1B5JA

Oligo-peptide binding protein (oppa) complexed with kqk
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
total genus 185
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b5jA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b5jA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b5jA02
1QKBA 3OENA 2I0CA 3O6IA 5H8HB 4KD5A 2AL5A 2D3IA 1O7TA 3PPQA 3H6UA 4ESWA 4OMBA 1B40A 3DRHA 4OEUA 5F1QA 2F78A 2V84A 4RK9A 3UK4A 4MLQA 3S9EA 4NEDA 4FEBA 3S9MC 3LBSA 1DMBA 4GVOA 4F3SA 1YCJA 1SYHA 3ZS6A 4HW8A 1B0HA 4ECFA 1B1HA 3RY3A 4JDFA 3RT8A 5DVFA 4HS7A 4DCXA 2I58A 3UORA 1B5HA 1SDXA 3EHTA 5IKBA 1MXYA 2O84X 3GZGA 2XXWA 3V83A 4YZZA 4F22A 4NF6B 3W15C 1GV8A 3RNNA 3S9NC 2ZMBA 4GWOA 4H67A 2ANJA 3G3GA 4R72A 3UA8A 3KEIA 1FTMA 5I56A 2FYIA 1N04A 1JVYA 4PFYA 1MY4A 1R6ZA 3H6WA 4IY5A 3K2DA 3BKIB 1D4NA 1M5FA 4KYDA 5ELVA 3N94A 4NF8A 1XVXA 4KHZE 3IO4A 1IXGA 2GH9A 3S9LC 2HXWA 5DVJA 3PMWA 1MG1A 2DWJA 3SEUA 4FEDA 3K4UA 3MZBA 1P1UA 3FVKA 3OEMA 4MF3A 4F1VA 1JEUA 3LR1A 4G68A 2AYSA 4QSCA 1ZMGA 2Q8JA 4IO5A 3UGWA 2B4MA 3K01A 2ZNSA 5DT6A 4Q5TA 3T9VA 3U8QA 5JK4A 4DIGA 1JW4A 3RYAA 3KBRA 5FHOA 2QMWA 3HN0A 3TODA 2PMSA 2NUVA 4E0WA 5AA4A 4AB6A 2Q88A 1QUJA 1PC3A 4WEDA 2DXRA 1S7YA 3FV1A 2OWSA 3K00A 3PUXE 4KCDA 4BDNA 3O6GA 5DVIA 1Y9UA 5HPQA 1RYOA 2O51A 3HSTA 5CMBA 2WOKA 3FJ7A 4I62A 4NWCA 2O7UA 3ZSFA 2IEEA 2CMOA 4DZ1A 1O64A 1P99A 1B3LA 4DLDA 1S9TA 5B7DA 4IY6A 3TEPA 2HZKA 4DXCA 1Y4TA 2IA4A 3O2AA 1JW1A 4IGTA 1VR5A 1LB9A 3FVGA 5ICQA 4ZECA 3O28A 2G93A 3E3KA 1DTGA 1IXHA 1NNTA 1UTBA 3PGFA 4YU0A 1Y3NA 5AE4A 3PPOA 2HFBA 1BP5A 5M2VA 1GGGA 1I6BA 5H8SA 4XKNA 1KWHA 5EYFA 2XXXA 3KN7A 1B7ZA 4F29A 1CB6A 4YB5A 4OQOA 1IIWA 4OESA 4DCYA 2R9JA 1ANFA 2X26A 1T0KA 3MVWA 3C31A 1URSA 3RGYA 3BBRA 3T9UA 3IX1A 1MQJA 1NKXA 4LUBA 1M5DA 1WVJA 4O3AA 5CRYA 3TDJA 1B1XA 3G3FA 1QUKA 4G68C 2RC8A 2Y7RA 1VFEA 3TTLA 4LP2B 1OQGA 3THIA 1FTJA 2A5TA 1OVBA 2B4LA 3TCGA 1MDP1 2VGQA 3O66A 4GD5A 4RNSA 4DXBA 3FASA 3OELA 4QRZA 2QS3A 3LSXA 3PMVA 4MFIA 4BLAA 2ZYMA 4M1VA 5EHSA 1LBCA 1N3XA 1N7WA 5DTBA 4N07A 4ONYA 4BDRA 3RTWB 3ONMA 4OYVA 3MW0A 5I57A 2GHBA 3KG2A 1O63A 2QPQA 3L6GA 4OXVA 3TZAA 3VV5A 5ISUA 1P1QA 1FQFA 1HSLA 1F9BA 4QF9A 2XXPA 1B4HA 3CHGA 4RPOA 4X9TA 3QIMA 1IXIA 3PMXA 4UACA 3FXUA 2UVIA 2Z22A 4JWYA 3K1NA 4TLMB 1FQCA 3K0VA 4ZZAA 3K1MA 2H98A 2VP1A 1H44A 3RTFB 2O7IA 3WAEA 4R2BA 4H6DA 4ELRA 1MXWA 3O6HA 4U4XA 1A55A 1LFGA 3VLUA 3V89B 3Q26A 2ESNA 2HEUA 3DRKA 4FE8A 4DDDA 3EQ1A 5IAIA 2DS9A 3OOAA 3O97A 2Y7KA 2F7CA 4GQOA 5K2YA 3T96B 4LZ8A 2OCUA 3MP8A 4X1DA 1L5TA 2RC7A 2B3BA 2RINA 3MQ9A 4NF5A 1I6AA 2DWAA 3K6VA 1P1OA 4O3CA 4P11A 4GL8A 1LGBC 1Y3QA 2F34A 1NH7A 4P0IA 4F39A 3KFMA 2YLNA 3OEKA 5A5XA 1MPBA 1TFDA 5I59A 3DRGA 4RA1A 1II5A 3CFXA 3HPIA 4R9GA 4YKJA 4U4SA 3WAFA 1SW5A 3IJOB 1Z7NE 4JB7A 1SVXB 3I3VA 4IO3A 1NNPA 2H9BA 4ZS9A 3JV9A 2PBWA 2QS2A 3G7WA 2XX8A 4H8JA 1FW0A 1JW5A 1URGA 3SETA 3M3LA 2ONSA 1Y4CA 3C32A 3OMBA 5AA2D 3VLVA 4NWDA 4HCYA 5DEXB 3O6PA 2I6EA 3MPKA 4G8NA 3CRBA 1SI1A 4ZEKA 1LCTA 2ZYOA 1BKAA 1M5BA 3A09A 3DM0A 2UVJA 3M8UA 1H45A 3PPRA 4ELOA 3GBBA 2I0BA 3PV0E 3SKPA 4H5FA 1B46A 5ICTA 5KCJB 1JEVA 2P2AA 2QS1A 2OJTA 4Z0IA 3FXQA 4PFWA 4G2ZA 1GVCA 4OWDA 4U23A 3KSXA 4IGRA 2E0SA 1IZ1A 3ODBA 4YB7A 1N0TA 1OLCA 1Y3PA 4H0WA 1UTBB 3LSLA 1YAEA 1XC1A 2ONRA 2PYYA 4IB2A 4YKPA 3MPLA 4IO4A 2O1MA 1VE4A 5EHMA 2V3QA 2VD3A 1OMPA 3K6WA 1SW1A 3OO9A 4OFLA 1FQDA 2F36A 4L17A 4R73A 4F3PA 2I3VA 2WOPA 3FIRA 3DRFA 3W9VA 5ITOA 1ZJLA 2VD2A 4QFLA 3Q25A 4RPNA 4XKRA 2Q89A 1B3EA 3S2VA 2XXRA 1N84A 3D4CA 3MP1A 3B6QA 3PD9A 2XD2A 2REGA 1FQBA 1EU8A 3H3GA 2BJJX 2ZYKA 5CC2A 2F97A 2UXAA 4FATA 4H8IA 2M8CA 3TQWA 3PPPA 4M4GA 2HQ0A 1EZPA 2Z8EA 3CSBA 3QAXA 1H43A 4THIA 2UYEA 4QFPA 5H8QB 4FJPA 2I48A 3TCHA 1FQAA 1LSTA 1SBPA 4EQBA 4PQJA 3QUFA 3Q29A 1IEJA 1JETA 4F3GA 4ZZEA 2Y7PA 2OBGA 3DP6A 4YMAA 3FV2A 1QUIA 5JTYB 4OEVA 1EZ9A 3U92A 2NWJA 2GHAA 1UIVA 2DVZA 3DELB 5BWJA 4ZEDA 3H6VA 1LFIA 4LQ2A 4QFNA 4TQUQ 2A5SA 3C33A 4GOTA 3FJMA 3CSGA 3IOVA 1DPEA 5AA3A 1URDA 2V3UA 5L9SA 3UN6A 3H4ZA 3CIJA 4QFKA 5L8DA 4YKIA 1MQIA 3PUWE 1PBQA 1EH3A 4PP0A 4ELPA 1ZLQA 4OERA 4BDQA 4EDPA 4LQ5A 2F8DA 5L9MA 2QL3A 3QSLA 4F1YA 2AL4A 2UVGA 4JBZA 3TFLA 5AA4B 1IITA 1MPCA 3FUZA 2I49A 4BDLA 3TMGA 2X7QA 2DQVA 3M3KA 1RYXA 3MZ9A 1A8EA 4YMBA 1D9VA 1TXFA 2W7YA 1NNKA 1LBBA 2ONKE 3IB1A 1TFAA 3H06B 3KN3A 1FQEA 4PE5B 2XXUA 4R6YA 4ZDMA 2Q2AA 2B65A 1N3WA 4U22A 5DYHA 4IO6A 3IAZA 3DP8A 5AA2A 2XXIA 5TP9B 1HSJA 3OD7A 2F7BA 1WDNA 2XX9A 1MQGA 1MQDA 3SERA 1XVYA 4ZE8A 3TUSA 1MH4A 1B4ZA 2DP8A 1FTLA 1B7UA 4OFJA 2HAUA 5CM6A 3RN8A 2XX7A 4F2OA 4FIMA 1EZOA 3RUMA 5I2NB 1B3HA 3GBAA 3R6UA 3CG1A 5KDTB 1YTVA 2LAOA 3ILUB 3BFTA 1IXCA 2QJEA 3JZJA 2O69A 4JSOA 2KLFA 1JNFA 2PT1A 3PD8A 3MP6A 4EF1A 2DWIA 2PVUA 3KGCA 5H8FA 5JEIA 1IQ7A 4IO2A 4WEPA 4LA9A 2YJPA 1LAFE 4MLVA 3TAJA 2ZNUA 2PX1A 3OSRA 4R6HA 2UYFA 2DSFA 3C4MA 3SEVA 4GRKA 1ZIUA 4E0XA 4EXKA 4OHNA 3KOSA 5J1DA 1SD3A 3PU5A 1QW0A 4KFQA 3QYTA 1JVXA 4GXAA 3E4RA 3IOTA 4BDMA 3TELA 2O68A 3VXCA 4LZ5A 4NF5B 3CG3A 3VE1B 2THIA 3H6TA 4F19A 4KYEA 4JXIA 4EF2A 2GRVA 4KPTA 1HSEA 4NF6A 4R9FA 2Y7WA 3MVZA 5I57B 3DRJA 2R6GE 4XTCQ 3DLNA 4JSDA 1LB8A 4Q0CA 4BDOA 1US5A 3CFLA 3GXAA 4NF4A 2FNCA 1H76A 4NMYA 2XD3A 3KJTA 1B7HA 4P0GA 2HZLA 3C34A 1MM7A 1H3DA 2V3TA 4WXJA 3MAMA 4G4PA 3TCFA 2D5WA 2OLBA 5FTIA 1LLSA 1XS5A 5I2KA 2D21A 1MDQA 4G68B 4Q8RA 3UP9A 1PEBA 3IORA 4FORA 1AOVA 3K02A 3G3KA 3LUYA 5H8QA 4PFUA 4POWA 1DTZA 3CVGA 3LSFB 3Q27A 4LZ7A 5I58A 3FVNA 3R7XA 4MBPA 5JTYA 3EHSA 1M5EA 5I84A 3A3UA 1NFTA 4HTGA 3G3JA 3TTNA 3TTMA 3EPEA 1CE2A 2Z8DA 5CBSA 1LFHA 3D4GA 1QVSA 3E9XA 3IR1A 1B32A 1XOCA 1P1NA 1Y20A 3QK6A 3V5AA 4G8HA 1PBPA 5F7VA 4ESXA 2X7PA 4U1OA 2XXHA 2YPNA 4OTEA 1UTHB 5H8NA 5H8HA 4X48A 1AIVA 3CR9A 1BIYA 4I1DA 5AA2B 4OENA 1DPPA 1R1NA 4Q30B 3OO8A 4N13A 3DP4A 2ZXTA 1B9JA 1MXXA 2QSXA 3G3IA 4R6KA 4YB6A 1UIUA 3N5LA 5CMMA 5DEXA 1LAXA 1B05A 4Z7EA 1ZTYA 4AQ4A 3IK6B 3CFZA 5FHMA 2GFEA 4OZ9A 5FHNA 3V8XB 1B2HA 1OLAA 3AXFA 3HV1A 2DE2A 5K2XA 1TT1A 1AL3A 4XIGQ 3TQLA 3H7MA 3M3FA 4OVJA 2RKMA 4DXUA 1NNFA 4GLIA 1MQHA 1USYH 4ZEFA 3TTRA 1QJMA 2RF1A 2XXYA 3KOTA 3RYBA 4KCCA 5B70A 3QXMA 3TTKA 2F5XA 2NVUB 3OO7A 1VSOA 1Y1MA 1Q35A 3VLWA 5I2NA 2REJA 4TOZA 4R74A 1POY1 1TWYA 3JYRA 3L6HA 4X1BA 3N6TA 2I3WA 3C36A 3R26A 1MRPA 3MJNA 3U1OA 4QSDA 2DVCA 4PFTA 1MY2A 3BFUA 5TU0A 2Q9TA 4YICA 4F18A 3GLBA 3G3HA 5KCJA 2F7AA 2Y84A 3IB0A 3KJ7A 3T9HB 3UIFA 1JQFA 1B58A 1MXUA 3I6VA 1PB9A 4H1XA 1SW2A 3RPWA 3IB2A 1MXVA 4RJZA 3SESA 4GL0A 2DE3A 2G29A 1P1WA 2NOOA 2VHAA 4H65A 5CMCA 1MY1A 2RCAA 2VOZA 1VFDA 3U93A 1XT8A 4OETA 2O6AA 4KI0E 4YAHX 3HCQA 2Z8FA 4R75A 4KYSA 5CMKA 1J1NA 3VDFA 2P0SA 3O9PA 3OSQA 2F6PA 3C9HA 1B5JA 4MH5A 3VVFA 1ZBMA 1B3FA 2Y7IA 4NF8B 3LSWA 4KR5A 1SQYA 4GIZA 3K1PA 5L9OA 5TP9A 4AB5A 1FTKA 3HO7A 4ND9A 2Q2CA 1BTJA 4JWXA 2RCBA 4GXSB 1GR2A 4KQPA 4NF4B 4I8CA 3CI8A 4U1ZA 5A5XB 3RT6B 3MZ1A 1A99A 3FTOA 1I69A 1NMUA 2OZZA 3PUVE 1B5IA 3ILTB 4C1TA 3DRIA 1PB8A 3P7IA 3B6TA 3VVEA 2O1LA 3EN3A 1PDAA 4WKMA 2DWHA 4ELQA 1M5CA 3RQTA 1B0LA 1MS7A 2B3FA 4C0RA 1B3GA 4RK2A 4DE8A 2AIXA 4RYAA 2ZNTA 5CBRA 3KZGA 4RY1A 4FAJA 1A40A 2R71A 2A5TB 1LAGE 1DOTA 2ABHA 2XHDA 3RLFE 3OO6A 4ZEBA 3F11A 3EF7A 3O29A 2UVHA 3PUZE 3FZVA 3B6WA 1BLFA 1ATGA 1N76A 2DE4A 4U21A 4QSEA 4F2QA 2RC9A 3FJGA 1LAHE 1Y1ZA 4EQ9A 1IUDA 1QKAA 3PAMA 1I6QA 5ITPA 1MY0A 3IOUA 5KDTA 2DOJA 1XHYA 4R2FA 3USDA 4RXLA 3N26A 1OIBA 2Z23A 3S4UA 4F3BA 1MM6A 3EHUA 5HM4B 2PT2A 1N7XA 3K6UA 1S50A 5H8FB 1FCKA 3SEWA 3VVDA 1D3KA 1A7LA 4XXUA 2FA7A 3IL1B 3QUJA 3W9WA 3I5OA 3MBPA 3T22A 1R9QA 4QFOA 1WODA 3FD3A 3FATA 1POTA 1ZKBA 2WKYA 3LC8A 1Q1KA 4YKKA 4LONB 1GTKA 2OWTA 2I4BA 5I56B 1D9YA 1SYIA 2OK2A 3MC2A 4FECA 5HBCA 3KSJA 1B52A 5TPAA 5KZTA 3T66A 3KN8A 4F1UA 2H5YA 1ELJA 1MH3A 1YPNA 2DYXA 2V93A 5TPAB 1US4A 1AH5A 1SI0A 4POXA 3TKDA 2P1SA 2QMXA 4PETA 2I4CA 3U94A 1A54A 5I59B 3MUQA 4O3BA 3PUYE 2HCAA 4G77A 3MVXA 3FVOA 2ALUA 4TLLB 3HHGA 1OVTA 3MVYA 1DSNA 2E1SA 3ZKKA 1MXZA 2QS4A 2CZLA 2XXVA 5CI5A 2DXYA 4NE4A 4EXLA 3K6XA 4EQ7A 4QHQA 1UTHA 2HAVA 4LATA 5H8NB 1B51A 3N6UA 1NH8A 3SEYA 5AA1A 4I9DA 4U2RA 2H4IA 1OQHA 3FGSA 3B7DA 4JWOA 4K3FA 5BUUA 1B6HA 4XKQA 4XKPA 3IOWA 4G8MA 1USYE 2QRYA 3C35A 3IJXB 5I2KB 1UQWA 3U72A 3TYHA 5LOMA 3VXBA 4LVQA 4H5GA 4F31B 4ISUA 1MY3A 1QULA 2H99A 3A3CA 5FTHA 3ZKLA 3Q28A 4NTLA 1PB7A 4ZE9A 3FXRA 3HHFA 1Z7ME 5I58B 3E13X 2XXQA 4GFRA 3SEXA 1LCFA 4ZEIA 4C1UA 3OXNA 1MPDA 2V25A 3LVUA 2ZYNA 4EUOA 3IO6A 3SDFA 3T9XB 1A8FA 1FTOA 3H03A 3TPAA 3ECRA 2WOLA 1R9LA 2H25A 2NXOA 2F6GA 1NL5A 1RKMA 2XXTA 2F35A 3MWBA 1ZU0A 3PPNA 1SW4A 4HCWA 3VFJA 3T93B 4OFOA 4IO7A 4N6PA 4UA8A 1AMFA 4GF8A
chains in the Genus database with same CATH superfamily
4KD5A 2ZZWA 4ESWA 4OMBA 5F1QA 2V84A 4NEDA 1DMBA 1SYHA 4HW8A 4AS4A 1B0HA 1B1HA 3RY3A 4JDFA 4OVQA 1LBWA 3KBZA 3EHTA 5IKBA 3GZGA 2XXWA 4OA4A 3W15C 1GV8A 2ZMBA 3KC1A 3UA8A 3U65A 2FYIA 1N04A 1JVYA 5ELVA 3BKIB 1D4NA 3N94A 1XVXA 4MMPA 4FEDA 4MF3A 1ZMGA 2ZNSA 5I3SA 3TODA 5AA4A 4AB6A 5ITPA 1PC3A 2DXRA 3K00A 4BDNA 2OWSA 5DVIA 1RYOA 2IEEA 4DZ1A 1P99A 4DXCA 1Y4TA 1JW1A 3O28A 1NNTA 1KZ8A 1BP5A 1GGGA 1KA0A 1KWHA 2XXXA 2CZIA 3D1RA 1CB6A 1FBGA 1NKXA 5CRYA 1B1XA 1OQGA 2A5TA 3O66A 4MFIA 4BLAA 1N3XA 4N07A 2QPQA 4P1LA 3TZAA 1FQFA 2XXPA 1B4HA 4X9TA 4UACA 3HFUA 3K1NA 4NGUA 2VP1A 1MXWA 4U4XA 1A55A 1JP4A 1LFGA 3Q26A 3E79A 2DS9A 2Y7KA 2F7CA 3T96B 2OCUA 2RINA 4P11A 3K6VA 4GL8A 2QVRA 5A5XA 5I59A 3WAFA 4R9GA 4YKJA 4U4SA 1NV7A 1SW5A 4JB7A 3U92A 1SVXB 4H8JA 3A29A 1URGA 1EYKA 5AA2D 4HCYA 2I6EA 3MPKA 4NX1A 1K9YA 5IZZA 1LCTA 2ZYOA 1M5BA 3A09A 3PPRA 3GBBA 3PV0E 3FXQA 4PFWA 4IB2A 4YKPA 1K9ZA 2ZZXA 1OMPA 3K6WA 1SW1A 3OO9A 4OFLA 4L17A 2WOPA 3FIRA 3W9VA 4DI3D 1ZJLA 4QFLA 3Q25A 2QVUA 2Q89A 2XXRA 1N84A 2XD2A 2REGA 2BJJX 2QVVA 4H8IA 3MYUA 4THIA 1KA1A 2UYEA 4FJPA 1LSTA 3QUFA 4F3GA 3DP6A 5JTYB 1EZ9A 2GHAA 5BWJA 4ZEDA 2XWIA 1IMAA 3FJMA 1LBYA 1MQIA 3PUWE 4PP0A 5AA4B 1IITA 4MJOA 2DQVA 3M3KA 1RYXA 1A8EA 4PFIA 1NNKA 3IB1A 4PE5B 4U22A 3IAZA 4N8YA 5TP9B 1WDNA 1XVYA 4GX3A 2PCRA 1B7UA 3RUMA 1RDXA 3BFTA 4JSOA 3KGCA 2OWZA 4WEPA 1LAFE 3TAJA 2ZNUA 3C4MA 2XWOA 3PU5A 1JVXA 4R9FA 4NF6A 2Y7WA 4MHFA 1US5A 1H76A 2XD3A 2V3TA 3MAMA 4G4PA 5FTIA 5I2KA 1MDQA 3IORA 3LSFB 3FVNA 4MBPA 5JTYA 3TTNA 1CE2A 2Z8DA 3IR1A 1XOCA 4UABA 2GQ1A 1EYJA 4ESXA 1UTHB 4PDHA 4Q30B 2XWVA 3DP4A 2ZXTA 2QSXA 3G3IA 4O94A 5CMMA 1B05A 4PF8A 2HPGA 3IK6B 5FHMA 1B2HA 1OLAA 3TQLA 3M3FA 4OVJA 1NNFA 1USYH 4ZEFA 2FHYA 3VLWA 5I2NA 2REJA 3N6TA 2I3WA 3U1OA 5TU0A 3IB0A 3T9HB 4N6KA 1JQFA 3RPWA 1PB9A 1SW2A 3IB2A 1MXVA 2NOOA 2RCAA 2VOZA 1SPIA 4OETA 4KI0E 3HCQA 4R75A 4KYSA 3OSQA 3C9HA 1B3FA 1AWBA 2Y7IA 3LSWA 1SQYA 3K1PA 2Q8MA 2XXKA 4PGNA 1BTJA 4GXSB 4PBQA 4U1ZA 3FTOA 5J16A 3ILTB 3EN3A 4WKMA 1B3GA 5EQ9A 2ZNTA 3KZGA 1DOTA 3F11A 1BLFA 1ATGA 4OVRA 1LAHE 1MY0A 3IOUA 2DOJA 1XHYA 4RXLA 1OIBA 2Z23A 4PE3A 5HM4B 1N7XA 3K6UA 4X04A 4XXUA 3IL1B 1R9QA 1WODA 3FATA 1ZKBA 5I56B 2OK2A 3MC2A 3KSJA 3T66A 2H5YA 1YPNA 3TKDA 1AH5A 4PETA 1IMBA 2HCAA 4G77A 2ALUA 4TLLB 1FPDA 3MVYA 1OVTA 5CI5A 1DBZA 2CEXA 5AA1A 4U2RA 4JWOA 3B7DA 4K3FA 1UQWA 3TYHA 4NF0A 1QULA 3Q28A 4ZEIA 3OXNA 2ZYNA 4EUOA 3IO6A 3SDFA 1FTOA 1R9LA 1RKMA 3PPNA 2F35A 4UA8A 4N6PA 2CZKA 4GWXA 1QKBA 3OENA 2I0CA 2AL5A 2D3IA 2F78A 3UK4A 4MLQA 3LBSA 5IGAA 1YCJA 3ZS6A 5DVFA 4DCXA 1SDXA 1MXYA 3V83A 4YZZA 4JVDA 1FRPA 4PFYA 1R6ZA 4NF8A 4KHZE 1IXGA 2HXWA 1P1UA 4F1VA 1JEUA 3LR1A 4G68A 2AYSA 4QSCA 3T0JA 3RYAA 1QGXA 1QUJA 2QFLA 4NWCA 2CMOA 1O64A 1S9TA 3TEPA 3FVGA 1DTGA 1IMFA 5H8SA 5EYFA 3KN7A 4YB5A 4DCYA 2R9JA 4GBWA 3RGYA 3T9UA 1MQJA 4O3AA 1M5DA 1FPEA 3G3FA 2Y7RA 4LP2B 1YYZA 1FTJA 4GD5A 1OVBA 1MDP1 4RNSA 4QRZA 4M1VA 4N6DA 3ONMA 1O63A 5ISUA 4RPOA 3BIGA 1IXIA 4PFBA 3FXUA 2UVIA 2Z22A 4JWYA 1FQCA 2H98A 1H44A 3WAEA 3O6HA 3V89B 2HEUA 1NUYA 2CEYA 3DRKA 5IAIA 2B3BA 1FPFA 1LGBC 4F39A 3KFMA 4QXDA 1FPKA 3E78A 4RA1A 2HXRA 1Z7NE 1NNPA 4ZS9A 2QS2A 3G7WA 2XX8A 2FBPA 3VLVA 4NWDA 5DEXB 2WEFA 4G8NA 3CRBA 1BKAA 4ELOA 3SKPA 4H5FA 5ICTA 4OWDA 4U23A 1NV2A 1IZ1A 1OLCA 1UTBB 4GX6A 3MPLA 4IO4A 2O1MA 1VE4A 4F3PA 5ITOA 2VD2A 3D4CA 3MP1A 3PD9A 1FQBA 2WYPA 5CC2A 2UXAA 4FATA 2WBDA 3KC0A 2M8CA 4M4GA 2HQ0A 1EZPA 2Z8EA 3CSBA 3ISPA 4GX4A 1FPJA 3TCHA 1FQAA 4PQJA 3Q29A 1JETA 1QUIA 2DVZA 3DELB 3H6VA 5LTCA 1LFIA 2JJKA 4MNPA 3IOVA 5L9SA 3CIJA 4BDQA 4OERA 4EDPA 2F8DA 4F1YA 4JBZA 3FUZA 4BDLA 1FPLA 3MZ9A 4NHBA 2W7YA 1TFAA 1FQEA 5AA2A 1HSJA 4ZE8A 2DP8A 5CM6A 2XX7A 4F2OA 5I2NB 3ILUB 3EKIA 1IXCA 5IM2A 3PD8A 1FPGA 4EF1A 3MP6A 2DWIA 5H8FA 4IO2A 4MLVA 2PX1A 4R6HA 5ET7A 1QW0A 4KFQA 3QYTA 4GXAA 2R8TA 3IOTA 5DW8A 3VXCA 4NF5B 3VE1B 2THIA 4KYEA 4JXIA 3SZPA 3MVZA 4XTCQ 3DLNA 3RPLB 4JSDA 1LB8A 4Q0CA 4NMYA 1H3DA 1FBDA 2OLBA 4Q8RA 3FXBA 3K02A 3G3KA 3LUYA 3EHSA 3TTMA 3EPEA 5CBSA 4XEQA 3V5AA 1PBPA 5F7VA 5H8NA 5H8HA 5AA2B 1R1NA 4NN3A 4N13A 2Y5LA 5DEXA 1ZTYA 3CFZA 5FHNA 4XIGQ 4P3LA 4DXUA 3MSTA 4GLIA 1MQHA 4E0XA 2RF1A 3QXMA 4O7MA 3TTKA 2F5XA 1Y1MA 1Q35A 4GWUA 4TOZA 1NI9A 4HE2A 1DK4A 4X1BA 1MRPA 4QSDA 3BFUA 4YICA 3GLBA 1MXUA 3I6VA 3SESA 2DE3A 5ET5A 3U93A 2Z8FA 3VDFA 2P0SA 3O9PA 4MH5A 3VVFA 4NF8B 5L9OA 4ND9A 1GR2A 1FBHA 5A5XB 1FPBA 3MZ1A 1I69A 3PUVE 3P7IA 3B6TA 3VVEA 2O1LA 1M5CA 1B0LA 2B3FA 4MIJA 2AIXA 3PTYA 4FAJA 2R71A 2XHDA 1CNQA 1LAGE 2ABHA 3RLFE 4OVSA 3EF7A 3FZVA 3B6WA 4QSEA 3FJGA 4EQ9A 1IUDA 1QKAA 3PAMA 1I6QA 4R2FA 3N26A 3S4UA 1S50A 5IZ1A 1FCKA 3SEWA 3I5OA 3FD3A 2WKYA 4LONB 1GTKA 1SYIA 4FECA 1NV1A 4F1UA 5TPAB 1SI0A 3U94A 4O3BA 1MXZA 4EXLA 2PFZA 1BK4A 4EQ7A 4QHQA 2HAVA 4LATA 1B51A 2CZHA 4I9DA 1OQHA 3B50A 1Q9DA 4G8MA 4DI4B 2QRYA 4I3YA 5I2KB 3U72A 5LOMA 5ESYA 1MY3A 5FTHA 1Z7ME 2V25A 3ECRA 2NXOA 3MWBA 4HE0A 3O6IA 3PPQA 1O7TA 3H6UA 3DRHA 4OEUA 4RK9A 4MNIA 3S9EA 4F3SA 1IMDA 3FBPA 4ECFA 2I58A 1B5HA 2O84X 4F22A 3S9NC 4GWOA 4H67A 2ANJA 3G3GA 3KEIA 5I56A 4IY5A 3H6WA 4C1UA 2GH9A 5DVJA 1RDYA 1MG1A 2DWJA 3SEUA 1FPIA 3OEMA 3VXBA 3UGWA 5JK4A 3T9VA 5DT6A 4Q5TA 1D9QA 4E0WA 3KBRA 2QMWA 3PUXE 4WEDA 1S7YA 2P3NA 3FV1A 1Y9UA 3HSTA 5CMBA 2WOKA 1FBEA 2O7UA 2WYKA 1NUZA 1B3LA 4DLDA 2HZKA 4KXPA 2IA4A 1RDZA 4IGTA 1VR5A 4ZECA 2G93A 3E3KA 1UTBA 4YU0A 1Y3NA 5AE4A 2HFBA 5M2VA 1I6BA 1YXIA 1B7ZA 2X26A 1ANFA 1T0KA 3C31A 3BBRA 3TDJA 1QUKA 1FTAA 3TTLA 4N8GA 4OANA 4DXBA 3TCGA 5I7IA 3OELA 4N17A 5EHSA 1LBCA 1N7WA 4BDRA 4OYVA 5I57A 3KG2A 4PTKA 4H46A 1P1QA 4QF9A 3CHGA 3PMXA 4ZZAA 3RTFB 2F3BA 4R2BA 2HHMA 4H6DA 4PC9A 3VLUA 4PAFA 2ESNA 3EQ1A 4GQOA 4LZ8A 4X1DA 3MP8A 1L5TA 2VT5A 4O3CA 1P1OA 2PFYA 2F34A 3RYDA 4P0IA 1LBVA 2YLNA 3OEKA 1TFDA 1II5A 3CFXA 3IJOB 3I3VA 2H9BA 3JV9A 2PBWA 1FW0A 3SETA 3C32A 3OMBA 3O6PA 2VPNA 3DM0A 1H45A 4MX6A 1B46A 5KCJB 1JEVA 2OJTA 4Z0IA 1GVCA 3KSXA 4IGRA 4GWYA 3LSLA 2ONRA 2V3QA 2VD3A 1FQDA 2F36A 4P9KA 3S2VA 4X8RA 1EU8A 2ZYKA 3QAXA 5IZ3B 2I48A 1SBPA 1IEJA 4ZZEA 2OBGA 4HE1A 4OEVA 5IZ3A 2NWJA 1UIVA 4GWSA 4LQ2A 2A5SA 4GOTA 1DPEA 1URDA 2V3UA 3UN6A 4QFKA 5L8DA 1PBQA 4ELPA 2KQZA 2QL3A 3QSLA 2UVGA 3TFLA 4G61A 2I49A 3TMGA 2X7QA 2L5VA 3KN3A 4ZDMA 2Q2AA 1N3WA 4IO6A 3OD7A 2F7BA 1MQDA 3SERA 3TUSA 1MH4A 4GBVA 4OFJA 4H45A 4FIMA 1B3HA 3R6UA 3CG1A 5KDTB 1YTVA 2LAOA 3JZJA 2O69A 2KLFA 1JNFA 2PT1A 5I5PA 2PVUA 1IQ7A 4LA9A 1NV3A 3OSRA 5KCJA 2UYFA 2DSFA 4MAGA 3SEVA 1LBXA 4PAKA 3KOSA 1INPA 4BDMA 3IFAA 2O68A 4LZ5A 4F19A 2GRVA 1HSEA 2R6GE 4BDOA 3GXAA 2FNCA 1B7HA 3C34A 4WXJA 3TCFA 1LLSA 1XS5A 2D21A 4NAPA 4PFUA 4POWA 1DTZA 4LZ7A 5I58A 3A3UA 3G3JA 1QVSA 1B32A 1Y20A 3QK6A 4U1OA 4X48A 4XF5A 3CR9A 1BIYA 1DPPA 3OO8A 2XWKA 1MXXA 1UIUA 1LAXA 1EYIA 4Z7EA 4AQ4A 4MNCA 3V8XB 3AXFA 3HV1A 5K2XA 3NOHA 1TT1A 1AL3A 3H7MA 2RKMA 3LUZA 1QJMA 5B70A 3RYBA 1VSOA 4R74A 1POY1 1TWYA 3JYRA 3L6HA 3R26A 4PF6A 2DVCA 4PFTA 3LV0A 2Q9TA 2WBBA 2Y84A 3KJ7A 3UIFA 4H1XA 4RJZA 2VHAA 1P1WA 4H65A 1VFDA 1XT8A 2O6AA 4YAHX 1XI6A 2F6PA 1B5JA 4MCOA 4GIZA 5TP9A 4AB5A 1FTKA 4NF4B 2RCBA 4KQPA 4I8CA 4N4UA 3RT6B 1A99A 2OZZA 3DRIA 1PB8A 4ELQA 1PDAA 2DWHA 4C0RA 4DE8A 5CBRA 2A5TB 4NQ8A 3OO6A 4ZEBA 3O29A 3PUZE 2UVHA 1N76A 4U21A 4JVIA 2RC9A 4NG7A 1FJ6A 3USDA 4F3BA 1MM6A 3EHUA 5H8FB 1D3KA 3QUJA 5A5LA 3BIHA 4IR8A 3T22A 4GWZA 1POTA 3LC8A 1Q1KA 2FIEA 5HBCA 5TPAA 5KZTA 1ELJA 2P1SA 2QMXA 2I4CA 2DDKA 3MVXA 3FVOA 4FBPA 1DSNA 3ZKKA 4NE4A 4P8BA 1UTHA 5ET6A 4LN5A 1NH8A 3SEYA 1FSAA 2H4IA 5BUUA 1B6HA 4XKQA 4XKPA 3IOWA 1YZ0A 3C35A 4F31B 4ISUA 3ZKLA 3A3CA 4NTLA 1PB7A 4ZE9A 3FXRA 3HHFA 5I58B 3E13X 4P47A 1LCFA 1MPDA 3LVUA 3T9XB 1A8FA 3H03A 3TPAA 2WOLA 2H25A 2F6GA 1NL5A 4OVTA 4PBHA 5EQ8A 3T93B 4IO7A 1AMFA 5H8HB 1B40A 4FEBA 3S9MC 4GVOA 3RT8A 4HS7A 3UORA 4NF6B 3RNNA 4R72A 1FTMA 3B8BA 1MY4A 4KYDA 3K2DA 1M5FA 2P3VA 3IO4A 3S9LC 3PMWA 3K4UA 3MZBA 3FVKA 2Q8JA 4IO5A 2B4MA 3K01A 3U8QA 4DIGA 1JW4A 5FHOA 3HN0A 2PMSA 2NUVA 2Q88A 4KCDA 5HPQA 3O6GA 2O51A 1IMCA 3ZSFA 3FJ7A 4I62A 5B7DA 4IY6A 3O2AA 1LB9A 5EYHA 5ICQA 1IXHA 5EYGA 3PGFA 3PPOA 4XKNA 4F29A 4OQOA 1IIWA 4OESA 3MVWA 1URSA 3IX1A 4LUBA 1WVJA 4PCDA 4G68C 2RC8A 5ET8A 1VFEA 3THIA 2VGQA 2B4LA 3FASA 2QS3A 3LSXA 3PMVA 2ZYMA 5DTBA 4ONYA 1NV6A 3RTWB 3MW0A 2GHBA 4OXVA 3L6GA 3VV5A 1HSLA 1F9BA 1AIVA 3QIMA 2ZZVA 3K0VA 4TLMB 3K1MA 2O7IA 2FIXA 3IFCA 4FE8A 4DDDA 3OOAA 3O97A 5K2YA 2RC7A 3MQ9A 4NF5A 1I6AA 2DWAA 1Y3QA 1NH7A 2VPOA 1MPBA 3DRGA 3HPIA 4IO3A 1JW5A 4P1EA 3M3LA 2ONSA 1G0HA 1Y4CA 4PAIA 1SI1A 4ZEKA 5T3JA 1FBCA 2UVJA 3M8UA 4I40A 4JVCA 2I0BA 2P2AA 2QS1A 4G2ZA 1FBPA 2E0SA 3ODBA 4YB7A 1N0TA 1Y3PA 4H0WA 1YAEA 1XC1A 2PYYA 5EHMA 4ELRA 4R73A 4XFEA 2I3VA 2KR0A 3DRFA 2WX9A 4RPNA 4XKRA 2FVZA 1B3EA 3B6QA 3H3GA 2F97A 3TQWA 3PPPA 1H43A 5H8QB 4QFPA 4EQBA 2Y7PA 4YMAA 2XA5A 3FV2A 4QFNA 4TQUQ 4N91A 3C33A 3CSGA 5AA3A 3RPLA 3H4ZA 4YKIA 1NUWA 1LEVA 1EH3A 1ZLQA 4LQ5A 5L9MA 2AL4A 1LBZA 1MPCA 4AS5A 4YMBA 1D9VA 1TXFA 2ONKE 4R6YA 1LBBA 3H06B 2XXUA 4QBAA 2Y5KA 2B65A 5DYHA 3DP8A 5F24A 2XXIA 2XX9A 1MQGA 1B4ZA 1FTLA 2HAUA 3RN8A 3T1BA 1EZOA 4GWWA 3GBAA 3QMFA 2QJEA 1IMEA 5JEIA 2OX3A 2YJPA 4EXKA 5J1DA 4GRKA 1ZIUA 4OHNA 1SD3A 4HXVA 3E4RA 3ROJA 1G0IA 3TELA 4N15A 3CG3A 3H6TA 4EF2A 4KPTA 5I57B 3DRJA 1FJ9A 3CFLA 1DCUA 4NF4A 3KJTA 4P0GA 2HZLA 1MM7A 4I3EA 2D5WA 4G68B 3UP9A 1PEBA 4FORA 1AOVA 5H8QA 2Q74A 4N81A 3CVGA 3Q27A 4P56A 3R7XA 1M5EA 5I84A 1NFTA 4HTGA 1LFHA 3D4GA 4O7IA 4OVPA 5EQAA 3E9XA 1P1NA 4G8HA 4PFRA 2X7PA 2XXHA 2YPNA 2V4CA 4OTEA 4I1DA 5FBPA 4OENA 1B9JA 4R6KA 4YB6A 3N5LA 2GFEA 4OZ9A 2DE2A 5EQ7A 3TTRA 4KCCA 2XXYA 3KOTA 4PGPA 2NVUB 3OO7A 3C36A 3MJNA 1MY2A 4F18A 3G3HA 2F7AA 1B58A 1VDWA 4GL0A 2G29A 5CMCA 1MY1A 5CMKA 1J1NA 4PDDA 1ZBMA 4KR5A 3HO7A 5LDZA 2MKZA 2Q2CA 4JWXA 3CI8A 4O8MA 4C1TA 1NMUA 1B5IA 3RQTA 1MS7A 4RK2A 4RYAA 4RY1A 1A40A 2DE4A 4F2QA 1Y1ZA 5KDTA 4MEVA 2F3DA 2PT2A 1NV4A 3VVDA 1A7LA 2FA7A 3W9WA 3MBPA 4QFOA 1NV5A 4YKKA 2OWTA 2I4BA 1D9YA 1B52A 3KN8A 1MH3A 2DYXA 2V93A 1US4A 4POXA 2BJIA 1NV0A 5I59B 1A54A 3MUQA 3PUYE 1FBFA 3HHGA 2E1SA 1NUXA 2QS4A 2CZLA 2XXVA 2DXYA 3K6XA 5H8NB 3N6UA 3FGSA 1USYE 3IJXB 4LVQA 4H5GA 2H99A 2XXQA 4GFRA 3SEXA 2XXTA 3GYYA 3VFJA 1ZU0A 4HCWA 1SW4A 4OFOA 4GF8A
chains in the Genus database with same CATH topology
1QKBA 3OENA 2I0CA 3O6IA 5H8HB 4KD5A 2AL5A 2D3IA 1O7TA 3PPQA 3H6UA 4ESWA 4OMBA 1B40A 3DRHA 4OEUA 5F1QA 2F78A 2V84A 4RK9A 3UK4A 4MLQA 3S9EA 4NEDA 4FEBA 3S9MC 3LBSA 1DMBA 4GVOA 4F3SA 1YCJA 1SYHA 3ZS6A 4HW8A 1B0HA 4ECFA 1B1HA 3RY3A 4JDFA 3RT8A 5DVFA 4HS7A 4DCXA 2I58A 3UORA 1B5HA 1SDXA 3EHTA 5IKBA 1MXYA 2O84X 3GZGA 2XXWA 3V83A 4YZZA 4F22A 4NF6B 3W15C 1GV8A 3RNNA 3S9NC 2ZMBA 4GWOA 4H67A 2ANJA 3G3GA 4R72A 3UA8A 3KEIA 1FTMA 5I56A 2FYIA 1N04A 1JVYA 4PFYA 1MY4A 1R6ZA 3H6WA 4IY5A 3K2DA 3BKIB 1D4NA 1M5FA 4KYDA 5ELVA 3N94A 4NF8A 1XVXA 4KHZE 3IO4A 1IXGA 2GH9A 3S9LC 2HXWA 5DVJA 3PMWA 1MG1A 2DWJA 3SEUA 4FEDA 3K4UA 3MZBA 1P1UA 3FVKA 3OEMA 4MF3A 4F1VA 1JEUA 3LR1A 4G68A 2AYSA 4QSCA 1ZMGA 2Q8JA 4IO5A 3UGWA 2B4MA 3K01A 2ZNSA 5DT6A 4Q5TA 3T9VA 3U8QA 5JK4A 4DIGA 1JW4A 3RYAA 3KBRA 5FHOA 2QMWA 3HN0A 3TODA 2PMSA 2NUVA 4E0WA 5AA4A 4AB6A 2Q88A 1QUJA 1PC3A 4WEDA 2DXRA 1S7YA 3FV1A 2OWSA 3K00A 3PUXE 4KCDA 4BDNA 3O6GA 5DVIA 1Y9UA 5HPQA 1RYOA 2O51A 3HSTA 5CMBA 2WOKA 3FJ7A 4I62A 4NWCA 2O7UA 3ZSFA 2IEEA 2CMOA 4DZ1A 1O64A 1P99A 1B3LA 4DLDA 1S9TA 5B7DA 4IY6A 3TEPA 2HZKA 4DXCA 1Y4TA 2IA4A 3O2AA 1JW1A 4IGTA 1VR5A 1LB9A 3FVGA 5ICQA 4ZECA 3O28A 2G93A 3E3KA 1DTGA 1IXHA 1NNTA 1UTBA 3PGFA 4YU0A 1Y3NA 5AE4A 3PPOA 2HFBA 1BP5A 5M2VA 1GGGA 1I6BA 5H8SA 4XKNA 1KWHA 5EYFA 2XXXA 3KN7A 1B7ZA 4F29A 1CB6A 4YB5A 4OQOA 1IIWA 4OESA 4DCYA 2R9JA 1ANFA 2X26A 1T0KA 3MVWA 3C31A 1URSA 3RGYA 3BBRA 3T9UA 3IX1A 1MQJA 1NKXA 4LUBA 1M5DA 1WVJA 4O3AA 5CRYA 3TDJA 1B1XA 3G3FA 1QUKA 4G68C 2RC8A 2Y7RA 1VFEA 3TTLA 4LP2B 1OQGA 3THIA 1FTJA 2A5TA 1OVBA 2B4LA 3TCGA 1MDP1 2VGQA 3O66A 4GD5A 4RNSA 4DXBA 3FASA 3OELA 4QRZA 2QS3A 3LSXA 3PMVA 4MFIA 4BLAA 2ZYMA 4M1VA 5EHSA 1LBCA 1N3XA 1N7WA 5DTBA 4N07A 4ONYA 4BDRA 3RTWB 3ONMA 4OYVA 3MW0A 5I57A 2GHBA 3KG2A 1O63A 2QPQA 3L6GA 4OXVA 3TZAA 3VV5A 5ISUA 1P1QA 1FQFA 1HSLA 1F9BA 4QF9A 2XXPA 1B4HA 3CHGA 4RPOA 4X9TA 3QIMA 1IXIA 3PMXA 4UACA 3FXUA 2UVIA 2Z22A 4JWYA 3K1NA 4TLMB 1FQCA 3K0VA 4ZZAA 3K1MA 2H98A 2VP1A 1H44A 3RTFB 2O7IA 3WAEA 4R2BA 4H6DA 4ELRA 1MXWA 3O6HA 4U4XA 1A55A 1LFGA 3VLUA 3V89B 3Q26A 2ESNA 2HEUA 3DRKA 4FE8A 4DDDA 3EQ1A 5IAIA 2DS9A 3OOAA 3O97A 2Y7KA 2F7CA 4GQOA 5K2YA 3T96B 4LZ8A 2OCUA 3MP8A 4X1DA 1L5TA 2RC7A 2B3BA 2RINA 3MQ9A 4NF5A 1I6AA 2DWAA 3K6VA 1P1OA 4O3CA 4P11A 4GL8A 1LGBC 1Y3QA 2F34A 1NH7A 4P0IA 4F39A 3KFMA 2YLNA 3OEKA 5A5XA 1MPBA 1TFDA 5I59A 3DRGA 4RA1A 1II5A 3CFXA 3HPIA 4R9GA 4YKJA 4U4SA 3WAFA 1SW5A 3IJOB 1Z7NE 4JB7A 1SVXB 3I3VA 4IO3A 1NNPA 2H9BA 4ZS9A 3JV9A 2PBWA 2QS2A 3G7WA 2XX8A 4H8JA 1FW0A 1JW5A 1URGA 3SETA 3M3LA 2ONSA 1Y4CA 3C32A 3OMBA 5AA2D 3VLVA 4NWDA 4HCYA 5DEXB 3O6PA 2I6EA 3MPKA 4G8NA 3CRBA 1SI1A 4ZEKA 1LCTA 2ZYOA 1BKAA 1M5BA 3A09A 3DM0A 2UVJA 3M8UA 1H45A 3PPRA 4ELOA 3GBBA 2I0BA 3PV0E 3SKPA 4H5FA 1B46A 5ICTA 5KCJB 1JEVA 2P2AA 2QS1A 2OJTA 4Z0IA 3FXQA 4PFWA 4G2ZA 1GVCA 4OWDA 4U23A 3KSXA 4IGRA 2E0SA 1IZ1A 3ODBA 4YB7A 1N0TA 1OLCA 1Y3PA 4H0WA 1UTBB 3LSLA 1YAEA 1XC1A 2ONRA 2PYYA 4IB2A 4YKPA 3MPLA 4IO4A 2O1MA 1VE4A 5EHMA 2V3QA 2VD3A 1OMPA 3K6WA 1SW1A 3OO9A 4OFLA 1FQDA 2F36A 4L17A 4R73A 4F3PA 2I3VA 2WOPA 3FIRA 3DRFA 3W9VA 5ITOA 1ZJLA 2VD2A 4QFLA 3Q25A 4RPNA 4XKRA 2Q89A 1B3EA 3S2VA 2XXRA 1N84A 3D4CA 3MP1A 3B6QA 3PD9A 2XD2A 2REGA 1FQBA 1EU8A 3H3GA 2BJJX 2ZYKA 5CC2A 2F97A 2UXAA 4FATA 4H8IA 2M8CA 3TQWA 3PPPA 4M4GA 2HQ0A 1EZPA 2Z8EA 3CSBA 3QAXA 1H43A 4THIA 2UYEA 4QFPA 5H8QB 4FJPA 2I48A 3TCHA 1FQAA 1LSTA 1SBPA 4EQBA 4PQJA 3QUFA 3Q29A 1IEJA 1JETA 4F3GA 4ZZEA 2Y7PA 2OBGA 3DP6A 4YMAA 3FV2A 1QUIA 5JTYB 4OEVA 1EZ9A 3U92A 2NWJA 2GHAA 1UIVA 2DVZA 3DELB 5BWJA 4ZEDA 3H6VA 1LFIA 4LQ2A 4QFNA 4TQUQ 2A5SA 3C33A 4GOTA 3FJMA 3CSGA 3IOVA 1DPEA 5AA3A 1URDA 2V3UA 5L9SA 3UN6A 3H4ZA 3CIJA 4QFKA 5L8DA 4YKIA 1MQIA 3PUWE 1PBQA 1EH3A 4PP0A 4ELPA 1ZLQA 4OERA 4BDQA 4EDPA 4LQ5A 2F8DA 5L9MA 2QL3A 3QSLA 4F1YA 2AL4A 2UVGA 4JBZA 3TFLA 5AA4B 1IITA 1MPCA 3FUZA 2I49A 4BDLA 3TMGA 2X7QA 2DQVA 3M3KA 1RYXA 3MZ9A 1A8EA 4YMBA 1D9VA 1TXFA 2W7YA 1NNKA 1LBBA 2ONKE 3IB1A 1TFAA 3H06B 3KN3A 1FQEA 4PE5B 2XXUA 4R6YA 4ZDMA 2Q2AA 2B65A 1N3WA 4U22A 5DYHA 4IO6A 3IAZA 3DP8A 5AA2A 2XXIA 5TP9B 1HSJA 3OD7A 2F7BA 1WDNA 2XX9A 1MQGA 1MQDA 3SERA 1XVYA 4ZE8A 3TUSA 1MH4A 1B4ZA 2DP8A 1FTLA 1B7UA 4OFJA 2HAUA 5CM6A 3RN8A 2XX7A 4F2OA 4FIMA 1EZOA 3RUMA 5I2NB 1B3HA 3GBAA 3R6UA 3CG1A 5KDTB 1YTVA 2LAOA 3ILUB 3BFTA 1IXCA 2QJEA 3JZJA 2O69A 4JSOA 2KLFA 1JNFA 2PT1A 3PD8A 3MP6A 4EF1A 2DWIA 2PVUA 3KGCA 5H8FA 5JEIA 1IQ7A 4IO2A 4WEPA 4LA9A 2YJPA 1LAFE 4MLVA 3TAJA 2ZNUA 2PX1A 3OSRA 4R6HA 2UYFA 2DSFA 3C4MA 3SEVA 4GRKA 1ZIUA 4E0XA 4EXKA 4OHNA 3KOSA 5J1DA 1SD3A 3PU5A 1QW0A 4KFQA 3QYTA 1JVXA 4GXAA 3E4RA 3IOTA 4BDMA 3TELA 2O68A 3VXCA 4LZ5A 4NF5B 3CG3A 3VE1B 2THIA 3H6TA 4F19A 4KYEA 4JXIA 4EF2A 2GRVA 4KPTA 1HSEA 4NF6A 4R9FA 2Y7WA 3MVZA 5I57B 3DRJA 2R6GE 4XTCQ 3DLNA 4JSDA 1LB8A 4Q0CA 4BDOA 1US5A 3CFLA 3GXAA 4NF4A 2FNCA 1H76A 4NMYA 2XD3A 3KJTA 1B7HA 4P0GA 2HZLA 3C34A 1MM7A 1H3DA 2V3TA 4WXJA 3MAMA 4G4PA 3TCFA 2D5WA 2OLBA 5FTIA 1LLSA 1XS5A 5I2KA 2D21A 1MDQA 4G68B 4Q8RA 3UP9A 1PEBA 3IORA 4FORA 1AOVA 3K02A 3G3KA 3LUYA 5H8QA 4PFUA 4POWA 1DTZA 3CVGA 3LSFB 3Q27A 4LZ7A 5I58A 3FVNA 3R7XA 4MBPA 5JTYA 3EHSA 1M5EA 5I84A 3A3UA 1NFTA 4HTGA 3G3JA 3TTNA 3TTMA 3EPEA 1CE2A 2Z8DA 5CBSA 1LFHA 3D4GA 1QVSA 3E9XA 3IR1A 1B32A 1XOCA 1P1NA 1Y20A 3QK6A 3V5AA 4G8HA 1PBPA 5F7VA 4ESXA 2X7PA 4U1OA 2XXHA 2YPNA 4OTEA 1UTHB 5H8NA 5H8HA 4X48A 1AIVA 3CR9A 1BIYA 4I1DA 5AA2B 4OENA 1DPPA 1R1NA 4Q30B 3OO8A 4N13A 3DP4A 2ZXTA 1B9JA 1MXXA 2QSXA 3G3IA 4R6KA 4YB6A 1UIUA 3N5LA 5CMMA 5DEXA 1LAXA 1B05A 4Z7EA 1ZTYA 4AQ4A 3IK6B 3CFZA 5FHMA 2GFEA 4OZ9A 5FHNA 3V8XB 1B2HA 1OLAA 3AXFA 3HV1A 2DE2A 5K2XA 1TT1A 1AL3A 4XIGQ 3TQLA 3H7MA 3M3FA 4OVJA 2RKMA 4DXUA 1NNFA 4GLIA 1MQHA 1USYH 4ZEFA 3TTRA 1QJMA 2RF1A 2XXYA 3KOTA 3RYBA 4KCCA 5B70A 3QXMA 3TTKA 2F5XA 2NVUB 3OO7A 1VSOA 1Y1MA 1Q35A 3VLWA 5I2NA 2REJA 4TOZA 4R74A 1POY1 1TWYA 3JYRA 3L6HA 4X1BA 3N6TA 2I3WA 3C36A 3R26A 1MRPA 3MJNA 3U1OA 4QSDA 2DVCA 4PFTA 1MY2A 3BFUA 5TU0A 2Q9TA 4YICA 4F18A 3GLBA 3G3HA 5KCJA 2F7AA 2Y84A 3IB0A 3KJ7A 3T9HB 3UIFA 1JQFA 1B58A 1MXUA 3I6VA 1PB9A 4H1XA 1SW2A 3RPWA 3IB2A 1MXVA 4RJZA 3SESA 4GL0A 2DE3A 2G29A 1P1WA 2NOOA 2VHAA 4H65A 5CMCA 1MY1A 2RCAA 2VOZA 1VFDA 3U93A 1XT8A 4OETA 2O6AA 4KI0E 4YAHX 3HCQA 2Z8FA 4R75A 4KYSA 5CMKA 1J1NA 3VDFA 2P0SA 3O9PA 3OSQA 2F6PA 3C9HA 1B5JA 4MH5A 3VVFA 1ZBMA 1B3FA 2Y7IA 4NF8B 3LSWA 4KR5A 1SQYA 4GIZA 3K1PA 5L9OA 5TP9A 4AB5A 1FTKA 3HO7A 4ND9A 2Q2CA 1BTJA 4JWXA 2RCBA 4GXSB 1GR2A 4KQPA 4NF4B 4I8CA 3CI8A 4U1ZA 5A5XB 3RT6B 3MZ1A 1A99A 3FTOA 1I69A 1NMUA 2OZZA 3PUVE 1B5IA 3ILTB 4C1TA 3DRIA 1PB8A 3P7IA 3B6TA 3VVEA 2O1LA 3EN3A 1PDAA 4WKMA 2DWHA 4ELQA 1M5CA 3RQTA 1B0LA 1MS7A 2B3FA 4C0RA 1B3GA 4RK2A 4DE8A 2AIXA 4RYAA 2ZNTA 5CBRA 3KZGA 4RY1A 4FAJA 1A40A 2R71A 2A5TB 1LAGE 1DOTA 2ABHA 2XHDA 3RLFE 3OO6A 4ZEBA 3F11A 3EF7A 3O29A 2UVHA 3PUZE 3FZVA 3B6WA 1BLFA 1ATGA 1N76A 2DE4A 4U21A 4QSEA 4F2QA 2RC9A 3FJGA 1LAHE 1Y1ZA 4EQ9A 1IUDA 1QKAA 3PAMA 1I6QA 5ITPA 1MY0A 3IOUA 5KDTA 2DOJA 1XHYA 4R2FA 3USDA 4RXLA 3N26A 1OIBA 2Z23A 3S4UA 4F3BA 1MM6A 3EHUA 5HM4B 2PT2A 1N7XA 3K6UA 1S50A 5H8FB 1FCKA 3SEWA 3VVDA 1D3KA 1A7LA 4XXUA 2FA7A 3IL1B 3QUJA 3W9WA 3I5OA 3MBPA 3T22A 1R9QA 4QFOA 1WODA 3FD3A 3FATA 1POTA 1ZKBA 2WKYA 3LC8A 1Q1KA 4YKKA 4LONB 1GTKA 2OWTA 2I4BA 5I56B 1D9YA 1SYIA 2OK2A 3MC2A 4FECA 5HBCA 3KSJA 1B52A 5TPAA 5KZTA 3T66A 3KN8A 4F1UA 2H5YA 1ELJA 1MH3A 1YPNA 2DYXA 2V93A 5TPAB 1US4A 1AH5A 1SI0A 4POXA 3TKDA 2P1SA 2QMXA 4PETA 2I4CA 3U94A 1A54A 5I59B 3MUQA 4O3BA 3PUYE 2HCAA 4G77A 3MVXA 3FVOA 2ALUA 4TLLB 3HHGA 1OVTA 3MVYA 1DSNA 2E1SA 3ZKKA 1MXZA 2QS4A 2CZLA 2XXVA 5CI5A 2DXYA 4NE4A 4EXLA 3K6XA 4EQ7A 4QHQA 1UTHA 2HAVA 4LATA 5H8NB 1B51A 3N6UA 1NH8A 3SEYA 5AA1A 4I9DA 4U2RA 2H4IA 1OQHA 3FGSA 3B7DA 4JWOA 4K3FA 5BUUA 1B6HA 4XKQA 4XKPA 3IOWA 4G8MA 1USYE 2QRYA 3C35A 3IJXB 5I2KB 1UQWA 3U72A 3TYHA 5LOMA 3VXBA 4LVQA 4H5GA 4F31B 4ISUA 1MY3A 1QULA 2H99A 3A3CA 5FTHA 3ZKLA 3Q28A 4NTLA 1PB7A 4ZE9A 3FXRA 3HHFA 1Z7ME 5I58B 3E13X 2XXQA 4GFRA 3SEXA 1LCFA 4ZEIA 4C1UA 3OXNA 1MPDA 2V25A 3LVUA 2ZYNA 4EUOA 3IO6A 3SDFA 3T9XB 1A8FA 1FTOA 3H03A 3TPAA 3ECRA 2WOLA 1R9LA 2H25A 2NXOA 2F6GA 1NL5A 1RKMA 2XXTA 2F35A 3MWBA 1ZU0A 3PPNA 1SW4A 4HCWA 3VFJA 3T93B 4OFOA 4IO7A 4N6PA 4UA8A 1AMFA 4GF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKB A;  3OEN A;  2I0C A;  3O6I A;  5H8H B;  4KD5 A;  2AL5 A;  2D3I A;  1O7T A;  3PPQ A;  3H6U A;  4ESW A;  4OMB A;  1B40 A;  3DRH A;  4OEU A;  5F1Q A;  2F78 A;  2V84 A;  4RK9 A;  3UK4 A;  4MLQ A;  3S9E A;  4NED A;  4FEB A;  3S9M C;  3LBS A;  1DMB A;  4GVO A;  4F3S A;  1YCJ A;  1SYH A;  3ZS6 A;  4HW8 A;  1B0H A;  4ECF A;  1B1H A;  3RY3 A;  4JDF A;  3RT8 A;  5DVF A;  4HS7 A;  4DCX A;  2I58 A;  3UOR A;  1B5H A;  1SDX A;  3EHT A;  5IKB A;  1MXY A;  2O84 X;  3GZG A;  2XXW A;  3V83 A;  4YZZ A;  4F22 A;  4NF6 B;  3W15 C;  1GV8 A;  3RNN A;  3S9N C;  2ZMB A;  4GWO A;  4H67 A;  2ANJ A;  3G3G A;  4R72 A;  3UA8 A;  3KEI A;  1FTM A;  5I56 A;  2FYI A;  1N04 A;  1JVY A;  4PFY A;  1MY4 A;  1R6Z A;  3H6W A;  4IY5 A;  3K2D A;  3BKI B;  1D4N A;  1M5F A;  4KYD A;  5ELV A;  3N94 A;  4NF8 A;  1XVX A;  4KHZ E;  3IO4 A;  1IXG A;  2GH9 A;  3S9L C;  2HXW A;  5DVJ A;  3PMW A;  1MG1 A;  2DWJ A;  3SEU A;  4FED A;  3K4U A;  3MZB A;  1P1U A;  3FVK A;  3OEM A;  4MF3 A;  4F1V A;  1JEU A;  3LR1 A;  4G68 A;  2AYS A;  4QSC A;  1ZMG A;  2Q8J A;  4IO5 A;  3UGW A;  2B4M A;  3K01 A;  2ZNS A;  5DT6 A;  4Q5T A;  3T9V A;  3U8Q A;  5JK4 A;  4DIG A;  1JW4 A;  3RYA A;  3KBR A;  5FHO A;  2QMW A;  3HN0 A;  3TOD A;  2PMS A;  2NUV A;  4E0W A;  5AA4 A;  4AB6 A;  2Q88 A;  1QUJ A;  1PC3 A;  4WED A;  2DXR A;  1S7Y A;  3FV1 A;  2OWS A;  3K00 A;  3PUX E;  4KCD A;  4BDN A;  3O6G A;  5DVI A;  1Y9U A;  5HPQ A;  1RYO A;  2O51 A;  3HST A;  5CMB A;  2WOK A;  3FJ7 A;  4I62 A;  4NWC A;  2O7U A;  3ZSF A;  2IEE A;  2CMO A;  4DZ1 A;  1O64 A;  1P99 A;  1B3L A;  4DLD A;  1S9T A;  5B7D A;  4IY6 A;  3TEP A;  2HZK A;  4DXC A;  1Y4T A;  2IA4 A;  3O2A A;  1JW1 A;  4IGT A;  1VR5 A;  1LB9 A;  3FVG A;  5ICQ A;  4ZEC A;  3O28 A;  2G93 A;  3E3K A;  1DTG A;  1IXH A;  1NNT A;  1UTB A;  3PGF A;  4YU0 A;  1Y3N A;  5AE4 A;  3PPO A;  2HFB A;  1BP5 A;  5M2V A;  1GGG A;  1I6B A;  5H8S A;  4XKN A;  1KWH A;  5EYF A;  2XXX A;  3KN7 A;  1B7Z A;  4F29 A;  1CB6 A;  4YB5 A;  4OQO A;  1IIW A;  4OES A;  4DCY A;  2R9J A;  1ANF A;  2X26 A;  1T0K A;  3MVW A;  3C31 A;  1URS A;  3RGY A;  3BBR A;  3T9U A;  3IX1 A;  1MQJ A;  1NKX A;  4LUB A;  1M5D A;  1WVJ A;  4O3A A;  5CRY A;  3TDJ A;  1B1X A;  3G3F A;  1QUK A;  4G68 C;  2RC8 A;  2Y7R A;  1VFE A;  3TTL A;  4LP2 B;  1OQG A;  3THI A;  1FTJ A;  2A5T A;  1OVB A;  2B4L A;  3TCG A;  1MDP 1;  2VGQ A;  3O66 A;  4GD5 A;  4RNS A;  4DXB A;  3FAS A;  3OEL A;  4QRZ A;  2QS3 A;  3LSX A;  3PMV A;  4MFI A;  4BLA A;  2ZYM A;  4M1V A;  5EHS A;  1LBC A;  1N3X A;  1N7W A;  5DTB A;  4N07 A;  4ONY A;  4BDR A;  3RTW B;  3ONM A;  4OYV A;  3MW0 A;  5I57 A;  2GHB A;  3KG2 A;  1O63 A;  2QPQ A;  3L6G A;  4OXV A;  3TZA A;  3VV5 A;  5ISU A;  1P1Q A;  1FQF A;  1HSL A;  1F9B A;  4QF9 A;  2XXP A;  1B4H A;  3CHG A;  4RPO A;  4X9T A;  3QIM A;  1IXI A;  3PMX A;  4UAC A;  3FXU A;  2UVI A;  2Z22 A;  4JWY A;  3K1N A;  4TLM B;  1FQC A;  3K0V A;  4ZZA A;  3K1M A;  2H98 A;  2VP1 A;  1H44 A;  3RTF B;  2O7I A;  3WAE A;  4R2B A;  4H6D A;  4ELR A;  1MXW A;  3O6H A;  4U4X A;  1A55 A;  1LFG A;  3VLU A;  3V89 B;  3Q26 A;  2ESN A;  2HEU A;  3DRK A;  4FE8 A;  4DDD A;  3EQ1 A;  5IAI A;  2DS9 A;  3OOA A;  3O97 A;  2Y7K A;  2F7C A;  4GQO A;  5K2Y A;  3T96 B;  4LZ8 A;  2OCU A;  3MP8 A;  4X1D A;  1L5T A;  2RC7 A;  2B3B A;  2RIN A;  3MQ9 A;  4NF5 A;  1I6A A;  2DWA A;  3K6V A;  1P1O A;  4O3C A;  4P11 A;  4GL8 A;  1LGB C;  1Y3Q A;  2F34 A;  1NH7 A;  4P0I A;  4F39 A;  3KFM A;  2YLN A;  3OEK A;  5A5X A;  1MPB A;  1TFD A;  5I59 A;  3DRG A;  4RA1 A;  1II5 A;  3CFX A;  3HPI A;  4R9G A;  4YKJ A;  4U4S A;  3WAF A;  1SW5 A;  3IJO B;  1Z7N E;  4JB7 A;  1SVX B;  3I3V A;  4IO3 A;  1NNP A;  2H9B A;  4ZS9 A;  3JV9 A;  2PBW A;  2QS2 A;  3G7W A;  2XX8 A;  4H8J A;  1FW0 A;  1JW5 A;  1URG A;  3SET A;  3M3L A;  2ONS A;  1Y4C A;  3C32 A;  3OMB A;  5AA2 D;  3VLV A;  4NWD A;  4HCY A;  5DEX B;  3O6P A;  2I6E A;  3MPK A;  4G8N A;  3CRB A;  1SI1 A;  4ZEK A;  1LCT A;  2ZYO A;  1BKA A;  1M5B A;  3A09 A;  3DM0 A;  2UVJ A;  3M8U A;  1H45 A;  3PPR A;  4ELO A;  3GBB A;  2I0B A;  3PV0 E;  3SKP A;  4H5F A;  1B46 A;  5ICT A;  5KCJ B;  1JEV A;  2P2A A;  2QS1 A;  2OJT A;  4Z0I A;  3FXQ A;  4PFW A;  4G2Z A;  1GVC A;  4OWD A;  4U23 A;  3KSX A;  4IGR A;  2E0S A;  1IZ1 A;  3ODB A;  4YB7 A;  1N0T A;  1OLC A;  1Y3P A;  4H0W A;  1UTB B;  3LSL A;  1YAE A;  1XC1 A;  2ONR A;  2PYY A;  4IB2 A;  4YKP A;  3MPL A;  4IO4 A;  2O1M A;  1VE4 A;  5EHM A;  2V3Q A;  2VD3 A;  1OMP A;  3K6W A;  1SW1 A;  3OO9 A;  4OFL A;  1FQD A;  2F36 A;  4L17 A;  4R73 A;  4F3P A;  2I3V A;  2WOP A;  3FIR A;  3DRF A;  3W9V A;  5ITO A;  1ZJL A;  2VD2 A;  4QFL A;  3Q25 A;  4RPN A;  4XKR A;  2Q89 A;  1B3E A;  3S2V A;  2XXR A;  1N84 A;  3D4C A;  3MP1 A;  3B6Q A;  3PD9 A;  2XD2 A;  2REG A;  1FQB A;  1EU8 A;  3H3G A;  2BJJ X;  2ZYK A;  5CC2 A;  2F97 A;  2UXA A;  4FAT A;  4H8I A;  2M8C A;  3TQW A;  3PPP A;  4M4G A;  2HQ0 A;  1EZP A;  2Z8E A;  3CSB A;  3QAX A;  1H43 A;  4THI A;  2UYE A;  4QFP A;  5H8Q B;  4FJP A;  2I48 A;  3TCH A;  1FQA A;  1LST A;  1SBP A;  4EQB A;  4PQJ A;  3QUF A;  3Q29 A;  1IEJ A;  1JET A;  4F3G A;  4ZZE A;  2Y7P A;  2OBG A;  3DP6 A;  4YMA A;  3FV2 A;  1QUI A;  5JTY B;  4OEV A;  1EZ9 A;  3U92 A;  2NWJ A;  2GHA A;  1UIV A;  2DVZ A;  3DEL B;  5BWJ A;  4ZED A;  3H6V A;  1LFI A;  4LQ2 A;  4QFN A;  4TQU Q;  2A5S A;  3C33 A;  4GOT A;  3FJM A;  3CSG A;  3IOV A;  1DPE A;  5AA3 A;  1URD A;  2V3U A;  5L9S A;  3UN6 A;  3H4Z A;  3CIJ A;  4QFK A;  5L8D A;  4YKI A;  1MQI A;  3PUW E;  1PBQ A;  1EH3 A;  4PP0 A;  4ELP A;  1ZLQ A;  4OER A;  4BDQ A;  4EDP A;  4LQ5 A;  2F8D A;  5L9M A;  2QL3 A;  3QSL A;  4F1Y A;  2AL4 A;  2UVG A;  4JBZ A;  3TFL A;  5AA4 B;  1IIT A;  1MPC A;  3FUZ A;  2I49 A;  4BDL A;  3TMG A;  2X7Q A;  2DQV A;  3M3K A;  1RYX A;  3MZ9 A;  1A8E A;  4YMB A;  1D9V A;  1TXF A;  2W7Y A;  1NNK A;  1LBB A;  2ONK E;  3IB1 A;  1TFA A;  3H06 B;  3KN3 A;  1FQE A;  4PE5 B;  2XXU A;  4R6Y A;  4ZDM A;  2Q2A A;  2B65 A;  1N3W A;  4U22 A;  5DYH A;  4IO6 A;  3IAZ A;  3DP8 A;  5AA2 A;  2XXI A;  5TP9 B;  1HSJ A;  3OD7 A;  2F7B A;  1WDN A;  2XX9 A;  1MQG A;  1MQD A;  3SER A;  1XVY A;  4ZE8 A;  3TUS A;  1MH4 A;  1B4Z A;  2DP8 A;  1FTL A;  1B7U A;  4OFJ A;  2HAU A;  5CM6 A;  3RN8 A;  2XX7 A;  4F2O A;  4FIM A;  1EZO A;  3RUM A;  5I2N B;  1B3H A;  3GBA A;  3R6U A;  3CG1 A;  5KDT B;  1YTV A;  2LAO A;  3ILU B;  3BFT A;  1IXC A;  2QJE A;  3JZJ A;  2O69 A;  4JSO A;  2KLF A;  1JNF A;  2PT1 A;  3PD8 A;  3MP6 A;  4EF1 A;  2DWI A;  2PVU A;  3KGC A;  5H8F A;  5JEI A;  1IQ7 A;  4IO2 A;  4WEP A;  4LA9 A;  2YJP A;  1LAF E;  4MLV A;  3TAJ A;  2ZNU A;  2PX1 A;  3OSR A;  4R6H A;  2UYF A;  2DSF A;  3C4M A;  3SEV A;  4GRK A;  1ZIU A;  4E0X A;  4EXK A;  4OHN A;  3KOS A;  5J1D A;  1SD3 A;  3PU5 A;  1QW0 A;  4KFQ A;  3QYT A;  1JVX A;  4GXA A;  3E4R A;  3IOT A;  4BDM A;  3TEL A;  2O68 A;  3VXC A;  4LZ5 A;  4NF5 B;  3CG3 A;  3VE1 B;  2THI A;  3H6T A;  4F19 A;  4KYE A;  4JXI A;  4EF2 A;  2GRV A;  4KPT A;  1HSE A;  4NF6 A;  4R9F A;  2Y7W A;  3MVZ A;  5I57 B;  3DRJ A;  2R6G E;  4XTC Q;  3DLN A;  4JSD A;  1LB8 A;  4Q0C A;  4BDO A;  1US5 A;  3CFL A;  3GXA A;  4NF4 A;  2FNC A;  1H76 A;  4NMY A;  2XD3 A;  3KJT A;  1B7H A;  4P0G A;  2HZL A;  3C34 A;  1MM7 A;  1H3D A;  2V3T A;  4WXJ A;  3MAM A;  4G4P A;  3TCF A;  2D5W A;  2OLB A;  5FTI A;  1LLS A;  1XS5 A;  5I2K A;  2D21 A;  1MDQ A;  4G68 B;  4Q8R A;  3UP9 A;  1PEB A;  3IOR A;  4FOR A;  1AOV A;  3K02 A;  3G3K A;  3LUY A;  5H8Q A;  4PFU A;  4POW A;  1DTZ A;  3CVG A;  3LSF B;  3Q27 A;  4LZ7 A;  5I58 A;  3FVN A;  3R7X A;  4MBP A;  5JTY A;  3EHS A;  1M5E A;  5I84 A;  3A3U A;  1NFT A;  4HTG A;  3G3J A;  3TTN A;  3TTM A;  3EPE A;  1CE2 A;  2Z8D A;  5CBS A;  1LFH A;  3D4G A;  1QVS A;  3E9X A;  3IR1 A;  1B32 A;  1XOC A;  1P1N A;  1Y20 A;  3QK6 A;  3V5A A;  4G8H A;  1PBP A;  5F7V A;  4ESX A;  2X7P A;  4U1O A;  2XXH A;  2YPN A;  4OTE A;  1UTH B;  5H8N A;  5H8H A;  4X48 A;  1AIV A;  3CR9 A;  1BIY A;  4I1D A;  5AA2 B;  4OEN A;  1DPP A;  1R1N A;  4Q30 B;  3OO8 A;  4N13 A;  3DP4 A;  2ZXT A;  1B9J A;  1MXX A;  2QSX A;  3G3I A;  4R6K A;  4YB6 A;  1UIU A;  3N5L A;  5CMM A;  5DEX A;  1LAX A;  1B05 A;  4Z7E A;  1ZTY A;  4AQ4 A;  3IK6 B;  3CFZ A;  5FHM A;  2GFE A;  4OZ9 A;  5FHN A;  3V8X B;  1B2H A;  1OLA A;  3AXF A;  3HV1 A;  2DE2 A;  5K2X A;  1TT1 A;  1AL3 A;  4XIG Q;  3TQL A;  3H7M A;  3M3F A;  4OVJ A;  2RKM A;  4DXU A;  1NNF A;  4GLI A;  1MQH A;  1USY H;  4ZEF A;  3TTR A;  1QJM A;  2RF1 A;  2XXY A;  3KOT A;  3RYB A;  4KCC A;  5B70 A;  3QXM A;  3TTK A;  2F5X A;  2NVU B;  3OO7 A;  1VSO A;  1Y1M A;  1Q35 A;  3VLW A;  5I2N A;  2REJ A;  4TOZ A;  4R74 A;  1POY 1;  1TWY A;  3JYR A;  3L6H A;  4X1B A;  3N6T A;  2I3W A;  3C36 A;  3R26 A;  1MRP A;  3MJN A;  3U1O A;  4QSD A;  2DVC A;  4PFT A;  1MY2 A;  3BFU A;  5TU0 A;  2Q9T A;  4YIC A;  4F18 A;  3GLB A;  3G3H A;  5KCJ A;  2F7A A;  2Y84 A;  3IB0 A;  3KJ7 A;  3T9H B;  3UIF A;  1JQF A;  1B58 A;  1MXU A;  3I6V A;  1PB9 A;  4H1X A;  1SW2 A;  3RPW A;  3IB2 A;  1MXV A;  4RJZ A;  3SES A;  4GL0 A;  2DE3 A;  2G29 A;  1P1W A;  2NOO A;  2VHA A;  4H65 A;  5CMC A;  1MY1 A;  2RCA A;  2VOZ A;  1VFD A;  3U93 A;  1XT8 A;  4OET A;  2O6A A;  4KI0 E;  4YAH X;  3HCQ A;  2Z8F A;  4R75 A;  4KYS A;  5CMK A;  1J1N A;  3VDF A;  2P0S A;  3O9P A;  3OSQ A;  2F6P A;  3C9H A;  1B5J A;  4MH5 A;  3VVF A;  1ZBM A;  1B3F A;  2Y7I A;  4NF8 B;  3LSW A;  4KR5 A;  1SQY A;  4GIZ A;  3K1P A;  5L9O A;  5TP9 A;  4AB5 A;  1FTK A;  3HO7 A;  4ND9 A;  2Q2C A;  1BTJ A;  4JWX A;  2RCB A;  4GXS B;  1GR2 A;  4KQP A;  4NF4 B;  4I8C A;  3CI8 A;  4U1Z A;  5A5X B;  3RT6 B;  3MZ1 A;  1A99 A;  3FTO A;  1I69 A;  1NMU A;  2OZZ A;  3PUV E;  1B5I A;  3ILT B;  4C1T A;  3DRI A;  1PB8 A;  3P7I A;  3B6T A;  3VVE A;  2O1L A;  3EN3 A;  1PDA A;  4WKM A;  2DWH A;  4ELQ A;  1M5C A;  3RQT A;  1B0L A;  1MS7 A;  2B3F A;  4C0R A;  1B3G A;  4RK2 A;  4DE8 A;  2AIX A;  4RYA A;  2ZNT A;  5CBR A;  3KZG A;  4RY1 A;  4FAJ A;  1A40 A;  2R71 A;  2A5T B;  1LAG E;  1DOT A;  2ABH A;  2XHD A;  3RLF E;  3OO6 A;  4ZEB A;  3F11 A;  3EF7 A;  3O29 A;  2UVH A;  3PUZ E;  3FZV A;  3B6W A;  1BLF A;  1ATG A;  1N76 A;  2DE4 A;  4U21 A;  4QSE A;  4F2Q A;  2RC9 A;  3FJG A;  1LAH E;  1Y1Z A;  4EQ9 A;  1IUD A;  1QKA A;  3PAM A;  1I6Q A;  5ITP A;  1MY0 A;  3IOU A;  5KDT A;  2DOJ A;  1XHY A;  4R2F A;  3USD A;  4RXL A;  3N26 A;  1OIB A;  2Z23 A;  3S4U A;  4F3B A;  1MM6 A;  3EHU A;  5HM4 B;  2PT2 A;  1N7X A;  3K6U A;  1S50 A;  5H8F B;  1FCK A;  3SEW A;  3VVD A;  1D3K A;  1A7L A;  4XXU A;  2FA7 A;  3IL1 B;  3QUJ A;  3W9W A;  3I5O A;  3MBP A;  3T22 A;  1R9Q A;  4QFO A;  1WOD A;  3FD3 A;  3FAT A;  1POT A;  1ZKB A;  2WKY A;  3LC8 A;  1Q1K A;  4YKK A;  4LON B;  1GTK A;  2OWT A;  2I4B A;  5I56 B;  1D9Y A;  1SYI A;  2OK2 A;  3MC2 A;  4FEC A;  5HBC A;  3KSJ A;  1B52 A;  5TPA A;  5KZT A;  3T66 A;  3KN8 A;  4F1U A;  2H5Y A;  1ELJ A;  1MH3 A;  1YPN A;  2DYX A;  2V93 A;  5TPA B;  1US4 A;  1AH5 A;  1SI0 A;  4POX A;  3TKD A;  2P1S A;  2QMX A;  4PET A;  2I4C A;  3U94 A;  1A54 A;  5I59 B;  3MUQ A;  4O3B A;  3PUY E;  2HCA A;  4G77 A;  3MVX A;  3FVO A;  2ALU A;  4TLL B;  3HHG A;  1OVT A;  3MVY A;  1DSN A;  2E1S A;  3ZKK A;  1MXZ A;  2QS4 A;  2CZL A;  2XXV A;  5CI5 A;  2DXY A;  4NE4 A;  4EXL A;  3K6X A;  4EQ7 A;  4QHQ A;  1UTH A;  2HAV A;  4LAT A;  5H8N B;  1B51 A;  3N6U A;  1NH8 A;  3SEY A;  5AA1 A;  4I9D A;  4U2R A;  2H4I A;  1OQH A;  3FGS A;  3B7D A;  4JWO A;  4K3F A;  5BUU A;  1B6H A;  4XKQ A;  4XKP A;  3IOW A;  4G8M A;  1USY E;  2QRY A;  3C35 A;  3IJX B;  5I2K B;  1UQW A;  3U72 A;  3TYH A;  5LOM A;  3VXB A;  4LVQ A;  4H5G A;  4F31 B;  4ISU A;  1MY3 A;  1QUL A;  2H99 A;  3A3C A;  5FTH A;  3ZKL A;  3Q28 A;  4NTL A;  1PB7 A;  4ZE9 A;  3FXR A;  3HHF A;  1Z7M E;  5I58 B;  3E13 X;  2XXQ A;  4GFR A;  3SEX A;  1LCF A;  4ZEI A;  4C1U A;  3OXN A;  1MPD A;  2V25 A;  3LVU A;  2ZYN A;  4EUO A;  3IO6 A;  3SDF A;  3T9X B;  1A8F A;  1FTO A;  3H03 A;  3TPA A;  3ECR A;  2WOL A;  1R9L A;  2H25 A;  2NXO A;  2F6G A;  1NL5 A;  1RKM A;  2XXT A;  2F35 A;  3MWB A;  1ZU0 A;  3PPN A;  1SW4 A;  4HCW A;  3VFJ A;  3T93 B;  4OFO A;  4IO7 A;  4N6P A;  4UA8 A;  1AMF A;  4GF8 A; 
#chains in the Genus database with same CATH topology
 4KD5 A;  2ZZW A;  4ESW A;  4OMB A;  5F1Q A;  2V84 A;  4NED A;  1DMB A;  1SYH A;  4HW8 A;  4AS4 A;  1B0H A;  1B1H A;  3RY3 A;  4JDF A;  4OVQ A;  1LBW A;  3KBZ A;  3EHT A;  5IKB A;  3GZG A;  2XXW A;  4OA4 A;  3W15 C;  1GV8 A;  2ZMB A;  3KC1 A;  3UA8 A;  3U65 A;  2FYI A;  1N04 A;  1JVY A;  5ELV A;  3BKI B;  1D4N A;  3N94 A;  1XVX A;  4MMP A;  4FED A;  4MF3 A;  1ZMG A;  2ZNS A;  5I3S A;  3TOD A;  5AA4 A;  4AB6 A;  5ITP A;  1PC3 A;  2DXR A;  3K00 A;  4BDN A;  2OWS A;  5DVI A;  1RYO A;  2IEE A;  4DZ1 A;  1P99 A;  4DXC A;  1Y4T A;  1JW1 A;  3O28 A;  1NNT A;  1KZ8 A;  1BP5 A;  1GGG A;  1KA0 A;  1KWH A;  2XXX A;  2CZI A;  3D1R A;  1CB6 A;  1FBG A;  1NKX A;  5CRY A;  1B1X A;  1OQG A;  2A5T A;  3O66 A;  4MFI A;  4BLA A;  1N3X A;  4N07 A;  2QPQ A;  4P1L A;  3TZA A;  1FQF A;  2XXP A;  1B4H A;  4X9T A;  4UAC A;  3HFU A;  3K1N A;  4NGU A;  2VP1 A;  1MXW A;  4U4X A;  1A55 A;  1JP4 A;  1LFG A;  3Q26 A;  3E79 A;  2DS9 A;  2Y7K A;  2F7C A;  3T96 B;  2OCU A;  2RIN A;  4P11 A;  3K6V A;  4GL8 A;  2QVR A;  5A5X A;  5I59 A;  3WAF A;  4R9G A;  4YKJ A;  4U4S A;  1NV7 A;  1SW5 A;  4JB7 A;  3U92 A;  1SVX B;  4H8J A;  3A29 A;  1URG A;  1EYK A;  5AA2 D;  4HCY A;  2I6E A;  3MPK A;  4NX1 A;  1K9Y A;  5IZZ A;  1LCT A;  2ZYO A;  1M5B A;  3A09 A;  3PPR A;  3GBB A;  3PV0 E;  3FXQ A;  4PFW A;  4IB2 A;  4YKP A;  1K9Z A;  2ZZX A;  1OMP A;  3K6W A;  1SW1 A;  3OO9 A;  4OFL A;  4L17 A;  2WOP A;  3FIR A;  3W9V A;  4DI3 D;  1ZJL A;  4QFL A;  3Q25 A;  2QVU A;  2Q89 A;  2XXR A;  1N84 A;  2XD2 A;  2REG A;  2BJJ X;  2QVV A;  4H8I A;  3MYU A;  4THI A;  1KA1 A;  2UYE A;  4FJP A;  1LST A;  3QUF A;  4F3G A;  3DP6 A;  5JTY B;  1EZ9 A;  2GHA A;  5BWJ A;  4ZED A;  2XWI A;  1IMA A;  3FJM A;  1LBY A;  1MQI A;  3PUW E;  4PP0 A;  5AA4 B;  1IIT A;  4MJO A;  2DQV A;  3M3K A;  1RYX A;  1A8E A;  4PFI A;  1NNK A;  3IB1 A;  4PE5 B;  4U22 A;  3IAZ A;  4N8Y A;  5TP9 B;  1WDN A;  1XVY A;  4GX3 A;  2PCR A;  1B7U A;  3RUM A;  1RDX A;  3BFT A;  4JSO A;  3KGC A;  2OWZ A;  4WEP A;  1LAF E;  3TAJ A;  2ZNU A;  3C4M A;  2XWO A;  3PU5 A;  1JVX A;  4R9F A;  4NF6 A;  2Y7W A;  4MHF A;  1US5 A;  1H76 A;  2XD3 A;  2V3T A;  3MAM A;  4G4P A;  5FTI A;  5I2K A;  1MDQ A;  3IOR A;  3LSF B;  3FVN A;  4MBP A;  5JTY A;  3TTN A;  1CE2 A;  2Z8D A;  3IR1 A;  1XOC A;  4UAB A;  2GQ1 A;  1EYJ A;  4ESX A;  1UTH B;  4PDH A;  4Q30 B;  2XWV A;  3DP4 A;  2ZXT A;  2QSX A;  3G3I A;  4O94 A;  5CMM A;  1B05 A;  4PF8 A;  2HPG A;  3IK6 B;  5FHM A;  1B2H A;  1OLA A;  3TQL A;  3M3F A;  4OVJ A;  1NNF A;  1USY H;  4ZEF A;  2FHY A;  3VLW A;  5I2N A;  2REJ A;  3N6T A;  2I3W A;  3U1O A;  5TU0 A;  3IB0 A;  3T9H B;  4N6K A;  1JQF A;  3RPW A;  1PB9 A;  1SW2 A;  3IB2 A;  1MXV A;  2NOO A;  2RCA A;  2VOZ A;  1SPI A;  4OET A;  4KI0 E;  3HCQ A;  4R75 A;  4KYS A;  3OSQ A;  3C9H A;  1B3F A;  1AWB A;  2Y7I A;  3LSW A;  1SQY A;  3K1P A;  2Q8M A;  2XXK A;  4PGN A;  1BTJ A;  4GXS B;  4PBQ A;  4U1Z A;  3FTO A;  5J16 A;  3ILT B;  3EN3 A;  4WKM A;  1B3G A;  5EQ9 A;  2ZNT A;  3KZG A;  1DOT A;  3F11 A;  1BLF A;  1ATG A;  4OVR A;  1LAH E;  1MY0 A;  3IOU A;  2DOJ A;  1XHY A;  4RXL A;  1OIB A;  2Z23 A;  4PE3 A;  5HM4 B;  1N7X A;  3K6U A;  4X04 A;  4XXU A;  3IL1 B;  1R9Q A;  1WOD A;  3FAT A;  1ZKB A;  5I56 B;  2OK2 A;  3MC2 A;  3KSJ A;  3T66 A;  2H5Y A;  1YPN A;  3TKD A;  1AH5 A;  4PET A;  1IMB A;  2HCA A;  4G77 A;  2ALU A;  4TLL B;  1FPD A;  3MVY A;  1OVT A;  5CI5 A;  1DBZ A;  2CEX A;  5AA1 A;  4U2R A;  4JWO A;  3B7D A;  4K3F A;  1UQW A;  3TYH A;  4NF0 A;  1QUL A;  3Q28 A;  4ZEI A;  3OXN A;  2ZYN A;  4EUO A;  3IO6 A;  3SDF A;  1FTO A;  1R9L A;  1RKM A;  3PPN A;  2F35 A;  4UA8 A;  4N6P A;  2CZK A;  4GWX A;  1QKB A;  3OEN A;  2I0C A;  2AL5 A;  2D3I A;  2F78 A;  3UK4 A;  4MLQ A;  3LBS A;  5IGA A;  1YCJ A;  3ZS6 A;  5DVF A;  4DCX A;  1SDX A;  1MXY A;  3V83 A;  4YZZ A;  4JVD A;  1FRP A;  4PFY A;  1R6Z A;  4NF8 A;  4KHZ E;  1IXG A;  2HXW A;  1P1U A;  4F1V A;  1JEU A;  3LR1 A;  4G68 A;  2AYS A;  4QSC A;  3T0J A;  3RYA A;  1QGX A;  1QUJ A;  2QFL A;  4NWC A;  2CMO A;  1O64 A;  1S9T A;  3TEP A;  3FVG A;  1DTG A;  1IMF A;  5H8S A;  5EYF A;  3KN7 A;  4YB5 A;  4DCY A;  2R9J A;  4GBW A;  3RGY A;  3T9U A;  1MQJ A;  4O3A A;  1M5D A;  1FPE A;  3G3F A;  2Y7R A;  4LP2 B;  1YYZ A;  1FTJ A;  4GD5 A;  1OVB A;  1MDP 1;  4RNS A;  4QRZ A;  4M1V A;  4N6D A;  3ONM A;  1O63 A;  5ISU A;  4RPO A;  3BIG A;  1IXI A;  4PFB A;  3FXU A;  2UVI A;  2Z22 A;  4JWY A;  1FQC A;  2H98 A;  1H44 A;  3WAE A;  3O6H A;  3V89 B;  2HEU A;  1NUY A;  2CEY A;  3DRK A;  5IAI A;  2B3B A;  1FPF A;  1LGB C;  4F39 A;  3KFM A;  4QXD A;  1FPK A;  3E78 A;  4RA1 A;  2HXR A;  1Z7N E;  1NNP A;  4ZS9 A;  2QS2 A;  3G7W A;  2XX8 A;  2FBP A;  3VLV A;  4NWD A;  5DEX B;  2WEF A;  4G8N A;  3CRB A;  1BKA A;  4ELO A;  3SKP A;  4H5F A;  5ICT A;  4OWD A;  4U23 A;  1NV2 A;  1IZ1 A;  1OLC A;  1UTB B;  4GX6 A;  3MPL A;  4IO4 A;  2O1M A;  1VE4 A;  4F3P A;  5ITO A;  2VD2 A;  3D4C A;  3MP1 A;  3PD9 A;  1FQB A;  2WYP A;  5CC2 A;  2UXA A;  4FAT A;  2WBD A;  3KC0 A;  2M8C A;  4M4G A;  2HQ0 A;  1EZP A;  2Z8E A;  3CSB A;  3ISP A;  4GX4 A;  1FPJ A;  3TCH A;  1FQA A;  4PQJ A;  3Q29 A;  1JET A;  1QUI A;  2DVZ A;  3DEL B;  3H6V A;  5LTC A;  1LFI A;  2JJK A;  4MNP A;  3IOV A;  5L9S A;  3CIJ A;  4BDQ A;  4OER A;  4EDP A;  2F8D A;  4F1Y A;  4JBZ A;  3FUZ A;  4BDL A;  1FPL A;  3MZ9 A;  4NHB A;  2W7Y A;  1TFA A;  1FQE A;  5AA2 A;  1HSJ A;  4ZE8 A;  2DP8 A;  5CM6 A;  2XX7 A;  4F2O A;  5I2N B;  3ILU B;  3EKI A;  1IXC A;  5IM2 A;  3PD8 A;  1FPG A;  4EF1 A;  3MP6 A;  2DWI A;  5H8F A;  4IO2 A;  4MLV A;  2PX1 A;  4R6H A;  5ET7 A;  1QW0 A;  4KFQ A;  3QYT A;  4GXA A;  2R8T A;  3IOT A;  5DW8 A;  3VXC A;  4NF5 B;  3VE1 B;  2THI A;  4KYE A;  4JXI A;  3SZP A;  3MVZ A;  4XTC Q;  3DLN A;  3RPL B;  4JSD A;  1LB8 A;  4Q0C A;  4NMY A;  1H3D A;  1FBD A;  2OLB A;  4Q8R A;  3FXB A;  3K02 A;  3G3K A;  3LUY A;  3EHS A;  3TTM A;  3EPE A;  5CBS A;  4XEQ A;  3V5A A;  1PBP A;  5F7V A;  5H8N A;  5H8H A;  5AA2 B;  1R1N A;  4NN3 A;  4N13 A;  2Y5L A;  5DEX A;  1ZTY A;  3CFZ A;  5FHN A;  4XIG Q;  4P3L A;  4DXU A;  3MST A;  4GLI A;  1MQH A;  4E0X A;  2RF1 A;  3QXM A;  4O7M A;  3TTK A;  2F5X A;  1Y1M A;  1Q35 A;  4GWU A;  4TOZ A;  1NI9 A;  4HE2 A;  1DK4 A;  4X1B A;  1MRP A;  4QSD A;  3BFU A;  4YIC A;  3GLB A;  1MXU A;  3I6V A;  3SES A;  2DE3 A;  5ET5 A;  3U93 A;  2Z8F A;  3VDF A;  2P0S A;  3O9P A;  4MH5 A;  3VVF A;  4NF8 B;  5L9O A;  4ND9 A;  1GR2 A;  1FBH A;  5A5X B;  1FPB A;  3MZ1 A;  1I69 A;  3PUV E;  3P7I A;  3B6T A;  3VVE A;  2O1L A;  1M5C A;  1B0L A;  2B3F A;  4MIJ A;  2AIX A;  3PTY A;  4FAJ A;  2R71 A;  2XHD A;  1CNQ A;  1LAG E;  2ABH A;  3RLF E;  4OVS A;  3EF7 A;  3FZV A;  3B6W A;  4QSE A;  3FJG A;  4EQ9 A;  1IUD A;  1QKA A;  3PAM A;  1I6Q A;  4R2F A;  3N26 A;  3S4U A;  1S50 A;  5IZ1 A;  1FCK A;  3SEW A;  3I5O A;  3FD3 A;  2WKY A;  4LON B;  1GTK A;  1SYI A;  4FEC A;  1NV1 A;  4F1U A;  5TPA B;  1SI0 A;  3U94 A;  4O3B A;  1MXZ A;  4EXL A;  2PFZ A;  1BK4 A;  4EQ7 A;  4QHQ A;  2HAV A;  4LAT A;  1B51 A;  2CZH A;  4I9D A;  1OQH A;  3B50 A;  1Q9D A;  4G8M A;  4DI4 B;  2QRY A;  4I3Y A;  5I2K B;  3U72 A;  5LOM A;  5ESY A;  1MY3 A;  5FTH A;  1Z7M E;  2V25 A;  3ECR A;  2NXO A;  3MWB A;  4HE0 A;  3O6I A;  3PPQ A;  1O7T A;  3H6U A;  3DRH A;  4OEU A;  4RK9 A;  4MNI A;  3S9E A;  4F3S A;  1IMD A;  3FBP A;  4ECF A;  2I58 A;  1B5H A;  2O84 X;  4F22 A;  3S9N C;  4GWO A;  4H67 A;  2ANJ A;  3G3G A;  3KEI A;  5I56 A;  4IY5 A;  3H6W A;  4C1U A;  2GH9 A;  5DVJ A;  1RDY A;  1MG1 A;  2DWJ A;  3SEU A;  1FPI A;  3OEM A;  3VXB A;  3UGW A;  5JK4 A;  3T9V A;  5DT6 A;  4Q5T A;  1D9Q A;  4E0W A;  3KBR A;  2QMW A;  3PUX E;  4WED A;  1S7Y A;  2P3N A;  3FV1 A;  1Y9U A;  3HST A;  5CMB A;  2WOK A;  1FBE A;  2O7U A;  2WYK A;  1NUZ A;  1B3L A;  4DLD A;  2HZK A;  4KXP A;  2IA4 A;  1RDZ A;  4IGT A;  1VR5 A;  4ZEC A;  2G93 A;  3E3K A;  1UTB A;  4YU0 A;  1Y3N A;  5AE4 A;  2HFB A;  5M2V A;  1I6B A;  1YXI A;  1B7Z A;  2X26 A;  1ANF A;  1T0K A;  3C31 A;  3BBR A;  3TDJ A;  1QUK A;  1FTA A;  3TTL A;  4N8G A;  4OAN A;  4DXB A;  3TCG A;  5I7I A;  3OEL A;  4N17 A;  5EHS A;  1LBC A;  1N7W A;  4BDR A;  4OYV A;  5I57 A;  3KG2 A;  4PTK A;  4H46 A;  1P1Q A;  4QF9 A;  3CHG A;  3PMX A;  4ZZA A;  3RTF B;  2F3B A;  4R2B A;  2HHM A;  4H6D A;  4PC9 A;  3VLU A;  4PAF A;  2ESN A;  3EQ1 A;  4GQO A;  4LZ8 A;  4X1D A;  3MP8 A;  1L5T A;  2VT5 A;  4O3C A;  1P1O A;  2PFY A;  2F34 A;  3RYD A;  4P0I A;  1LBV A;  2YLN A;  3OEK A;  1TFD A;  1II5 A;  3CFX A;  3IJO B;  3I3V A;  2H9B A;  3JV9 A;  2PBW A;  1FW0 A;  3SET A;  3C32 A;  3OMB A;  3O6P A;  2VPN A;  3DM0 A;  1H45 A;  4MX6 A;  1B46 A;  5KCJ B;  1JEV A;  2OJT A;  4Z0I A;  1GVC A;  3KSX A;  4IGR A;  4GWY A;  3LSL A;  2ONR A;  2V3Q A;  2VD3 A;  1FQD A;  2F36 A;  4P9K A;  3S2V A;  4X8R A;  1EU8 A;  2ZYK A;  3QAX A;  5IZ3 B;  2I48 A;  1SBP A;  1IEJ A;  4ZZE A;  2OBG A;  4HE1 A;  4OEV A;  5IZ3 A;  2NWJ A;  1UIV A;  4GWS A;  4LQ2 A;  2A5S A;  4GOT A;  1DPE A;  1URD A;  2V3U A;  3UN6 A;  4QFK A;  5L8D A;  1PBQ A;  4ELP A;  2KQZ A;  2QL3 A;  3QSL A;  2UVG A;  3TFL A;  4G61 A;  2I49 A;  3TMG A;  2X7Q A;  2L5V A;  3KN3 A;  4ZDM A;  2Q2A A;  1N3W A;  4IO6 A;  3OD7 A;  2F7B A;  1MQD A;  3SER A;  3TUS A;  1MH4 A;  4GBV A;  4OFJ A;  4H45 A;  4FIM A;  1B3H A;  3R6U A;  3CG1 A;  5KDT B;  1YTV A;  2LAO A;  3JZJ A;  2O69 A;  2KLF A;  1JNF A;  2PT1 A;  5I5P A;  2PVU A;  1IQ7 A;  4LA9 A;  1NV3 A;  3OSR A;  5KCJ A;  2UYF A;  2DSF A;  4MAG A;  3SEV A;  1LBX A;  4PAK A;  3KOS A;  1INP A;  4BDM A;  3IFA A;  2O68 A;  4LZ5 A;  4F19 A;  2GRV A;  1HSE A;  2R6G E;  4BDO A;  3GXA A;  2FNC A;  1B7H A;  3C34 A;  4WXJ A;  3TCF A;  1LLS A;  1XS5 A;  2D21 A;  4NAP A;  4PFU A;  4POW A;  1DTZ A;  4LZ7 A;  5I58 A;  3A3U A;  3G3J A;  1QVS A;  1B32 A;  1Y20 A;  3QK6 A;  4U1O A;  4X48 A;  4XF5 A;  3CR9 A;  1BIY A;  1DPP A;  3OO8 A;  2XWK A;  1MXX A;  1UIU A;  1LAX A;  1EYI A;  4Z7E A;  4AQ4 A;  4MNC A;  3V8X B;  3AXF A;  3HV1 A;  5K2X A;  3NOH A;  1TT1 A;  1AL3 A;  3H7M A;  2RKM A;  3LUZ A;  1QJM A;  5B70 A;  3RYB A;  1VSO A;  4R74 A;  1POY 1;  1TWY A;  3JYR A;  3L6H A;  3R26 A;  4PF6 A;  2DVC A;  4PFT A;  3LV0 A;  2Q9T A;  2WBB A;  2Y84 A;  3KJ7 A;  3UIF A;  4H1X A;  4RJZ A;  2VHA A;  1P1W A;  4H65 A;  1VFD A;  1XT8 A;  2O6A A;  4YAH X;  1XI6 A;  2F6P A;  1B5J A;  4MCO A;  4GIZ A;  5TP9 A;  4AB5 A;  1FTK A;  4NF4 B;  2RCB A;  4KQP A;  4I8C A;  4N4U A;  3RT6 B;  1A99 A;  2OZZ A;  3DRI A;  1PB8 A;  4ELQ A;  1PDA A;  2DWH A;  4C0R A;  4DE8 A;  5CBR A;  2A5T B;  4NQ8 A;  3OO6 A;  4ZEB A;  3O29 A;  3PUZ E;  2UVH A;  1N76 A;  4U21 A;  4JVI A;  2RC9 A;  4NG7 A;  1FJ6 A;  3USD A;  4F3B A;  1MM6 A;  3EHU A;  5H8F B;  1D3K A;  3QUJ A;  5A5L A;  3BIH A;  4IR8 A;  3T22 A;  4GWZ A;  1POT A;  3LC8 A;  1Q1K A;  2FIE A;  5HBC A;  5TPA A;  5KZT A;  1ELJ A;  2P1S A;  2QMX A;  2I4C A;  2DDK A;  3MVX A;  3FVO A;  4FBP A;  1DSN A;  3ZKK A;  4NE4 A;  4P8B A;  1UTH A;  5ET6 A;  4LN5 A;  1NH8 A;  3SEY A;  1FSA A;  2H4I A;  5BUU A;  1B6H A;  4XKQ A;  4XKP A;  3IOW A;  1YZ0 A;  3C35 A;  4F31 B;  4ISU A;  3ZKL A;  3A3C A;  4NTL A;  1PB7 A;  4ZE9 A;  3FXR A;  3HHF A;  5I58 B;  3E13 X;  4P47 A;  1LCF A;  1MPD A;  3LVU A;  3T9X B;  1A8F A;  3H03 A;  3TPA A;  2WOL A;  2H25 A;  2F6G A;  1NL5 A;  4OVT A;  4PBH A;  5EQ8 A;  3T93 B;  4IO7 A;  1AMF A;  5H8H B;  1B40 A;  4FEB A;  3S9M C;  4GVO A;  3RT8 A;  4HS7 A;  3UOR A;  4NF6 B;  3RNN A;  4R72 A;  1FTM A;  3B8B A;  1MY4 A;  4KYD A;  3K2D A;  1M5F A;  2P3V A;  3IO4 A;  3S9L C;  3PMW A;  3K4U A;  3MZB A;  3FVK A;  2Q8J A;  4IO5 A;  2B4M A;  3K01 A;  3U8Q A;  4DIG A;  1JW4 A;  5FHO A;  3HN0 A;  2PMS A;  2NUV A;  2Q88 A;  4KCD A;  5HPQ A;  3O6G A;  2O51 A;  1IMC A;  3ZSF A;  3FJ7 A;  4I62 A;  5B7D A;  4IY6 A;  3O2A A;  1LB9 A;  5EYH A;  5ICQ A;  1IXH A;  5EYG A;  3PGF A;  3PPO A;  4XKN A;  4F29 A;  4OQO A;  1IIW A;  4OES A;  3MVW A;  1URS A;  3IX1 A;  4LUB A;  1WVJ A;  4PCD A;  4G68 C;  2RC8 A;  5ET8 A;  1VFE A;  3THI A;  2VGQ A;  2B4L A;  3FAS A;  2QS3 A;  3LSX A;  3PMV A;  2ZYM A;  5DTB A;  4ONY A;  1NV6 A;  3RTW B;  3MW0 A;  2GHB A;  4OXV A;  3L6G A;  3VV5 A;  1HSL A;  1F9B A;  1AIV A;  3QIM A;  2ZZV A;  3K0V A;  4TLM B;  3K1M A;  2O7I A;  2FIX A;  3IFC A;  4FE8 A;  4DDD A;  3OOA A;  3O97 A;  5K2Y A;  2RC7 A;  3MQ9 A;  4NF5 A;  1I6A A;  2DWA A;  1Y3Q A;  1NH7 A;  2VPO A;  1MPB A;  3DRG A;  3HPI A;  4IO3 A;  1JW5 A;  4P1E A;  3M3L A;  2ONS A;  1G0H A;  1Y4C A;  4PAI A;  1SI1 A;  4ZEK A;  5T3J A;  1FBC A;  2UVJ A;  3M8U A;  4I40 A;  4JVC A;  2I0B A;  2P2A A;  2QS1 A;  4G2Z A;  1FBP A;  2E0S A;  3ODB A;  4YB7 A;  1N0T A;  1Y3P A;  4H0W A;  1YAE A;  1XC1 A;  2PYY A;  5EHM A;  4ELR A;  4R73 A;  4XFE A;  2I3V A;  2KR0 A;  3DRF A;  2WX9 A;  4RPN A;  4XKR A;  2FVZ A;  1B3E A;  3B6Q A;  3H3G A;  2F97 A;  3TQW A;  3PPP A;  1H43 A;  5H8Q B;  4QFP A;  4EQB A;  2Y7P A;  4YMA A;  2XA5 A;  3FV2 A;  4QFN A;  4TQU Q;  4N91 A;  3C33 A;  3CSG A;  5AA3 A;  3RPL A;  3H4Z A;  4YKI A;  1NUW A;  1LEV A;  1EH3 A;  1ZLQ A;  4LQ5 A;  5L9M A;  2AL4 A;  1LBZ A;  1MPC A;  4AS5 A;  4YMB A;  1D9V A;  1TXF A;  2ONK E;  4R6Y A;  1LBB A;  3H06 B;  2XXU A;  4QBA A;  2Y5K A;  2B65 A;  5DYH A;  3DP8 A;  5F24 A;  2XXI A;  2XX9 A;  1MQG A;  1B4Z A;  1FTL A;  2HAU A;  3RN8 A;  3T1B A;  1EZO A;  4GWW A;  3GBA A;  3QMF A;  2QJE A;  1IME A;  5JEI A;  2OX3 A;  2YJP A;  4EXK A;  5J1D A;  4GRK A;  1ZIU A;  4OHN A;  1SD3 A;  4HXV A;  3E4R A;  3ROJ A;  1G0I A;  3TEL A;  4N15 A;  3CG3 A;  3H6T A;  4EF2 A;  4KPT A;  5I57 B;  3DRJ A;  1FJ9 A;  3CFL A;  1DCU A;  4NF4 A;  3KJT A;  4P0G A;  2HZL A;  1MM7 A;  4I3E A;  2D5W A;  4G68 B;  3UP9 A;  1PEB A;  4FOR A;  1AOV A;  5H8Q A;  2Q74 A;  4N81 A;  3CVG A;  3Q27 A;  4P56 A;  3R7X A;  1M5E A;  5I84 A;  1NFT A;  4HTG A;  1LFH A;  3D4G A;  4O7I A;  4OVP A;  5EQA A;  3E9X A;  1P1N A;  4G8H A;  4PFR A;  2X7P A;  2XXH A;  2YPN A;  2V4C A;  4OTE A;  4I1D A;  5FBP A;  4OEN A;  1B9J A;  4R6K A;  4YB6 A;  3N5L A;  2GFE A;  4OZ9 A;  2DE2 A;  5EQ7 A;  3TTR A;  4KCC A;  2XXY A;  3KOT A;  4PGP A;  2NVU B;  3OO7 A;  3C36 A;  3MJN A;  1MY2 A;  4F18 A;  3G3H A;  2F7A A;  1B58 A;  1VDW A;  4GL0 A;  2G29 A;  5CMC A;  1MY1 A;  5CMK A;  1J1N A;  4PDD A;  1ZBM A;  4KR5 A;  3HO7 A;  5LDZ A;  2MKZ A;  2Q2C A;  4JWX A;  3CI8 A;  4O8M A;  4C1T A;  1NMU A;  1B5I A;  3RQT A;  1MS7 A;  4RK2 A;  4RYA A;  4RY1 A;  1A40 A;  2DE4 A;  4F2Q A;  1Y1Z A;  5KDT A;  4MEV A;  2F3D A;  2PT2 A;  1NV4 A;  3VVD A;  1A7L A;  2FA7 A;  3W9W A;  3MBP A;  4QFO A;  1NV5 A;  4YKK A;  2OWT A;  2I4B A;  1D9Y A;  1B52 A;  3KN8 A;  1MH3 A;  2DYX A;  2V93 A;  1US4 A;  4POX A;  2BJI A;  1NV0 A;  5I59 B;  1A54 A;  3MUQ A;  3PUY E;  1FBF A;  3HHG A;  2E1S A;  1NUX A;  2QS4 A;  2CZL A;  2XXV A;  2DXY A;  3K6X A;  5H8N B;  3N6U A;  3FGS A;  1USY E;  3IJX B;  4LVQ A;  4H5G A;  2H99 A;  2XXQ A;  4GFR A;  3SEX A;  2XXT A;  3GYY A;  3VFJ A;  1ZU0 A;  4HCW A;  1SW4 A;  4OFO A;  4GF8 A; 
#chains in the Genus database with same CATH homology
 1QKB A;  3OEN A;  2I0C A;  3O6I A;  5H8H B;  4KD5 A;  2AL5 A;  2D3I A;  1O7T A;  3PPQ A;  3H6U A;  4ESW A;  4OMB A;  1B40 A;  3DRH A;  4OEU A;  5F1Q A;  2F78 A;  2V84 A;  4RK9 A;  3UK4 A;  4MLQ A;  3S9E A;  4NED A;  4FEB A;  3S9M C;  3LBS A;  1DMB A;  4GVO A;  4F3S A;  1YCJ A;  1SYH A;  3ZS6 A;  4HW8 A;  1B0H A;  4ECF A;  1B1H A;  3RY3 A;  4JDF A;  3RT8 A;  5DVF A;  4HS7 A;  4DCX A;  2I58 A;  3UOR A;  1B5H A;  1SDX A;  3EHT A;  5IKB A;  1MXY A;  2O84 X;  3GZG A;  2XXW A;  3V83 A;  4YZZ A;  4F22 A;  4NF6 B;  3W15 C;  1GV8 A;  3RNN A;  3S9N C;  2ZMB A;  4GWO A;  4H67 A;  2ANJ A;  3G3G A;  4R72 A;  3UA8 A;  3KEI A;  1FTM A;  5I56 A;  2FYI A;  1N04 A;  1JVY A;  4PFY A;  1MY4 A;  1R6Z A;  3H6W A;  4IY5 A;  3K2D A;  3BKI B;  1D4N A;  1M5F A;  4KYD A;  5ELV A;  3N94 A;  4NF8 A;  1XVX A;  4KHZ E;  3IO4 A;  1IXG A;  2GH9 A;  3S9L C;  2HXW A;  5DVJ A;  3PMW A;  1MG1 A;  2DWJ A;  3SEU A;  4FED A;  3K4U A;  3MZB A;  1P1U A;  3FVK A;  3OEM A;  4MF3 A;  4F1V A;  1JEU A;  3LR1 A;  4G68 A;  2AYS A;  4QSC A;  1ZMG A;  2Q8J A;  4IO5 A;  3UGW A;  2B4M A;  3K01 A;  2ZNS A;  5DT6 A;  4Q5T A;  3T9V A;  3U8Q A;  5JK4 A;  4DIG A;  1JW4 A;  3RYA A;  3KBR A;  5FHO A;  2QMW A;  3HN0 A;  3TOD A;  2PMS A;  2NUV A;  4E0W A;  5AA4 A;  4AB6 A;  2Q88 A;  1QUJ A;  1PC3 A;  4WED A;  2DXR A;  1S7Y A;  3FV1 A;  2OWS A;  3K00 A;  3PUX E;  4KCD A;  4BDN A;  3O6G A;  5DVI A;  1Y9U A;  5HPQ A;  1RYO A;  2O51 A;  3HST A;  5CMB A;  2WOK A;  3FJ7 A;  4I62 A;  4NWC A;  2O7U A;  3ZSF A;  2IEE A;  2CMO A;  4DZ1 A;  1O64 A;  1P99 A;  1B3L A;  4DLD A;  1S9T A;  5B7D A;  4IY6 A;  3TEP A;  2HZK A;  4DXC A;  1Y4T A;  2IA4 A;  3O2A A;  1JW1 A;  4IGT A;  1VR5 A;  1LB9 A;  3FVG A;  5ICQ A;  4ZEC A;  3O28 A;  2G93 A;  3E3K A;  1DTG A;  1IXH A;  1NNT A;  1UTB A;  3PGF A;  4YU0 A;  1Y3N A;  5AE4 A;  3PPO A;  2HFB A;  1BP5 A;  5M2V A;  1GGG A;  1I6B A;  5H8S A;  4XKN A;  1KWH A;  5EYF A;  2XXX A;  3KN7 A;  1B7Z A;  4F29 A;  1CB6 A;  4YB5 A;  4OQO A;  1IIW A;  4OES A;  4DCY A;  2R9J A;  1ANF A;  2X26 A;  1T0K A;  3MVW A;  3C31 A;  1URS A;  3RGY A;  3BBR A;  3T9U A;  3IX1 A;  1MQJ A;  1NKX A;  4LUB A;  1M5D A;  1WVJ A;  4O3A A;  5CRY A;  3TDJ A;  1B1X A;  3G3F A;  1QUK A;  4G68 C;  2RC8 A;  2Y7R A;  1VFE A;  3TTL A;  4LP2 B;  1OQG A;  3THI A;  1FTJ A;  2A5T A;  1OVB A;  2B4L A;  3TCG A;  1MDP 1;  2VGQ A;  3O66 A;  4GD5 A;  4RNS A;  4DXB A;  3FAS A;  3OEL A;  4QRZ A;  2QS3 A;  3LSX A;  3PMV A;  4MFI A;  4BLA A;  2ZYM A;  4M1V A;  5EHS A;  1LBC A;  1N3X A;  1N7W A;  5DTB A;  4N07 A;  4ONY A;  4BDR A;  3RTW B;  3ONM A;  4OYV A;  3MW0 A;  5I57 A;  2GHB A;  3KG2 A;  1O63 A;  2QPQ A;  3L6G A;  4OXV A;  3TZA A;  3VV5 A;  5ISU A;  1P1Q A;  1FQF A;  1HSL A;  1F9B A;  4QF9 A;  2XXP A;  1B4H A;  3CHG A;  4RPO A;  4X9T A;  3QIM A;  1IXI A;  3PMX A;  4UAC A;  3FXU A;  2UVI A;  2Z22 A;  4JWY A;  3K1N A;  4TLM B;  1FQC A;  3K0V A;  4ZZA A;  3K1M A;  2H98 A;  2VP1 A;  1H44 A;  3RTF B;  2O7I A;  3WAE A;  4R2B A;  4H6D A;  4ELR A;  1MXW A;  3O6H A;  4U4X A;  1A55 A;  1LFG A;  3VLU A;  3V89 B;  3Q26 A;  2ESN A;  2HEU A;  3DRK A;  4FE8 A;  4DDD A;  3EQ1 A;  5IAI A;  2DS9 A;  3OOA A;  3O97 A;  2Y7K A;  2F7C A;  4GQO A;  5K2Y A;  3T96 B;  4LZ8 A;  2OCU A;  3MP8 A;  4X1D A;  1L5T A;  2RC7 A;  2B3B A;  2RIN A;  3MQ9 A;  4NF5 A;  1I6A A;  2DWA A;  3K6V A;  1P1O A;  4O3C A;  4P11 A;  4GL8 A;  1LGB C;  1Y3Q A;  2F34 A;  1NH7 A;  4P0I A;  4F39 A;  3KFM A;  2YLN A;  3OEK A;  5A5X A;  1MPB A;  1TFD A;  5I59 A;  3DRG A;  4RA1 A;  1II5 A;  3CFX A;  3HPI A;  4R9G A;  4YKJ A;  4U4S A;  3WAF A;  1SW5 A;  3IJO B;  1Z7N E;  4JB7 A;  1SVX B;  3I3V A;  4IO3 A;  1NNP A;  2H9B A;  4ZS9 A;  3JV9 A;  2PBW A;  2QS2 A;  3G7W A;  2XX8 A;  4H8J A;  1FW0 A;  1JW5 A;  1URG A;  3SET A;  3M3L A;  2ONS A;  1Y4C A;  3C32 A;  3OMB A;  5AA2 D;  3VLV A;  4NWD A;  4HCY A;  5DEX B;  3O6P A;  2I6E A;  3MPK A;  4G8N A;  3CRB A;  1SI1 A;  4ZEK A;  1LCT A;  2ZYO A;  1BKA A;  1M5B A;  3A09 A;  3DM0 A;  2UVJ A;  3M8U A;  1H45 A;  3PPR A;  4ELO A;  3GBB A;  2I0B A;  3PV0 E;  3SKP A;  4H5F A;  1B46 A;  5ICT A;  5KCJ B;  1JEV A;  2P2A A;  2QS1 A;  2OJT A;  4Z0I A;  3FXQ A;  4PFW A;  4G2Z A;  1GVC A;  4OWD A;  4U23 A;  3KSX A;  4IGR A;  2E0S A;  1IZ1 A;  3ODB A;  4YB7 A;  1N0T A;  1OLC A;  1Y3P A;  4H0W A;  1UTB B;  3LSL A;  1YAE A;  1XC1 A;  2ONR A;  2PYY A;  4IB2 A;  4YKP A;  3MPL A;  4IO4 A;  2O1M A;  1VE4 A;  5EHM A;  2V3Q A;  2VD3 A;  1OMP A;  3K6W A;  1SW1 A;  3OO9 A;  4OFL A;  1FQD A;  2F36 A;  4L17 A;  4R73 A;  4F3P A;  2I3V A;  2WOP A;  3FIR A;  3DRF A;  3W9V A;  5ITO A;  1ZJL A;  2VD2 A;  4QFL A;  3Q25 A;  4RPN A;  4XKR A;  2Q89 A;  1B3E A;  3S2V A;  2XXR A;  1N84 A;  3D4C A;  3MP1 A;  3B6Q A;  3PD9 A;  2XD2 A;  2REG A;  1FQB A;  1EU8 A;  3H3G A;  2BJJ X;  2ZYK A;  5CC2 A;  2F97 A;  2UXA A;  4FAT A;  4H8I A;  2M8C A;  3TQW A;  3PPP A;  4M4G A;  2HQ0 A;  1EZP A;  2Z8E A;  3CSB A;  3QAX A;  1H43 A;  4THI A;  2UYE A;  4QFP A;  5H8Q B;  4FJP A;  2I48 A;  3TCH A;  1FQA A;  1LST A;  1SBP A;  4EQB A;  4PQJ A;  3QUF A;  3Q29 A;  1IEJ A;  1JET A;  4F3G A;  4ZZE A;  2Y7P A;  2OBG A;  3DP6 A;  4YMA A;  3FV2 A;  1QUI A;  5JTY B;  4OEV A;  1EZ9 A;  3U92 A;  2NWJ A;  2GHA A;  1UIV A;  2DVZ A;  3DEL B;  5BWJ A;  4ZED A;  3H6V A;  1LFI A;  4LQ2 A;  4QFN A;  4TQU Q;  2A5S A;  3C33 A;  4GOT A;  3FJM A;  3CSG A;  3IOV A;  1DPE A;  5AA3 A;  1URD A;  2V3U A;  5L9S A;  3UN6 A;  3H4Z A;  3CIJ A;  4QFK A;  5L8D A;  4YKI A;  1MQI A;  3PUW E;  1PBQ A;  1EH3 A;  4PP0 A;  4ELP A;  1ZLQ A;  4OER A;  4BDQ A;  4EDP A;  4LQ5 A;  2F8D A;  5L9M A;  2QL3 A;  3QSL A;  4F1Y A;  2AL4 A;  2UVG A;  4JBZ A;  3TFL A;  5AA4 B;  1IIT A;  1MPC A;  3FUZ A;  2I49 A;  4BDL A;  3TMG A;  2X7Q A;  2DQV A;  3M3K A;  1RYX A;  3MZ9 A;  1A8E A;  4YMB A;  1D9V A;  1TXF A;  2W7Y A;  1NNK A;  1LBB A;  2ONK E;  3IB1 A;  1TFA A;  3H06 B;  3KN3 A;  1FQE A;  4PE5 B;  2XXU A;  4R6Y A;  4ZDM A;  2Q2A A;  2B65 A;  1N3W A;  4U22 A;  5DYH A;  4IO6 A;  3IAZ A;  3DP8 A;  5AA2 A;  2XXI A;  5TP9 B;  1HSJ A;  3OD7 A;  2F7B A;  1WDN A;  2XX9 A;  1MQG A;  1MQD A;  3SER A;  1XVY A;  4ZE8 A;  3TUS A;  1MH4 A;  1B4Z A;  2DP8 A;  1FTL A;  1B7U A;  4OFJ A;  2HAU A;  5CM6 A;  3RN8 A;  2XX7 A;  4F2O A;  4FIM A;  1EZO A;  3RUM A;  5I2N B;  1B3H A;  3GBA A;  3R6U A;  3CG1 A;  5KDT B;  1YTV A;  2LAO A;  3ILU B;  3BFT A;  1IXC A;  2QJE A;  3JZJ A;  2O69 A;  4JSO A;  2KLF A;  1JNF A;  2PT1 A;  3PD8 A;  3MP6 A;  4EF1 A;  2DWI A;  2PVU A;  3KGC A;  5H8F A;  5JEI A;  1IQ7 A;  4IO2 A;  4WEP A;  4LA9 A;  2YJP A;  1LAF E;  4MLV A;  3TAJ A;  2ZNU A;  2PX1 A;  3OSR A;  4R6H A;  2UYF A;  2DSF A;  3C4M A;  3SEV A;  4GRK A;  1ZIU A;  4E0X A;  4EXK A;  4OHN A;  3KOS A;  5J1D A;  1SD3 A;  3PU5 A;  1QW0 A;  4KFQ A;  3QYT A;  1JVX A;  4GXA A;  3E4R A;  3IOT A;  4BDM A;  3TEL A;  2O68 A;  3VXC A;  4LZ5 A;  4NF5 B;  3CG3 A;  3VE1 B;  2THI A;  3H6T A;  4F19 A;  4KYE A;  4JXI A;  4EF2 A;  2GRV A;  4KPT A;  1HSE A;  4NF6 A;  4R9F A;  2Y7W A;  3MVZ A;  5I57 B;  3DRJ A;  2R6G E;  4XTC Q;  3DLN A;  4JSD A;  1LB8 A;  4Q0C A;  4BDO A;  1US5 A;  3CFL A;  3GXA A;  4NF4 A;  2FNC A;  1H76 A;  4NMY A;  2XD3 A;  3KJT A;  1B7H A;  4P0G A;  2HZL A;  3C34 A;  1MM7 A;  1H3D A;  2V3T A;  4WXJ A;  3MAM A;  4G4P A;  3TCF A;  2D5W A;  2OLB A;  5FTI A;  1LLS A;  1XS5 A;  5I2K A;  2D21 A;  1MDQ A;  4G68 B;  4Q8R A;  3UP9 A;  1PEB A;  3IOR A;  4FOR A;  1AOV A;  3K02 A;  3G3K A;  3LUY A;  5H8Q A;  4PFU A;  4POW A;  1DTZ A;  3CVG A;  3LSF B;  3Q27 A;  4LZ7 A;  5I58 A;  3FVN A;  3R7X A;  4MBP A;  5JTY A;  3EHS A;  1M5E A;  5I84 A;  3A3U A;  1NFT A;  4HTG A;  3G3J A;  3TTN A;  3TTM A;  3EPE A;  1CE2 A;  2Z8D A;  5CBS A;  1LFH A;  3D4G A;  1QVS A;  3E9X A;  3IR1 A;  1B32 A;  1XOC A;  1P1N A;  1Y20 A;  3QK6 A;  3V5A A;  4G8H A;  1PBP A;  5F7V A;  4ESX A;  2X7P A;  4U1O A;  2XXH A;  2YPN A;  4OTE A;  1UTH B;  5H8N A;  5H8H A;  4X48 A;  1AIV A;  3CR9 A;  1BIY A;  4I1D A;  5AA2 B;  4OEN A;  1DPP A;  1R1N A;  4Q30 B;  3OO8 A;  4N13 A;  3DP4 A;  2ZXT A;  1B9J A;  1MXX A;  2QSX A;  3G3I A;  4R6K A;  4YB6 A;  1UIU A;  3N5L A;  5CMM A;  5DEX A;  1LAX A;  1B05 A;  4Z7E A;  1ZTY A;  4AQ4 A;  3IK6 B;  3CFZ A;  5FHM A;  2GFE A;  4OZ9 A;  5FHN A;  3V8X B;  1B2H A;  1OLA A;  3AXF A;  3HV1 A;  2DE2 A;  5K2X A;  1TT1 A;  1AL3 A;  4XIG Q;  3TQL A;  3H7M A;  3M3F A;  4OVJ A;  2RKM A;  4DXU A;  1NNF A;  4GLI A;  1MQH A;  1USY H;  4ZEF A;  3TTR A;  1QJM A;  2RF1 A;  2XXY A;  3KOT A;  3RYB A;  4KCC A;  5B70 A;  3QXM A;  3TTK A;  2F5X A;  2NVU B;  3OO7 A;  1VSO A;  1Y1M A;  1Q35 A;  3VLW A;  5I2N A;  2REJ A;  4TOZ A;  4R74 A;  1POY 1;  1TWY A;  3JYR A;  3L6H A;  4X1B A;  3N6T A;  2I3W A;  3C36 A;  3R26 A;  1MRP A;  3MJN A;  3U1O A;  4QSD A;  2DVC A;  4PFT A;  1MY2 A;  3BFU A;  5TU0 A;  2Q9T A;  4YIC A;  4F18 A;  3GLB A;  3G3H A;  5KCJ A;  2F7A A;  2Y84 A;  3IB0 A;  3KJ7 A;  3T9H B;  3UIF A;  1JQF A;  1B58 A;  1MXU A;  3I6V A;  1PB9 A;  4H1X A;  1SW2 A;  3RPW A;  3IB2 A;  1MXV A;  4RJZ A;  3SES A;  4GL0 A;  2DE3 A;  2G29 A;  1P1W A;  2NOO A;  2VHA A;  4H65 A;  5CMC A;  1MY1 A;  2RCA A;  2VOZ A;  1VFD A;  3U93 A;  1XT8 A;  4OET A;  2O6A A;  4KI0 E;  4YAH X;  3HCQ A;  2Z8F A;  4R75 A;  4KYS A;  5CMK A;  1J1N A;  3VDF A;  2P0S A;  3O9P A;  3OSQ A;  2F6P A;  3C9H A;  1B5J A;  4MH5 A;  3VVF A;  1ZBM A;  1B3F A;  2Y7I A;  4NF8 B;  3LSW A;  4KR5 A;  1SQY A;  4GIZ A;  3K1P A;  5L9O A;  5TP9 A;  4AB5 A;  1FTK A;  3HO7 A;  4ND9 A;  2Q2C A;  1BTJ A;  4JWX A;  2RCB A;  4GXS B;  1GR2 A;  4KQP A;  4NF4 B;  4I8C A;  3CI8 A;  4U1Z A;  5A5X B;  3RT6 B;  3MZ1 A;  1A99 A;  3FTO A;  1I69 A;  1NMU A;  2OZZ A;  3PUV E;  1B5I A;  3ILT B;  4C1T A;  3DRI A;  1PB8 A;  3P7I A;  3B6T A;  3VVE A;  2O1L A;  3EN3 A;  1PDA A;  4WKM A;  2DWH A;  4ELQ A;  1M5C A;  3RQT A;  1B0L A;  1MS7 A;  2B3F A;  4C0R A;  1B3G A;  4RK2 A;  4DE8 A;  2AIX A;  4RYA A;  2ZNT A;  5CBR A;  3KZG A;  4RY1 A;  4FAJ A;  1A40 A;  2R71 A;  2A5T B;  1LAG E;  1DOT A;  2ABH A;  2XHD A;  3RLF E;  3OO6 A;  4ZEB A;  3F11 A;  3EF7 A;  3O29 A;  2UVH A;  3PUZ E;  3FZV A;  3B6W A;  1BLF A;  1ATG A;  1N76 A;  2DE4 A;  4U21 A;  4QSE A;  4F2Q A;  2RC9 A;  3FJG A;  1LAH E;  1Y1Z A;  4EQ9 A;  1IUD A;  1QKA A;  3PAM A;  1I6Q A;  5ITP A;  1MY0 A;  3IOU A;  5KDT A;  2DOJ A;  1XHY A;  4R2F A;  3USD A;  4RXL A;  3N26 A;  1OIB A;  2Z23 A;  3S4U A;  4F3B A;  1MM6 A;  3EHU A;  5HM4 B;  2PT2 A;  1N7X A;  3K6U A;  1S50 A;  5H8F B;  1FCK A;  3SEW A;  3VVD A;  1D3K A;  1A7L A;  4XXU A;  2FA7 A;  3IL1 B;  3QUJ A;  3W9W A;  3I5O A;  3MBP A;  3T22 A;  1R9Q A;  4QFO A;  1WOD A;  3FD3 A;  3FAT A;  1POT A;  1ZKB A;  2WKY A;  3LC8 A;  1Q1K A;  4YKK A;  4LON B;  1GTK A;  2OWT A;  2I4B A;  5I56 B;  1D9Y A;  1SYI A;  2OK2 A;  3MC2 A;  4FEC A;  5HBC A;  3KSJ A;  1B52 A;  5TPA A;  5KZT A;  3T66 A;  3KN8 A;  4F1U A;  2H5Y A;  1ELJ A;  1MH3 A;  1YPN A;  2DYX A;  2V93 A;  5TPA B;  1US4 A;  1AH5 A;  1SI0 A;  4POX A;  3TKD A;  2P1S A;  2QMX A;  4PET A;  2I4C A;  3U94 A;  1A54 A;  5I59 B;  3MUQ A;  4O3B A;  3PUY E;  2HCA A;  4G77 A;  3MVX A;  3FVO A;  2ALU A;  4TLL B;  3HHG A;  1OVT A;  3MVY A;  1DSN A;  2E1S A;  3ZKK A;  1MXZ A;  2QS4 A;  2CZL A;  2XXV A;  5CI5 A;  2DXY A;  4NE4 A;  4EXL A;  3K6X A;  4EQ7 A;  4QHQ A;  1UTH A;  2HAV A;  4LAT A;  5H8N B;  1B51 A;  3N6U A;  1NH8 A;  3SEY A;  5AA1 A;  4I9D A;  4U2R A;  2H4I A;  1OQH A;  3FGS A;  3B7D A;  4JWO A;  4K3F A;  5BUU A;  1B6H A;  4XKQ A;  4XKP A;  3IOW A;  4G8M A;  1USY E;  2QRY A;  3C35 A;  3IJX B;  5I2K B;  1UQW A;  3U72 A;  3TYH A;  5LOM A;  3VXB A;  4LVQ A;  4H5G A;  4F31 B;  4ISU A;  1MY3 A;  1QUL A;  2H99 A;  3A3C A;  5FTH A;  3ZKL A;  3Q28 A;  4NTL A;  1PB7 A;  4ZE9 A;  3FXR A;  3HHF A;  1Z7M E;  5I58 B;  3E13 X;  2XXQ A;  4GFR A;  3SEX A;  1LCF A;  4ZEI A;  4C1U A;  3OXN A;  1MPD A;  2V25 A;  3LVU A;  2ZYN A;  4EUO A;  3IO6 A;  3SDF A;  3T9X B;  1A8F A;  1FTO A;  3H03 A;  3TPA A;  3ECR A;  2WOL A;  1R9L A;  2H25 A;  2NXO A;  2F6G A;  1NL5 A;  1RKM A;  2XXT A;  2F35 A;  3MWB A;  1ZU0 A;  3PPN A;  1SW4 A;  4HCW A;  3VFJ A;  3T93 B;  4OFO A;  4IO7 A;  4N6P A;  4UA8 A;  1AMF A;  4GF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...