1B5JA

Oligo-peptide binding protein (oppa) complexed with kqk
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 185
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b5jA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b5jA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b5jA02
4XKNA 5H8SA 2OK2A 4JXIA 4BDMA 2O51A 3K4UA 3CHGA 3PPPA 4RK9A 3CFZA 1GTKA 1DTGA 5KCJB 1XVYA 5EHSA 4ZEBA 3HV1A 4YMBA 4R72A 2WKYA 3TTLA 1Y3NA 4OEVA 1Q35A 4DXUA 3TFLA 1FQDA 4HCWA 4Q5TA 2XXRA 3TTMA 1LAXA 4LQ2A 2OJTA 5EHMA 4WXJA 3OEKA 4OXVA 4O3BA 2XX9A 4GXSB 1O7TA 2GFEA 1OQHA 2UVJA 3E4RA 1CE2A 1JW4A 3FZVA 5DEXB 5CI5A 1P1WA 1SYIA 3IO4A 3P7IA 4OTEA 2Z22A 1OQGA 3T9XB 1LB9A 3T9VA 3C33A 1QULA 2DYXA 4ND9A 4G4PA 4R6YA 4GLIA 4KYEA 3G7WA 2QS1A 3GXAA 2REJA 2H98A 5ISUA 2RINA 3EHSA 5AA4A 3ILTB 1ZJLA 3O9PA 3TAJA 2I49A 2I6EA 1Y4CA 2P1SA 2VP1A 3IJOB 5DTBA 3PUWE 1LFHA 2DE2A 4DIGA 3U93A 1LAHE 3ZKLA 1MXZA 3UGWA 2V25A 3TYHA 5TU0A 1ANFA 2ZMBA 3D4GA 1JNFA 2NWJA 2PT1A 1PEBA 3RTFB 3RGYA 4G8NA 3IX1A 2ONRA 3ONMA 5I59B 4GF8A 1N3WA 1B51A 1N7XA 3VLWA 2Y7KA 4R75A 3S9MC 3RT8A 5FTIA 3UN6A 4QHQA 1B3GA 5TP9A 5ICTA 2VOZA 5TPAB 2PT2A 3CFLA 5KZTA 1S7YA 4YB7A 3SERA 5H8NA 1VE4A 1MM6A 4U4XA 1N7WA 5I58A 4OWDA 5CRYA 3PD8A 1B2HA 3MWBA 2WOLA 2I48A 1B3FA 1D9YA 3TODA 1WDNA 2O7IA 4RJZA 5I2NA 5K2XA 1SQYA 3ZKKA 4FECA 3KOTA 3PUYE 1EZ9A 1B1HA 3PPOA 1B52A 3K6XA 4YB6A 2X7QA 3KJ7A 5CMKA 1MY2A 4BLAA 3K6UA 1T0KA 1PC3A 3BFTA 1MXWA 4GWOA 3U72A 4ELQA 1R9LA 3ZSFA 1IXGA 1M5CA 1JW1A 1EH3A 4OFJA 2ALUA 1USYH 2XD2A 2REGA 4G77A 4MH5A 3SEWA 3FUZA 2IA4A 3GBBA 3O66A 1MDQA 1LAGE 1M5BA 1IXIA 3TCGA 1B9JA 2XXXA 4PP0A 2QPQA 4GVOA 4AB5A 4RK2A 2OCUA 3OO9A 4ZZAA 3S2VA 4NF8B 4G68B 4EQBA 3EQ1A 3CG3A 4QFNA 4QFOA 3DP6A 3I6VA 3C35A 1FQFA 2Z8EA 1SI0A 3PMVA 4DXBA 3OSQA 2I4BA 3QUJA 2DQVA 2DE3A 4F3GA 4NF6B 3U94A 1B5HA 3G3HA 3KGCA 4YKJA 1QW0A 1GGGA 5I56B 3TQWA 2BJJX 1LBBA 2PBWA 3FXRA 3U92A 1FTJA 4KD5A 1MXYA 1A8FA 3F11A 4XKQA 4WEPA 2GHAA 4F1UA 3TTKA 3R7XA 1PBQA 4LQ5A 3K02A 2F7CA 1MY1A 4F22A 4OERA 1VFDA 1B7HA 4OHNA 4M1VA 1TWYA 4NF5B 4MLQA 1SYHA 3SDFA 1ZLQA 2HZKA 3OO7A 1MPBA 3THIA 4NTLA 2UVHA 4GL0A 4X48A 2VHAA 3MZ1A 3M3LA 3IO6A 4H8IA 4ONYA 3V8XB 3MP6A 4U1ZA 1Y1ZA 1BKAA 2OWSA 2D21A 4TQUQ 3IOUA 3KN8A 1Y9UA 4HCYA 2QSXA 2XXQA 3O6HA 3S9LC 2HAUA 3H6WA 3M8UA 5H8QA 1YCJA 4WKMA 5I57B 3AXFA 4YKPA 4NE4A 4LA9A 3TTNA 4POWA 2RCAA 4IO3A 3SEXA 2QMWA 2XXVA 3B6QA 5IAIA 1GV8A 3FGSA 4F3SA 3K00A 1UTHB 4QFKA 3S9NC 3HSTA 1LAFE 3KEIA 4Q8RA 2DSFA 1MM7A 1QKAA 1N76A 3A3UA 4H65A 3MVWA 1SD3A 4R9FA 3CSBA 1KWHA 3V89B 1FQCA 3VFJA 3SESA 2ZYNA 4RXLA 3VVDA 2O68A 2O69A 1ZKBA 3H03A 2RCBA 2HEUA 1UIUA 4LZ7A 5A5XA 4ECFA 1NNPA 3IJXB 2QS2A 4XKRA 2DVZA 3VXBA 1MY3A 1XHYA 3FD3A 1NMUA 3LSWA 3K6VA 2A5TA 4PETA 3G3IA 3SEUA 1DSNA 4IO7A 2PMSA 5TP9B 2ZNSA 4YKIA 1IIWA 1JEVA 3EHUA 5HBCA 5F7VA 2I0BA 3W9VA 4GQOA 3RT6B 3T22A 4I1DA 4LATA 2QS4A 3CIJA 3QXMA 3PU5A 2I58A 5H8FA 1MQGA 1B4HA 3Q29A 1VSOA 2A5SA 2UYEA 1H43A 2ABHA 3W9WA 1MH3A 5I2KB 4LVQA 2YLNA 3OMBA 1JVXA 1MG1A 5JTYB 3C36A 1M5EA 2DVCA 1OLAA 1D3KA 3CR9A 3PPQA 4GFRA 3VVFA 1R9QA 4R9GA 2RKMA 1MQIA 3JV9A 1B5JA 1FTMA 3C4MA 2NOOA 1AMFA 2F78A 1DPEA 3VLUA 1D9VA 3HN0A 3TCFA 1H76A 4OEUA 2XXPA 4LZ5A 3O6PA 2QL3A 5ICQA 4H8JA 1XOCA 3FVKA 2F7AA 1Y4TA 3CSGA 3PMXA 3T96B 1POTA 2R71A 1PDAA 4QSDA 2X26A 1IITA 1IXCA 3TQLA 4NF4B 3DRKA 1JW5A 3JZJA 3Q26A 1TFDA 3MW0A 2F34A 1PB9A 3N94A 1LLSA 1NNFA 1Y3PA 2ONKE 1TT1A 2DS9A 3K6WA 1JETA 3IORA 2H4IA 2DE4A 3KSJA 2OWTA 1SW1A 1LFGA 3K0VA 4H67A 3MVYA 1UTBB 3MP1A 2ZYKA 2B65A 3OENA 1ZTYA 1I6QA 3VVEA 3MBPA 1LCFA 3LVUA 4POXA 3TTRA 2FYIA 4GL8A 2F5XA 2XX7A 3PGFA 5K2YA 3WAEA 4H1XA 1MY4A 3MVXA 4HTGA 4EF1A 2O1LA 3B6TA 4BDRA 2NVUB 4PFTA 4OENA 4THIA 2Y7WA 3KG2A 1EZOA 2I4CA 1NNTA 5FHNA 1LBCA 3O97A 1WODA 4OQOA 4ELOA 1M5FA 4XXUA 2ZXTA 3OXNA 5KDTB 1MRPA 3DLNA 4LP2B 4C1UA 3N6UA 2WOPA 1B1XA 3KZGA 2QRYA 4QRZA 3CFXA 4I9DA 1I6AA 3FXQA 4KCCA 3RTWB 4OMBA 1LGBC 4TLMB 4U4SA 2VGQA 4IY6A 4YMAA 3RYAA 1AOVA 1A40A 1SW4A 4ZZEA 1XS5A 4PQJA 2E1SA 5M2VA 4ZE8A 1WVJA 2Q2CA 1IQ7A 3K2DA 4DE8A 3MJNA 3MQ9A 5I84A 2HAVA 3W15C 2PYYA 1Y1MA 1LB8A 3TEPA 3UA8A 2DWJA 2ZYMA 3FXUA 4KI0E 2W7YA 3KN7A 4X1BA 4H5FA 3KFMA 3E13X 5FHMA 2AL4A 4H6DA 3K1NA 4OFLA 1NH8A 4U1OA 5DT6A 3FTOA 4JB7A 3HPIA 4PE5B 3D4CA 1B4ZA 2XHDA 1B05A 5FHOA 5A5XB 4MFIA 4E0WA 1JEUA 1QUKA 3H4ZA 1FQBA 5B70A 5ITPA 3HO7A 2M8CA 1ZIUA 4TOZA 1NKXA 1QUJA 1US5A 4RPOA 5CMCA 4KFQA 1XVXA 3TPAA 2AYSA 2GH9A 1AL3A 5AA2B 4DCXA 3FJMA 4R2BA 3VLVA 4C0RA 5H8FB 4G2ZA 5LOMA 2HXWA 5DEXA 4U23A 5JK4A 3I5OA 3PUXE 1RKMA 4YKKA 3MVZA 1DOTA 3MC2A 4FIMA 2XD3A 4RA1A 2CZLA 3I3VA 4EXKA 3N6TA 3R26A 1MQJA 4F2QA 1P1QA 4EXLA 1B32A 1GVCA 4KHZE 3T66A 1FTKA 3SEVA 4PFWA 4XKPA 4OYVA 4Q0CA 3CVGA 1S9TA 2R6GE 1HSLA 1BLFA 2NXOA 4X9TA 2V3QA 4XTCQ 1YTVA 4XIGQ 3SKPA 1Z7ME 3C34A 1ZBMA 3PUVE 2B4MA 1LSTA 1SDXA 3MPLA 2VD2A 4F19A 3IOWA 5I59A 2DP8A 2V93A 4UACA 3PD9A 1A7LA 1RYOA 4ZEKA 1B3LA 3DELB 4JDFA 2XXUA 5CBRA 1A8EA 5CM6A 5TPAA 2XXHA 1US4A 1FTLA 2Q9TA 1DMBA 1SVXB 4I62A 5HM4B 1OMPA 1JQFA 3QUFA 4IO4A 2HQ0A 4YAHX 3IR1A 3KOSA 2YJPA 4YICA 1BP5A 4KQPA 4FE8A 3QK6A 4KR5A 3KSXA 4IO2A 4LZ8A 1MXVA 1B6HA 4NWCA 5AA4B 4PFUA 3S9EA 3H06B 4DDDA 4HW8A 3BBRA 2PVUA 3R6UA 1H45A 2HCAA 3G3JA 4C1TA 2GRVA 3O2AA 4BDLA 4ESWA 4OESA 1YPNA 3TUSA 3ILUB 1QVSA 3HHFA 1LCTA 3H6VA 3DP4A 3KBRA 4N13A 1M5DA 4NEDA 1P1NA 5ITOA 4EF2A 1OLCA 3U1OA 1XT8A 2V3TA 2I3WA 3PMWA 4MBPA 2FNCA 4GOTA 2P2AA 1A54A 4LONB 4JSDA 5L8DA 1NFTA 2VD3A 5F1QA 3KN3A 3WAFA 4G68C 3MZ9A 1IXHA 2XXYA 3DRIA 3T9UA 3RYBA 3N5LA 3K1MA 5H8NB 5JEIA 2ONSA 4G68A 4YZZA 5I58B 2FA7A 1MQHA 2Q2AA 4JBZA 1LFIA 3ODBA 2OZZA 1EU8A 2ZYOA 4NF6A 3KJTA 5I2NB 2RC8A 4DLDA 3DRHA 3T9HB 3L6GA 4H5GA 5I56A 4EDPA 2ANJA 1OVTA 3O28A 3JYRA 4P11A 4JSOA 4QFLA 3TZAA 3LC8A 2Z8DA 1D4NA 1QJMA 2H5YA 5CBSA 4R6KA 3U8QA 3TCHA 1SI1A 2DXRA 5IKBA 2HZLA 4NF5A 2F7BA 3VXCA 3UIFA 1UIVA 4R74A 2Y7PA 3QAXA 1L5TA 4F2OA 4YU0A 3K01A 1B3EA 3G3GA 2O7UA 1ATGA 1H3DA 2THIA 3IB0A 2PX1A 1S50A 3V5AA 3E3KA 1Z7NE 3QYTA 3DRJA 4F1YA 1HSEA 1A55A 3M3FA 4F31B 3C9HA 2AL5A 4DXCA 1ZMGA 1MQDA 3RLFE 3RY3A 5I57A 4FEBA 4OETA 4RNSA 4Z0IA 5L9MA 3O6IA 3ECRA 1BIYA 1TXFA 4X1DA 4ELRA 2RC9A 2B3BA 4L17A 4F18A 4GIZA 4IGTA 2F6PA 2F6GA 1UTHA 1POY1 3Q27A 1JVYA 3PPNA 1FCKA 1MPDA 4DZ1A 3EF7A 3B6WA 4JWXA 3Q25A 3SEYA 3TMGA 1IEJA 3RPWA 2HFBA 4TLLB 3PPRA 1XC1A 1OIBA 1UQWA 4N07A 1B58A 2Q8JA 2DXYA 3QSLA 2R9JA 3UP9A 2O6AA 1URGA 5HPQA 3A09A 2Y7RA 4F1VA 1B0HA 4K3FA 4Z7EA 3O6GA 4IGRA 1I6BA 3FJ7A 4R2FA 1QKBA 4HS7A 5H8QB 5CMMA 3LBSA 5DVJA 4QFPA 2QJEA 1MPCA 4YB5A 1MXUA 4R6HA 2G93A 1NL5A 3C31A 4R73A 4M4GA 5DYHA 2V3UA 3OOAA 2H9BA 2CMOA 3LUYA 1DTZA 4ISUA 1N04A 3K1PA 4GD5A 3RUMA 5BUUA 2Q88A 5I2KA 1MXXA 4O3AA 5AA3A 3BFUA 1B5IA 5JTYA 4ESXA 3MZBA 3OELA 3UK4A 4G8HA 3RQTA 2UVIA 4ZDMA 3FVGA 3IOVA 4P0GA 1QUIA 2NUVA 5H8HA 4FORA 4G8MA 3MPKA 2DOJA 1FTOA 1GR2A 3H6UA 3PAMA 5DVIA 4F3PA 5KCJA 1J1NA 4U21A 3TDJA 1TFAA 2Z8FA 4QSCA 3RNNA 2LAOA 1PB8A 4RY1A 1MH4A 1H44A 2RF1A 3H3GA 1B0LA 1P1OA 4ZEIA 4U2RA 2A5TB 4WEDA 3B7DA 3HCQA 3VDFA 2F97A 2G29A 4JWOA 3S4UA 4F29A 4ZECA 1PB7A 5CMBA 2IEEA 2O84X 1FW0A 4ZEDA 3FATA 1Y20A 1A99A 4P0IA 5L9SA 4NF4A 2I0CA 3TELA 2F8DA 2Y84A 3G3KA 1F9BA 3FV1A 5CC2A 4ELPA 4ZEFA 2QMXA 3T93B 3FV2A 4GXAA 2DWIA 1FQEA 5FTHA 3PV0E 3CG1A 4KYDA 3FIRA 3DRFA 1VFEA 4IB2A 4F39A 1IZ1A 3OO8A 1B3HA 3LSFB 3SETA 2DWAA 1SBPA 2Z23A 2XX8A 1UTBA 2Q89A 3HHGA 2B3FA 4RYAA 3IAZA 3Q28A 1OVBA 2OBGA 3C32A 3DM0A 4FATA 1Q1KA 4IY5A 3MUQA 3GBAA 1HSJA 5AA2D 3CI8A 3QIMA 4AB6A 3MAMA 1URSA 4O3CA 5AA1A 3UORA 4JWYA 3LSLA 4ZS9A 2DWHA 5ELVA 1BTJA 4RPNA 3OEMA 4AQ4A 4FJPA 4F3BA 4QSEA 3PUZE 1YAEA 2P0SA 4E0XA 3VE1B 1CB6A 1NH7A 2Y7IA 1SW5A 2F36A 1AIVA 1B46A 2XXWA 5KDTA 3G3FA 1P99A 5DVFA 2X7PA 2RC7A 4FEDA 3ZS6A 1Y3QA 1USYE 3MP8A 4IO6A 3FVNA 3CRBA 2ZNTA 3GLBA 2O1MA 2GHBA 3IL1B 3E9XA 3IOTA 4EQ7A 2H25A 5AE4A 2QS3A 3IB1A 4MLVA 3EHTA 4BDOA 4GRKA 1SW2A 1N3XA 2UXAA 3EPEA 4LUBA 4KCDA 4U22A 2XXIA 1AH5A 3DP8A 3V83A 3N26A 4KPTA 4NMYA 2WOKA 2YPNA 5J1DA 3A3CA 4OFOA 3VV5A 3L6HA 4BDNA 3M3KA 3RN8A 3H6TA 1FQAA 2XXTA 2UVGA 3LSXA 4IO5A 1ELJA 2H99A 2D5WA 4H0WA 2F35A 1RYXA 1PBPA 1IUDA 4MF3A 1MY0A 3FJGA 4EUOA 2AIXA 5L9OA 3TKDA 1O63A 3FASA 1B40A 2KLFA 4I8CA 3OSRA 1N0TA 4NWDA 1ZU0A 4OZ9A 4BDQA 1DPPA 1II5A 4ZE9A 3O29A 4NF8A 2D3IA 1I69A 5EYFA 4FAJA 2E0SA 4EQ9A 1N84A 1B7UA 1P1UA 2UYFA 1R1NA 2ESNA 5AA2A 5BWJA 4PFYA 3EN3A 3OD7A 1MDP1 2ZNUA 5B7DA 2I3VA 3H7MA 3GZGA 3USDA 4QF9A 4OVJA 3IK6B 1MS7A 3IB2A 4N6PA 1VR5A 3BKIB 3LR1A 1O64A 1EZPA 3FVOA 4KYSA 2V84A 1B7ZA 3OO6A 4Q30B 4DCYA 1NNKA 2OLBA 4UA8A 1R6ZA 5H8HB 1URDA 3DRGA 2B4LA
chains in the Genus database with same CATH superfamily
4XKNA 5H8SA 2OK2A 4JXIA 4BDMA 2O51A 3K4UA 3CHGA 3PPPA 4RK9A 4PCDA 3CFZA 1GTKA 1DTGA 2P3NA 5KCJB 1XVYA 5EHSA 4NGUA 4ZEBA 3HV1A 3U65A 4YMBA 4R72A 2WKYA 3TTLA 1Y3NA 3E78A 4OEVA 1Q35A 4DXUA 4DI4B 3RPLA 3TFLA 1FQDA 4HCWA 4Q5TA 4DI3D 2XXRA 3TTMA 2FBPA 1FJ6A 1LAXA 4LQ2A 2OJTA 5EHMA 4WXJA 3OEKA 4OXVA 4O3BA 2XX9A 4GXSB 1O7TA 2GFEA 1OQHA 4JVCA 4QBAA 1SPIA 2UVJA 3E4RA 1CE2A 2WBBA 1JW4A 1NV4A 3FZVA 5EQAA 5DEXB 5CI5A 1P1WA 1SYIA 3IO4A 3P7IA 4OTEA 2Z22A 1OQGA 3T9XB 1LB9A 3T9VA 3C33A 1QULA 4N8GA 2DYXA 4ND9A 4G4PA 4NQ8A 4R6YA 4GLIA 4KYEA 3G7WA 2QS1A 3GXAA 5IZ1A 2REJA 2H98A 5ISUA 4NHBA 4OVSA 2RINA 3EHSA 5AA4A 3ILTB 1ZJLA 3O9PA 1RDXA 3TAJA 2I49A 1NV7A 2I6EA 1Y4CA 2P1SA 2VP1A 3IJOB 5DTBA 3PUWE 1LFHA 2DE2A 4DIGA 3U93A 1LAHE 4PFRA 3ZKLA 1MXZA 3UGWA 4PGPA 4PE3A 2V25A 3TYHA 5TU0A 1ANFA 2ZMBA 4KXPA 3D4GA 1JNFA 2NWJA 2PT1A 1PEBA 3RTFB 3RGYA 2PFZA 4G8NA 3IX1A 2ONRA 3ONMA 5I59B 4GF8A 1N3WA 1B51A 4MIJA 1N7XA 3VLWA 2Y7KA 4HE0A 4R75A 3S9MC 1YYZA 3RT8A 5FTIA 3UN6A 4QHQA 1B3GA 5TP9A 4P9KA 5ICTA 2KQZA 2VOZA 1FPFA 5TPAB 2PT2A 3CFLA 5KZTA 1S7YA 4YB7A 2QVRA 3SERA 5H8NA 1VE4A 1MM6A 1LBYA 4U4XA 1N7WA 5I58A 1FSAA 4OWDA 5CRYA 5DW8A 3PD8A 1B2HA 3MWBA 2WOLA 3RYDA 4MJOA 3D1RA 2I48A 1B3FA 4P1LA 1D9YA 3TODA 1WDNA 2O7IA 4RJZA 5I2NA 5K2XA 1G0IA 1SQYA 1EYJA 4FECA 3KOTA 3PUYE 3ZKKA 2CZIA 1EZ9A 1B1HA 3PPOA 1B52A 3K6XA 5ET5A 4YB6A 2X7QA 3KJ7A 5CMKA 1MY2A 4BLAA 3K6UA 1T0KA 2JJKA 1PC3A 3BFTA 1MXWA 4GWOA 5I7IA 3U72A 4ELQA 1R9LA 3ZSFA 1IXGA 1M5CA 3B8BA 1JW1A 1EH3A 4OFJA 2ALUA 3LV0A 1USYH 2XD2A 2REGA 4G77A 4MH5A 1K9YA 4O8MA 2VT5A 1FBGA 3SEWA 3FUZA 2IA4A 3GBBA 3O66A 1MDQA 1LAGE 1M5BA 1IXIA 3TCGA 4NX1A 2Y5KA 1B9JA 2XXXA 4PP0A 2QPQA 1FBCA 4GVOA 4AB5A 4RK2A 2OCUA 3OO9A 4ZZAA 3S2VA 4NF8B 4G68B 4EQBA 3EQ1A 3CG3A 4QFNA 4QFOA 3DP6A 3I6VA 4O7IA 3C35A 1Q9DA 1NUZA 1FQFA 2Z8EA 1SI0A 3PMVA 4DXBA 3OSQA 2I4BA 3A29A 3QUJA 4NF0A 2DQVA 2DE3A 4F3GA 4QXDA 1K9ZA 4NF6B 5LTCA 3U94A 1B5HA 1G0HA 3G3HA 3KGCA 3MYUA 4YKJA 1FPJA 1QW0A 1GGGA 5I56B 3TQWA 2BJJX 1LBBA 2PBWA 3FXRA 3U92A 1FTJA 4KD5A 1MXYA 1A8FA 3F11A 4XKQA 4WEPA 2GHAA 4F1UA 3TTKA 3R7XA 1PBQA 1LBWA 4LQ5A 3K02A 2F7CA 1MY1A 4F22A 4OERA 1VFDA 1B7HA 4OHNA 4M1VA 1TWYA 4NF5B 4GBWA 1SYHA 4MLQA 1ZLQA 3SDFA 2HZKA 3OO7A 2FHYA 1MPBA 3THIA 3KBZA 4NTLA 4P47A 2UVHA 3HFUA 4GL0A 4X48A 2VHAA 1FPGA 3MZ1A 3M3LA 3IO6A 4H8IA 4ONYA 3V8XB 3MP6A 4U1ZA 1Y1ZA 1BKAA 2OWSA 2D21A 4TQUQ 3IOUA 4N6KA 3KN8A 1Y9UA 4HCYA 2QSXA 2XXQA 3O6HA 3S9LC 2HAUA 3H6WA 3M8UA 5H8QA 1YCJA 4N8YA 4WKMA 5I57B 3AXFA 4YKPA 4NE4A 4LA9A 3TTNA 4MNCA 1IMAA 4POWA 2RCAA 4IO3A 3SEXA 2QMWA 2XXVA 3B6QA 5IAIA 1GV8A 3FGSA 3K00A 4F3SA 1UTHB 2ZZXA 5FBPA 4QFKA 3S9NC 3HSTA 1LAFE 3KEIA 2WBDA 4Q8RA 2DSFA 3GYYA 1MM7A 1QKAA 1N76A 3A3UA 4H65A 3MVWA 1SD3A 4R9FA 3CSBA 1KWHA 3V89B 1FQCA 3VFJA 3SESA 2ZYNA 4RXLA 3VVDA 2O68A 2O69A 1ZKBA 3H03A 2RCBA 2HEUA 1UIUA 4LZ7A 5A5XA 4ECFA 1NNPA 3IJXB 2QS2A 4XKRA 2DVZA 3VXBA 1MY3A 1XHYA 3FD3A 1NMUA 3LSWA 1IMBA 3K6VA 2A5TA 4PETA 1KA1A 3NOHA 3G3IA 4GWSA 3SEUA 1DSNA 4IO7A 2PMSA 2WYPA 5TP9B 2ZNSA 4YKIA 4PBHA 1IIWA 1JEVA 3EHUA 5HBCA 5F7VA 2I0BA 2FIXA 3W9VA 2FIEA 4GQOA 3RT6B 3T22A 4I1DA 4LATA 2QS4A 3CIJA 3QXMA 3PU5A 2I58A 5H8FA 4OVQA 1MQGA 1B4HA 5IZ3A 3Q29A 1VSOA 2A5SA 2UYEA 4XFEA 1FBHA 4H46A 1H43A 2ABHA 3W9WA 1MH3A 5I2KB 4LVQA 3QMFA 2YLNA 3OMBA 1JVXA 1MG1A 3SZPA 5JTYB 3C36A 1M5EA 2DVCA 1OLAA 1D3KA 3CR9A 3PPQA 4GFRA 3VVFA 1R9QA 3MSTA 4HE1A 2CEXA 4R9GA 4PAKA 2RKMA 1MQIA 3JV9A 1B5JA 4N91A 1FTMA 3C4MA 2NOOA 1AMFA 2F78A 1DPEA 5IZZA 3VLUA 1D9VA 3HN0A 3TCFA 1H76A 2ZZVA 4OEUA 2XXPA 4LZ5A 2VPNA 3O6PA 2QL3A 5ICQA 4H8JA 1XOCA 3FVKA 2F7AA 3T0JA 1Y4TA 3BIGA 3CSGA 3PMXA 4FBPA 3T96B 1POTA 2R71A 1PDAA 4QSDA 2X26A 1IITA 1IXCA 3TQLA 4NF4B 3DRKA 2DDKA 1JW5A 3JZJA 3KC0A 3Q26A 1TFDA 3MW0A 2F34A 1PB9A 2ZZWA 3N94A 1LLSA 1NNFA 1Y3PA 2ONKE 2QVVA 1TT1A 1CNQA 2DS9A 3K6WA 1JETA 3IORA 2H4IA 2DE4A 3KSJA 1FBPA 2OWTA 1SW1A 1LFGA 2CZKA 3K0VA 4H67A 3MVYA 1UTBB 3MP1A 2ZYKA 2B65A 2FVZA 3OENA 1ZTYA 1I6QA 3VVEA 3MBPA 1LCFA 3LVUA 4POXA 3TTRA 1FBFA 2FYIA 4GL8A 2F5XA 2XX7A 3PGFA 5K2YA 3WAEA 4H1XA 1MY4A 3MVXA 4N4UA 4HTGA 4EF1A 4NN3A 4GWUA 2O1LA 1INPA 3B6TA 4BDRA 2NVUB 4PFTA 4OENA 4THIA 1FPDA 2Y7WA 3KG2A 1EZOA 1FTAA 2I4CA 2F3DA 1NNTA 5FHNA 1LBCA 3O97A 1WODA 4OQOA 4ELOA 3IFAA 4HE2A 1M5FA 4XXUA 2ZXTA 3OXNA 5KDTB 1MRPA 4PFBA 3DLNA 4LP2B 1NV2A 1QGXA 2QVUA 2Q8MA 4C1UA 3N6UA 2WOPA 1B1XA 3KZGA 2QRYA 4QRZA 3CFXA 4I9DA 1I6AA 3FXQA 4KCCA 3RTWB 4OMBA 1LGBC 3EKIA 4TLMB 4U4SA 4GWZA 2VGQA 4IY6A 4YMAA 3RYAA 4GBVA 1AOVA 1A40A 1SW4A 3T1BA 4ZZEA 1XS5A 4MNPA 4PQJA 2E1SA 4AS5A 5M2VA 4ZE8A 1WVJA 2Q2CA 1IQ7A 3K2DA 4DE8A 3MJNA 3MQ9A 1NV0A 5I84A 2HAVA 2MKZA 3W15C 3ROJA 2PYYA 1Y1MA 4JVDA 5ET8A 1LB8A 3TEPA 3UA8A 4P56A 2DWJA 2ZYMA 3FXUA 4KI0E 4X04A 2W7YA 3KN7A 4X1BA 5LDZA 1AWBA 4H5FA 1IMEA 3KFMA 3E13X 4P3LA 5FHMA 2AL4A 4H6DA 3K1NA 4OFLA 1NH8A 4U1OA 5DT6A 3FTOA 4JB7A 3HPIA 4PE5B 3D4CA 1B4ZA 2XHDA 1B05A 5FHOA 5A5XB 4MFIA 1RDZA 4MCOA 4E0WA 1JEUA 1QUKA 3H4ZA 1FQBA 2WYKA 5B70A 5ITPA 3HO7A 2M8CA 1ZIUA 1KA0A 4TOZA 1NKXA 1QUJA 1US5A 4RPOA 5CMCA 4KFQA 1D9QA 1XVXA 3TPAA 2AYSA 2GH9A 2L5VA 1AL3A 5AA2B 4DCXA 3FJMA 4R2BA 3VLVA 4C0RA 5H8FB 4G2ZA 5LOMA 2HXWA 5DEXA 5IZ3B 4U23A 5JK4A 3I5OA 3PUXE 1RKMA 4YKKA 3MVZA 1DOTA 3MC2A 4MX6A 1YZ0A 4FIMA 4I3YA 2XD3A 4RA1A 2CZLA 3I3VA 4EXKA 3N6TA 3R26A 1MQJA 4F2QA 1P1QA 4EXLA 1B32A 1GVCA 4KHZE 3T66A 1FTKA 3SEVA 4PFWA 4XKPA 4OYVA 4Q0CA 4GX6A 3CVGA 1S9TA 2R6GE 1HSLA 1BLFA 2NXOA 4X9TA 2V3QA 4XTCQ 1YTVA 4XIGQ 3SKPA 1Z7ME 3C34A 1ZBMA 3PUVE 2B4MA 1LSTA 1SDXA 3LUZA 1LBXA 2XWIA 3MPLA 2VD2A 4F19A 3IOWA 3RPLB 5I59A 2DP8A 2V93A 4UACA 3PD9A 1A7LA 1RYOA 4ZEKA 1B3LA 3DELB 4JDFA 2XXUA 5CBRA 4P8BA 1A8EA 1NV1A 4PDHA 1LEVA 1FBDA 5CM6A 4PTKA 5TPAA 2XXHA 1US4A 4MMPA 2VPOA 5IGAA 1FTLA 2Q9TA 1DMBA 1SVXB 4I62A 5HM4B 1OMPA 1JQFA 3QUFA 4IO4A 2HQ0A 4YAHX 3IR1A 3KOSA 2YJPA 4YICA 1BP5A 4KQPA 1NUWA 4FE8A 3QK6A 4KR5A 3KSXA 3B50A 4IO2A 4LZ8A 1MXVA 1B6HA 4NWCA 5AA4B 4PFUA 5ESYA 3S9EA 3H06B 4DDDA 4HW8A 3BBRA 2PVUA 3R6UA 1H45A 2HCAA 3G3JA 4C1TA 2GRVA 4GWYA 3O2AA 4BDLA 4ESWA 4OESA 1YPNA 3TUSA 3ILUB 1QVSA 3HHFA 1YXIA 1LCTA 4GWWA 3H6VA 3DP4A 5EYHA 3KBRA 4N13A 1M5DA 4NEDA 1P1NA 5ITOA 2HHMA 4EF2A 1OLCA 3U1OA 1XT8A 2V3TA 2I3WA 4PAFA 3PMWA 4MBPA 2FNCA 4GOTA 2P2AA 1A54A 4LONB 4JSDA 5L8DA 1NFTA 2VD3A 5F1QA 3KN3A 3WAFA 4G68C 5IM2A 3MZ9A 1IXHA 2XXYA 3DRIA 3T9UA 3RYBA 3N5LA 3K1MA 5H8NB 1RDYA 2ONSA 5JEIA 4G68A 2R8TA 4YZZA 5I58B 4PF6A 2FA7A 1MQHA 2Q2AA 1FRPA 4JBZA 1NUYA 1LFIA 3ODBA 2OZZA 1EU8A 4PF8A 2ZYOA 4OVPA 4NF6A 3KJTA 5I2NB 2RC8A 4DLDA 3DRHA 3T9HB 3L6GA 4H5GA 5I56A 4EDPA 2ANJA 1OVTA 1DBZA 3O28A 3JYRA 4P11A 4JSOA 4QFLA 3TZAA 3LC8A 2Z8DA 1D4NA 1QJMA 2H5YA 5CBSA 4R6KA 3U8QA 3TCHA 1SI1A 2DXRA 5IKBA 2HZLA 1IMDA 4NF5A 2F7BA 3VXCA 3UIFA 1UIVA 4R74A 2Y7PA 3QAXA 1L5TA 4F2OA 4YU0A 3K01A 1B3EA 3G3GA 2O7UA 1ATGA 1H3DA 2THIA 1XI6A 3IB0A 2PX1A 4P1EA 1S50A 3V5AA 3E3KA 1Z7NE 1NI9A 3QYTA 3DRJA 4F1YA 1HSEA 1A55A 3M3FA 4F31B 2CEYA 3C9HA 2AL5A 4DXCA 1ZMGA 5A5LA 1MQDA 3RLFE 3RY3A 5I57A 4FEBA 5EQ9A 4O7MA 4XEQA 4OETA 4RNSA 4Z0IA 5L9MA 3O6IA 3ECRA 1BIYA 1TXFA 5F24A 2F3BA 4X1DA 4ELRA 5EYGA 2RC9A 2B3BA 4L17A 4F18A 5I5PA 1NV3A 4GIZA 4IGTA 1EYKA 2F6PA 2F6GA 1UTHA 1POY1 1EYIA 4H45A 4XF5A 3Q27A 3ISPA 1JVYA 3PPNA 1FCKA 1MPDA 4DZ1A 3EF7A 3B6WA 4JWXA 4LN5A 3Q25A 3SEYA 3TMGA 1IEJA 3RPWA 2HFBA 4TLLB 2PCRA 1FPEA 1NV6A 3PPRA 4HXVA 1JP4A 1XC1A 5EQ7A 1OIBA 1UQWA 4N17A 4N07A 1B58A 2Q8JA 2DXYA 2Y5LA 2R9JA 3QSLA 3UP9A 2O6AA 1URGA 2GQ1A 5HPQA 3A09A 1NUXA 2Y7RA 4F1VA 4PFIA 1B0HA 4K3FA 4Z7EA 3O6GA 4IGRA 4OVRA 1I6BA 3FJ7A 4R2FA 1QKBA 4HS7A 5H8QB 5CMMA 3LBSA 5DVJA 4QFPA 2QJEA 1MPCA 4YB5A 4O94A 1MXUA 4R6HA 2G93A 1NL5A 3C31A 4R73A 4M4GA 5DYHA 2V3UA 3OOAA 2H9BA 4PDDA 2CMOA 2V4CA 3LUYA 1VDWA 1DTZA 4ISUA 1N04A 1URDA 3K1PA 4GD5A 3RUMA 5BUUA 5EQ8A 2KR0A 4JVIA 2Q88A 5I2KA 1MXXA 4O3AA 2XWKA 5AA3A 3BFUA 1B5IA 4MHFA 5JTYA 4ESXA 4N6DA 3MZBA 3OELA 3UK4A 3PTYA 4G8HA 3RQTA 2XXKA 4I40A 4PC9A 2UVIA 4ZDMA 3FVGA 3IOVA 4P0GA 1QUIA 2NUVA 5H8HA 4FORA 4G8MA 3MPKA 2DOJA 1FTOA 1GR2A 3H6UA 2WX9A 5J16A 3PAMA 5DVIA 4F3PA 5KCJA 1J1NA 4U21A 3TDJA 1TFAA 2Z8FA 4QSCA 4MEVA 3RNNA 2LAOA 1PB8A 4RY1A 1MH4A 1H44A 2RF1A 3H3GA 1FPLA 1B0LA 1P1OA 4ZEIA 4U2RA 2A5TB 4WEDA 3B7DA 3HCQA 3VDFA 2F97A 2G29A 4JWOA 3S4UA 4F29A 4ZECA 1PB7A 5CMBA 2HPGA 2IEEA 2O84X 1FW0A 2XWVA 4ZEDA 4N81A 3FATA 1Y20A 2QFLA 1A99A 4P0IA 5L9SA 4NF4A 2XWOA 2WEFA 2I0CA 1LBVA 5ET6A 3TELA 2F8DA 2Y84A 3G3KA 1F9BA 3FV1A 5CC2A 4ELPA 4ZEFA 2QMXA 3T93B 3FV2A 4GXAA 2DWIA 4OVTA 4UABA 1FQEA 5FTHA 3PV0E 3CG1A 4KYDA 3IFCA 3FIRA 3DRFA 1VFEA 4IB2A 4F39A 1IZ1A 3OO8A 1B3HA 3LSFB 2OWZA 3SETA 2DWAA 1SBPA 2Z23A 2XX8A 1UTBA 4GX3A 2Q89A 3HHGA 2B3FA 1IMFA 4NAPA 4RYAA 3IAZA 3Q28A 1OVBA 2OBGA 3C32A 3DM0A 4FATA 1Q1KA 2OX3A 4N15A 4IY5A 3MUQA 4AS4A 3GBAA 1HSJA 4OA4A 5AA2D 3CI8A 3QIMA 1FPBA 4AB6A 3MAMA 1URSA 4O3CA 5AA1A 3UORA 4JWYA 1DK4A 3LSLA 4ZS9A 2DWHA 5ELVA 1BTJA 4RPNA 3OEMA 4AQ4A 2PFYA 4FJPA 4F3BA 4QSEA 3FXBA 3PUZE 1YAEA 2P0SA 4E0XA 3VE1B 1CB6A 1NH7A 2Y7IA 1SW5A 2F36A 1AIVA 1B46A 2XXWA 5KDTA 1FPIA 3G3FA 1P99A 4OANA 5DVFA 2X7PA 2RC7A 4FEDA 3ZS6A 1Y3QA 3BIHA 1USYE 3MP8A 4IO6A 3FVNA 3CRBA 2ZNTA 3GLBA 2O1MA 2GHBA 4MNIA 3IL1B 3E9XA 2CZHA 3IOTA 4EQ7A 1FJ9A 2H25A 5T3JA 5AE4A 2QS3A 3IB1A 4MLVA 3EHTA 4BDOA 4GRKA 4I3EA 1DCUA 1SW2A 1N3XA 2UXAA 3EPEA 4LUBA 4KCDA 4PGNA 2Q74A 4U22A 5I3SA 2XXIA 1AH5A 3DP8A 1KZ8A 3N26A 4KPTA 3V83A 4NMYA 1IMCA 2WOKA 2YPNA 5J1DA 3A3CA 4OFOA 3VV5A 3L6HA 4BDNA 2P3VA 3M3KA 3RN8A 3H6TA 1FQAA 2XXTA 2UVGA 3LSXA 4IR8A 1BK4A 4IO5A 1ELJA 3E79A 2H99A 2D5WA 4H0WA 2F35A 1RYXA 1PBPA 1IUDA 4MF3A 4GX4A 1LBZA 1MY0A 4NG7A 3FJGA 4EUOA 2AIXA 1NV5A 5ET7A 5L9OA 3TKDA 2HXRA 1O63A 3FASA 1B40A 2KLFA 3FBPA 4I8CA 3OSRA 1N0TA 4NWDA 1ZU0A 4OZ9A 4BDQA 1DPPA 1II5A 4ZE9A 3O29A 1FPKA 2BJIA 4NF8A 2D3IA 1I69A 5EYFA 4FAJA 2E0SA 4EQ9A 1N84A 1B7UA 1P1UA 2UYFA 4MAGA 4PAIA 1R1NA 2ESNA 5AA2A 4GWXA 5BWJA 4PFYA 2XA5A 3EN3A 1FBEA 3OD7A 1MDP1 2ZNUA 4PBQA 5B7DA 2I3VA 3H7MA 3GZGA 4G61A 3USDA 4QF9A 4OVJA 3IK6B 1MS7A 3IB2A 4N6PA 1VR5A 3BKIB 3LR1A 1O64A 1EZPA 3FVOA 4KYSA 2V84A 1B7ZA 3OO6A 4Q30B 4X8RA 4DCYA 1NNKA 2OLBA 4UA8A 1R6ZA 5H8HB 3KC1A 3DRGA 2B4LA
chains in the Genus database with same CATH topology
4XKNA 5H8SA 2OK2A 4JXIA 4BDMA 2O51A 3K4UA 3CHGA 3PPPA 4RK9A 3CFZA 1GTKA 1DTGA 5KCJB 1XVYA 5EHSA 4ZEBA 3HV1A 4YMBA 4R72A 2WKYA 3TTLA 1Y3NA 4OEVA 1Q35A 4DXUA 3TFLA 1FQDA 4HCWA 4Q5TA 2XXRA 3TTMA 1LAXA 4LQ2A 2OJTA 5EHMA 4WXJA 3OEKA 4OXVA 4O3BA 2XX9A 4GXSB 1O7TA 2GFEA 1OQHA 2UVJA 3E4RA 1CE2A 1JW4A 3FZVA 5DEXB 5CI5A 1P1WA 1SYIA 3IO4A 3P7IA 4OTEA 2Z22A 1OQGA 3T9XB 1LB9A 3T9VA 3C33A 1QULA 2DYXA 4ND9A 4G4PA 4R6YA 4GLIA 4KYEA 3G7WA 2QS1A 3GXAA 2REJA 2H98A 5ISUA 2RINA 3EHSA 5AA4A 3ILTB 1ZJLA 3O9PA 3TAJA 2I49A 2I6EA 1Y4CA 2P1SA 2VP1A 3IJOB 5DTBA 3PUWE 1LFHA 2DE2A 4DIGA 3U93A 1LAHE 3ZKLA 1MXZA 3UGWA 2V25A 3TYHA 5TU0A 1ANFA 2ZMBA 3D4GA 1JNFA 2NWJA 2PT1A 1PEBA 3RTFB 3RGYA 4G8NA 3IX1A 2ONRA 3ONMA 5I59B 4GF8A 1N3WA 1B51A 1N7XA 3VLWA 2Y7KA 4R75A 3S9MC 3RT8A 5FTIA 3UN6A 4QHQA 1B3GA 5TP9A 5ICTA 2VOZA 5TPAB 2PT2A 3CFLA 5KZTA 1S7YA 4YB7A 3SERA 5H8NA 1VE4A 1MM6A 4U4XA 1N7WA 5I58A 4OWDA 5CRYA 3PD8A 1B2HA 3MWBA 2WOLA 2I48A 1B3FA 1D9YA 3TODA 1WDNA 2O7IA 4RJZA 5I2NA 5K2XA 1SQYA 3ZKKA 4FECA 3KOTA 3PUYE 1EZ9A 1B1HA 3PPOA 1B52A 3K6XA 4YB6A 2X7QA 3KJ7A 5CMKA 1MY2A 4BLAA 3K6UA 1T0KA 1PC3A 3BFTA 1MXWA 4GWOA 3U72A 4ELQA 1R9LA 3ZSFA 1IXGA 1M5CA 1JW1A 1EH3A 4OFJA 2ALUA 1USYH 2XD2A 2REGA 4G77A 4MH5A 3SEWA 3FUZA 2IA4A 3GBBA 3O66A 1MDQA 1LAGE 1M5BA 1IXIA 3TCGA 1B9JA 2XXXA 4PP0A 2QPQA 4GVOA 4AB5A 4RK2A 2OCUA 3OO9A 4ZZAA 3S2VA 4NF8B 4G68B 4EQBA 3EQ1A 3CG3A 4QFNA 4QFOA 3DP6A 3I6VA 3C35A 1FQFA 2Z8EA 1SI0A 3PMVA 4DXBA 3OSQA 2I4BA 3QUJA 2DQVA 2DE3A 4F3GA 4NF6B 3U94A 1B5HA 3G3HA 3KGCA 4YKJA 1QW0A 1GGGA 5I56B 3TQWA 2BJJX 1LBBA 2PBWA 3FXRA 3U92A 1FTJA 4KD5A 1MXYA 1A8FA 3F11A 4XKQA 4WEPA 2GHAA 4F1UA 3TTKA 3R7XA 1PBQA 4LQ5A 3K02A 2F7CA 1MY1A 4F22A 4OERA 1VFDA 1B7HA 4OHNA 4M1VA 1TWYA 4NF5B 4MLQA 1SYHA 3SDFA 1ZLQA 2HZKA 3OO7A 1MPBA 3THIA 4NTLA 2UVHA 4GL0A 4X48A 2VHAA 3MZ1A 3M3LA 3IO6A 4H8IA 4ONYA 3V8XB 3MP6A 4U1ZA 1Y1ZA 1BKAA 2OWSA 2D21A 4TQUQ 3IOUA 3KN8A 1Y9UA 4HCYA 2QSXA 2XXQA 3O6HA 3S9LC 2HAUA 3H6WA 3M8UA 5H8QA 1YCJA 4WKMA 5I57B 3AXFA 4YKPA 4NE4A 4LA9A 3TTNA 4POWA 2RCAA 4IO3A 3SEXA 2QMWA 2XXVA 3B6QA 5IAIA 1GV8A 3FGSA 4F3SA 3K00A 1UTHB 4QFKA 3S9NC 3HSTA 1LAFE 3KEIA 4Q8RA 2DSFA 1MM7A 1QKAA 1N76A 3A3UA 4H65A 3MVWA 1SD3A 4R9FA 3CSBA 1KWHA 3V89B 1FQCA 3VFJA 3SESA 2ZYNA 4RXLA 3VVDA 2O68A 2O69A 1ZKBA 3H03A 2RCBA 2HEUA 1UIUA 4LZ7A 5A5XA 4ECFA 1NNPA 3IJXB 2QS2A 4XKRA 2DVZA 3VXBA 1MY3A 1XHYA 3FD3A 1NMUA 3LSWA 3K6VA 2A5TA 4PETA 3G3IA 3SEUA 1DSNA 4IO7A 2PMSA 5TP9B 2ZNSA 4YKIA 1IIWA 1JEVA 3EHUA 5HBCA 5F7VA 2I0BA 3W9VA 4GQOA 3RT6B 3T22A 4I1DA 4LATA 2QS4A 3CIJA 3QXMA 3PU5A 2I58A 5H8FA 1MQGA 1B4HA 3Q29A 1VSOA 2A5SA 2UYEA 1H43A 2ABHA 3W9WA 1MH3A 5I2KB 4LVQA 2YLNA 3OMBA 1JVXA 1MG1A 5JTYB 3C36A 1M5EA 2DVCA 1OLAA 1D3KA 3CR9A 3PPQA 4GFRA 3VVFA 1R9QA 4R9GA 2RKMA 1MQIA 3JV9A 1B5JA 1FTMA 3C4MA 2NOOA 1AMFA 2F78A 1DPEA 3VLUA 1D9VA 3HN0A 3TCFA 1H76A 4OEUA 2XXPA 4LZ5A 3O6PA 2QL3A 5ICQA 4H8JA 1XOCA 3FVKA 2F7AA 1Y4TA 3CSGA 3PMXA 3T96B 1POTA 2R71A 1PDAA 4QSDA 2X26A 1IITA 1IXCA 3TQLA 4NF4B 3DRKA 1JW5A 3JZJA 3Q26A 1TFDA 3MW0A 2F34A 1PB9A 3N94A 1LLSA 1NNFA 1Y3PA 2ONKE 1TT1A 2DS9A 3K6WA 1JETA 3IORA 2H4IA 2DE4A 3KSJA 2OWTA 1SW1A 1LFGA 3K0VA 4H67A 3MVYA 1UTBB 3MP1A 2ZYKA 2B65A 3OENA 1ZTYA 1I6QA 3VVEA 3MBPA 1LCFA 3LVUA 4POXA 3TTRA 2FYIA 4GL8A 2F5XA 2XX7A 3PGFA 5K2YA 3WAEA 4H1XA 1MY4A 3MVXA 4HTGA 4EF1A 2O1LA 3B6TA 4BDRA 2NVUB 4PFTA 4OENA 4THIA 2Y7WA 3KG2A 1EZOA 2I4CA 1NNTA 5FHNA 1LBCA 3O97A 1WODA 4OQOA 4ELOA 1M5FA 4XXUA 2ZXTA 3OXNA 5KDTB 1MRPA 3DLNA 4LP2B 4C1UA 3N6UA 2WOPA 1B1XA 3KZGA 2QRYA 4QRZA 3CFXA 4I9DA 1I6AA 3FXQA 4KCCA 3RTWB 4OMBA 1LGBC 4TLMB 4U4SA 2VGQA 4IY6A 4YMAA 3RYAA 1AOVA 1A40A 1SW4A 4ZZEA 1XS5A 4PQJA 2E1SA 5M2VA 4ZE8A 1WVJA 2Q2CA 1IQ7A 3K2DA 4DE8A 3MJNA 3MQ9A 5I84A 2HAVA 3W15C 2PYYA 1Y1MA 1LB8A 3TEPA 3UA8A 2DWJA 2ZYMA 3FXUA 4KI0E 2W7YA 3KN7A 4X1BA 4H5FA 3KFMA 3E13X 5FHMA 2AL4A 4H6DA 3K1NA 4OFLA 1NH8A 4U1OA 5DT6A 3FTOA 4JB7A 3HPIA 4PE5B 3D4CA 1B4ZA 2XHDA 1B05A 5FHOA 5A5XB 4MFIA 4E0WA 1JEUA 1QUKA 3H4ZA 1FQBA 5B70A 5ITPA 3HO7A 2M8CA 1ZIUA 4TOZA 1NKXA 1QUJA 1US5A 4RPOA 5CMCA 4KFQA 1XVXA 3TPAA 2AYSA 2GH9A 1AL3A 5AA2B 4DCXA 3FJMA 4R2BA 3VLVA 4C0RA 5H8FB 4G2ZA 5LOMA 2HXWA 5DEXA 4U23A 5JK4A 3I5OA 3PUXE 1RKMA 4YKKA 3MVZA 1DOTA 3MC2A 4FIMA 2XD3A 4RA1A 2CZLA 3I3VA 4EXKA 3N6TA 3R26A 1MQJA 4F2QA 1P1QA 4EXLA 1B32A 1GVCA 4KHZE 3T66A 1FTKA 3SEVA 4PFWA 4XKPA 4OYVA 4Q0CA 3CVGA 1S9TA 2R6GE 1HSLA 1BLFA 2NXOA 4X9TA 2V3QA 4XTCQ 1YTVA 4XIGQ 3SKPA 1Z7ME 3C34A 1ZBMA 3PUVE 2B4MA 1LSTA 1SDXA 3MPLA 2VD2A 4F19A 3IOWA 5I59A 2DP8A 2V93A 4UACA 3PD9A 1A7LA 1RYOA 4ZEKA 1B3LA 3DELB 4JDFA 2XXUA 5CBRA 1A8EA 5CM6A 5TPAA 2XXHA 1US4A 1FTLA 2Q9TA 1DMBA 1SVXB 4I62A 5HM4B 1OMPA 1JQFA 3QUFA 4IO4A 2HQ0A 4YAHX 3IR1A 3KOSA 2YJPA 4YICA 1BP5A 4KQPA 4FE8A 3QK6A 4KR5A 3KSXA 4IO2A 4LZ8A 1MXVA 1B6HA 4NWCA 5AA4B 4PFUA 3S9EA 3H06B 4DDDA 4HW8A 3BBRA 2PVUA 3R6UA 1H45A 2HCAA 3G3JA 4C1TA 2GRVA 3O2AA 4BDLA 4ESWA 4OESA 1YPNA 3TUSA 3ILUB 1QVSA 3HHFA 1LCTA 3H6VA 3DP4A 3KBRA 4N13A 1M5DA 4NEDA 1P1NA 5ITOA 4EF2A 1OLCA 3U1OA 1XT8A 2V3TA 2I3WA 3PMWA 4MBPA 2FNCA 4GOTA 2P2AA 1A54A 4LONB 4JSDA 5L8DA 1NFTA 2VD3A 5F1QA 3KN3A 3WAFA 4G68C 3MZ9A 1IXHA 2XXYA 3DRIA 3T9UA 3RYBA 3N5LA 3K1MA 5H8NB 5JEIA 2ONSA 4G68A 4YZZA 5I58B 2FA7A 1MQHA 2Q2AA 4JBZA 1LFIA 3ODBA 2OZZA 1EU8A 2ZYOA 4NF6A 3KJTA 5I2NB 2RC8A 4DLDA 3DRHA 3T9HB 3L6GA 4H5GA 5I56A 4EDPA 2ANJA 1OVTA 3O28A 3JYRA 4P11A 4JSOA 4QFLA 3TZAA 3LC8A 2Z8DA 1D4NA 1QJMA 2H5YA 5CBSA 4R6KA 3U8QA 3TCHA 1SI1A 2DXRA 5IKBA 2HZLA 4NF5A 2F7BA 3VXCA 3UIFA 1UIVA 4R74A 2Y7PA 3QAXA 1L5TA 4F2OA 4YU0A 3K01A 1B3EA 3G3GA 2O7UA 1ATGA 1H3DA 2THIA 3IB0A 2PX1A 1S50A 3V5AA 3E3KA 1Z7NE 3QYTA 3DRJA 4F1YA 1HSEA 1A55A 3M3FA 4F31B 3C9HA 2AL5A 4DXCA 1ZMGA 1MQDA 3RLFE 3RY3A 5I57A 4FEBA 4OETA 4RNSA 4Z0IA 5L9MA 3O6IA 3ECRA 1BIYA 1TXFA 4X1DA 4ELRA 2RC9A 2B3BA 4L17A 4F18A 4GIZA 4IGTA 2F6PA 2F6GA 1UTHA 1POY1 3Q27A 1JVYA 3PPNA 1FCKA 1MPDA 4DZ1A 3EF7A 3B6WA 4JWXA 3Q25A 3SEYA 3TMGA 1IEJA 3RPWA 2HFBA 4TLLB 3PPRA 1XC1A 1OIBA 1UQWA 4N07A 1B58A 2Q8JA 2DXYA 3QSLA 2R9JA 3UP9A 2O6AA 1URGA 5HPQA 3A09A 2Y7RA 4F1VA 1B0HA 4K3FA 4Z7EA 3O6GA 4IGRA 1I6BA 3FJ7A 4R2FA 1QKBA 4HS7A 5H8QB 5CMMA 3LBSA 5DVJA 4QFPA 2QJEA 1MPCA 4YB5A 1MXUA 4R6HA 2G93A 1NL5A 3C31A 4R73A 4M4GA 5DYHA 2V3UA 3OOAA 2H9BA 2CMOA 3LUYA 1DTZA 4ISUA 1N04A 3K1PA 4GD5A 3RUMA 5BUUA 2Q88A 5I2KA 1MXXA 4O3AA 5AA3A 3BFUA 1B5IA 5JTYA 4ESXA 3MZBA 3OELA 3UK4A 4G8HA 3RQTA 2UVIA 4ZDMA 3FVGA 3IOVA 4P0GA 1QUIA 2NUVA 5H8HA 4FORA 4G8MA 3MPKA 2DOJA 1FTOA 1GR2A 3H6UA 3PAMA 5DVIA 4F3PA 5KCJA 1J1NA 4U21A 3TDJA 1TFAA 2Z8FA 4QSCA 3RNNA 2LAOA 1PB8A 4RY1A 1MH4A 1H44A 2RF1A 3H3GA 1B0LA 1P1OA 4ZEIA 4U2RA 2A5TB 4WEDA 3B7DA 3HCQA 3VDFA 2F97A 2G29A 4JWOA 3S4UA 4F29A 4ZECA 1PB7A 5CMBA 2IEEA 2O84X 1FW0A 4ZEDA 3FATA 1Y20A 1A99A 4P0IA 5L9SA 4NF4A 2I0CA 3TELA 2F8DA 2Y84A 3G3KA 1F9BA 3FV1A 5CC2A 4ELPA 4ZEFA 2QMXA 3T93B 3FV2A 4GXAA 2DWIA 1FQEA 5FTHA 3PV0E 3CG1A 4KYDA 3FIRA 3DRFA 1VFEA 4IB2A 4F39A 1IZ1A 3OO8A 1B3HA 3LSFB 3SETA 2DWAA 1SBPA 2Z23A 2XX8A 1UTBA 2Q89A 3HHGA 2B3FA 4RYAA 3IAZA 3Q28A 1OVBA 2OBGA 3C32A 3DM0A 4FATA 1Q1KA 4IY5A 3MUQA 3GBAA 1HSJA 5AA2D 3CI8A 3QIMA 4AB6A 3MAMA 1URSA 4O3CA 5AA1A 3UORA 4JWYA 3LSLA 4ZS9A 2DWHA 5ELVA 1BTJA 4RPNA 3OEMA 4AQ4A 4FJPA 4F3BA 4QSEA 3PUZE 1YAEA 2P0SA 4E0XA 3VE1B 1CB6A 1NH7A 2Y7IA 1SW5A 2F36A 1AIVA 1B46A 2XXWA 5KDTA 3G3FA 1P99A 5DVFA 2X7PA 2RC7A 4FEDA 3ZS6A 1Y3QA 1USYE 3MP8A 4IO6A 3FVNA 3CRBA 2ZNTA 3GLBA 2O1MA 2GHBA 3IL1B 3E9XA 3IOTA 4EQ7A 2H25A 5AE4A 2QS3A 3IB1A 4MLVA 3EHTA 4BDOA 4GRKA 1SW2A 1N3XA 2UXAA 3EPEA 4LUBA 4KCDA 4U22A 2XXIA 1AH5A 3DP8A 3V83A 3N26A 4KPTA 4NMYA 2WOKA 2YPNA 5J1DA 3A3CA 4OFOA 3VV5A 3L6HA 4BDNA 3M3KA 3RN8A 3H6TA 1FQAA 2XXTA 2UVGA 3LSXA 4IO5A 1ELJA 2H99A 2D5WA 4H0WA 2F35A 1RYXA 1PBPA 1IUDA 4MF3A 1MY0A 3FJGA 4EUOA 2AIXA 5L9OA 3TKDA 1O63A 3FASA 1B40A 2KLFA 4I8CA 3OSRA 1N0TA 4NWDA 1ZU0A 4OZ9A 4BDQA 1DPPA 1II5A 4ZE9A 3O29A 4NF8A 2D3IA 1I69A 5EYFA 4FAJA 2E0SA 4EQ9A 1N84A 1B7UA 1P1UA 2UYFA 1R1NA 2ESNA 5AA2A 5BWJA 4PFYA 3EN3A 3OD7A 1MDP1 2ZNUA 5B7DA 2I3VA 3H7MA 3GZGA 3USDA 4QF9A 4OVJA 3IK6B 1MS7A 3IB2A 4N6PA 1VR5A 3BKIB 3LR1A 1O64A 1EZPA 3FVOA 4KYSA 2V84A 1B7ZA 3OO6A 4Q30B 4DCYA 1NNKA 2OLBA 4UA8A 1R6ZA 5H8HB 1URDA 3DRGA 2B4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKN A;  5H8S A;  2OK2 A;  4JXI A;  4BDM A;  2O51 A;  3K4U A;  3CHG A;  3PPP A;  4RK9 A;  3CFZ A;  1GTK A;  1DTG A;  5KCJ B;  1XVY A;  5EHS A;  4ZEB A;  3HV1 A;  4YMB A;  4R72 A;  2WKY A;  3TTL A;  1Y3N A;  4OEV A;  1Q35 A;  4DXU A;  3TFL A;  1FQD A;  4HCW A;  4Q5T A;  2XXR A;  3TTM A;  1LAX A;  4LQ2 A;  2OJT A;  5EHM A;  4WXJ A;  3OEK A;  4OXV A;  4O3B A;  2XX9 A;  4GXS B;  1O7T A;  2GFE A;  1OQH A;  2UVJ A;  3E4R A;  1CE2 A;  1JW4 A;  3FZV A;  5DEX B;  5CI5 A;  1P1W A;  1SYI A;  3IO4 A;  3P7I A;  4OTE A;  2Z22 A;  1OQG A;  3T9X B;  1LB9 A;  3T9V A;  3C33 A;  1QUL A;  2DYX A;  4ND9 A;  4G4P A;  4R6Y A;  4GLI A;  4KYE A;  3G7W A;  2QS1 A;  3GXA A;  2REJ A;  2H98 A;  5ISU A;  2RIN A;  3EHS A;  5AA4 A;  3ILT B;  1ZJL A;  3O9P A;  3TAJ A;  2I49 A;  2I6E A;  1Y4C A;  2P1S A;  2VP1 A;  3IJO B;  5DTB A;  3PUW E;  1LFH A;  2DE2 A;  4DIG A;  3U93 A;  1LAH E;  3ZKL A;  1MXZ A;  3UGW A;  2V25 A;  3TYH A;  5TU0 A;  1ANF A;  2ZMB A;  3D4G A;  1JNF A;  2NWJ A;  2PT1 A;  1PEB A;  3RTF B;  3RGY A;  4G8N A;  3IX1 A;  2ONR A;  3ONM A;  5I59 B;  4GF8 A;  1N3W A;  1B51 A;  1N7X A;  3VLW A;  2Y7K A;  4R75 A;  3S9M C;  3RT8 A;  5FTI A;  3UN6 A;  4QHQ A;  1B3G A;  5TP9 A;  5ICT A;  2VOZ A;  5TPA B;  2PT2 A;  3CFL A;  5KZT A;  1S7Y A;  4YB7 A;  3SER A;  5H8N A;  1VE4 A;  1MM6 A;  4U4X A;  1N7W A;  5I58 A;  4OWD A;  5CRY A;  3PD8 A;  1B2H A;  3MWB A;  2WOL A;  2I48 A;  1B3F A;  1D9Y A;  3TOD A;  1WDN A;  2O7I A;  4RJZ A;  5I2N A;  5K2X A;  1SQY A;  3ZKK A;  4FEC A;  3KOT A;  3PUY E;  1EZ9 A;  1B1H A;  3PPO A;  1B52 A;  3K6X A;  4YB6 A;  2X7Q A;  3KJ7 A;  5CMK A;  1MY2 A;  4BLA A;  3K6U A;  1T0K A;  1PC3 A;  3BFT A;  1MXW A;  4GWO A;  3U72 A;  4ELQ A;  1R9L A;  3ZSF A;  1IXG A;  1M5C A;  1JW1 A;  1EH3 A;  4OFJ A;  2ALU A;  1USY H;  2XD2 A;  2REG A;  4G77 A;  4MH5 A;  3SEW A;  3FUZ A;  2IA4 A;  3GBB A;  3O66 A;  1MDQ A;  1LAG E;  1M5B A;  1IXI A;  3TCG A;  1B9J A;  2XXX A;  4PP0 A;  2QPQ A;  4GVO A;  4AB5 A;  4RK2 A;  2OCU A;  3OO9 A;  4ZZA A;  3S2V A;  4NF8 B;  4G68 B;  4EQB A;  3EQ1 A;  3CG3 A;  4QFN A;  4QFO A;  3DP6 A;  3I6V A;  3C35 A;  1FQF A;  2Z8E A;  1SI0 A;  3PMV A;  4DXB A;  3OSQ A;  2I4B A;  3QUJ A;  2DQV A;  2DE3 A;  4F3G A;  4NF6 B;  3U94 A;  1B5H A;  3G3H A;  3KGC A;  4YKJ A;  1QW0 A;  1GGG A;  5I56 B;  3TQW A;  2BJJ X;  1LBB A;  2PBW A;  3FXR A;  3U92 A;  1FTJ A;  4KD5 A;  1MXY A;  1A8F A;  3F11 A;  4XKQ A;  4WEP A;  2GHA A;  4F1U A;  3TTK A;  3R7X A;  1PBQ A;  4LQ5 A;  3K02 A;  2F7C A;  1MY1 A;  4F22 A;  4OER A;  1VFD A;  1B7H A;  4OHN A;  4M1V A;  1TWY A;  4NF5 B;  4MLQ A;  1SYH A;  3SDF A;  1ZLQ A;  2HZK A;  3OO7 A;  1MPB A;  3THI A;  4NTL A;  2UVH A;  4GL0 A;  4X48 A;  2VHA A;  3MZ1 A;  3M3L A;  3IO6 A;  4H8I A;  4ONY A;  3V8X B;  3MP6 A;  4U1Z A;  1Y1Z A;  1BKA A;  2OWS A;  2D21 A;  4TQU Q;  3IOU A;  3KN8 A;  1Y9U A;  4HCY A;  2QSX A;  2XXQ A;  3O6H A;  3S9L C;  2HAU A;  3H6W A;  3M8U A;  5H8Q A;  1YCJ A;  4WKM A;  5I57 B;  3AXF A;  4YKP A;  4NE4 A;  4LA9 A;  3TTN A;  4POW A;  2RCA A;  4IO3 A;  3SEX A;  2QMW A;  2XXV A;  3B6Q A;  5IAI A;  1GV8 A;  3FGS A;  4F3S A;  3K00 A;  1UTH B;  4QFK A;  3S9N C;  3HST A;  1LAF E;  3KEI A;  4Q8R A;  2DSF A;  1MM7 A;  1QKA A;  1N76 A;  3A3U A;  4H65 A;  3MVW A;  1SD3 A;  4R9F A;  3CSB A;  1KWH A;  3V89 B;  1FQC A;  3VFJ A;  3SES A;  2ZYN A;  4RXL A;  3VVD A;  2O68 A;  2O69 A;  1ZKB A;  3H03 A;  2RCB A;  2HEU A;  1UIU A;  4LZ7 A;  5A5X A;  4ECF A;  1NNP A;  3IJX B;  2QS2 A;  4XKR A;  2DVZ A;  3VXB A;  1MY3 A;  1XHY A;  3FD3 A;  1NMU A;  3LSW A;  3K6V A;  2A5T A;  4PET A;  3G3I A;  3SEU A;  1DSN A;  4IO7 A;  2PMS A;  5TP9 B;  2ZNS A;  4YKI A;  1IIW A;  1JEV A;  3EHU A;  5HBC A;  5F7V A;  2I0B A;  3W9V A;  4GQO A;  3RT6 B;  3T22 A;  4I1D A;  4LAT A;  2QS4 A;  3CIJ A;  3QXM A;  3PU5 A;  2I58 A;  5H8F A;  1MQG A;  1B4H A;  3Q29 A;  1VSO A;  2A5S A;  2UYE A;  1H43 A;  2ABH A;  3W9W A;  1MH3 A;  5I2K B;  4LVQ A;  2YLN A;  3OMB A;  1JVX A;  1MG1 A;  5JTY B;  3C36 A;  1M5E A;  2DVC A;  1OLA A;  1D3K A;  3CR9 A;  3PPQ A;  4GFR A;  3VVF A;  1R9Q A;  4R9G A;  2RKM A;  1MQI A;  3JV9 A;  1B5J A;  1FTM A;  3C4M A;  2NOO A;  1AMF A;  2F78 A;  1DPE A;  3VLU A;  1D9V A;  3HN0 A;  3TCF A;  1H76 A;  4OEU A;  2XXP A;  4LZ5 A;  3O6P A;  2QL3 A;  5ICQ A;  4H8J A;  1XOC A;  3FVK A;  2F7A A;  1Y4T A;  3CSG A;  3PMX A;  3T96 B;  1POT A;  2R71 A;  1PDA A;  4QSD A;  2X26 A;  1IIT A;  1IXC A;  3TQL A;  4NF4 B;  3DRK A;  1JW5 A;  3JZJ A;  3Q26 A;  1TFD A;  3MW0 A;  2F34 A;  1PB9 A;  3N94 A;  1LLS A;  1NNF A;  1Y3P A;  2ONK E;  1TT1 A;  2DS9 A;  3K6W A;  1JET A;  3IOR A;  2H4I A;  2DE4 A;  3KSJ A;  2OWT A;  1SW1 A;  1LFG A;  3K0V A;  4H67 A;  3MVY A;  1UTB B;  3MP1 A;  2ZYK A;  2B65 A;  3OEN A;  1ZTY A;  1I6Q A;  3VVE A;  3MBP A;  1LCF A;  3LVU A;  4POX A;  3TTR A;  2FYI A;  4GL8 A;  2F5X A;  2XX7 A;  3PGF A;  5K2Y A;  3WAE A;  4H1X A;  1MY4 A;  3MVX A;  4HTG A;  4EF1 A;  2O1L A;  3B6T A;  4BDR A;  2NVU B;  4PFT A;  4OEN A;  4THI A;  2Y7W A;  3KG2 A;  1EZO A;  2I4C A;  1NNT A;  5FHN A;  1LBC A;  3O97 A;  1WOD A;  4OQO A;  4ELO A;  1M5F A;  4XXU A;  2ZXT A;  3OXN A;  5KDT B;  1MRP A;  3DLN A;  4LP2 B;  4C1U A;  3N6U A;  2WOP A;  1B1X A;  3KZG A;  2QRY A;  4QRZ A;  3CFX A;  4I9D A;  1I6A A;  3FXQ A;  4KCC A;  3RTW B;  4OMB A;  1LGB C;  4TLM B;  4U4S A;  2VGQ A;  4IY6 A;  4YMA A;  3RYA A;  1AOV A;  1A40 A;  1SW4 A;  4ZZE A;  1XS5 A;  4PQJ A;  2E1S A;  5M2V A;  4ZE8 A;  1WVJ A;  2Q2C A;  1IQ7 A;  3K2D A;  4DE8 A;  3MJN A;  3MQ9 A;  5I84 A;  2HAV A;  3W15 C;  2PYY A;  1Y1M A;  1LB8 A;  3TEP A;  3UA8 A;  2DWJ A;  2ZYM A;  3FXU A;  4KI0 E;  2W7Y A;  3KN7 A;  4X1B A;  4H5F A;  3KFM A;  3E13 X;  5FHM A;  2AL4 A;  4H6D A;  3K1N A;  4OFL A;  1NH8 A;  4U1O A;  5DT6 A;  3FTO A;  4JB7 A;  3HPI A;  4PE5 B;  3D4C A;  1B4Z A;  2XHD A;  1B05 A;  5FHO A;  5A5X B;  4MFI A;  4E0W A;  1JEU A;  1QUK A;  3H4Z A;  1FQB A;  5B70 A;  5ITP A;  3HO7 A;  2M8C A;  1ZIU A;  4TOZ A;  1NKX A;  1QUJ A;  1US5 A;  4RPO A;  5CMC A;  4KFQ A;  1XVX A;  3TPA A;  2AYS A;  2GH9 A;  1AL3 A;  5AA2 B;  4DCX A;  3FJM A;  4R2B A;  3VLV A;  4C0R A;  5H8F B;  4G2Z A;  5LOM A;  2HXW A;  5DEX A;  4U23 A;  5JK4 A;  3I5O A;  3PUX E;  1RKM A;  4YKK A;  3MVZ A;  1DOT A;  3MC2 A;  4FIM A;  2XD3 A;  4RA1 A;  2CZL A;  3I3V A;  4EXK A;  3N6T A;  3R26 A;  1MQJ A;  4F2Q A;  1P1Q A;  4EXL A;  1B32 A;  1GVC A;  4KHZ E;  3T66 A;  1FTK A;  3SEV A;  4PFW A;  4XKP A;  4OYV A;  4Q0C A;  3CVG A;  1S9T A;  2R6G E;  1HSL A;  1BLF A;  2NXO A;  4X9T A;  2V3Q A;  4XTC Q;  1YTV A;  4XIG Q;  3SKP A;  1Z7M E;  3C34 A;  1ZBM A;  3PUV E;  2B4M A;  1LST A;  1SDX A;  3MPL A;  2VD2 A;  4F19 A;  3IOW A;  5I59 A;  2DP8 A;  2V93 A;  4UAC A;  3PD9 A;  1A7L A;  1RYO A;  4ZEK A;  1B3L A;  3DEL B;  4JDF A;  2XXU A;  5CBR A;  1A8E A;  5CM6 A;  5TPA A;  2XXH A;  1US4 A;  1FTL A;  2Q9T A;  1DMB A;  1SVX B;  4I62 A;  5HM4 B;  1OMP A;  1JQF A;  3QUF A;  4IO4 A;  2HQ0 A;  4YAH X;  3IR1 A;  3KOS A;  2YJP A;  4YIC A;  1BP5 A;  4KQP A;  4FE8 A;  3QK6 A;  4KR5 A;  3KSX A;  4IO2 A;  4LZ8 A;  1MXV A;  1B6H A;  4NWC A;  5AA4 B;  4PFU A;  3S9E A;  3H06 B;  4DDD A;  4HW8 A;  3BBR A;  2PVU A;  3R6U A;  1H45 A;  2HCA A;  3G3J A;  4C1T A;  2GRV A;  3O2A A;  4BDL A;  4ESW A;  4OES A;  1YPN A;  3TUS A;  3ILU B;  1QVS A;  3HHF A;  1LCT A;  3H6V A;  3DP4 A;  3KBR A;  4N13 A;  1M5D A;  4NED A;  1P1N A;  5ITO A;  4EF2 A;  1OLC A;  3U1O A;  1XT8 A;  2V3T A;  2I3W A;  3PMW A;  4MBP A;  2FNC A;  4GOT A;  2P2A A;  1A54 A;  4LON B;  4JSD A;  5L8D A;  1NFT A;  2VD3 A;  5F1Q A;  3KN3 A;  3WAF A;  4G68 C;  3MZ9 A;  1IXH A;  2XXY A;  3DRI A;  3T9U A;  3RYB A;  3N5L A;  3K1M A;  5H8N B;  5JEI A;  2ONS A;  4G68 A;  4YZZ A;  5I58 B;  2FA7 A;  1MQH A;  2Q2A A;  4JBZ A;  1LFI A;  3ODB A;  2OZZ A;  1EU8 A;  2ZYO A;  4NF6 A;  3KJT A;  5I2N B;  2RC8 A;  4DLD A;  3DRH A;  3T9H B;  3L6G A;  4H5G A;  5I56 A;  4EDP A;  2ANJ A;  1OVT A;  3O28 A;  3JYR A;  4P11 A;  4JSO A;  4QFL A;  3TZA A;  3LC8 A;  2Z8D A;  1D4N A;  1QJM A;  2H5Y A;  5CBS A;  4R6K A;  3U8Q A;  3TCH A;  1SI1 A;  2DXR A;  5IKB A;  2HZL A;  4NF5 A;  2F7B A;  3VXC A;  3UIF A;  1UIV A;  4R74 A;  2Y7P A;  3QAX A;  1L5T A;  4F2O A;  4YU0 A;  3K01 A;  1B3E A;  3G3G A;  2O7U A;  1ATG A;  1H3D A;  2THI A;  3IB0 A;  2PX1 A;  1S50 A;  3V5A A;  3E3K A;  1Z7N E;  3QYT A;  3DRJ A;  4F1Y A;  1HSE A;  1A55 A;  3M3F A;  4F31 B;  3C9H A;  2AL5 A;  4DXC A;  1ZMG A;  1MQD A;  3RLF E;  3RY3 A;  5I57 A;  4FEB A;  4OET A;  4RNS A;  4Z0I A;  5L9M A;  3O6I A;  3ECR A;  1BIY A;  1TXF A;  4X1D A;  4ELR A;  2RC9 A;  2B3B A;  4L17 A;  4F18 A;  4GIZ A;  4IGT A;  2F6P A;  2F6G A;  1UTH A;  1POY 1;  3Q27 A;  1JVY A;  3PPN A;  1FCK A;  1MPD A;  4DZ1 A;  3EF7 A;  3B6W A;  4JWX A;  3Q25 A;  3SEY A;  3TMG A;  1IEJ A;  3RPW A;  2HFB A;  4TLL B;  3PPR A;  1XC1 A;  1OIB A;  1UQW A;  4N07 A;  1B58 A;  2Q8J A;  2DXY A;  3QSL A;  2R9J A;  3UP9 A;  2O6A A;  1URG A;  5HPQ A;  3A09 A;  2Y7R A;  4F1V A;  1B0H A;  4K3F A;  4Z7E A;  3O6G A;  4IGR A;  1I6B A;  3FJ7 A;  4R2F A;  1QKB A;  4HS7 A;  5H8Q B;  5CMM A;  3LBS A;  5DVJ A;  4QFP A;  2QJE A;  1MPC A;  4YB5 A;  1MXU A;  4R6H A;  2G93 A;  1NL5 A;  3C31 A;  4R73 A;  4M4G A;  5DYH A;  2V3U A;  3OOA A;  2H9B A;  2CMO A;  3LUY A;  1DTZ A;  4ISU A;  1N04 A;  3K1P A;  4GD5 A;  3RUM A;  5BUU A;  2Q88 A;  5I2K A;  1MXX A;  4O3A A;  5AA3 A;  3BFU A;  1B5I A;  5JTY A;  4ESX A;  3MZB A;  3OEL A;  3UK4 A;  4G8H A;  3RQT A;  2UVI A;  4ZDM A;  3FVG A;  3IOV A;  4P0G A;  1QUI A;  2NUV A;  5H8H A;  4FOR A;  4G8M A;  3MPK A;  2DOJ A;  1FTO A;  1GR2 A;  3H6U A;  3PAM A;  5DVI A;  4F3P A;  5KCJ A;  1J1N A;  4U21 A;  3TDJ A;  1TFA A;  2Z8F A;  4QSC A;  3RNN A;  2LAO A;  1PB8 A;  4RY1 A;  1MH4 A;  1H44 A;  2RF1 A;  3H3G A;  1B0L A;  1P1O A;  4ZEI A;  4U2R A;  2A5T B;  4WED A;  3B7D A;  3HCQ A;  3VDF A;  2F97 A;  2G29 A;  4JWO A;  3S4U A;  4F29 A;  4ZEC A;  1PB7 A;  5CMB A;  2IEE A;  2O84 X;  1FW0 A;  4ZED A;  3FAT A;  1Y20 A;  1A99 A;  4P0I A;  5L9S A;  4NF4 A;  2I0C A;  3TEL A;  2F8D A;  2Y84 A;  3G3K A;  1F9B A;  3FV1 A;  5CC2 A;  4ELP A;  4ZEF A;  2QMX A;  3T93 B;  3FV2 A;  4GXA A;  2DWI A;  1FQE A;  5FTH A;  3PV0 E;  3CG1 A;  4KYD A;  3FIR A;  3DRF A;  1VFE A;  4IB2 A;  4F39 A;  1IZ1 A;  3OO8 A;  1B3H A;  3LSF B;  3SET A;  2DWA A;  1SBP A;  2Z23 A;  2XX8 A;  1UTB A;  2Q89 A;  3HHG A;  2B3F A;  4RYA A;  3IAZ A;  3Q28 A;  1OVB A;  2OBG A;  3C32 A;  3DM0 A;  4FAT A;  1Q1K A;  4IY5 A;  3MUQ A;  3GBA A;  1HSJ A;  5AA2 D;  3CI8 A;  3QIM A;  4AB6 A;  3MAM A;  1URS A;  4O3C A;  5AA1 A;  3UOR A;  4JWY A;  3LSL A;  4ZS9 A;  2DWH A;  5ELV A;  1BTJ A;  4RPN A;  3OEM A;  4AQ4 A;  4FJP A;  4F3B A;  4QSE A;  3PUZ E;  1YAE A;  2P0S A;  4E0X A;  3VE1 B;  1CB6 A;  1NH7 A;  2Y7I A;  1SW5 A;  2F36 A;  1AIV A;  1B46 A;  2XXW A;  5KDT A;  3G3F A;  1P99 A;  5DVF A;  2X7P A;  2RC7 A;  4FED A;  3ZS6 A;  1Y3Q A;  1USY E;  3MP8 A;  4IO6 A;  3FVN A;  3CRB A;  2ZNT A;  3GLB A;  2O1M A;  2GHB A;  3IL1 B;  3E9X A;  3IOT A;  4EQ7 A;  2H25 A;  5AE4 A;  2QS3 A;  3IB1 A;  4MLV A;  3EHT A;  4BDO A;  4GRK A;  1SW2 A;  1N3X A;  2UXA A;  3EPE A;  4LUB A;  4KCD A;  4U22 A;  2XXI A;  1AH5 A;  3DP8 A;  3V83 A;  3N26 A;  4KPT A;  4NMY A;  2WOK A;  2YPN A;  5J1D A;  3A3C A;  4OFO A;  3VV5 A;  3L6H A;  4BDN A;  3M3K A;  3RN8 A;  3H6T A;  1FQA A;  2XXT A;  2UVG A;  3LSX A;  4IO5 A;  1ELJ A;  2H99 A;  2D5W A;  4H0W A;  2F35 A;  1RYX A;  1PBP A;  1IUD A;  4MF3 A;  1MY0 A;  3FJG A;  4EUO A;  2AIX A;  5L9O A;  3TKD A;  1O63 A;  3FAS A;  1B40 A;  2KLF A;  4I8C A;  3OSR A;  1N0T A;  4NWD A;  1ZU0 A;  4OZ9 A;  4BDQ A;  1DPP A;  1II5 A;  4ZE9 A;  3O29 A;  4NF8 A;  2D3I A;  1I69 A;  5EYF A;  4FAJ A;  2E0S A;  4EQ9 A;  1N84 A;  1B7U A;  1P1U A;  2UYF A;  1R1N A;  2ESN A;  5AA2 A;  5BWJ A;  4PFY A;  3EN3 A;  3OD7 A;  1MDP 1;  2ZNU A;  5B7D A;  2I3V A;  3H7M A;  3GZG A;  3USD A;  4QF9 A;  4OVJ A;  3IK6 B;  1MS7 A;  3IB2 A;  4N6P A;  1VR5 A;  3BKI B;  3LR1 A;  1O64 A;  1EZP A;  3FVO A;  4KYS A;  2V84 A;  1B7Z A;  3OO6 A;  4Q30 B;  4DCY A;  1NNK A;  2OLB A;  4UA8 A;  1R6Z A;  5H8H B;  1URD A;  3DRG A;  2B4L A; 
#chains in the Genus database with same CATH topology
 4XKN A;  5H8S A;  2OK2 A;  4JXI A;  4BDM A;  2O51 A;  3K4U A;  3CHG A;  3PPP A;  4RK9 A;  4PCD A;  3CFZ A;  1GTK A;  1DTG A;  2P3N A;  5KCJ B;  1XVY A;  5EHS A;  4NGU A;  4ZEB A;  3HV1 A;  3U65 A;  4YMB A;  4R72 A;  2WKY A;  3TTL A;  1Y3N A;  3E78 A;  4OEV A;  1Q35 A;  4DXU A;  4DI4 B;  3RPL A;  3TFL A;  1FQD A;  4HCW A;  4Q5T A;  4DI3 D;  2XXR A;  3TTM A;  2FBP A;  1FJ6 A;  1LAX A;  4LQ2 A;  2OJT A;  5EHM A;  4WXJ A;  3OEK A;  4OXV A;  4O3B A;  2XX9 A;  4GXS B;  1O7T A;  2GFE A;  1OQH A;  4JVC A;  4QBA A;  1SPI A;  2UVJ A;  3E4R A;  1CE2 A;  2WBB A;  1JW4 A;  1NV4 A;  3FZV A;  5EQA A;  5DEX B;  5CI5 A;  1P1W A;  1SYI A;  3IO4 A;  3P7I A;  4OTE A;  2Z22 A;  1OQG A;  3T9X B;  1LB9 A;  3T9V A;  3C33 A;  1QUL A;  4N8G A;  2DYX A;  4ND9 A;  4G4P A;  4NQ8 A;  4R6Y A;  4GLI A;  4KYE A;  3G7W A;  2QS1 A;  3GXA A;  5IZ1 A;  2REJ A;  2H98 A;  5ISU A;  4NHB A;  4OVS A;  2RIN A;  3EHS A;  5AA4 A;  3ILT B;  1ZJL A;  3O9P A;  1RDX A;  3TAJ A;  2I49 A;  1NV7 A;  2I6E A;  1Y4C A;  2P1S A;  2VP1 A;  3IJO B;  5DTB A;  3PUW E;  1LFH A;  2DE2 A;  4DIG A;  3U93 A;  1LAH E;  4PFR A;  3ZKL A;  1MXZ A;  3UGW A;  4PGP A;  4PE3 A;  2V25 A;  3TYH A;  5TU0 A;  1ANF A;  2ZMB A;  4KXP A;  3D4G A;  1JNF A;  2NWJ A;  2PT1 A;  1PEB A;  3RTF B;  3RGY A;  2PFZ A;  4G8N A;  3IX1 A;  2ONR A;  3ONM A;  5I59 B;  4GF8 A;  1N3W A;  1B51 A;  4MIJ A;  1N7X A;  3VLW A;  2Y7K A;  4HE0 A;  4R75 A;  3S9M C;  1YYZ A;  3RT8 A;  5FTI A;  3UN6 A;  4QHQ A;  1B3G A;  5TP9 A;  4P9K A;  5ICT A;  2KQZ A;  2VOZ A;  1FPF A;  5TPA B;  2PT2 A;  3CFL A;  5KZT A;  1S7Y A;  4YB7 A;  2QVR A;  3SER A;  5H8N A;  1VE4 A;  1MM6 A;  1LBY A;  4U4X A;  1N7W A;  5I58 A;  1FSA A;  4OWD A;  5CRY A;  5DW8 A;  3PD8 A;  1B2H A;  3MWB A;  2WOL A;  3RYD A;  4MJO A;  3D1R A;  2I48 A;  1B3F A;  4P1L A;  1D9Y A;  3TOD A;  1WDN A;  2O7I A;  4RJZ A;  5I2N A;  5K2X A;  1G0I A;  1SQY A;  1EYJ A;  4FEC A;  3KOT A;  3PUY E;  3ZKK A;  2CZI A;  1EZ9 A;  1B1H A;  3PPO A;  1B52 A;  3K6X A;  5ET5 A;  4YB6 A;  2X7Q A;  3KJ7 A;  5CMK A;  1MY2 A;  4BLA A;  3K6U A;  1T0K A;  2JJK A;  1PC3 A;  3BFT A;  1MXW A;  4GWO A;  5I7I A;  3U72 A;  4ELQ A;  1R9L A;  3ZSF A;  1IXG A;  1M5C A;  3B8B A;  1JW1 A;  1EH3 A;  4OFJ A;  2ALU A;  3LV0 A;  1USY H;  2XD2 A;  2REG A;  4G77 A;  4MH5 A;  1K9Y A;  4O8M A;  2VT5 A;  1FBG A;  3SEW A;  3FUZ A;  2IA4 A;  3GBB A;  3O66 A;  1MDQ A;  1LAG E;  1M5B A;  1IXI A;  3TCG A;  4NX1 A;  2Y5K A;  1B9J A;  2XXX A;  4PP0 A;  2QPQ A;  1FBC A;  4GVO A;  4AB5 A;  4RK2 A;  2OCU A;  3OO9 A;  4ZZA A;  3S2V A;  4NF8 B;  4G68 B;  4EQB A;  3EQ1 A;  3CG3 A;  4QFN A;  4QFO A;  3DP6 A;  3I6V A;  4O7I A;  3C35 A;  1Q9D A;  1NUZ A;  1FQF A;  2Z8E A;  1SI0 A;  3PMV A;  4DXB A;  3OSQ A;  2I4B A;  3A29 A;  3QUJ A;  4NF0 A;  2DQV A;  2DE3 A;  4F3G A;  4QXD A;  1K9Z A;  4NF6 B;  5LTC A;  3U94 A;  1B5H A;  1G0H A;  3G3H A;  3KGC A;  3MYU A;  4YKJ A;  1FPJ A;  1QW0 A;  1GGG A;  5I56 B;  3TQW A;  2BJJ X;  1LBB A;  2PBW A;  3FXR A;  3U92 A;  1FTJ A;  4KD5 A;  1MXY A;  1A8F A;  3F11 A;  4XKQ A;  4WEP A;  2GHA A;  4F1U A;  3TTK A;  3R7X A;  1PBQ A;  1LBW A;  4LQ5 A;  3K02 A;  2F7C A;  1MY1 A;  4F22 A;  4OER A;  1VFD A;  1B7H A;  4OHN A;  4M1V A;  1TWY A;  4NF5 B;  4GBW A;  1SYH A;  4MLQ A;  1ZLQ A;  3SDF A;  2HZK A;  3OO7 A;  2FHY A;  1MPB A;  3THI A;  3KBZ A;  4NTL A;  4P47 A;  2UVH A;  3HFU A;  4GL0 A;  4X48 A;  2VHA A;  1FPG A;  3MZ1 A;  3M3L A;  3IO6 A;  4H8I A;  4ONY A;  3V8X B;  3MP6 A;  4U1Z A;  1Y1Z A;  1BKA A;  2OWS A;  2D21 A;  4TQU Q;  3IOU A;  4N6K A;  3KN8 A;  1Y9U A;  4HCY A;  2QSX A;  2XXQ A;  3O6H A;  3S9L C;  2HAU A;  3H6W A;  3M8U A;  5H8Q A;  1YCJ A;  4N8Y A;  4WKM A;  5I57 B;  3AXF A;  4YKP A;  4NE4 A;  4LA9 A;  3TTN A;  4MNC A;  1IMA A;  4POW A;  2RCA A;  4IO3 A;  3SEX A;  2QMW A;  2XXV A;  3B6Q A;  5IAI A;  1GV8 A;  3FGS A;  3K00 A;  4F3S A;  1UTH B;  2ZZX A;  5FBP A;  4QFK A;  3S9N C;  3HST A;  1LAF E;  3KEI A;  2WBD A;  4Q8R A;  2DSF A;  3GYY A;  1MM7 A;  1QKA A;  1N76 A;  3A3U A;  4H65 A;  3MVW A;  1SD3 A;  4R9F A;  3CSB A;  1KWH A;  3V89 B;  1FQC A;  3VFJ A;  3SES A;  2ZYN A;  4RXL A;  3VVD A;  2O68 A;  2O69 A;  1ZKB A;  3H03 A;  2RCB A;  2HEU A;  1UIU A;  4LZ7 A;  5A5X A;  4ECF A;  1NNP A;  3IJX B;  2QS2 A;  4XKR A;  2DVZ A;  3VXB A;  1MY3 A;  1XHY A;  3FD3 A;  1NMU A;  3LSW A;  1IMB A;  3K6V A;  2A5T A;  4PET A;  1KA1 A;  3NOH A;  3G3I A;  4GWS A;  3SEU A;  1DSN A;  4IO7 A;  2PMS A;  2WYP A;  5TP9 B;  2ZNS A;  4YKI A;  4PBH A;  1IIW A;  1JEV A;  3EHU A;  5HBC A;  5F7V A;  2I0B A;  2FIX A;  3W9V A;  2FIE A;  4GQO A;  3RT6 B;  3T22 A;  4I1D A;  4LAT A;  2QS4 A;  3CIJ A;  3QXM A;  3PU5 A;  2I58 A;  5H8F A;  4OVQ A;  1MQG A;  1B4H A;  5IZ3 A;  3Q29 A;  1VSO A;  2A5S A;  2UYE A;  4XFE A;  1FBH A;  4H46 A;  1H43 A;  2ABH A;  3W9W A;  1MH3 A;  5I2K B;  4LVQ A;  3QMF A;  2YLN A;  3OMB A;  1JVX A;  1MG1 A;  3SZP A;  5JTY B;  3C36 A;  1M5E A;  2DVC A;  1OLA A;  1D3K A;  3CR9 A;  3PPQ A;  4GFR A;  3VVF A;  1R9Q A;  3MST A;  4HE1 A;  2CEX A;  4R9G A;  4PAK A;  2RKM A;  1MQI A;  3JV9 A;  1B5J A;  4N91 A;  1FTM A;  3C4M A;  2NOO A;  1AMF A;  2F78 A;  1DPE A;  5IZZ A;  3VLU A;  1D9V A;  3HN0 A;  3TCF A;  1H76 A;  2ZZV A;  4OEU A;  2XXP A;  4LZ5 A;  2VPN A;  3O6P A;  2QL3 A;  5ICQ A;  4H8J A;  1XOC A;  3FVK A;  2F7A A;  3T0J A;  1Y4T A;  3BIG A;  3CSG A;  3PMX A;  4FBP A;  3T96 B;  1POT A;  2R71 A;  1PDA A;  4QSD A;  2X26 A;  1IIT A;  1IXC A;  3TQL A;  4NF4 B;  3DRK A;  2DDK A;  1JW5 A;  3JZJ A;  3KC0 A;  3Q26 A;  1TFD A;  3MW0 A;  2F34 A;  1PB9 A;  2ZZW A;  3N94 A;  1LLS A;  1NNF A;  1Y3P A;  2ONK E;  2QVV A;  1TT1 A;  1CNQ A;  2DS9 A;  3K6W A;  1JET A;  3IOR A;  2H4I A;  2DE4 A;  3KSJ A;  1FBP A;  2OWT A;  1SW1 A;  1LFG A;  2CZK A;  3K0V A;  4H67 A;  3MVY A;  1UTB B;  3MP1 A;  2ZYK A;  2B65 A;  2FVZ A;  3OEN A;  1ZTY A;  1I6Q A;  3VVE A;  3MBP A;  1LCF A;  3LVU A;  4POX A;  3TTR A;  1FBF A;  2FYI A;  4GL8 A;  2F5X A;  2XX7 A;  3PGF A;  5K2Y A;  3WAE A;  4H1X A;  1MY4 A;  3MVX A;  4N4U A;  4HTG A;  4EF1 A;  4NN3 A;  4GWU A;  2O1L A;  1INP A;  3B6T A;  4BDR A;  2NVU B;  4PFT A;  4OEN A;  4THI A;  1FPD A;  2Y7W A;  3KG2 A;  1EZO A;  1FTA A;  2I4C A;  2F3D A;  1NNT A;  5FHN A;  1LBC A;  3O97 A;  1WOD A;  4OQO A;  4ELO A;  3IFA A;  4HE2 A;  1M5F A;  4XXU A;  2ZXT A;  3OXN A;  5KDT B;  1MRP A;  4PFB A;  3DLN A;  4LP2 B;  1NV2 A;  1QGX A;  2QVU A;  2Q8M A;  4C1U A;  3N6U A;  2WOP A;  1B1X A;  3KZG A;  2QRY A;  4QRZ A;  3CFX A;  4I9D A;  1I6A A;  3FXQ A;  4KCC A;  3RTW B;  4OMB A;  1LGB C;  3EKI A;  4TLM B;  4U4S A;  4GWZ A;  2VGQ A;  4IY6 A;  4YMA A;  3RYA A;  4GBV A;  1AOV A;  1A40 A;  1SW4 A;  3T1B A;  4ZZE A;  1XS5 A;  4MNP A;  4PQJ A;  2E1S A;  4AS5 A;  5M2V A;  4ZE8 A;  1WVJ A;  2Q2C A;  1IQ7 A;  3K2D A;  4DE8 A;  3MJN A;  3MQ9 A;  1NV0 A;  5I84 A;  2HAV A;  2MKZ A;  3W15 C;  3ROJ A;  2PYY A;  1Y1M A;  4JVD A;  5ET8 A;  1LB8 A;  3TEP A;  3UA8 A;  4P56 A;  2DWJ A;  2ZYM A;  3FXU A;  4KI0 E;  4X04 A;  2W7Y A;  3KN7 A;  4X1B A;  5LDZ A;  1AWB A;  4H5F A;  1IME A;  3KFM A;  3E13 X;  4P3L A;  5FHM A;  2AL4 A;  4H6D A;  3K1N A;  4OFL A;  1NH8 A;  4U1O A;  5DT6 A;  3FTO A;  4JB7 A;  3HPI A;  4PE5 B;  3D4C A;  1B4Z A;  2XHD A;  1B05 A;  5FHO A;  5A5X B;  4MFI A;  1RDZ A;  4MCO A;  4E0W A;  1JEU A;  1QUK A;  3H4Z A;  1FQB A;  2WYK A;  5B70 A;  5ITP A;  3HO7 A;  2M8C A;  1ZIU A;  1KA0 A;  4TOZ A;  1NKX A;  1QUJ A;  1US5 A;  4RPO A;  5CMC A;  4KFQ A;  1D9Q A;  1XVX A;  3TPA A;  2AYS A;  2GH9 A;  2L5V A;  1AL3 A;  5AA2 B;  4DCX A;  3FJM A;  4R2B A;  3VLV A;  4C0R A;  5H8F B;  4G2Z A;  5LOM A;  2HXW A;  5DEX A;  5IZ3 B;  4U23 A;  5JK4 A;  3I5O A;  3PUX E;  1RKM A;  4YKK A;  3MVZ A;  1DOT A;  3MC2 A;  4MX6 A;  1YZ0 A;  4FIM A;  4I3Y A;  2XD3 A;  4RA1 A;  2CZL A;  3I3V A;  4EXK A;  3N6T A;  3R26 A;  1MQJ A;  4F2Q A;  1P1Q A;  4EXL A;  1B32 A;  1GVC A;  4KHZ E;  3T66 A;  1FTK A;  3SEV A;  4PFW A;  4XKP A;  4OYV A;  4Q0C A;  4GX6 A;  3CVG A;  1S9T A;  2R6G E;  1HSL A;  1BLF A;  2NXO A;  4X9T A;  2V3Q A;  4XTC Q;  1YTV A;  4XIG Q;  3SKP A;  1Z7M E;  3C34 A;  1ZBM A;  3PUV E;  2B4M A;  1LST A;  1SDX A;  3LUZ A;  1LBX A;  2XWI A;  3MPL A;  2VD2 A;  4F19 A;  3IOW A;  3RPL B;  5I59 A;  2DP8 A;  2V93 A;  4UAC A;  3PD9 A;  1A7L A;  1RYO A;  4ZEK A;  1B3L A;  3DEL B;  4JDF A;  2XXU A;  5CBR A;  4P8B A;  1A8E A;  1NV1 A;  4PDH A;  1LEV A;  1FBD A;  5CM6 A;  4PTK A;  5TPA A;  2XXH A;  1US4 A;  4MMP A;  2VPO A;  5IGA A;  1FTL A;  2Q9T A;  1DMB A;  1SVX B;  4I62 A;  5HM4 B;  1OMP A;  1JQF A;  3QUF A;  4IO4 A;  2HQ0 A;  4YAH X;  3IR1 A;  3KOS A;  2YJP A;  4YIC A;  1BP5 A;  4KQP A;  1NUW A;  4FE8 A;  3QK6 A;  4KR5 A;  3KSX A;  3B50 A;  4IO2 A;  4LZ8 A;  1MXV A;  1B6H A;  4NWC A;  5AA4 B;  4PFU A;  5ESY A;  3S9E A;  3H06 B;  4DDD A;  4HW8 A;  3BBR A;  2PVU A;  3R6U A;  1H45 A;  2HCA A;  3G3J A;  4C1T A;  2GRV A;  4GWY A;  3O2A A;  4BDL A;  4ESW A;  4OES A;  1YPN A;  3TUS A;  3ILU B;  1QVS A;  3HHF A;  1YXI A;  1LCT A;  4GWW A;  3H6V A;  3DP4 A;  5EYH A;  3KBR A;  4N13 A;  1M5D A;  4NED A;  1P1N A;  5ITO A;  2HHM A;  4EF2 A;  1OLC A;  3U1O A;  1XT8 A;  2V3T A;  2I3W A;  4PAF A;  3PMW A;  4MBP A;  2FNC A;  4GOT A;  2P2A A;  1A54 A;  4LON B;  4JSD A;  5L8D A;  1NFT A;  2VD3 A;  5F1Q A;  3KN3 A;  3WAF A;  4G68 C;  5IM2 A;  3MZ9 A;  1IXH A;  2XXY A;  3DRI A;  3T9U A;  3RYB A;  3N5L A;  3K1M A;  5H8N B;  1RDY A;  2ONS A;  5JEI A;  4G68 A;  2R8T A;  4YZZ A;  5I58 B;  4PF6 A;  2FA7 A;  1MQH A;  2Q2A A;  1FRP A;  4JBZ A;  1NUY A;  1LFI A;  3ODB A;  2OZZ A;  1EU8 A;  4PF8 A;  2ZYO A;  4OVP A;  4NF6 A;  3KJT A;  5I2N B;  2RC8 A;  4DLD A;  3DRH A;  3T9H B;  3L6G A;  4H5G A;  5I56 A;  4EDP A;  2ANJ A;  1OVT A;  1DBZ A;  3O28 A;  3JYR A;  4P11 A;  4JSO A;  4QFL A;  3TZA A;  3LC8 A;  2Z8D A;  1D4N A;  1QJM A;  2H5Y A;  5CBS A;  4R6K A;  3U8Q A;  3TCH A;  1SI1 A;  2DXR A;  5IKB A;  2HZL A;  1IMD A;  4NF5 A;  2F7B A;  3VXC A;  3UIF A;  1UIV A;  4R74 A;  2Y7P A;  3QAX A;  1L5T A;  4F2O A;  4YU0 A;  3K01 A;  1B3E A;  3G3G A;  2O7U A;  1ATG A;  1H3D A;  2THI A;  1XI6 A;  3IB0 A;  2PX1 A;  4P1E A;  1S50 A;  3V5A A;  3E3K A;  1Z7N E;  1NI9 A;  3QYT A;  3DRJ A;  4F1Y A;  1HSE A;  1A55 A;  3M3F A;  4F31 B;  2CEY A;  3C9H A;  2AL5 A;  4DXC A;  1ZMG A;  5A5L A;  1MQD A;  3RLF E;  3RY3 A;  5I57 A;  4FEB A;  5EQ9 A;  4O7M A;  4XEQ A;  4OET A;  4RNS A;  4Z0I A;  5L9M A;  3O6I A;  3ECR A;  1BIY A;  1TXF A;  5F24 A;  2F3B A;  4X1D A;  4ELR A;  5EYG A;  2RC9 A;  2B3B A;  4L17 A;  4F18 A;  5I5P A;  1NV3 A;  4GIZ A;  4IGT A;  1EYK A;  2F6P A;  2F6G A;  1UTH A;  1POY 1;  1EYI A;  4H45 A;  4XF5 A;  3Q27 A;  3ISP A;  1JVY A;  3PPN A;  1FCK A;  1MPD A;  4DZ1 A;  3EF7 A;  3B6W A;  4JWX A;  4LN5 A;  3Q25 A;  3SEY A;  3TMG A;  1IEJ A;  3RPW A;  2HFB A;  4TLL B;  2PCR A;  1FPE A;  1NV6 A;  3PPR A;  4HXV A;  1JP4 A;  1XC1 A;  5EQ7 A;  1OIB A;  1UQW A;  4N17 A;  4N07 A;  1B58 A;  2Q8J A;  2DXY A;  2Y5L A;  2R9J A;  3QSL A;  3UP9 A;  2O6A A;  1URG A;  2GQ1 A;  5HPQ A;  3A09 A;  1NUX A;  2Y7R A;  4F1V A;  4PFI A;  1B0H A;  4K3F A;  4Z7E A;  3O6G A;  4IGR A;  4OVR A;  1I6B A;  3FJ7 A;  4R2F A;  1QKB A;  4HS7 A;  5H8Q B;  5CMM A;  3LBS A;  5DVJ A;  4QFP A;  2QJE A;  1MPC A;  4YB5 A;  4O94 A;  1MXU A;  4R6H A;  2G93 A;  1NL5 A;  3C31 A;  4R73 A;  4M4G A;  5DYH A;  2V3U A;  3OOA A;  2H9B A;  4PDD A;  2CMO A;  2V4C A;  3LUY A;  1VDW A;  1DTZ A;  4ISU A;  1N04 A;  1URD A;  3K1P A;  4GD5 A;  3RUM A;  5BUU A;  5EQ8 A;  2KR0 A;  4JVI A;  2Q88 A;  5I2K A;  1MXX A;  4O3A A;  2XWK A;  5AA3 A;  3BFU A;  1B5I A;  4MHF A;  5JTY A;  4ESX A;  4N6D A;  3MZB A;  3OEL A;  3UK4 A;  3PTY A;  4G8H A;  3RQT A;  2XXK A;  4I40 A;  4PC9 A;  2UVI A;  4ZDM A;  3FVG A;  3IOV A;  4P0G A;  1QUI A;  2NUV A;  5H8H A;  4FOR A;  4G8M A;  3MPK A;  2DOJ A;  1FTO A;  1GR2 A;  3H6U A;  2WX9 A;  5J16 A;  3PAM A;  5DVI A;  4F3P A;  5KCJ A;  1J1N A;  4U21 A;  3TDJ A;  1TFA A;  2Z8F A;  4QSC A;  4MEV A;  3RNN A;  2LAO A;  1PB8 A;  4RY1 A;  1MH4 A;  1H44 A;  2RF1 A;  3H3G A;  1FPL A;  1B0L A;  1P1O A;  4ZEI A;  4U2R A;  2A5T B;  4WED A;  3B7D A;  3HCQ A;  3VDF A;  2F97 A;  2G29 A;  4JWO A;  3S4U A;  4F29 A;  4ZEC A;  1PB7 A;  5CMB A;  2HPG A;  2IEE A;  2O84 X;  1FW0 A;  2XWV A;  4ZED A;  4N81 A;  3FAT A;  1Y20 A;  2QFL A;  1A99 A;  4P0I A;  5L9S A;  4NF4 A;  2XWO A;  2WEF A;  2I0C A;  1LBV A;  5ET6 A;  3TEL A;  2F8D A;  2Y84 A;  3G3K A;  1F9B A;  3FV1 A;  5CC2 A;  4ELP A;  4ZEF A;  2QMX A;  3T93 B;  3FV2 A;  4GXA A;  2DWI A;  4OVT A;  4UAB A;  1FQE A;  5FTH A;  3PV0 E;  3CG1 A;  4KYD A;  3IFC A;  3FIR A;  3DRF A;  1VFE A;  4IB2 A;  4F39 A;  1IZ1 A;  3OO8 A;  1B3H A;  3LSF B;  2OWZ A;  3SET A;  2DWA A;  1SBP A;  2Z23 A;  2XX8 A;  1UTB A;  4GX3 A;  2Q89 A;  3HHG A;  2B3F A;  1IMF A;  4NAP A;  4RYA A;  3IAZ A;  3Q28 A;  1OVB A;  2OBG A;  3C32 A;  3DM0 A;  4FAT A;  1Q1K A;  2OX3 A;  4N15 A;  4IY5 A;  3MUQ A;  4AS4 A;  3GBA A;  1HSJ A;  4OA4 A;  5AA2 D;  3CI8 A;  3QIM A;  1FPB A;  4AB6 A;  3MAM A;  1URS A;  4O3C A;  5AA1 A;  3UOR A;  4JWY A;  1DK4 A;  3LSL A;  4ZS9 A;  2DWH A;  5ELV A;  1BTJ A;  4RPN A;  3OEM A;  4AQ4 A;  2PFY A;  4FJP A;  4F3B A;  4QSE A;  3FXB A;  3PUZ E;  1YAE A;  2P0S A;  4E0X A;  3VE1 B;  1CB6 A;  1NH7 A;  2Y7I A;  1SW5 A;  2F36 A;  1AIV A;  1B46 A;  2XXW A;  5KDT A;  1FPI A;  3G3F A;  1P99 A;  4OAN A;  5DVF A;  2X7P A;  2RC7 A;  4FED A;  3ZS6 A;  1Y3Q A;  3BIH A;  1USY E;  3MP8 A;  4IO6 A;  3FVN A;  3CRB A;  2ZNT A;  3GLB A;  2O1M A;  2GHB A;  4MNI A;  3IL1 B;  3E9X A;  2CZH A;  3IOT A;  4EQ7 A;  1FJ9 A;  2H25 A;  5T3J A;  5AE4 A;  2QS3 A;  3IB1 A;  4MLV A;  3EHT A;  4BDO A;  4GRK A;  4I3E A;  1DCU A;  1SW2 A;  1N3X A;  2UXA A;  3EPE A;  4LUB A;  4KCD A;  4PGN A;  2Q74 A;  4U22 A;  5I3S A;  2XXI A;  1AH5 A;  3DP8 A;  1KZ8 A;  3N26 A;  4KPT A;  3V83 A;  4NMY A;  1IMC A;  2WOK A;  2YPN A;  5J1D A;  3A3C A;  4OFO A;  3VV5 A;  3L6H A;  4BDN A;  2P3V A;  3M3K A;  3RN8 A;  3H6T A;  1FQA A;  2XXT A;  2UVG A;  3LSX A;  4IR8 A;  1BK4 A;  4IO5 A;  1ELJ A;  3E79 A;  2H99 A;  2D5W A;  4H0W A;  2F35 A;  1RYX A;  1PBP A;  1IUD A;  4MF3 A;  4GX4 A;  1LBZ A;  1MY0 A;  4NG7 A;  3FJG A;  4EUO A;  2AIX A;  1NV5 A;  5ET7 A;  5L9O A;  3TKD A;  2HXR A;  1O63 A;  3FAS A;  1B40 A;  2KLF A;  3FBP A;  4I8C A;  3OSR A;  1N0T A;  4NWD A;  1ZU0 A;  4OZ9 A;  4BDQ A;  1DPP A;  1II5 A;  4ZE9 A;  3O29 A;  1FPK A;  2BJI A;  4NF8 A;  2D3I A;  1I69 A;  5EYF A;  4FAJ A;  2E0S A;  4EQ9 A;  1N84 A;  1B7U A;  1P1U A;  2UYF A;  4MAG A;  4PAI A;  1R1N A;  2ESN A;  5AA2 A;  4GWX A;  5BWJ A;  4PFY A;  2XA5 A;  3EN3 A;  1FBE A;  3OD7 A;  1MDP 1;  2ZNU A;  4PBQ A;  5B7D A;  2I3V A;  3H7M A;  3GZG A;  4G61 A;  3USD A;  4QF9 A;  4OVJ A;  3IK6 B;  1MS7 A;  3IB2 A;  4N6P A;  1VR5 A;  3BKI B;  3LR1 A;  1O64 A;  1EZP A;  3FVO A;  4KYS A;  2V84 A;  1B7Z A;  3OO6 A;  4Q30 B;  4X8R A;  4DCY A;  1NNK A;  2OLB A;  4UA8 A;  1R6Z A;  5H8H B;  3KC1 A;  3DRG A;  2B4L A; 
#chains in the Genus database with same CATH homology
 4XKN A;  5H8S A;  2OK2 A;  4JXI A;  4BDM A;  2O51 A;  3K4U A;  3CHG A;  3PPP A;  4RK9 A;  3CFZ A;  1GTK A;  1DTG A;  5KCJ B;  1XVY A;  5EHS A;  4ZEB A;  3HV1 A;  4YMB A;  4R72 A;  2WKY A;  3TTL A;  1Y3N A;  4OEV A;  1Q35 A;  4DXU A;  3TFL A;  1FQD A;  4HCW A;  4Q5T A;  2XXR A;  3TTM A;  1LAX A;  4LQ2 A;  2OJT A;  5EHM A;  4WXJ A;  3OEK A;  4OXV A;  4O3B A;  2XX9 A;  4GXS B;  1O7T A;  2GFE A;  1OQH A;  2UVJ A;  3E4R A;  1CE2 A;  1JW4 A;  3FZV A;  5DEX B;  5CI5 A;  1P1W A;  1SYI A;  3IO4 A;  3P7I A;  4OTE A;  2Z22 A;  1OQG A;  3T9X B;  1LB9 A;  3T9V A;  3C33 A;  1QUL A;  2DYX A;  4ND9 A;  4G4P A;  4R6Y A;  4GLI A;  4KYE A;  3G7W A;  2QS1 A;  3GXA A;  2REJ A;  2H98 A;  5ISU A;  2RIN A;  3EHS A;  5AA4 A;  3ILT B;  1ZJL A;  3O9P A;  3TAJ A;  2I49 A;  2I6E A;  1Y4C A;  2P1S A;  2VP1 A;  3IJO B;  5DTB A;  3PUW E;  1LFH A;  2DE2 A;  4DIG A;  3U93 A;  1LAH E;  3ZKL A;  1MXZ A;  3UGW A;  2V25 A;  3TYH A;  5TU0 A;  1ANF A;  2ZMB A;  3D4G A;  1JNF A;  2NWJ A;  2PT1 A;  1PEB A;  3RTF B;  3RGY A;  4G8N A;  3IX1 A;  2ONR A;  3ONM A;  5I59 B;  4GF8 A;  1N3W A;  1B51 A;  1N7X A;  3VLW A;  2Y7K A;  4R75 A;  3S9M C;  3RT8 A;  5FTI A;  3UN6 A;  4QHQ A;  1B3G A;  5TP9 A;  5ICT A;  2VOZ A;  5TPA B;  2PT2 A;  3CFL A;  5KZT A;  1S7Y A;  4YB7 A;  3SER A;  5H8N A;  1VE4 A;  1MM6 A;  4U4X A;  1N7W A;  5I58 A;  4OWD A;  5CRY A;  3PD8 A;  1B2H A;  3MWB A;  2WOL A;  2I48 A;  1B3F A;  1D9Y A;  3TOD A;  1WDN A;  2O7I A;  4RJZ A;  5I2N A;  5K2X A;  1SQY A;  3ZKK A;  4FEC A;  3KOT A;  3PUY E;  1EZ9 A;  1B1H A;  3PPO A;  1B52 A;  3K6X A;  4YB6 A;  2X7Q A;  3KJ7 A;  5CMK A;  1MY2 A;  4BLA A;  3K6U A;  1T0K A;  1PC3 A;  3BFT A;  1MXW A;  4GWO A;  3U72 A;  4ELQ A;  1R9L A;  3ZSF A;  1IXG A;  1M5C A;  1JW1 A;  1EH3 A;  4OFJ A;  2ALU A;  1USY H;  2XD2 A;  2REG A;  4G77 A;  4MH5 A;  3SEW A;  3FUZ A;  2IA4 A;  3GBB A;  3O66 A;  1MDQ A;  1LAG E;  1M5B A;  1IXI A;  3TCG A;  1B9J A;  2XXX A;  4PP0 A;  2QPQ A;  4GVO A;  4AB5 A;  4RK2 A;  2OCU A;  3OO9 A;  4ZZA A;  3S2V A;  4NF8 B;  4G68 B;  4EQB A;  3EQ1 A;  3CG3 A;  4QFN A;  4QFO A;  3DP6 A;  3I6V A;  3C35 A;  1FQF A;  2Z8E A;  1SI0 A;  3PMV A;  4DXB A;  3OSQ A;  2I4B A;  3QUJ A;  2DQV A;  2DE3 A;  4F3G A;  4NF6 B;  3U94 A;  1B5H A;  3G3H A;  3KGC A;  4YKJ A;  1QW0 A;  1GGG A;  5I56 B;  3TQW A;  2BJJ X;  1LBB A;  2PBW A;  3FXR A;  3U92 A;  1FTJ A;  4KD5 A;  1MXY A;  1A8F A;  3F11 A;  4XKQ A;  4WEP A;  2GHA A;  4F1U A;  3TTK A;  3R7X A;  1PBQ A;  4LQ5 A;  3K02 A;  2F7C A;  1MY1 A;  4F22 A;  4OER A;  1VFD A;  1B7H A;  4OHN A;  4M1V A;  1TWY A;  4NF5 B;  4MLQ A;  1SYH A;  3SDF A;  1ZLQ A;  2HZK A;  3OO7 A;  1MPB A;  3THI A;  4NTL A;  2UVH A;  4GL0 A;  4X48 A;  2VHA A;  3MZ1 A;  3M3L A;  3IO6 A;  4H8I A;  4ONY A;  3V8X B;  3MP6 A;  4U1Z A;  1Y1Z A;  1BKA A;  2OWS A;  2D21 A;  4TQU Q;  3IOU A;  3KN8 A;  1Y9U A;  4HCY A;  2QSX A;  2XXQ A;  3O6H A;  3S9L C;  2HAU A;  3H6W A;  3M8U A;  5H8Q A;  1YCJ A;  4WKM A;  5I57 B;  3AXF A;  4YKP A;  4NE4 A;  4LA9 A;  3TTN A;  4POW A;  2RCA A;  4IO3 A;  3SEX A;  2QMW A;  2XXV A;  3B6Q A;  5IAI A;  1GV8 A;  3FGS A;  4F3S A;  3K00 A;  1UTH B;  4QFK A;  3S9N C;  3HST A;  1LAF E;  3KEI A;  4Q8R A;  2DSF A;  1MM7 A;  1QKA A;  1N76 A;  3A3U A;  4H65 A;  3MVW A;  1SD3 A;  4R9F A;  3CSB A;  1KWH A;  3V89 B;  1FQC A;  3VFJ A;  3SES A;  2ZYN A;  4RXL A;  3VVD A;  2O68 A;  2O69 A;  1ZKB A;  3H03 A;  2RCB A;  2HEU A;  1UIU A;  4LZ7 A;  5A5X A;  4ECF A;  1NNP A;  3IJX B;  2QS2 A;  4XKR A;  2DVZ A;  3VXB A;  1MY3 A;  1XHY A;  3FD3 A;  1NMU A;  3LSW A;  3K6V A;  2A5T A;  4PET A;  3G3I A;  3SEU A;  1DSN A;  4IO7 A;  2PMS A;  5TP9 B;  2ZNS A;  4YKI A;  1IIW A;  1JEV A;  3EHU A;  5HBC A;  5F7V A;  2I0B A;  3W9V A;  4GQO A;  3RT6 B;  3T22 A;  4I1D A;  4LAT A;  2QS4 A;  3CIJ A;  3QXM A;  3PU5 A;  2I58 A;  5H8F A;  1MQG A;  1B4H A;  3Q29 A;  1VSO A;  2A5S A;  2UYE A;  1H43 A;  2ABH A;  3W9W A;  1MH3 A;  5I2K B;  4LVQ A;  2YLN A;  3OMB A;  1JVX A;  1MG1 A;  5JTY B;  3C36 A;  1M5E A;  2DVC A;  1OLA A;  1D3K A;  3CR9 A;  3PPQ A;  4GFR A;  3VVF A;  1R9Q A;  4R9G A;  2RKM A;  1MQI A;  3JV9 A;  1B5J A;  1FTM A;  3C4M A;  2NOO A;  1AMF A;  2F78 A;  1DPE A;  3VLU A;  1D9V A;  3HN0 A;  3TCF A;  1H76 A;  4OEU A;  2XXP A;  4LZ5 A;  3O6P A;  2QL3 A;  5ICQ A;  4H8J A;  1XOC A;  3FVK A;  2F7A A;  1Y4T A;  3CSG A;  3PMX A;  3T96 B;  1POT A;  2R71 A;  1PDA A;  4QSD A;  2X26 A;  1IIT A;  1IXC A;  3TQL A;  4NF4 B;  3DRK A;  1JW5 A;  3JZJ A;  3Q26 A;  1TFD A;  3MW0 A;  2F34 A;  1PB9 A;  3N94 A;  1LLS A;  1NNF A;  1Y3P A;  2ONK E;  1TT1 A;  2DS9 A;  3K6W A;  1JET A;  3IOR A;  2H4I A;  2DE4 A;  3KSJ A;  2OWT A;  1SW1 A;  1LFG A;  3K0V A;  4H67 A;  3MVY A;  1UTB B;  3MP1 A;  2ZYK A;  2B65 A;  3OEN A;  1ZTY A;  1I6Q A;  3VVE A;  3MBP A;  1LCF A;  3LVU A;  4POX A;  3TTR A;  2FYI A;  4GL8 A;  2F5X A;  2XX7 A;  3PGF A;  5K2Y A;  3WAE A;  4H1X A;  1MY4 A;  3MVX A;  4HTG A;  4EF1 A;  2O1L A;  3B6T A;  4BDR A;  2NVU B;  4PFT A;  4OEN A;  4THI A;  2Y7W A;  3KG2 A;  1EZO A;  2I4C A;  1NNT A;  5FHN A;  1LBC A;  3O97 A;  1WOD A;  4OQO A;  4ELO A;  1M5F A;  4XXU A;  2ZXT A;  3OXN A;  5KDT B;  1MRP A;  3DLN A;  4LP2 B;  4C1U A;  3N6U A;  2WOP A;  1B1X A;  3KZG A;  2QRY A;  4QRZ A;  3CFX A;  4I9D A;  1I6A A;  3FXQ A;  4KCC A;  3RTW B;  4OMB A;  1LGB C;  4TLM B;  4U4S A;  2VGQ A;  4IY6 A;  4YMA A;  3RYA A;  1AOV A;  1A40 A;  1SW4 A;  4ZZE A;  1XS5 A;  4PQJ A;  2E1S A;  5M2V A;  4ZE8 A;  1WVJ A;  2Q2C A;  1IQ7 A;  3K2D A;  4DE8 A;  3MJN A;  3MQ9 A;  5I84 A;  2HAV A;  3W15 C;  2PYY A;  1Y1M A;  1LB8 A;  3TEP A;  3UA8 A;  2DWJ A;  2ZYM A;  3FXU A;  4KI0 E;  2W7Y A;  3KN7 A;  4X1B A;  4H5F A;  3KFM A;  3E13 X;  5FHM A;  2AL4 A;  4H6D A;  3K1N A;  4OFL A;  1NH8 A;  4U1O A;  5DT6 A;  3FTO A;  4JB7 A;  3HPI A;  4PE5 B;  3D4C A;  1B4Z A;  2XHD A;  1B05 A;  5FHO A;  5A5X B;  4MFI A;  4E0W A;  1JEU A;  1QUK A;  3H4Z A;  1FQB A;  5B70 A;  5ITP A;  3HO7 A;  2M8C A;  1ZIU A;  4TOZ A;  1NKX A;  1QUJ A;  1US5 A;  4RPO A;  5CMC A;  4KFQ A;  1XVX A;  3TPA A;  2AYS A;  2GH9 A;  1AL3 A;  5AA2 B;  4DCX A;  3FJM A;  4R2B A;  3VLV A;  4C0R A;  5H8F B;  4G2Z A;  5LOM A;  2HXW A;  5DEX A;  4U23 A;  5JK4 A;  3I5O A;  3PUX E;  1RKM A;  4YKK A;  3MVZ A;  1DOT A;  3MC2 A;  4FIM A;  2XD3 A;  4RA1 A;  2CZL A;  3I3V A;  4EXK A;  3N6T A;  3R26 A;  1MQJ A;  4F2Q A;  1P1Q A;  4EXL A;  1B32 A;  1GVC A;  4KHZ E;  3T66 A;  1FTK A;  3SEV A;  4PFW A;  4XKP A;  4OYV A;  4Q0C A;  3CVG A;  1S9T A;  2R6G E;  1HSL A;  1BLF A;  2NXO A;  4X9T A;  2V3Q A;  4XTC Q;  1YTV A;  4XIG Q;  3SKP A;  1Z7M E;  3C34 A;  1ZBM A;  3PUV E;  2B4M A;  1LST A;  1SDX A;  3MPL A;  2VD2 A;  4F19 A;  3IOW A;  5I59 A;  2DP8 A;  2V93 A;  4UAC A;  3PD9 A;  1A7L A;  1RYO A;  4ZEK A;  1B3L A;  3DEL B;  4JDF A;  2XXU A;  5CBR A;  1A8E A;  5CM6 A;  5TPA A;  2XXH A;  1US4 A;  1FTL A;  2Q9T A;  1DMB A;  1SVX B;  4I62 A;  5HM4 B;  1OMP A;  1JQF A;  3QUF A;  4IO4 A;  2HQ0 A;  4YAH X;  3IR1 A;  3KOS A;  2YJP A;  4YIC A;  1BP5 A;  4KQP A;  4FE8 A;  3QK6 A;  4KR5 A;  3KSX A;  4IO2 A;  4LZ8 A;  1MXV A;  1B6H A;  4NWC A;  5AA4 B;  4PFU A;  3S9E A;  3H06 B;  4DDD A;  4HW8 A;  3BBR A;  2PVU A;  3R6U A;  1H45 A;  2HCA A;  3G3J A;  4C1T A;  2GRV A;  3O2A A;  4BDL A;  4ESW A;  4OES A;  1YPN A;  3TUS A;  3ILU B;  1QVS A;  3HHF A;  1LCT A;  3H6V A;  3DP4 A;  3KBR A;  4N13 A;  1M5D A;  4NED A;  1P1N A;  5ITO A;  4EF2 A;  1OLC A;  3U1O A;  1XT8 A;  2V3T A;  2I3W A;  3PMW A;  4MBP A;  2FNC A;  4GOT A;  2P2A A;  1A54 A;  4LON B;  4JSD A;  5L8D A;  1NFT A;  2VD3 A;  5F1Q A;  3KN3 A;  3WAF A;  4G68 C;  3MZ9 A;  1IXH A;  2XXY A;  3DRI A;  3T9U A;  3RYB A;  3N5L A;  3K1M A;  5H8N B;  5JEI A;  2ONS A;  4G68 A;  4YZZ A;  5I58 B;  2FA7 A;  1MQH A;  2Q2A A;  4JBZ A;  1LFI A;  3ODB A;  2OZZ A;  1EU8 A;  2ZYO A;  4NF6 A;  3KJT A;  5I2N B;  2RC8 A;  4DLD A;  3DRH A;  3T9H B;  3L6G A;  4H5G A;  5I56 A;  4EDP A;  2ANJ A;  1OVT A;  3O28 A;  3JYR A;  4P11 A;  4JSO A;  4QFL A;  3TZA A;  3LC8 A;  2Z8D A;  1D4N A;  1QJM A;  2H5Y A;  5CBS A;  4R6K A;  3U8Q A;  3TCH A;  1SI1 A;  2DXR A;  5IKB A;  2HZL A;  4NF5 A;  2F7B A;  3VXC A;  3UIF A;  1UIV A;  4R74 A;  2Y7P A;  3QAX A;  1L5T A;  4F2O A;  4YU0 A;  3K01 A;  1B3E A;  3G3G A;  2O7U A;  1ATG A;  1H3D A;  2THI A;  3IB0 A;  2PX1 A;  1S50 A;  3V5A A;  3E3K A;  1Z7N E;  3QYT A;  3DRJ A;  4F1Y A;  1HSE A;  1A55 A;  3M3F A;  4F31 B;  3C9H A;  2AL5 A;  4DXC A;  1ZMG A;  1MQD A;  3RLF E;  3RY3 A;  5I57 A;  4FEB A;  4OET A;  4RNS A;  4Z0I A;  5L9M A;  3O6I A;  3ECR A;  1BIY A;  1TXF A;  4X1D A;  4ELR A;  2RC9 A;  2B3B A;  4L17 A;  4F18 A;  4GIZ A;  4IGT A;  2F6P A;  2F6G A;  1UTH A;  1POY 1;  3Q27 A;  1JVY A;  3PPN A;  1FCK A;  1MPD A;  4DZ1 A;  3EF7 A;  3B6W A;  4JWX A;  3Q25 A;  3SEY A;  3TMG A;  1IEJ A;  3RPW A;  2HFB A;  4TLL B;  3PPR A;  1XC1 A;  1OIB A;  1UQW A;  4N07 A;  1B58 A;  2Q8J A;  2DXY A;  3QSL A;  2R9J A;  3UP9 A;  2O6A A;  1URG A;  5HPQ A;  3A09 A;  2Y7R A;  4F1V A;  1B0H A;  4K3F A;  4Z7E A;  3O6G A;  4IGR A;  1I6B A;  3FJ7 A;  4R2F A;  1QKB A;  4HS7 A;  5H8Q B;  5CMM A;  3LBS A;  5DVJ A;  4QFP A;  2QJE A;  1MPC A;  4YB5 A;  1MXU A;  4R6H A;  2G93 A;  1NL5 A;  3C31 A;  4R73 A;  4M4G A;  5DYH A;  2V3U A;  3OOA A;  2H9B A;  2CMO A;  3LUY A;  1DTZ A;  4ISU A;  1N04 A;  3K1P A;  4GD5 A;  3RUM A;  5BUU A;  2Q88 A;  5I2K A;  1MXX A;  4O3A A;  5AA3 A;  3BFU A;  1B5I A;  5JTY A;  4ESX A;  3MZB A;  3OEL A;  3UK4 A;  4G8H A;  3RQT A;  2UVI A;  4ZDM A;  3FVG A;  3IOV A;  4P0G A;  1QUI A;  2NUV A;  5H8H A;  4FOR A;  4G8M A;  3MPK A;  2DOJ A;  1FTO A;  1GR2 A;  3H6U A;  3PAM A;  5DVI A;  4F3P A;  5KCJ A;  1J1N A;  4U21 A;  3TDJ A;  1TFA A;  2Z8F A;  4QSC A;  3RNN A;  2LAO A;  1PB8 A;  4RY1 A;  1MH4 A;  1H44 A;  2RF1 A;  3H3G A;  1B0L A;  1P1O A;  4ZEI A;  4U2R A;  2A5T B;  4WED A;  3B7D A;  3HCQ A;  3VDF A;  2F97 A;  2G29 A;  4JWO A;  3S4U A;  4F29 A;  4ZEC A;  1PB7 A;  5CMB A;  2IEE A;  2O84 X;  1FW0 A;  4ZED A;  3FAT A;  1Y20 A;  1A99 A;  4P0I A;  5L9S A;  4NF4 A;  2I0C A;  3TEL A;  2F8D A;  2Y84 A;  3G3K A;  1F9B A;  3FV1 A;  5CC2 A;  4ELP A;  4ZEF A;  2QMX A;  3T93 B;  3FV2 A;  4GXA A;  2DWI A;  1FQE A;  5FTH A;  3PV0 E;  3CG1 A;  4KYD A;  3FIR A;  3DRF A;  1VFE A;  4IB2 A;  4F39 A;  1IZ1 A;  3OO8 A;  1B3H A;  3LSF B;  3SET A;  2DWA A;  1SBP A;  2Z23 A;  2XX8 A;  1UTB A;  2Q89 A;  3HHG A;  2B3F A;  4RYA A;  3IAZ A;  3Q28 A;  1OVB A;  2OBG A;  3C32 A;  3DM0 A;  4FAT A;  1Q1K A;  4IY5 A;  3MUQ A;  3GBA A;  1HSJ A;  5AA2 D;  3CI8 A;  3QIM A;  4AB6 A;  3MAM A;  1URS A;  4O3C A;  5AA1 A;  3UOR A;  4JWY A;  3LSL A;  4ZS9 A;  2DWH A;  5ELV A;  1BTJ A;  4RPN A;  3OEM A;  4AQ4 A;  4FJP A;  4F3B A;  4QSE A;  3PUZ E;  1YAE A;  2P0S A;  4E0X A;  3VE1 B;  1CB6 A;  1NH7 A;  2Y7I A;  1SW5 A;  2F36 A;  1AIV A;  1B46 A;  2XXW A;  5KDT A;  3G3F A;  1P99 A;  5DVF A;  2X7P A;  2RC7 A;  4FED A;  3ZS6 A;  1Y3Q A;  1USY E;  3MP8 A;  4IO6 A;  3FVN A;  3CRB A;  2ZNT A;  3GLB A;  2O1M A;  2GHB A;  3IL1 B;  3E9X A;  3IOT A;  4EQ7 A;  2H25 A;  5AE4 A;  2QS3 A;  3IB1 A;  4MLV A;  3EHT A;  4BDO A;  4GRK A;  1SW2 A;  1N3X A;  2UXA A;  3EPE A;  4LUB A;  4KCD A;  4U22 A;  2XXI A;  1AH5 A;  3DP8 A;  3V83 A;  3N26 A;  4KPT A;  4NMY A;  2WOK A;  2YPN A;  5J1D A;  3A3C A;  4OFO A;  3VV5 A;  3L6H A;  4BDN A;  3M3K A;  3RN8 A;  3H6T A;  1FQA A;  2XXT A;  2UVG A;  3LSX A;  4IO5 A;  1ELJ A;  2H99 A;  2D5W A;  4H0W A;  2F35 A;  1RYX A;  1PBP A;  1IUD A;  4MF3 A;  1MY0 A;  3FJG A;  4EUO A;  2AIX A;  5L9O A;  3TKD A;  1O63 A;  3FAS A;  1B40 A;  2KLF A;  4I8C A;  3OSR A;  1N0T A;  4NWD A;  1ZU0 A;  4OZ9 A;  4BDQ A;  1DPP A;  1II5 A;  4ZE9 A;  3O29 A;  4NF8 A;  2D3I A;  1I69 A;  5EYF A;  4FAJ A;  2E0S A;  4EQ9 A;  1N84 A;  1B7U A;  1P1U A;  2UYF A;  1R1N A;  2ESN A;  5AA2 A;  5BWJ A;  4PFY A;  3EN3 A;  3OD7 A;  1MDP 1;  2ZNU A;  5B7D A;  2I3V A;  3H7M A;  3GZG A;  3USD A;  4QF9 A;  4OVJ A;  3IK6 B;  1MS7 A;  3IB2 A;  4N6P A;  1VR5 A;  3BKI B;  3LR1 A;  1O64 A;  1EZP A;  3FVO A;  4KYS A;  2V84 A;  1B7Z A;  3OO6 A;  4Q30 B;  4DCY A;  1NNK A;  2OLB A;  4UA8 A;  1R6Z A;  5H8H B;  1URD A;  3DRG A;  2B4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...