4PE3 A;  1IZ1 A;  4ZS9 A;  4LA9 A;  5TP9 B;  3UIF A;  1LFI A;  1LB9 A;  4I3Y A;  1XHY A;  1FJ9 A;  3BIG A;  3HO7 A;  4THI A;  1UTH B;  4G68 C;  4YU0 A;  4PFT A;  3KJ7 A;  4H5G A;  4R74 A;  3DP6 A;  1A54 A;  5M2V A;  3VV5 A;  1ANF A;  3TKD A;  4ISU A;  3S9L C;  5DVF A;  4N8Y A;  1FBF A;  3IOT A;  1PB9 A;  1P99 A;  5DYH A;  4MBP A;  1UTB B;  4RY1 A;  1LAG E;  4QHQ A;  1XVX A;  3SEV A;  3PD8 A;  1S50 A;  3K0V A;  5ITP A;  1RDX A;  3Q27 A;  1Q1K A;  2F8D A;  2F36 A;  2FYI A;  3VXB A;  1P1Q A;  4KQP A;  2AIX A;  1QUL A;  1R9L A;  2XX9 A;  3JV9 A;  1B2H A;  1NUW A;  4ZED A;  2WOL A;  5L8D A;  1ZIU A;  4YMB A;  2GHB A;  4IY6 A;  1MXZ A;  3B6T A;  2VT5 A;  2DWA A;  3RYB A;  2B4M A;  3K2D A;  3K6W A;  3MPL A;  4PBQ A;  3FXR A;  1GR2 A;  2ANJ A;  1XC1 A;  3IB2 A;  2DYX A;  2QS1 A;  4UA8 A;  1A8F A;  4NF8 A;  4O3B A;  5CC2 A;  4F22 A;  3N26 A;  1MY4 A;  5I3S A;  2Y7K A;  3KGC A;  1GV8 A;  4UAB A;  2Q74 A;  1B4H A;  2QVU A;  3BFT A;  3OOA A;  1AIV A;  1D9Q A;  1FSA A;  4IGT A;  3QIM A;  3KN7 A;  1PC3 A;  2O6A A;  1B6H A;  3KZG A;  1M5F A;  2H25 A;  4OEV A;  4EF2 A;  2XXY A;  4DIG A;  4NED A;  2DP8 A;  3PPP A;  1KWH A;  1SI1 A;  3ISP A;  4DXB A;  4PQJ A;  1GGG A;  3PUV E;  2LAO A;  4JVD A;  4GWS A;  1LBZ A;  3V83 A;  4EQ9 A;  1MXX A;  4PDH A;  3KJT A;  2XXW A;  4IY5 A;  4LUB A;  2PT2 A;  5ICT A;  2Y7I A;  3U65 A;  2XXH A;  5JTY A;  2HAV A;  1FTJ A;  4PP0 A;  2WYK A;  4ZEF A;  3T9V A;  1H44 A;  3QSL A;  1SBP A;  5TPA A;  1IQ7 A;  3SEW A;  3FXQ A;  4NF0 A;  2ZNU A;  4KCD A;  1RDY A;  3FGS A;  1JW1 A;  3RT6 B;  4XIG Q;  1MY1 A;  5B70 A;  1B1H A;  1DK4 A;  2L5V A;  4N13 A;  3RN8 A;  4JWX A;  3VLW A;  4ELO A;  3G3I A;  4G8N A;  4MIJ A;  2XWK A;  3FV2 A;  2XWV A;  3WAF A;  1YAE A;  2Z8F A;  2O7U A;  2VOZ A;  4R2F A;  2ONK E;  2XXQ A;  2OLB A;  4FE8 A;  4DCY A;  3ONM A;  1FPF A;  3CFX A;  4LZ5 A;  1BK4 A;  5IM2 A;  3FXU A;  2DWJ A;  2XWI A;  3UN6 A;  1NNP A;  4OES A;  2E1S A;  2OJT A;  3G3J A;  1NUX A;  4OZ9 A;  1B5H A;  1IUD A;  1FTK A;  1EYK A;  2NVU B;  2OWT A;  1VR5 A;  4PFW A;  1FRP A;  2V84 A;  3IJO B;  3KC0 A;  2Z8D A;  4JVI A;  1HSE A;  2I48 A;  1Z7N E;  5I56 A;  1FJ6 A;  4IO6 A;  3G3K A;  3MAM A;  4QFK A;  4JSO A;  2H99 A;  4GXS B;  3S9N C;  1VSO A;  4GWX A;  4ESX A;  1B3F A;  4ZE9 A;  4P11 A;  2OX3 A;  4MJO A;  5I84 A;  4DXU A;  3K01 A;  3S9E A;  2HEU A;  3RUM A;  4GBW A;  1JEU A;  4KD5 A;  4YKI A;  1A40 A;  5JK4 A;  4PGN A;  4OVT A;  2WOP A;  4N15 A;  1Y4C A;  1B58 A;  3H6T A;  4QBA A;  1A8E A;  4U21 A;  2DOJ A;  3EPE A;  3MW0 A;  1MG1 A;  3MBP A;  3MQ9 A;  2W7Y A;  4G68 A;  2XXX A;  1ZBM A;  5A5X B;  3U94 A;  1UQW A;  2QMX A;  4X1D A;  5H8F B;  5KDT B;  5IZ3 A;  5IAI A;  3RTF B;  4QSE A;  4F1V A;  3O9P A;  3E13 X;  4K3F A;  3TZA A;  2CZL A;  4PFR A;  4C1T A;  4FOR A;  2OZZ A;  3K00 A;  2JJK A;  3C35 A;  3G7W A;  4FAJ A;  4XKP A;  4PGP A;  2D21 A;  4YIC A;  3VVD A;  1SDX A;  1B3E A;  2I0C A;  3O66 A;  4F29 A;  4ELR A;  3N94 A;  1CE2 A;  3K1N A;  3C9H A;  3N6T A;  4FEB A;  3C4M A;  1BIY A;  1D9Y A;  2XXR A;  3FZV A;  4I9D A;  3MUQ A;  5CMK A;  4ELQ A;  4OWD A;  1I6A A;  4HTG A;  4AB5 A;  5I2K A;  1NV1 A;  1YTV A;  3CG3 A;  2HZK A;  4O7M A;  3E9X A;  3EHU A;  4PDD A;  3W15 C;  2ONS A;  3U1O A;  4F1U A;  4GFR A;  3RNN A;  3E3K A;  3EQ1 A;  5I57 B;  5I2N B;  4U4S A;  3MWB A;  1XOC A;  3KBR A;  4NF4 B;  4ZE8 A;  5EYF A;  5DVJ A;  1EZ9 A;  1TFD A;  5H8N B;  3OO9 A;  1FCK A;  5KCJ A;  4H67 A;  5FTH A;  1PB7 A;  1Y9U A;  3TMG A;  4OHN A;  1BKA A;  1MXY A;  1ZJL A;  1B4Z A;  2NXO A;  5CBR A;  5ET5 A;  4PTK A;  3EF7 A;  4PAF A;  4FBP A;  4OMB A;  5IZ1 A;  1T0K A;  1US4 A;  1P1O A;  4GOT A;  2H4I A;  1ZU0 A;  4R73 A;  1FTM A;  1UIV A;  4F3S A;  4H8I A;  1NV5 A;  1SW2 A;  2PMS A;  4X1B A;  2H98 A;  1SQY A;  1YPN A;  1AOV A;  3BBR A;  4QFO A;  4N4U A;  3FBP A;  1SVX B;  3QUF A;  5AA4 B;  3TEL A;  3VVF A;  1YXI A;  4P47 A;  2OBG A;  2DE3 A;  2DSF A;  3DLN A;  2QL3 A;  1FTA A;  1VFD A;  4JXI A;  3DP8 A;  2WBB A;  1NKX A;  4G77 A;  3K4U A;  4GRK A;  1QKB A;  1A99 A;  2V3U A;  5LOM A;  1IXI A;  1MH3 A;  2CZI A;  3RYA A;  2HPG A;  5I59 A;  2HXW A;  3IR1 A;  5ITO A;  3TOD A;  3SEU A;  1LFG A;  1LBX A;  1OIB A;  1S9T A;  1H3D A;  1FBC A;  3A29 A;  3DRH A;  3I5O A;  2A5T A;  1MH4 A;  4KYE A;  3T96 B;  3U72 A;  1IMB A;  3TTL A;  5BWJ A;  3O6P A;  3IB0 A;  3SEX A;  3V89 B;  2QFL A;  1FQB A;  4Q30 B;  1EZO A;  3LSX A;  2VGQ A;  3FD3 A;  4YZZ A;  4QFL A;  1IIW A;  1KZ8 A;  4R75 A;  2FVZ A;  1N7W A;  4H65 A;  2CZK A;  3CR9 A;  3SEY A;  1B3G A;  3PPN A;  4F1Y A;  3P7I A;  5I58 A;  3LUY A;  1NUZ A;  3TQW A;  1MDP 1;  3O6G A;  1BLF A;  2Q9T A;  2F7C A;  4P9K A;  3G3G A;  3MZ1 A;  3TCG A;  4HS7 A;  2IA4 A;  3OXN A;  4RJZ A;  3PGF A;  1URS A;  2O1M A;  3RPL A;  3Q28 A;  5L9S A;  4G2Z A;  1B52 A;  4Q5T A;  2QJE A;  4YKJ A;  1OQG A;  2M8C A;  1NMU A;  3TCH A;  3DRK A;  1FTL A;  4QXD A;  5J16 A;  3LVU A;  5ELV A;  2DWI A;  1FPD A;  4H8J A;  3CHG A;  2HXR A;  3E79 A;  4NMY A;  3KN3 A;  1JEV A;  1LBY A;  3MVY A;  2R8T A;  3TTK A;  1YZ0 A;  2DS9 A;  1GTK A;  2Y7W A;  2F5X A;  1JP4 A;  4MHF A;  3U8Q A;  2PFZ A;  2ZZV A;  3FV1 A;  4JB7 A;  4OAN A;  4KXP A;  1DPE A;  2RIN A;  2ZZW A;  1Y1Z A;  5DVI A;  4OER A;  5FTI A;  1L5T A;  4ESW A;  3I3V A;  4ZDM A;  3GZG A;  2QS4 A;  1LAF E;  1B46 A;  1TWY A;  5AA2 A;  3A09 A;  5EYG A;  2UVH A;  1NFT A;  5TU0 A;  4PET A;  4NF8 B;  3QAX A;  3FIR A;  4XKR A;  1Y20 A;  5CBS A;  3THI A;  2VD3 A;  4XTC Q;  4DDD A;  3SES A;  5EQA A;  2NUV A;  4RYA A;  4X48 A;  1B05 A;  2V4C A;  4GD5 A;  1A7L A;  2P3N A;  2KQZ A;  3N6U A;  1EH3 A;  4MX6 A;  1FQA A;  1XVY A;  3OD7 A;  3ZS6 A;  4I8C A;  1QUJ A;  3RT8 A;  4HE1 A;  4YKP A;  3MJN A;  1YCJ A;  4FAT A;  1FQD A;  4LQ5 A;  3U93 A;  2GHA A;  1LBW A;  2O7I A;  4MLV A;  1LBV A;  4EXK A;  5H8H A;  1N04 A;  3S4U A;  2WEF A;  3TYH A;  2GH9 A;  3VFJ A;  3H4Z A;  4JDF A;  5EHM A;  1MM7 A;  5JTY B;  1MQG A;  2RC8 A;  3IAZ A;  3CVG A;  4QFP A;  5DW8 A;  3FAT A;  2Q8M A;  4PFU A;  5TPA B;  2WOK A;  4OFJ A;  1OVT A;  4JWO A;  3IOR A;  4MMP A;  4GQO A;  3LUZ A;  2O1L A;  4WXJ A;  1LST A;  1LFH A;  1FPJ A;  2DVZ A;  1FPL A;  3OEK A;  3EN3 A;  2F97 A;  4ZEC A;  1IEJ A;  2YLN A;  3VXC A;  4TQU Q;  3ILT B;  4O94 A;  3KEI A;  5LDZ A;  4ONY A;  1FBG A;  5AA1 A;  3TDJ A;  4PFB A;  5F7V A;  3LV0 A;  2F3B A;  4EUO A;  2OWZ A;  1MDQ A;  2THI A;  4I40 A;  5ET7 A;  4AS5 A;  4X04 A;  3T22 A;  3IL1 B;  4R6H A;  2I49 A;  2AYS A;  1DBZ A;  1NI9 A;  2ZYK A;  2Q2C A;  3RLF E;  1LGB C;  4RXL A;  4GX6 A;  3MZB A;  5ET6 A; 
#chains in the Genus database with same CATH homology
 3VLU A;  3PPR A;  2Q2A A;  5I56 B;  4IB2 A;  3G3F A;  1Y3N A;  2RCB A;  3RTW B;  2F34 A;  1HSL A;  1N3W A;  4LQ2 A;  1B32 A;  4POX A;  1M5B A;  3CRB A;  2Z23 A;  5DEX A;  4YKK A;  3MVZ A;  4OFO A;  4LON B;  2QPQ A;  3MVX A;  4NWC A;  4Z0I A;  3LBS A;  2AL5 A;  4U2R A;  2HCA A;  1B40 A;  3ECR A;  1LAH E;  1PBP A;  4G68 B;  2DXY A;  2X7P A;  5HBC A;  4ECF A;  2F7A A;  1B5I A;  2UVI A;  3E4R A;  4R6K A;  2G29 A;  3PUW E;  2NWJ A;  1Q35 A;  3FVN A;  4U1Z A;  4BDL A;  4R9F A;  5B7D A;  2REG A;  4QSD A;  2XXI A;  1HSJ A;  5AA2 D;  4OEU A;  2QRY A;  3PUZ E;  4BLA A;  1LAX A;  3GLB A;  3O2A A;  1S7Y A;  1P1U A;  4N6P A;  3IOW A;  3C33 A;  4E0X A;  2I58 A;  1MQH A;  4GL0 A;  4Q0C A;  1B51 A;  4M4G A;  4KHZ E;  1SD3 A;  3RQT A;  3MC2 A;  4LZ7 A;  1PB8 A;  2QS2 A;  5I2K B;  2G93 A;  3A3C A;  3ILU B;  4EQ7 A;  5L9M A;  2ZYM A;  1OQH A;  1ATG A;  2ZNS A;  3OEN A;  3K6X A;  2Y7P A;  5FHM A;  1NNF A;  4XKQ A;  3TTN A;  3U92 A;  4WEP A;  2B65 A;  4F31 B;  4R2B A;  3EHT A;  1NNT A;  5KCJ B;  1QVS A;  4H1X A;  1AMF A;  1FW0 A;  1N3X A;  2HQ0 A;  3MVW A;  1N84 A;  1DMB A;  2P2A A;  2UYE A;  5F1Q A;  1MPD A;  4E0W A;  2YPN A;  3PUY E;  3PUX E;  2ZYO A;  3DEL B;  1MRP A;  3I6V A;  1USY H;  4HCW A;  3R6U A;  5AE4 A;  2HFB A;  4JBZ A;  3H6U A;  4F3B A;  3K1M A;  2GFE A;  3S9M C;  2I3V A;  4RNS A;  2F6P A;  5BUU A;  3MP6 A;  4U22 A;  3TTM A;  1OLC A;  5ICQ A;  3R26 A;  3HHG A;  4BDO A;  3VLV A;  4GLI A;  2O68 A;  2KLF A;  1DTG A;  4OQO A;  4OET A;  5KZT A;  1O64 A;  2VHA A;  4RPO A;  1O63 A;  1SYH A;  1EU8 A;  1LLS A;  3R7X A;  2ABH A;  1IXC A;  1TT1 A;  2OK2 A;  4BDN A;  4Q8R A;  1ZLQ A;  1QW0 A;  5I59 B;  2QSX A;  4KPT A;  3V5A A;  3HV1 A;  3LR1 A;  1FQC A;  1MY3 A;  2A5T B;  5CI5 A;  2Q89 A;  1F9B A;  2WKY A;  4F2Q A;  2UXA A;  1CB6 A;  1QUI A;  2BJJ X;  2YJP A;  3JYR A;  3L6G A;  3DRI A;  1TFA A;  3VVE A;  3OSR A;  1B5J A;  3H6V A;  4DLD A;  1FTO A;  3HHF A;  2ALU A;  3SER A;  1JQF A;  4NF6 A;  3B6W A;  2I4B A;  3IO6 A;  5I58 B;  1MS7 A;  2ESN A;  3H3G A;  1NH7 A;  4ZZA A;  2I0B A;  4FEC A;  2QMW A;  4IO7 A;  1PEB A;  2X7Q A;  3ZSF A;  1Y3Q A;  3SDF A;  2DVC A;  3FJ7 A;  2XHD A;  3C36 A;  2VD2 A;  4EDP A;  1B1X A;  2ZYN A;  4P0I A;  1Y3P A;  3LSF B;  3UOR A;  4N07 A;  1SW5 A;  1XT8 A;  2PX1 A;  5H8Q A;  2ZNT A;  4X9T A;  2FA7 A;  2XXV A;  3H03 A;  5HPQ A;  3IOU A;  4DZ1 A;  1MQI A;  4HW8 A;  1ZMG A;  4ND9 A;  3OO6 A;  3FJM A;  3W9V A;  3OEM A;  4LZ8 A;  4F39 A;  1POY 1;  5JEI A;  1LCF A;  4GXA A;  3V8X B;  3FJG A;  4NF5 B;  4ELP A;  3O97 A;  1D4N A;  1D3K A;  1QJM A;  3PPO A;  1DSN A;  2UYF A;  3Q25 A;  4I62 A;  3KSJ A;  4P0G A;  4JSD A;  5TP9 A;  2V3Q A;  4OFL A;  3CSG A;  3Q29 A;  2Q88 A;  5AA2 B;  1UTH A;  4NF5 A;  3T9X B;  3K6V A;  4GIZ A;  1Z7M E;  3K1P A;  5J1D A;  3H7M A;  3Q26 A;  1PDA A;  2Q8J A;  1I6Q A;  1FQE A;  4QSC A;  4LP2 B;  3ZKK A;  1M5D A;  1AH5 A;  3FTO A;  1UTB A;  1H45 A;  4C1U A;  1SW4 A;  3KN8 A;  2IEE A;  3L6H A;  2E0S A;  4UAC A;  1EZP A;  3RPW A;  2PBW A;  3UK4 A;  4YAH X;  1R6Z A;  4KCC A;  1JW5 A;  2AL4 A;  2FNC A;  2A5S A;  5H8H B;  1MXW A;  2R71 A;  2B4L A;  4G4P A;  4YB7 A;  3B7D A;  3H6W A;  1DPP A;  1VE4 A;  2F35 A;  3QK6 A;  4F3P A;  4NTL A;  5DT6 A;  4RK9 A;  1WVJ A;  4MF3 A;  1H76 A;  1H43 A;  5HM4 B;  3T9U A;  1OVB A;  3DP4 A;  4XKN A;  3SET A;  4KYD A;  1QKA A;  1WDN A;  3O6I A;  3QUJ A;  4GL8 A;  2ZMB A;  1LB8 A;  3SKP A;  4KFQ A;  3MPK A;  2I4C A;  1GVC A;  3CSB A;  3TPA A;  2ZXT A;  4U1O A;  4FED A;  1NNK A;  3T9H B;  4R9G A;  3OO7 A;  1B9J A;  1Y1M A;  5DTB A;  3KOT A;  3LSL A;  3T93 B;  1N76 A;  1SYI A;  2Y7R A;  4XXU A;  4TLL B;  3PV0 E;  2XD2 A;  4I1D A;  3PD9 A;  3GBB A;  4NWD A;  3QXM A;  3BKI B;  1BTJ A;  1I6B A;  2B3B A;  3F11 A;  1B0H A;  4BDQ A;  4NE4 A;  1R1N A;  5DEX B;  4F3G A;  1SW1 A;  4KR5 A;  4F2O A;  3CFZ A;  2RKM A;  1M5E A;  3W9W A;  4MLQ A;  5FHN A;  3DRJ A;  3HCQ A;  1IXH A;  1PBQ A;  3CG1 A;  1LBB A;  1O7T A;  3OEL A;  3IO4 A;  2VP1 A;  4QF9 A;  4TLM B;  1LBC A;  2V3T A;  1SI0 A;  1FQF A;  3MP8 A;  3TUS A;  5K2X A;  4G8H A;  2XXP A;  2XXT A;  3UGW A;  2D3I A;  1WOD A;  4IO2 A;  3RY3 A;  4M1V A;  3TFL A;  2H9B A;  2RC9 A;  4FJP A;  3OO8 A;  2F6G A;  4RK2 A;  3UP9 A;  4QFN A;  4EF1 A;  4ZEI A;  3UA8 A;  4BDR A;  5CMB A;  4IO3 A;  4C0R A;  3ZKL A;  4HCY A;  4GF8 A;  1N0T A;  4Z7E A;  1B7H A;  1IIT A;  3O28 A;  3AXF A;  3PPQ A;  3O6H A;  3KSX A;  2R9J A;  4L17 A;  5L9O A;  1POT A;  2REJ A;  4RPN A;  3HPI A;  1NH8 A;  3H06 B;  3JZJ A;  2PVU A;  3DM0 A;  2HZL A;  3VDF A;  3BFU A;  2DE4 A;  3G3H A;  3IJX B;  3MP1 A;  3M8U A;  4AQ4 A;  2DQV A;  3B6Q A;  5A5X A;  2V93 A;  5H8F A;  1P1N A;  5KDT A;  3OSQ A;  2ONR A;  2CMO A;  2UVJ A;  3DRG A;  5CMC A;  2XD3 A;  2PYY A;  4OVJ A;  4EQB A;  2RC7 A;  3K6U A;  2OCU A;  3LSW A;  2Y84 A;  1MQJ A;  2OWS A;  3USD A;  4POW A;  3PAM A;  3IOV A;  3PU5 A;  4G8M A;  3A3U A;  3TCF A;  3KG2 A;  4LVQ A;  3FVK A;  1MPB A;  1URD A;  4JWY A;  1B7U A;  1B3H A;  2DXR A;  1JVX A;  2P1S A;  1JNF A;  4IGR A;  3PMV A;  1MXV A;  5ISU A;  1USY E;  3EHS A;  3PMX A;  3IB1 A;  3C31 A;  4R6Y A;  3TEP A;  2QS3 A;  1B3L A;  4PFY A;  5H8S A;  3TAJ A;  2I3W A;  1US5 A;  1VFE A;  2RCA A;  4O3C A;  1D9V A;  1I69 A;  2Z8E A;  3ODB A;  4LAT A;  5AA3 A;  3OMB A;  3PMW A;  4YB5 A;  5I57 A;  1JET A;  4H6D A;  1OMP A;  5I2N A;  1MPC A;  4H5F A;  4AB6 A;  4NF4 A;  4OTE A;  1IXG A;  2PT1 A;  4R72 A;  3IK6 B;  5H8N A;  1ELJ A;  4OXV A;  2P0S A;  1Y4T A;  3IX1 A;  3T66 A;  5IKB A;  5CM6 A;  2HAU A;  5K2Y A;  1A55 A;  4IO4 A;  3M3K A;  4DXC A;  1MM6 A;  4IO5 A;  3FUZ A;  2DE2 A;  3FVO A;  2GRV A;  1LCT A;  1XS5 A;  3DRF A;  1ZKB A;  4MFI A;  5FHO A;  4F19 A;  3GXA A;  4GWO A;  3D4C A;  3M3L A;  4F18 A;  4ZEK A;  3KOS A;  4FIM A;  2H5Y A;  3RGY A;  2RF1 A;  2O51 A;  4WED A;  1MXU A;  1UIU A;  5CRY A;  1TXF A;  1R9Q A;  3TTR A;  5AA4 A;  4KYS A;  1P1W A;  3S2V A;  4EXL A;  1RKM A;  3WAE A;  2O69 A;  4NF6 B;  3CFL A;  2XX7 A;  3GBA A;  4KI0 E;  1URG A;  2B3F A;  1RYO A;  4GVO A;  4YB6 A;  4O3A A;  1DTZ A;  1MQD A;  4TOZ A;  3CIJ A;  1QUK A;  3O29 A;  4PE5 B;  1B7Z A;  3VE1 B;  1AL3 A;  2F78 A;  4DCX A;  2XX8 A;  2DWH A;  3CI8 A;  1NL5 A;  3QYT A;  4U4X A;  2X26 A;  1OLA A;  3C32 A;  3M3F A;  4H0W A;  1MY2 A;  1J1N A;  4ZEB A;  3K02 A;  2V25 A;  4MH5 A;  3LC8 A;  4OYV A;  3FVG A;  4RA1 A;  1DOT A;  5CMM A;  4DE8 A;  5H8Q B;  2O84 X;  4OEN A;  4YMA A;  3D4G A;  3TQL A;  4QRZ A;  1JW4 A;  1B0L A;  1II5 A;  2XXU A;  4ZZE A;  2D5W A;  3KFM A;  1N7X A;  3C34 A;  3MZ9 A;  1RYX A;  1ZTY A;  4WKM A;  2Z22 A;  4U23 A;  3HST A;  4BDM A;  2UVG A;  1BP5 A;  2I6E A;  1MY0 A;  3HN0 A;  1JVY A;  2F7B A;  2R6G E;  3FAS A;  3N5L A;  2NOO A;  1M5C A;  5EHS A;  1IZ1 A;  4ZS9 A;  4LA9 A;  5TP9 B;  3UIF A;  1LFI A;  1LB9 A;  1XHY A;  3HO7 A;  4THI A;  1UTH B;  4G68 C;  4YU0 A;  4PFT A;  3KJ7 A;  4H5G A;  4R74 A;  3DP6 A;  1A54 A;  5M2V A;  3VV5 A;  1ANF A;  3TKD A;  4ISU A;  3S9L C;  5DVF A;  3IOT A;  1PB9 A;  1P99 A;  5DYH A;  4MBP A;  1UTB B;  4RY1 A;  1LAG E;  4QHQ A;  1XVX A;  3SEV A;  3PD8 A;  1S50 A;  3K0V A;  5ITP A;  3Q27 A;  1Q1K A;  2F8D A;  2F36 A;  2FYI A;  3VXB A;  1P1Q A;  4KQP A;  2AIX A;  1QUL A;  1R9L A;  2XX9 A;  3JV9 A;  1B2H A;  4ZED A;  2WOL A;  5L8D A;  1ZIU A;  4YMB A;  2GHB A;  4IY6 A;  1MXZ A;  3B6T A;  2DWA A;  3RYB A;  2B4M A;  3K2D A;  3K6W A;  3MPL A;  3FXR A;  1GR2 A;  2ANJ A;  1XC1 A;  3IB2 A;  2DYX A;  2QS1 A;  4UA8 A;  1A8F A;  4NF8 A;  4O3B A;  5CC2 A;  4F22 A;  3N26 A;  1MY4 A;  2Y7K A;  3KGC A;  1GV8 A;  1B4H A;  3BFT A;  3OOA A;  1AIV A;  4IGT A;  3QIM A;  3KN7 A;  1PC3 A;  2O6A A;  1B6H A;  3KZG A;  1M5F A;  2H25 A;  4OEV A;  4EF2 A;  2XXY A;  4DIG A;  4NED A;  2DP8 A;  3PPP A;  1KWH A;  1SI1 A;  4DXB A;  4PQJ A;  1GGG A;  3PUV E;  2LAO A;  3V83 A;  4EQ9 A;  1MXX A;  3KJT A;  2XXW A;  4IY5 A;  4LUB A;  2PT2 A;  5ICT A;  2Y7I A;  2XXH A;  5JTY A;  2HAV A;  1FTJ A;  4PP0 A;  4ZEF A;  3T9V A;  1H44 A;  3QSL A;  5TPA A;  1SBP A;  1IQ7 A;  3SEW A;  3FXQ A;  2ZNU A;  4KCD A;  3FGS A;  1JW1 A;  3RT6 B;  4XIG Q;  1MY1 A;  5B70 A;  1B1H A;  4N13 A;  3RN8 A;  4JWX A;  3VLW A;  4ELO A;  3G3I A;  4G8N A;  3FV2 A;  3WAF A;  1YAE A;  2Z8F A;  2O7U A;  2VOZ A;  4R2F A;  2ONK E;  2XXQ A;  2OLB A;  4FE8 A;  4DCY A;  3ONM A;  3CFX A;  4LZ5 A;  3FXU A;  2DWJ A;  3UN6 A;  1NNP A;  4OES A;  2E1S A;  2OJT A;  3G3J A;  4OZ9 A;  1B5H A;  1IUD A;  1FTK A;  2NVU B;  2OWT A;  1VR5 A;  4PFW A;  2V84 A;  3IJO B;  2Z8D A;  1HSE A;  2I48 A;  1Z7N E;  5I56 A;  3MAM A;  3G3K A;  4IO6 A;  4QFK A;  4JSO A;  2H99 A;  4GXS B;  3S9N C;  1VSO A;  4ESX A;  1B3F A;  4ZE9 A;  4P11 A;  5I84 A;  4DXU A;  3K01 A;  3S9E A;  2HEU A;  3RUM A;  1JEU A;  4KD5 A;  4YKI A;  1A40 A;  5JK4 A;  2WOP A;  1Y4C A;  1B58 A;  3H6T A;  1A8E A;  4U21 A;  2DOJ A;  3EPE A;  3MW0 A;  1MG1 A;  3MBP A;  3MQ9 A;  2W7Y A;  4G68 A;  2XXX A;  1ZBM A;  5A5X B;  3U94 A;  1UQW A;  2QMX A;  4X1D A;  5H8F B;  5KDT B;  5IAI A;  3RTF B;  4QSE A;  4F1V A;  3O9P A;  3E13 X;  4K3F A;  3TZA A;  2CZL A;  4C1T A;  4FOR A;  2OZZ A;  3K00 A;  3C35 A;  3G7W A;  4FAJ A;  4XKP A;  2D21 A;  4YIC A;  3VVD A;  1SDX A;  1B3E A;  2I0C A;  3O66 A;  4F29 A;  4ELR A;  3N94 A;  1CE2 A;  3K1N A;  3C9H A;  3N6T A;  4FEB A;  3C4M A;  1BIY A;  1D9Y A;  2XXR A;  3FZV A;  4I9D A;  3MUQ A;  5CMK A;  4ELQ A;  4OWD A;  1I6A A;  4HTG A;  4AB5 A;  5I2K A;  1YTV A;  3CG3 A;  2HZK A;  3E9X A;  3EHU A;  3W15 C;  2ONS A;  3U1O A;  4F1U A;  4GFR A;  3RNN A;  3E3K A;  3EQ1 A;  5I57 B;  5I2N B;  4U4S A;  3MWB A;  1XOC A;  3KBR A;  4NF4 B;  4ZE8 A;  5EYF A;  5DVJ A;  1EZ9 A;  1TFD A;  5H8N B;  3OO9 A;  1FCK A;  5KCJ A;  4H67 A;  5FTH A;  1PB7 A;  1Y9U A;  3TMG A;  4OHN A;  1BKA A;  1MXY A;  1ZJL A;  1B4Z A;  2NXO A;  5CBR A;  3EF7 A;  4OMB A;  1T0K A;  1US4 A;  1P1O A;  4GOT A;  2H4I A;  1ZU0 A;  4R73 A;  1FTM A;  1UIV A;  4F3S A;  4H8I A;  1SW2 A;  2PMS A;  4X1B A;  2H98 A;  1SQY A;  1YPN A;  1AOV A;  3BBR A;  4QFO A;  1SVX B;  3QUF A;  5AA4 B;  3TEL A;  3VVF A;  2OBG A;  2DE3 A;  2DSF A;  3DLN A;  2QL3 A;  1VFD A;  4JXI A;  3DP8 A;  1NKX A;  4G77 A;  3K4U A;  4GRK A;  1QKB A;  1A99 A;  2V3U A;  5LOM A;  1IXI A;  1MH3 A;  3RYA A;  5I59 A;  2HXW A;  3IR1 A;  5ITO A;  3TOD A;  3SEU A;  1LFG A;  1OIB A;  1S9T A;  1H3D A;  3DRH A;  3I5O A;  2A5T A;  1MH4 A;  4KYE A;  3T96 B;  3U72 A;  3TTL A;  5BWJ A;  3O6P A;  3IB0 A;  3SEX A;  3V89 B;  1FQB A;  4Q30 B;  1EZO A;  3LSX A;  2VGQ A;  3FD3 A;  4YZZ A;  4QFL A;  1IIW A;  4R75 A;  1N7W A;  4H65 A;  3CR9 A;  3SEY A;  1B3G A;  3PPN A;  4F1Y A;  3P7I A;  5I58 A;  3LUY A;  3TQW A;  1MDP 1;  3O6G A;  1BLF A;  2Q9T A;  2F7C A;  3G3G A;  3MZ1 A;  3TCG A;  4HS7 A;  2IA4 A;  3OXN A;  4RJZ A;  3PGF A;  1URS A;  2O1M A;  5L9S A;  3Q28 A;  4G2Z A;  1B52 A;  4Q5T A;  2QJE A;  4YKJ A;  1OQG A;  2M8C A;  1NMU A;  3TCH A;  3DRK A;  1FTL A;  3LVU A;  5ELV A;  2DWI A;  4H8J A;  3CHG A;  3KN3 A;  4NMY A;  1JEV A;  3MVY A;  3TTK A;  2DS9 A;  1GTK A;  2Y7W A;  2F5X A;  3U8Q A;  3FV1 A;  4JB7 A;  1DPE A;  2RIN A;  1Y1Z A;  5DVI A;  4OER A;  5FTI A;  1L5T A;  4ESW A;  3I3V A;  4ZDM A;  3GZG A;  2QS4 A;  1LAF E;  1B46 A;  1TWY A;  5AA2 A;  3A09 A;  2UVH A;  1NFT A;  5TU0 A;  4PET A;  4NF8 B;  3QAX A;  3FIR A;  4XKR A;  1Y20 A;  5CBS A;  3THI A;  2VD3 A;  4XTC Q;  4DDD A;  3SES A;  2NUV A;  4RYA A;  4X48 A;  1B05 A;  4GD5 A;  1A7L A;  3N6U A;  1EH3 A;  1FQA A;  1XVY A;  3OD7 A;  3ZS6 A;  4I8C A;  1QUJ A;  3RT8 A;  4YKP A;  3MJN A;  1YCJ A;  4FAT A;  1FQD A;  4LQ5 A;  3U93 A;  2GHA A;  2O7I A;  4MLV A;  4EXK A;  5H8H A;  1N04 A;  3S4U A;  3TYH A;  2GH9 A;  3VFJ A;  3H4Z A;  4JDF A;  5EHM A;  1MM7 A;  5JTY B;  1MQG A;  2RC8 A;  3IAZ A;  3CVG A;  4QFP A;  3FAT A;  4PFU A;  5TPA B;  2WOK A;  4OFJ A;  1OVT A;  4JWO A;  3IOR A;  4GQO A;  2O1L A;  4WXJ A;  1LST A;  1LFH A;  2DVZ A;  3OEK A;  3EN3 A;  2F97 A;  4ZEC A;  1IEJ A;  2YLN A;  3VXC A;  4TQU Q;  3ILT B;  3KEI A;  4ONY A;  5AA1 A;  3TDJ A;  5F7V A;  4EUO A;  1MDQ A;  2THI A;  3T22 A;  3IL1 B;  4R6H A;  2I49 A;  2AYS A;  2ZYK A;  2Q2C A;  3RLF E;  1LGB C;  4RXL A;  3MZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...