1B5JA

Oligo-peptide binding protein (oppa) complexed with kqk
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
total genus 185
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b5jA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b5jA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b5jA02
2RC7A 3RTFB 1LSTA 2XD2A 3LVUA 2HXWA 2HAVA 3TYHA 2HAUA 4JDFA 2PT1A 5BUUA 1ZIUA 1B5IA 1DTZA 5CRYA 2XXTA 3CFXA 3MP6A 4KD5A 4NF8A 1H43A 4C0RA 1NMUA 1FTOA 4RPOA 2H4IA 4IO7A 4N13A 4M1VA 4ZZEA 4ELOA 4GD5A 1SYHA 2H98A 1YAEA 1B6HA 3FTOA 4KYSA 4O3CA 1WDNA 3G3FA 3HHFA 3G3JA 3O6HA 3R7XA 5EHMA 4F18A 5AA1A 1S7YA 5I2KB 5EYFA 4AQ4A 2I4CA 2I0CA 2DYXA 3RT6B 1UQWA 1POY1 2QRYA 1HSLA 1OLAA 2UXAA 4U2RA 2XXRA 5DTBA 4E0XA 1QUJA 4JSDA 1I6BA 1NL5A 1Z7ME 3USDA 1QUIA 2XX7A 3H6WA 3HO7A 4JWYA 5ELVA 2F35A 3TTRA 4EDPA 1P1OA 5AA4A 4TQUQ 3Q25A 3DRFA 1VE4A 4GXSB 3EPEA 3AXFA 4R73A 1MDP1 4KCDA 4NF4B 4BLAA 4LZ7A 4GIZA 5F1QA 2O1LA 2QMXA 2XHDA 4GRKA 3TKDA 3DP4A 5H8FB 3LBSA 2VD2A 3LSLA 5I59B 4WKMA 5JK4A 4DIGA 5CMMA 3G3HA 3TZAA 1N7XA 2PMSA 2XXHA 3G3GA 3MWBA 3OO6A 5KDTB 2H9BA 3UN6A 1QKAA 1EZOA 4PFUA 3RY3A 2QJEA 4F1VA 2BJJX 4OENA 2X7PA 3ILUB 1LAGE 4MH5A 2DXRA 2GH9A 4IGTA 4YICA 4F39A 4ELRA 4OYVA 1J1NA 1BTJA 1PBPA 4ELPA 3MUQA 4OETA 3GBBA 4YKKA 1NNKA 2REJA 1LBBA 1ZKBA 2XXWA 2YPNA 3LUYA 5H8QA 5TPAB 1BIYA 4ZE8A 1D9YA 5DT6A 5F7VA 2WOLA 1GV8A 5I59A 2I49A 1OQHA 3FV2A 3E3KA 4H5GA 1H3DA 1OMPA 3VV5A 4DE8A 4F2QA 4NWDA 3K6WA 2HQ0A 3RGYA 3U94A 3QSLA 1N7WA 4YB6A 3FGSA 5H8QB 5TPAA 4I9DA 3PV0E 4KR5A 4ND9A 3T66A 1FQFA 1M5DA 3H7MA 3IL1B 4RY1A 1QW0A 4DXUA 3FVOA 4ZS9A 5CBSA 3CSBA 1L5TA 1D3KA 1OQGA 2PT2A 3OXNA 1YCJA 3MBPA 2R71A 4F3BA 1LAFE 1B5JA 5HBCA 3TQWA 3KJTA 1IUDA 3G3IA 3KZGA 3PPQA 4LQ2A 3S9LC 1MPCA 2V93A 1SI0A 3I5OA 3MZBA 4PFTA 3TCFA 1NH7A 1XC1A 2DQVA 3OO8A 4ZE9A 3D4CA 4M4GA 4YKPA 2HFBA 1M5CA 1N3XA 5KDTA 2A5TB 3GBAA 1LB9A 3CIJA 1ELJA 1IZ1A 1I6QA 1B2HA 1MXXA 3G3KA 3G7WA 5AE4A 3FATA 1MY1A 1URSA 1MDQA 1GGGA 3OO7A 4GLIA 2Z8EA 3EHTA 3I3VA 2G29A 3DP6A 3PMVA 3M3KA 1R9LA 2OWTA 3TAJA 4ISUA 2UYEA 3KSJA 4NWCA 1AMFA 3N5LA 1MQJA 3SEVA 3TFLA 1LAHE 3IOVA 1MXWA 2HEUA 3O2AA 5TP9A 4GQOA 4DCXA 1ZU0A 2Z23A 3SEYA 2RC9A 5I2KA 1FQEA 3IB0A 4KFQA 4EQBA 3KFMA 1O64A 4ZEDA 4KYEA 2I0BA 3S9EA 1CB6A 3LSXA 3W15C 4LVQA 4R75A 3VXBA 1LCFA 3FXQA 1P1UA 2XXIA 3DRGA 4H8JA 3UORA 3OEMA 3VVDA 4OFOA 1JVYA 3C32A 5H8NB 4OXVA 5HPQA 2DWIA 2YJPA 3DELB 4HCWA 3SEWA 4Z7EA 4LA9A 2UVIA 1HSEA 2GFEA 5I84A 3N6UA 1YPNA 3E9XA 2V84A 1MQIA 4RXLA 4F31B 1QUKA 1I6AA 1MY2A 5H8NA 3QK6A 2V3TA 3WAEA 2Q88A 3Q28A 4XKNA 3QUFA 1EZPA 1QULA 1PBQA 3O66A 3FJGA 5KCJA 3PPPA 4POWA 4OESA 1MQGA 3DLNA 4EXLA 2ZNTA 2PYYA 5AA2A 3O29A 3F11A 2O69A 4R9FA 1PB8A 3JV9A 4U1ZA 2YLNA 2CMOA 3K2DA 3ECRA 3K01A 3TMGA 1FQAA 3MVXA 1GR2A 2OCUA 3PPNA 4KCCA 4OMBA 4ELQA 3B6QA 2P0SA 4RJZA 4LQ5A 1ZJLA 1JNFA 3BBRA 1MM6A 4R72A 4X1BA 4DLDA 4R74A 1M5BA 3ODBA 4JWOA 3EQ1A 4QFKA 3RLFE 3CHGA 3S4UA 1B3FA 1B58A 1A8EA 3O6GA 3PUXE 4G8MA 2ZYKA 1IEJA 3TPAA 1EZ9A 4U4SA 1GTKA 1MH4A 2A5TA 1II5A 1B5HA 2DE4A 3IO6A 1QVSA 4I62A 3RQTA 1JW5A 4TLMB 3T9HB 1D9VA 1M5FA 4PFYA 4ONYA 2NXOA 1A40A 2ALUA 2O84X 3MP1A 1LBCA 2I3WA 1P1WA 1MY3A 3KBRA 1P1QA 4YMAA 5A5XB 1XVYA 4N07A 1DPEA 4EUOA 1FQBA 1US4A 4RA1A 3HV1A 1NKXA 4N6PA 1XS5A 1MS7A 2RKMA 2F7CA 2H5YA 1PB9A 5DVFA 1NFTA 2Z8DA 3MAMA 3ZKLA 5TP9B 3KN8A 4OVJA 3SERA 4YKJA 3K6VA 1B46A 1URGA 2F6PA 4U1OA 3TEPA 3KG2A 1T0KA 2DOJA 3HCQA 4QFLA 1TWYA 2B65A 2E1SA 3EF7A 3MJNA 3PMWA 4G4PA 4O3BA 5K2XA 3UA8A 1MPDA 4OZ9A 2ONRA 3KN3A 1B0HA 1MQDA 5TU0A 2XXUA 5AA2B 3O97A 1R1NA 3ONMA 3ZKKA 4F3GA 4TOZA 1JW4A 3DRIA 1H44A 1LFGA 4PP0A 3M8UA 4H5FA 1Y1ZA 4GWOA 4THIA 4EQ9A 3CRBA 3K0VA 2VD3A 3JZJA 1MH3A 4XKPA 2B3BA 2M8CA 1P99A 3C33A 4E0WA 4RYAA 2ZNUA 5L8DA 1POTA 4NF6B 4U22A 4GL8A 3FVGA 2H25A 4GXAA 3RYBA 2ZNSA 1WVJA 1B3HA 4QHQA 2WOKA 2ONKE 1SYIA 4RPNA 3SEUA 1MRPA 4AB6A 4NTLA 2FA7A 2DP8A 4OWDA 1PEBA 4Q8RA 2PX1A 1SBPA 5DEXA 3LSFB 4GFRA 1BP5A 1LFIA 3QYTA 2ZYNA 3Q26A 3UIFA 2QS1A 1ATGA 2Y7PA 3H03A 3IK6B 5CC2A 1H76A 1N0TA 3U92A 1R9QA 2XXQA 1VFDA 1Z7NE 1XOCA 1B7UA 2UVHA 3D4GA 3EHSA 4IB2A 3VDFA 2I48A 3PGFA 3PUVE 5BWJA 3CG1A 3MVYA 4Z0IA 4R6HA 2QMWA 1B9JA 3R26A 4FEBA 1B1XA 3RNNA 4MBPA 5LOMA 3WAFA 4PQJA 5ITPA 1RYXA 2DWHA 2WKYA 1FCKA 3PU5A 2G93A 3KJ7A 2F7AA 4MLQA 1DMBA 3B6WA 4DDDA 4FECA 1MXVA 4R2FA 1LB8A 1USYH 3O6IA 1AH5A 1URDA 3RTWB 1JETA 2QS3A 2XXXA 3IJXB 4YU0A 2UYFA 3C35A 4BDOA 5I2NA 1A99A 1B3EA 4H1XA 2NVUB 1UIUA 3IB1A 3QUJA 4ZDMA 3MVWA 2Y7RA 3U8QA 3O28A 3C36A 5AA4B 4L17A 1ANFA 3DRJA 4QFOA 3V8XB 4TLLB 5DYHA 1IIWA 4P11A 3TELA 4C1TA 5ITOA 4F19A 4F29A 1Y3NA 5L9MA 3T96B 2W7YA 1MPBA 2DWAA 1BLFA 2ABHA 1RYOA 4QFNA 3IAZA 1B4HA 4JXIA 1SQYA 2NWJA 3W9VA 4F2OA 3S9NC 3U1OA 1B51A 4EF1A 3OENA 4ZEBA 1LCTA 3VLWA 3C31A 1SW5A 3Q27A 4H0WA 3C9HA 4WEPA 1MXZA 2OWSA 3TTLA 2CZLA 4U4XA 5CI5A 5I56A 3IJOB 1IITA 1UTHA 3MPLA 4I8CA 2D5WA 3V89B 2Z22A 3RN8A 3SESA 4EQ7A 4NF8B 5H8HB 4NE4A 2KLFA 4BDQA 2IEEA 2GRVA 4FE8A 4NF5A 2QPQA 2I58A 1Y1MA 1UIVA 2B3FA 4H6DA 4DXCA 2V3QA 3CFZA 1FQDA 3MC2A 3N94A 3R6UA 2F78A 3RPWA 5KZTA 2H99A 2F34A 2XXPA 1MQHA 4LZ5A 3U72A 4OFJA 3VLUA 2P1SA 4HTGA 4ESWA 1Y20A 1Q1KA 2V3UA 4LATA 4Q5TA 2Q2AA 3DP8A 1UTBA 1LAXA 4OTEA 1D4NA 3DRHA 1HSJA 3A3UA 3N6TA 4G77A 4R6YA 4QSEA 3TCGA 3PUZE 2B4LA 5B7DA 4RK2A 3T9UA 3IX1A 2D21A 3FASA 1B7HA 3B6TA 2RINA 1ZLQA 3OO9A 4EF2A 3SETA 3VVFA 3ZSFA 2F7BA 1VFEA 1Y4CA 3MQ9A 1Y3PA 5CMCA 3THIA 3BFTA 3FIRA 3FVNA 3Q29A 2HCAA 2Y84A 4QF9A 3HSTA 1R6ZA 4KYDA 3E4RA 1TFAA 4UA8A 4F1YA 4OFLA 3N26A 1AIVA 1DSNA 1FTKA 4FORA 3KOTA 3K1PA 3CR9A 4NF6A 4R6KA 2Q2CA 3KN7A 2LAOA 3PD8A 1LFHA 2OBGA 4PFWA 5H8SA 1B1HA 3VXCA 1WODA 2UVJA 2QS4A 4OERA 1I69A 3HHGA 4NF4A 4NMYA 1MXUA 4KPTA 2X26A 5FHNA 3T22A 5JEIA 4R9GA 4BDNA 4G8NA 1QKBA 4GVOA 5DVJA 4FEDA 4G68B 2ZMBA 4MFIA 4ZEIA 2I6EA 4IY6A 1ZTYA 4QSCA 3VLVA 2OLBA 3M3LA 1PB7A 2XX9A 4KHZE 4OHNA 1P1NA 2THIA 1AL3A 4JBZA 4LONB 4YKIA 5DVIA 2VGQA 3K02A 2ONSA 3DM0A 1Q35A 5I58A 3TUSA 1DOTA 1CE2A 4FJPA 4G2ZA 3RT8A 1JW1A 3EHUA 4XKRA 1A8FA 3H6VA 5KCJB 1UTBB 1DTGA 2E0SA 2F97A 1JQFA 2REGA 3E13X 3L6GA 5DEXB 5CMBA 1TFDA 5FTHA 1NH8A 5L9SA 3ILTB 3T93B 2AYSA 5FHOA 4EXKA 3K1NA 2V25A 4ZEKA 3PUYE 4IO3A 4JWXA 2ESNA 2R9JA 3IR1A 3OD7A 3QIMA 3KOSA 3OEKA 1MG1A 2NUVA 3K1MA 4F1UA 4F3PA 4H65A 3P7IA 4HW8A 3IO4A 5H8HA 1N04A 3TTKA 3PD9A 1DPPA 3TDJA 3UK4A 2I4BA 2XXYA 2Y7IA 3FJ7A 3FXRA 4G68C 4G8HA 1SI1A 2Z8FA 1KWHA 5FHMA 2XX8A 2O68A 1IXGA 2IA4A 2B4MA 4LUBA 2O6AA 1A54A 3PPRA 4U23A 4XIGQ 1LLSA 2NOOA 1B05A 2FNCA 2VHAA 4X48A 1FTJA 2ZYOA 1YTVA 5K2YA 2FYIA 1EU8A 4FATA 3W9WA 3VFJA 3O6PA 1FW0A 4OQOA 3H6TA 1SVXB 2DVCA 1Y4TA 4P0IA 3GLBA 4QSDA 2Y7WA 5B70A 1OLCA 2DSFA 4U21A 3KEIA 4PE5B 1XHYA 5EHSA 1FTLA 2O51A 2OJTA 4YAHX 5AA2D 2RCBA 4IO5A 4DCYA 2X7QA 1SDXA 3FVKA 1RKMA 1Y9UA 3LSWA 3TTMA 3SEXA 1OIBA 1PDAA 2DXYA 4MLVA 1NNFA 4QRZA 5CMKA 4XKQA 4BDRA 1MY0A 1USYE 2O1MA 2OK2A 1IQ7A 1B0LA 1B4ZA 3MPKA 4LP2B 2PBWA 3U93A 3VE1B 1FTMA 5H8FA 2O7UA 1M5EA 4WEDA 1Y3QA 3TTNA 4LZ8A 3FZVA 2ANJA 4FAJA 1B32A 5IAIA 2R6GE 3EN3A 2WOPA 5AA3A 3OSQA 2O7IA 1JVXA 2QL3A 5I58B 3C4MA 3H3GA 2DWJA 1N84A 1SW1A 4WXJA 1TT1A 2I3VA 3H06B 2GHBA 2Q89A 3KSXA 4KI0E 1XVXA 2QS2A 4I1DA 4X1DA 3UP9A 1GVCA 4YB7A 3TODA 4PETA 3DRKA 2F36A 4G68A 4AB5A 1FQCA 3FXUA 5M2VA 2Q8JA 2DS9A 4IO4A 2RF1A 4Q30B 3T9XB 3MZ9A 3H4ZA 1JEUA 4YMBA 4MF3A 4RK9A 1SW4A 1TXFA 4HCYA 4QFPA 3MP8A 3C34A 3KGCA 4IO2A 3IOTA 2ZXTA 3A09A 1B40A 1IXCA 1AOVA 1O63A 2DE3A 4XXUA 4C1UA 5I57B 4IGRA 1A55A 1S50A 1BKAA 1O7TA 3M3FA 3OSRA 1QJMA 3OELA 2P2AA 1F9BA 5L9OA 2QSXA 3K6XA 3PAMA 1OVTA 4ZEFA 5CBRA 2RC8A 5I2NB 3ZS6A 4BDMA 4FIMA 1N3WA 4R2BA 3PUWE 3JYRA 3I6VA 4DXBA 3GZGA 4YB5A 3V5AA 2UVGA 3CFLA 1XT8A 3PPOA 3QAXA 2PVUA 3HPIA 4JB7A 1LGBC 4F22A 3MW0A 2DE2A 3K4UA 3CG3A 4POXA 3SKPA 4DZ1A 3OMBA 4XTCQ 1MM7A 3LR1A 2OZZA 4YZZA 2AIXA 3PMXA 4GOTA 4OEUA 3K00A 4NEDA 3SDFA 3IB2A 1H45A 1JEVA 1MY4A 5ICTA 4OEVA 5ISUA 3FD3A 1SW2A 2D3IA 5J1DA 3BFUA 1IXIA 2AL4A 4IY5A 4KQPA 5A5XA 2DVZA 1NNPA 4ZZAA 1B7ZA 5JTYB 3A3CA 4ESXA 4H8IA 2XXVA 1US5A 3O9PA 4BDLA 2GHAA 4NF5B 4GF8A 3S9MC 3MZ1A 4P0GA 1B52A 5FTIA 3CVGA 3QXMA 4GL0A 4Q0CA 2A5SA 1ZMGA 2F5XA 5JTYA 3B7DA 5I56B 4HS7A 2XD3A 1EH3A 4JSOA 2RCAA 1VR5A 4K3FA 1UTHB 3TQLA 1B3GA 3MVZA 2F8DA 3GXAA 3H6UA 3L6HA 3LC8A 4F3SA 1SD3A 3K6UA 1N76A 2AL5A 4IO6A 5HM4B 3FJMA 4ZECA 1S9TA 1IXHA 3CI8A 1B3LA 3RUMA 1MXYA 3HN0A 4ECFA 2F6GA 3S2VA 4X9TA 5ICQA 2Y7KA 2VOZA 3BKIB 3RYAA 3T9VA 4UACA 3FV1A 3IOWA 5CM6A 3UGWA 4RNSA 2ZYMA 2HZKA 2HZLA 3FUZA 4H67A 3OOAA 4O3AA 3V83A 1PC3A 2VP1A 3VVEA 3IORA 2Q9TA 1ZBMA 1NNTA 5I57A 3TCHA 3IOUA 1VSOA 5IKBA 3CSGA 1A7LA 1OVBA
chains in the Genus database with same CATH superfamily
3LVUA 2HXWA 4GBWA 2HAVA 1FPLA 1DCUA 2XXTA 4NF8A 1NMUA 1FTOA 4ELOA 1SYHA 1WDNA 5I2KB 2QRYA 4JSDA 4EDPA 3HO7A 3AXFA 2QMXA 4WKMA 4DIGA 5CMMA 3G3HA 2FIEA 2H9BA 4F1VA 2BJJX 2X7PA 3ILUB 1LAGE 1LBYA 4F39A 1BTJA 1PBPA 4HE2A 3GBBA 3LUYA 2YPNA 5I59A 1D9YA 3FV2A 1H3DA 1OMPA 2Y5LA 3U94A 3QSLA 1NI9A 5H8QB 5TPAA 4KR5A 4DXUA 1FPKA 1B5JA 1LAFE 3G3IA 3KZGA 1MPCA 3I5OA 1SI0A 5JK4A 2DQVA 4YKPA 3D4CA 1M5CA 1N3XA 4NN3A 1ELJA 1IZ1A 1B2HA 1MY1A 1GGGA 3DP6A 3PMVA 4X04A 1R9LA 2UYEA 1MXWA 5TP9A 4GQOA 3SEYA 3S9EA 4KYEA 2I0BA 1CB6A 4PDDA 4R75A 1LCFA 3FXQA 3DRGA 3VVDA 4OFOA 3C32A 5H8NB 4OXVA 3DELB 4HCWA 1HSEA 3N6UA 3E9XA 1MY2A 3WAEA 1EZPA 5KCJA 1NV7A 4POWA 4OESA 2O69A 1PB8A 2CMOA 3K01A 1FQAA 3B6QA 4RJZA 1ZJLA 1MM6A 4X1BA 4R74A 1M5BA 1A8EA 3PUXE 1EZ9A 1GTKA 4I62A 3T9HB 2O84X 5I5PA 2I3WA 3KBRA 4YMAA 4OANA 5A5XB 1XVYA 1DPEA 1US4A 1NKXA 1LBWA 1MS7A 2F7CA 1PB9A 1NFTA 3ZKLA 4OVJA 1URGA 2F6PA 1T0KA 3HCQA 3EF7A 2ONRA 1MQDA 1R1NA 3ZKKA 4OVPA 3DRIA 1LFGA 2HXRA 4PP0A 4H5FA 4THIA 5ET8A 1MH3A 4XKPA 4E0WA 4RYAA 5L8DA 4GL8A 4RPNA 1WVJA 1B3HA 1SYIA 3SEUA 1KZ8A 4OWDA 2PX1A 5DEXA 4GFRA 4P8BA 2ZYNA 3Q26A 3UIFA 2QS1A 3EHSA 2I48A 3CG1A 2QMWA 1B9JA 3WAFA 4PQJA 5ITPA 2G93A 4O8MA 3B6WA 3O6IA 3RTWB 3IJXB 2NVUB 4ZDMA 3QUJA 3MVWA 3U8QA 1FBGA 2PFYA 2PFZA 1DK4A 4QFOA 5DYHA 4C1TA 4F19A 3BIHA 4DXBA 1MPBA 2DWAA 2ABHA 2NWJA 3W9VA 1B51A 4EF1A 3VLWA 3Q27A 1MXZA 3TTLA 4U4XA 3V89B 3SESA 4EQ7A 4NF8B 4NE4A 4UABA 2QPQA 2V3QA 3RPWA 2XXPA 2H99A 5H8FA 1MQHA 4HTGA 1Y20A 4LATA 2Q2AA 4OTEA 4I3EA 3N6TA 4GBVA 5B7DA 3T9UA 4GWUA 1B7HA 1LBVA 3VVFA 3ZSFA 3BFTA 3Q29A 2Y84A 4NQ8A 4MX6A 3PD8A 2OBGA 4PFWA 5H8SA 4OERA 5FHNA 4G8NA 1QKBA 5DVJA 4FEDA 4KHZE 4LONB 2THIA 1AL3A 5DVIA 5I58A 3DM0A 1Q35A 1DOTA 4GX6A 4GWZA 1JW1A 3EHUA 2E0SA 1JQFA 5DEXB 3ILTB 4EXKA 2AYSA 4DI4B 3PUYE 2Q8MA 4F1UA 4HW8A 1N04A 1DPPA 2I4BA 3FXRA 1KWHA 2O68A 4LUBA 2B4MA 1YXIA 3PPRA 2NOOA 2VHAA 4PBHA 4FATA 1FW0A 4OQOA 1Y4TA 3KEIA 2OJTA 5AA2D 2X7QA 1SDXA 3LSWA 3BIGA 3SEXA 2DXYA 2QVUA 4QRZA 4BDRA 3MPKA 4LP2B 3VE1B 2O7UA 1Y3QA 3TTNA 2ANJA 4FAJA 5AA3A 3OSQA 3C4MA 4AS5A 1FPJA 4X1DA 3KSXA 1XVXA 2QS2A 1GVCA 3DRKA 2DS9A 1JEUA 4YMBA 4QFPA 3MP8A 3IOTA 1O63A 4C1UA 4G61A 4IGRA 4NG7A 5L9OA 5A5LA 5CBRA 2RC8A 4PF8A 1NV1A 4F22A 3MW0A 3K4UA 4ELQA 3CG3A 3SKPA 1MM7A 4PFBA 1MY4A 4GX3A 4OEVA 1NV6A 2D3IA 2DVZA 5JTYB 1B7ZA 3A3CA 1NUYA 2GHAA 3MZ1A 4P0GA 2WYPA 4MCOA 3QXMA 4GL0A 2A5SA 3B7DA 3MVZA 3GXAA 3H6UA 5HM4B 3FJMA 4ZECA 1S9TA 5IZZA 3CI8A 3S2VA 2VOZA 4RNSA 1IMAA 2HZLA 4MJOA 2VP1A 3VVEA 2Q9TA 1NNTA 4N15A 1OVBA 2RC7A 4X8RA 3TYHA 4JDFA 4C0RA 4KD5A 3CFXA 4RPOA 4ZZEA 4N6KA 4GD5A 1B6HA 3FTOA 4KYSA 3R7XA 3HHFA 3G3JA 4F18A 4PAFA 4N4UA 4AQ4A 5EQ9A 2I4CA 2DYXA 3RT6B 1HSLA 2XXRA 1QUJA 1NL5A 1Z7ME 3PTYA 4JWYA 5ELVA 3TTRA 4QBAA 1P1OA 4TQUQ 4N8GA 4GXSB 4R73A 1MDP1 4KCDA 4NF4B 3LBSA 3LSLA 2PMSA 2XXHA 3OO6A 1EZOA 4OENA 4MH5A 4IGTA 4OYVA 1J1NA 3MUQA 4YKKA 5H8QA 5TPAB 1BIYA 2I49A 4F2QA 3K6WA 3RGYA 5I59B 4I9DA 3IFAA 4ZS9A 5CBSA 1OQGA 5AA4A 2R71A 4LQ2A 2V93A 1XC1A 3MZBA 3TCFA 3OO8A 4M4GA 5KDTA 3GBAA 2CZIA 3G7WA 1URSA 3EHTA 3KC1A 1LAHE 3IOVA 2HEUA 1ZU0A 1FQEA 4EQBA 2R8TA 3VXBA 1P1UA 4H8JA 3OEMA 1JVYA 5HPQA 2DWIA 3SEWA 2UVIA 4O7IA 1MQIA 4F31B 1QUKA 1I6AA 5H8NA 2V3TA 3Q28A 3QUFA 1PBQA 3FJGA 3NOHA 2P3VA 4R9FA 3JV9A 4U1ZA 4MNCA 3TMGA 1GR2A 3PPNA 4KCCA 4OMBA 4HXVA 1AWBA 4LQ5A 1JNFA 4I3YA 4PF6A 4DLDA 4JWOA 3S4UA 2VPOA 1IEJA 4JVCA 1II5A 3IO6A 1QVSA 1D9VA 1A40A 3MP1A 2FVZA 1FQBA 1XS5A 4PBQA 5DVFA 3SERA 3K6VA 1FJ9A 2DOJA 1TWYA 3MJNA 3UA8A 5EYGA 3KN3A 3E78A 2XXUA 3O97A 4F3GA 4QXDA 4TOZA 1H44A 4EQ9A 3CRBA 2XWOA 1RDZA 4O94A 2ZNUA 1POTA 4U22A 2H25A 3USDA 3RYBA 2ZNSA 1MRPA 4AB6A 2OWZA 4NTLA 2FA7A 3LSFB 3QYTA 5ET7A 3IK6B 3U92A 3EKIA 3VDFA 2FBPA 3PGFA 5BWJA 1NUWA 3R26A 1RYXA 1FCKA 1MXVA 4R2FA 4PCDA 1URDA 2BJIA 1EYIA 2UYFA 4XFEA 1A99A 1B3EA 3IB1A 2Y7RA 3O28A 5AA4B 2CZHA 2VPNA 2Q74A 3V8XB 4TLLB 4F29A 5IZ1A 1Y3NA 3T96B 4MAGA 4NX1A 4F2OA 1LEVA 4MNIA 4ZEBA 3C9HA 2CZLA 5CI5A 3T1BA 4I8CA 2Z22A 3RN8A 2KLFA 2IEEA 4FE8A 4NF5A 2I58A 1Y1MA 1FQDA 4LZ5A 4ESWA 4OFJA 2P1SA 5EQ7A 1Q1KA 4Q5TA 1LAXA 2WEFA 1D4NA 3DRHA 4QSEA 1RDYA 2B4LA 3IX1A 3FASA 1ZLQA 4NGUA 3SETA 1FJ6A 1Y4CA 3MQ9A 1JP4A 3FIRA 1R6ZA 4KYDA 4HE0A 3KBZA 1FTKA 4FORA 3CR9A 4R6KA 5F7VA 4NMYA 2UVJA 2QS4A 4KPTA 4G68B 4MFIA 4ZEIA 4QSCA 5IM2A 2OLBA 4AS4A 2P3NA 4FJPA 4G2ZA 1YZ0A 4XKRA 3L6GA 1FBFA 1FPBA 1NH8A 4P9KA 5FHOA 3K1NA 4IO3A 4ZEKA 4JWXA 5FBPA 3OEKA 3K1MA 2NUVA 4DI3D 5H8HA 3TTKA 3UK4A 3FJ7A 4G68C 1SI1A 2F3DA 2O6AA 5ET6A 2FYIA 1EU8A 3W9WA 2OX3A 4U21A 1FTLA 4YAHX 3MYUA 4DCYA 1RKMA 1RDXA 3TTMA 1OIBA 4MLVA 4XKQA 2OK2A 4HE1A 1FTMA 4MMPA 3GYYA 3RPLA 3FZVA 1B32A 5IAIA 2R6GE 3EN3A 2WOPA 5I58B 2O7IA 2QL3A 1N84A 1TT1A 2I3VA 3H06B 3UP9A 4KI0E 2F36A 4AB5A 1FQCA 4O7MA 4Q30B 3T9XB 3MZ9A 4RK9A 1SW4A 1TXFA 4GWYA 3KGCA 3RYDA 1IXCA 1AOVA 5I57B 1S50A 2HPGA 1BKAA 3OSRA 5EYHA 2WYKA 4ZEFA 5I2NB 3ZS6A 1K9ZA 4FIMA 3PUWE 4YB5A 2UVGA 1XT8A 3PPOA 3HPIA 4JB7A 4POXA 1IMCA 3LR1A 2OZZA 5ICTA 1JEVA 4IY5A 4XEQA 1NNPA 1KA1A 4H8IA 2XXVA 3O9PA 4IR8A 2QVRA 5JTYA 1EH3A 1UTHB 3L6HA 3K6UA 4MHFA 1N76A 2AL5A 1IXHA 1B3LA 3RUMA 2F6GA 2Y7KA 3BKIB 3RYAA 3T9VA 3FV1A 3UGWA 1PC3A 3IORA 3IOUA 3RLFE 5A5XA 3CSGA 3RTFB 1LSTA 2HAUA 5BUUA 2PT1A 1ZIUA 1B5IA 1DTZA 4IO7A 2H98A 3U65A 1YAEA 4O3CA 3G3FA 5AA1A 1S7YA 1UQWA 1OLAA 5DTBA 1I6BA 1QUIA 4H46A 4LZ7A 5F1QA 2O1LA 2XHDA 4GRKA 3TKDA 3DP4A 3TZAA 5EQ8A 3G3GA 3MWBA 4PFUA 3RY3A 2QJEA 2DXRA 4YICA 4OETA 1LBBA 1ZKBA 2XXWA 5EQAA 4ZE8A 5DT6A 1GV8A 3A29A 3E3KA 3RPLB 4NWDA 2HQ0A 3FGSA 4ND9A 3SZPA 3T66A 1FQFA 1M5DA 1QW0A 4PC9A 3CSBA 1L5TA 2PT2A 1YCJA 5KDTB 5HBCA 3PPQA 1IUDA 3S9LC 1NV5A 1NH7A 4ZE9A 2HFBA 2A5TB 2XWVA 1MXXA 5AE4A 3FATA 4GX4A 4PE3A 2Z8EA 2OWTA 3TAJA 4ISUA 4NWCA 3KSJA 3TFLA 1AMFA 1MQJA 4DCXA 3KFMA 1O64A 5T3JA 3LSXA 3W15C 4LVQA 1IMFA 2GFEA 1YPNA 2V84A 4RXLA 3QK6A 4XKNA 1QULA 5AA2A 3DLNA 1MQGA 3F11A 2YLNA 3K2DA 2OCUA 2P0SA 4PGNA 4R72A 5F24A 3ODBA 3EQ1A 3CHGA 1YYZA 2V4CA 1B58A 4G8MA 2ZYKA 3TPAA 4I40A 2GQ1A 4PDHA 2DE4A 4TLMB 4ONYA 2NXOA 2ALUA 4EUOA 4RA1A 3HV1A 1FBDA 2RKMA 3MAMA 4YKJA 1B46A 4U1OA 2E1SA 2XXKA 4NAPA 1FBEA 1B0HA 5TU0A 5AA2B 3ONMA 4LN5A 3K0VA 2VD3A 3JZJA 2B3BA 3C33A 4NF6B 3SEVA 2WOKA 4N8YA 2WX9A 4Q8RA 1PEBA 1SBPA 1BP5A 1LFIA 1ATGA 1N0TA 1H76A 4IB2A 1R9QA 2UVHA 1B7UA 2Y5KA 3PUVE 3MVYA 4Z0IA 4R6HA 4FEBA 1B1XA 4MBPA 5LOMA 2WKYA 3PU5A 3KJ7A 1DMBA 1FTAA 4DDDA 3LV0A 1JETA 2XXXA 4YU0A 4H1XA 1UIUA 4L17A 1IIWA 4P11A 5ITOA 5L9MA 1RYOA 3IAZA 1B4HA 4JXIA 1SQYA 3S9NC 3U1OA 1LCTA 2XWKA 3C31A 4H0WA 2OWSA 1SPIA 5I56A 1IITA 1UTHA 3MPLA 3ROJA 2D5WA 5H8HB 4GWSA 4PFRA 4BDQA 2GRVA 4DXCA 3CFZA 3MC2A 3TQLA 5KZTA 2F34A 3VLUA 2V3UA 1UTBA 4G77A 3A3UA 4R6YA 3TCGA 4P47A 2D21A 2CZKA 4P1EA 3OO9A 2F7BA 3THIA 1Y3PA 5CMCA 3FVNA 4QF9A 2HCAA 1K9YA 3E4RA 1TFAA 2KR0A 4NF6A 2Q2CA 3KN7A 1NV4A 3HHGA 3T22A 5JEIA 1CNQA 2ZMBA 2I6EA 2XWIA 4IY6A 3M3LA 5DW8A 1P1NA 5ET5A 4YKIA 2VGQA 3TUSA 1CE2A 1A8FA 3H6VA 5KCJB 1UTBB 2F97A 2REGA 5CMBA 5L9SA 5LTCA 3T93B 2R9JA 3OD7A 3QIMA 3KOSA 1MG1A 4H65A 3P7IA 3TDJA 2XXYA 2Y7IA 4G8HA 2Z8FA 5FHMA 1IXGA 2IA4A 4XIGQ 1A54A 4U23A 4MNPA 2FNCA 1B05A 1FTJA 2ZYOA 1YTVA 5K2YA 3VFJA 2KQZA 1D9QA 2DVCA 4QSDA 2DSFA 1FPGA 4PE5B 1XHYA 2O51A 1MY0A 1USYE 2O1MA 5LDZA 1B4ZA 3U93A 1M5EA 4OVQA 4LZ8A 3H3GA 2DWJA 1SW1A 2GHBA 2Q89A 4I1DA 4YB7A 3TODA 4G68A 3FXUA 4IO4A 2RF1A 3B50A 4OVRA 4MF3A 2ZXTA 1FRPA 3A09A 1B40A 2DE3A 3OELA 2P2AA 3PAMA 4BDMA 1NV3A 1QGXA 1N3WA 4R2BA 3I6VA 3QAXA 3HFUA 4DZ1A 3TEPA 4YZZA 3SDFA 3PMXA 4GOTA 3K00A 1IMBA 1H45A 2XA5A 5ISUA 3FD3A 1SW2A 5J1DA 3BFUA 1IXIA 2AL4A 4KQPA 5IZ3A 3S9MC 1B52A 5FTIA 4Q0CA 5I56B 4HS7A 2XD3A 4JSOA 2RCAA 1VR5A 2F8DA 4F3SA 1SD3A 4IO6A 2WBBA 1MXYA 4ECFA 5ICQA 4UACA 1FPEA 4PAKA 2HZKA 4NF0A 4H67A 3OOAA 2FHYA 1IMEA 5I57A 4PETA 5IKBA 1A7LA 2XD2A 1EYKA 1VDWA 5CRYA 3MP6A 1H43A 4N91A 4N6DA 2H4IA 4N13A 1DBZA 4M1VA 1IMDA 3O6HA 5EHMA 5EYFA 2I0CA 1POY1 2UXAA 4U2RA 4E0XA 5I2NA 4ELRA 2XX7A 3H6WA 2F35A 3Q25A 3DRFA 1VE4A 3EPEA 4BLAA 4GWXA 4GIZA 5H8FB 2VD2A 1N7XA 3UN6A 1QKAA 1Q9DA 2GH9A 4ELPA 1NNKA 2REJA 2CEYA 4OVSA 2L5VA 2WOLA 1OQHA 4H5GA 3VV5A 4DE8A 2MKZA 2ZZXA 1N7WA 4YB6A 1LBZA 3PV0E 3H7MA 3IL1B 4RY1A 3FVOA 1D3KA 4F3BA 3OXNA 3MBPA 1FBCA 3B8BA 5IZ3B 3KJTA 3TQWA 4H45A 4PFTA 1LB9A 3CIJA 1I6QA 3G3KA 4GWWA 4JVDA 3OO7A 1MDQA 4GLIA 3I3VA 2G29A 1G0IA 3M3KA 1FSAA 2JJKA 1FBHA 3N5LA 3O2AA 2Z23A 2RC9A 5I2KA 3IB0A 4KFQA 4ZEDA 2XXIA 3UORA 2YJPA 4Z7EA 4LA9A 2Q88A 5I7IA 3O66A 3PPPA 4EXLA 2ZNTA 2PYYA 3O29A 3ECRA 3MVXA 1EYJA 3BBRA 3QMFA 4QFKA 1B3FA 3O6GA 1INPA 3FBPA 4U4SA 1MH4A 2A5TA 1B5HA 3RQTA 1JW5A 1M5FA 4PFYA 2ZZVA 1LBCA 1P1WA 1MY3A 1P1QA 4N07A 4N6PA 3T0JA 2H5YA 2Z8DA 5TP9B 3KN8A 3KG2A 4QFLA 2B65A 5K2XA 3PMWA 4G4PA 4O3BA 1MPDA 4OZ9A 1JW4A 3M8UA 1Y1ZA 4GWOA 1NV2A 2M8CA 1P99A 3IFCA 3FVGA 4GXAA 3V83A 4QHQA 2CEXA 2ONKE 2DP8A 3KC0A 2Y7PA 5CC2A 3H03A 3D1RA 2XXQA 1VFDA 1Z7NE 1XOCA 3D4GA 2PCRA 2QVVA 3RNNA 1G0HA 2DWHA 2F7AA 4MLQA 4FECA 1KA0A 1LB8A 1USYH 1NUXA 1AH5A 2QS3A 4BDOA 3C35A 4FBPA 3C36A 1ANFA 3DRJA 3TELA 2W7YA 1BLFA 4QFNA 4JVIA 3OENA 1SW5A 4WEPA 4N17A 1NV0A 3IJOB 2F3BA 4H6DA 2B3FA 1UIVA 4MEVA 3N94A 4NHBA 3R6UA 2F78A 3U72A 3DP8A 1HSJA 4MIJA 4P56A 3ISPA 3PUZE 4RK2A 2FIXA 3B6TA 2RINA 4EF2A 4OVTA 1VFEA 5I84A 3HSTA 1LBXA 4UA8A 4F1YA 4OFLA 3N26A 1FPFA 1FPIA 1DSNA 3KOTA 3K1PA 2LAOA 3FXBA 1LFHA 3VXCA 1B1HA 1WODA 4N81A 1I69A 4NF4A 1MXUA 2X26A 4R9GA 4BDNA 4GVOA 4P3LA 3VLVA 5J16A 1ZTYA 4P1LA 1PB7A 2XX9A 4OHNA 4JBZA 3K02A 2ONSA 3RT8A 1DTGA 3E13X 5FTHA 1TFDA 1FBPA 2V25A 2ESNA 3IR1A 4F3PA 3IO4A 3PD9A 4PGPA 2XX8A 2WBDA 2ZZWA 1LLSA 4X48A 3O6PA 2DDKA 1SVXB 3H6TA 4P0IA 3GLBA 2Y7WA 5B70A 1OLCA 4XF5A 5EHSA 2RCBA 4IO5A 3FVKA 4PAIA 1Y9UA 1PDAA 1NNFA 5IGAA 5CMKA 1IQ7A 1B0LA 4PFIA 2PBWA 2QFLA 4PTKA 4WEDA 3E79A 1BK4A 1JVXA 4WXJA 4KXPA 5M2VA 2Q8JA 3H4ZA 4HCYA 3C34A 4IO2A 5ESYA 3MSTA 4XXUA 1A55A 1O7TA 3M3FA 1QJMA 1F9BA 2QSXA 3K6XA 1OVTA 3JYRA 3GZGA 3V5AA 3CFLA 2PVUA 1LGBC 1AIVA 2DE2A 3OMBA 4XTCQ 2AIXA 4NEDA 4OEUA 3IB2A 4ZZAA 4ESXA 1US5A 4BDLA 4NF5B 4GF8A 3CVGA 3LUZA 5I3SA 1ZMGA 2F5XA 1FPDA 4OA4A 4K3FA 1B3GA 2HHMA 3LC8A 3HN0A 4X9TA 1NUZA 3IOWA 5CM6A 1XI6A 2ZYMA 3FUZA 4O3AA 2VT5A 1ZBMA 3TCHA 1VSOA
chains in the Genus database with same CATH topology
2RC7A 3RTFB 1LSTA 2XD2A 3LVUA 2HXWA 2HAVA 3TYHA 2HAUA 4JDFA 2PT1A 5BUUA 1ZIUA 1B5IA 1DTZA 5CRYA 2XXTA 3CFXA 3MP6A 4KD5A 4NF8A 1H43A 4C0RA 1NMUA 1FTOA 4RPOA 2H4IA 4IO7A 4N13A 4M1VA 4ZZEA 4ELOA 4GD5A 1SYHA 2H98A 1YAEA 1B6HA 3FTOA 4KYSA 4O3CA 1WDNA 3G3FA 3HHFA 3G3JA 3O6HA 3R7XA 5EHMA 4F18A 5AA1A 1S7YA 5I2KB 5EYFA 4AQ4A 2I4CA 2I0CA 2DYXA 3RT6B 1UQWA 1POY1 2QRYA 1HSLA 1OLAA 2UXAA 4U2RA 2XXRA 5DTBA 4E0XA 1QUJA 4JSDA 1I6BA 1NL5A 1Z7ME 3USDA 1QUIA 2XX7A 3H6WA 3HO7A 4JWYA 5ELVA 2F35A 3TTRA 4EDPA 1P1OA 5AA4A 4TQUQ 3Q25A 3DRFA 1VE4A 4GXSB 3EPEA 3AXFA 4R73A 1MDP1 4KCDA 4NF4B 4BLAA 4LZ7A 4GIZA 5F1QA 2O1LA 2QMXA 2XHDA 4GRKA 3TKDA 3DP4A 5H8FB 3LBSA 2VD2A 3LSLA 5I59B 4WKMA 5JK4A 4DIGA 5CMMA 3G3HA 3TZAA 1N7XA 2PMSA 2XXHA 3G3GA 3MWBA 3OO6A 5KDTB 2H9BA 3UN6A 1QKAA 1EZOA 4PFUA 3RY3A 2QJEA 4F1VA 2BJJX 4OENA 2X7PA 3ILUB 1LAGE 4MH5A 2DXRA 2GH9A 4IGTA 4YICA 4F39A 4ELRA 4OYVA 1J1NA 1BTJA 1PBPA 4ELPA 3MUQA 4OETA 3GBBA 4YKKA 1NNKA 2REJA 1LBBA 1ZKBA 2XXWA 2YPNA 3LUYA 5H8QA 5TPAB 1BIYA 4ZE8A 1D9YA 5DT6A 5F7VA 2WOLA 1GV8A 5I59A 2I49A 1OQHA 3FV2A 3E3KA 4H5GA 1H3DA 1OMPA 3VV5A 4DE8A 4F2QA 4NWDA 3K6WA 2HQ0A 3RGYA 3U94A 3QSLA 1N7WA 4YB6A 3FGSA 5H8QB 5TPAA 4I9DA 3PV0E 4KR5A 4ND9A 3T66A 1FQFA 1M5DA 3H7MA 3IL1B 4RY1A 1QW0A 4DXUA 3FVOA 4ZS9A 5CBSA 3CSBA 1L5TA 1D3KA 1OQGA 2PT2A 3OXNA 1YCJA 3MBPA 2R71A 4F3BA 1LAFE 1B5JA 5HBCA 3TQWA 3KJTA 1IUDA 3G3IA 3KZGA 3PPQA 4LQ2A 3S9LC 1MPCA 2V93A 1SI0A 3I5OA 3MZBA 4PFTA 3TCFA 1NH7A 1XC1A 2DQVA 3OO8A 4ZE9A 3D4CA 4M4GA 4YKPA 2HFBA 1M5CA 1N3XA 5KDTA 2A5TB 3GBAA 1LB9A 3CIJA 1ELJA 1IZ1A 1I6QA 1B2HA 1MXXA 3G3KA 3G7WA 5AE4A 3FATA 1MY1A 1URSA 1MDQA 1GGGA 3OO7A 4GLIA 2Z8EA 3EHTA 3I3VA 2G29A 3DP6A 3PMVA 3M3KA 1R9LA 2OWTA 3TAJA 4ISUA 2UYEA 3KSJA 4NWCA 1AMFA 3N5LA 1MQJA 3SEVA 3TFLA 1LAHE 3IOVA 1MXWA 2HEUA 3O2AA 5TP9A 4GQOA 4DCXA 1ZU0A 2Z23A 3SEYA 2RC9A 5I2KA 1FQEA 3IB0A 4KFQA 4EQBA 3KFMA 1O64A 4ZEDA 4KYEA 2I0BA 3S9EA 1CB6A 3LSXA 3W15C 4LVQA 4R75A 3VXBA 1LCFA 3FXQA 1P1UA 2XXIA 3DRGA 4H8JA 3UORA 3OEMA 3VVDA 4OFOA 1JVYA 3C32A 5H8NB 4OXVA 5HPQA 2DWIA 2YJPA 3DELB 4HCWA 3SEWA 4Z7EA 4LA9A 2UVIA 1HSEA 2GFEA 5I84A 3N6UA 1YPNA 3E9XA 2V84A 1MQIA 4RXLA 4F31B 1QUKA 1I6AA 1MY2A 5H8NA 3QK6A 2V3TA 3WAEA 2Q88A 3Q28A 4XKNA 3QUFA 1EZPA 1QULA 1PBQA 3O66A 3FJGA 5KCJA 3PPPA 4POWA 4OESA 1MQGA 3DLNA 4EXLA 2ZNTA 2PYYA 5AA2A 3O29A 3F11A 2O69A 4R9FA 1PB8A 3JV9A 4U1ZA 2YLNA 2CMOA 3K2DA 3ECRA 3K01A 3TMGA 1FQAA 3MVXA 1GR2A 2OCUA 3PPNA 4KCCA 4OMBA 4ELQA 3B6QA 2P0SA 4RJZA 4LQ5A 1ZJLA 1JNFA 3BBRA 1MM6A 4R72A 4X1BA 4DLDA 4R74A 1M5BA 3ODBA 4JWOA 3EQ1A 4QFKA 3RLFE 3CHGA 3S4UA 1B3FA 1B58A 1A8EA 3O6GA 3PUXE 4G8MA 2ZYKA 1IEJA 3TPAA 1EZ9A 4U4SA 1GTKA 1MH4A 2A5TA 1II5A 1B5HA 2DE4A 3IO6A 1QVSA 4I62A 3RQTA 1JW5A 4TLMB 3T9HB 1D9VA 1M5FA 4PFYA 4ONYA 2NXOA 1A40A 2ALUA 2O84X 3MP1A 1LBCA 2I3WA 1P1WA 1MY3A 3KBRA 1P1QA 4YMAA 5A5XB 1XVYA 4N07A 1DPEA 4EUOA 1FQBA 1US4A 4RA1A 3HV1A 1NKXA 4N6PA 1XS5A 1MS7A 2RKMA 2F7CA 2H5YA 1PB9A 5DVFA 1NFTA 2Z8DA 3MAMA 3ZKLA 5TP9B 3KN8A 4OVJA 3SERA 4YKJA 3K6VA 1B46A 1URGA 2F6PA 4U1OA 3TEPA 3KG2A 1T0KA 2DOJA 3HCQA 4QFLA 1TWYA 2B65A 2E1SA 3EF7A 3MJNA 3PMWA 4G4PA 4O3BA 5K2XA 3UA8A 1MPDA 4OZ9A 2ONRA 3KN3A 1B0HA 1MQDA 5TU0A 2XXUA 5AA2B 3O97A 1R1NA 3ONMA 3ZKKA 4F3GA 4TOZA 1JW4A 3DRIA 1H44A 1LFGA 4PP0A 3M8UA 4H5FA 1Y1ZA 4GWOA 4THIA 4EQ9A 3CRBA 3K0VA 2VD3A 3JZJA 1MH3A 4XKPA 2B3BA 2M8CA 1P99A 3C33A 4E0WA 4RYAA 2ZNUA 5L8DA 1POTA 4NF6B 4U22A 4GL8A 3FVGA 2H25A 4GXAA 3RYBA 2ZNSA 1WVJA 1B3HA 4QHQA 2WOKA 2ONKE 1SYIA 4RPNA 3SEUA 1MRPA 4AB6A 4NTLA 2FA7A 2DP8A 4OWDA 1PEBA 4Q8RA 2PX1A 1SBPA 5DEXA 3LSFB 4GFRA 1BP5A 1LFIA 3QYTA 2ZYNA 3Q26A 3UIFA 2QS1A 1ATGA 2Y7PA 3H03A 3IK6B 5CC2A 1H76A 1N0TA 3U92A 1R9QA 2XXQA 1VFDA 1Z7NE 1XOCA 1B7UA 2UVHA 3D4GA 3EHSA 4IB2A 3VDFA 2I48A 3PGFA 3PUVE 5BWJA 3CG1A 3MVYA 4Z0IA 4R6HA 2QMWA 1B9JA 3R26A 4FEBA 1B1XA 3RNNA 4MBPA 5LOMA 3WAFA 4PQJA 5ITPA 1RYXA 2DWHA 2WKYA 1FCKA 3PU5A 2G93A 3KJ7A 2F7AA 4MLQA 1DMBA 3B6WA 4DDDA 4FECA 1MXVA 4R2FA 1LB8A 1USYH 3O6IA 1AH5A 1URDA 3RTWB 1JETA 2QS3A 2XXXA 3IJXB 4YU0A 2UYFA 3C35A 4BDOA 5I2NA 1A99A 1B3EA 4H1XA 2NVUB 1UIUA 3IB1A 3QUJA 4ZDMA 3MVWA 2Y7RA 3U8QA 3O28A 3C36A 5AA4B 4L17A 1ANFA 3DRJA 4QFOA 3V8XB 4TLLB 5DYHA 1IIWA 4P11A 3TELA 4C1TA 5ITOA 4F19A 4F29A 1Y3NA 5L9MA 3T96B 2W7YA 1MPBA 2DWAA 1BLFA 2ABHA 1RYOA 4QFNA 3IAZA 1B4HA 4JXIA 1SQYA 2NWJA 3W9VA 4F2OA 3S9NC 3U1OA 1B51A 4EF1A 3OENA 4ZEBA 1LCTA 3VLWA 3C31A 1SW5A 3Q27A 4H0WA 3C9HA 4WEPA 1MXZA 2OWSA 3TTLA 2CZLA 4U4XA 5CI5A 5I56A 3IJOB 1IITA 1UTHA 3MPLA 4I8CA 2D5WA 3V89B 2Z22A 3RN8A 3SESA 4EQ7A 4NF8B 5H8HB 4NE4A 2KLFA 4BDQA 2IEEA 2GRVA 4FE8A 4NF5A 2QPQA 2I58A 1Y1MA 1UIVA 2B3FA 4H6DA 4DXCA 2V3QA 3CFZA 1FQDA 3MC2A 3N94A 3R6UA 2F78A 3RPWA 5KZTA 2H99A 2F34A 2XXPA 1MQHA 4LZ5A 3U72A 4OFJA 3VLUA 2P1SA 4HTGA 4ESWA 1Y20A 1Q1KA 2V3UA 4LATA 4Q5TA 2Q2AA 3DP8A 1UTBA 1LAXA 4OTEA 1D4NA 3DRHA 1HSJA 3A3UA 3N6TA 4G77A 4R6YA 4QSEA 3TCGA 3PUZE 2B4LA 5B7DA 4RK2A 3T9UA 3IX1A 2D21A 3FASA 1B7HA 3B6TA 2RINA 1ZLQA 3OO9A 4EF2A 3SETA 3VVFA 3ZSFA 2F7BA 1VFEA 1Y4CA 3MQ9A 1Y3PA 5CMCA 3THIA 3BFTA 3FIRA 3FVNA 3Q29A 2HCAA 2Y84A 4QF9A 3HSTA 1R6ZA 4KYDA 3E4RA 1TFAA 4UA8A 4F1YA 4OFLA 3N26A 1AIVA 1DSNA 1FTKA 4FORA 3KOTA 3K1PA 3CR9A 4NF6A 4R6KA 2Q2CA 3KN7A 2LAOA 3PD8A 1LFHA 2OBGA 4PFWA 5H8SA 1B1HA 3VXCA 1WODA 2UVJA 2QS4A 4OERA 1I69A 3HHGA 4NF4A 4NMYA 1MXUA 4KPTA 2X26A 5FHNA 3T22A 5JEIA 4R9GA 4BDNA 4G8NA 1QKBA 4GVOA 5DVJA 4FEDA 4G68B 2ZMBA 4MFIA 4ZEIA 2I6EA 4IY6A 1ZTYA 4QSCA 3VLVA 2OLBA 3M3LA 1PB7A 2XX9A 4KHZE 4OHNA 1P1NA 2THIA 1AL3A 4JBZA 4LONB 4YKIA 5DVIA 2VGQA 3K02A 2ONSA 3DM0A 1Q35A 5I58A 3TUSA 1DOTA 1CE2A 4FJPA 4G2ZA 3RT8A 1JW1A 3EHUA 4XKRA 1A8FA 3H6VA 5KCJB 1UTBB 1DTGA 2E0SA 2F97A 1JQFA 2REGA 3E13X 3L6GA 5DEXB 5CMBA 1TFDA 5FTHA 1NH8A 5L9SA 3ILTB 3T93B 2AYSA 5FHOA 4EXKA 3K1NA 2V25A 4ZEKA 3PUYE 4IO3A 4JWXA 2ESNA 2R9JA 3IR1A 3OD7A 3QIMA 3KOSA 3OEKA 1MG1A 2NUVA 3K1MA 4F1UA 4F3PA 4H65A 3P7IA 4HW8A 3IO4A 5H8HA 1N04A 3TTKA 3PD9A 1DPPA 3TDJA 3UK4A 2I4BA 2XXYA 2Y7IA 3FJ7A 3FXRA 4G68C 4G8HA 1SI1A 2Z8FA 1KWHA 5FHMA 2XX8A 2O68A 1IXGA 2IA4A 2B4MA 4LUBA 2O6AA 1A54A 3PPRA 4U23A 4XIGQ 1LLSA 2NOOA 1B05A 2FNCA 2VHAA 4X48A 1FTJA 2ZYOA 1YTVA 5K2YA 2FYIA 1EU8A 4FATA 3W9WA 3VFJA 3O6PA 1FW0A 4OQOA 3H6TA 1SVXB 2DVCA 1Y4TA 4P0IA 3GLBA 4QSDA 2Y7WA 5B70A 1OLCA 2DSFA 4U21A 3KEIA 4PE5B 1XHYA 5EHSA 1FTLA 2O51A 2OJTA 4YAHX 5AA2D 2RCBA 4IO5A 4DCYA 2X7QA 1SDXA 3FVKA 1RKMA 1Y9UA 3LSWA 3TTMA 3SEXA 1OIBA 1PDAA 2DXYA 4MLVA 1NNFA 4QRZA 5CMKA 4XKQA 4BDRA 1MY0A 1USYE 2O1MA 2OK2A 1IQ7A 1B0LA 1B4ZA 3MPKA 4LP2B 2PBWA 3U93A 3VE1B 1FTMA 5H8FA 2O7UA 1M5EA 4WEDA 1Y3QA 3TTNA 4LZ8A 3FZVA 2ANJA 4FAJA 1B32A 5IAIA 2R6GE 3EN3A 2WOPA 5AA3A 3OSQA 2O7IA 1JVXA 2QL3A 5I58B 3C4MA 3H3GA 2DWJA 1N84A 1SW1A 4WXJA 1TT1A 2I3VA 3H06B 2GHBA 2Q89A 3KSXA 4KI0E 1XVXA 2QS2A 4I1DA 4X1DA 3UP9A 1GVCA 4YB7A 3TODA 4PETA 3DRKA 2F36A 4G68A 4AB5A 1FQCA 3FXUA 5M2VA 2Q8JA 2DS9A 4IO4A 2RF1A 4Q30B 3T9XB 3MZ9A 3H4ZA 1JEUA 4YMBA 4MF3A 4RK9A 1SW4A 1TXFA 4HCYA 4QFPA 3MP8A 3C34A 3KGCA 4IO2A 3IOTA 2ZXTA 3A09A 1B40A 1IXCA 1AOVA 1O63A 2DE3A 4XXUA 4C1UA 5I57B 4IGRA 1A55A 1S50A 1BKAA 1O7TA 3M3FA 3OSRA 1QJMA 3OELA 2P2AA 1F9BA 5L9OA 2QSXA 3K6XA 3PAMA 1OVTA 4ZEFA 5CBRA 2RC8A 5I2NB 3ZS6A 4BDMA 4FIMA 1N3WA 4R2BA 3PUWE 3JYRA 3I6VA 4DXBA 3GZGA 4YB5A 3V5AA 2UVGA 3CFLA 1XT8A 3PPOA 3QAXA 2PVUA 3HPIA 4JB7A 1LGBC 4F22A 3MW0A 2DE2A 3K4UA 3CG3A 4POXA 3SKPA 4DZ1A 3OMBA 4XTCQ 1MM7A 3LR1A 2OZZA 4YZZA 2AIXA 3PMXA 4GOTA 4OEUA 3K00A 4NEDA 3SDFA 3IB2A 1H45A 1JEVA 1MY4A 5ICTA 4OEVA 5ISUA 3FD3A 1SW2A 2D3IA 5J1DA 3BFUA 1IXIA 2AL4A 4IY5A 4KQPA 5A5XA 2DVZA 1NNPA 4ZZAA 1B7ZA 5JTYB 3A3CA 4ESXA 4H8IA 2XXVA 1US5A 3O9PA 4BDLA 2GHAA 4NF5B 4GF8A 3S9MC 3MZ1A 4P0GA 1B52A 5FTIA 3CVGA 3QXMA 4GL0A 4Q0CA 2A5SA 1ZMGA 2F5XA 5JTYA 3B7DA 5I56B 4HS7A 2XD3A 1EH3A 4JSOA 2RCAA 1VR5A 4K3FA 1UTHB 3TQLA 1B3GA 3MVZA 2F8DA 3GXAA 3H6UA 3L6HA 3LC8A 4F3SA 1SD3A 3K6UA 1N76A 2AL5A 4IO6A 5HM4B 3FJMA 4ZECA 1S9TA 1IXHA 3CI8A 1B3LA 3RUMA 1MXYA 3HN0A 4ECFA 2F6GA 3S2VA 4X9TA 5ICQA 2Y7KA 2VOZA 3BKIB 3RYAA 3T9VA 4UACA 3FV1A 3IOWA 5CM6A 3UGWA 4RNSA 2ZYMA 2HZKA 2HZLA 3FUZA 4H67A 3OOAA 4O3AA 3V83A 1PC3A 2VP1A 3VVEA 3IORA 2Q9TA 1ZBMA 1NNTA 5I57A 3TCHA 3IOUA 1VSOA 5IKBA 3CSGA 1A7LA 1OVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RC7 A;  3RTF B;  1LST A;  2XD2 A;  3LVU A;  2HXW A;  2HAV A;  3TYH A;  2HAU A;  4JDF A;  2PT1 A;  5BUU A;  1ZIU A;  1B5I A;  1DTZ A;  5CRY A;  2XXT A;  3CFX A;  3MP6 A;  4KD5 A;  4NF8 A;  1H43 A;  4C0R A;  1NMU A;  1FTO A;  4RPO A;  2H4I A;  4IO7 A;  4N13 A;  4M1V A;  4ZZE A;  4ELO A;  4GD5 A;  1SYH A;  2H98 A;  1YAE A;  1B6H A;  3FTO A;  4KYS A;  4O3C A;  1WDN A;  3G3F A;  3HHF A;  3G3J A;  3O6H A;  3R7X A;  5EHM A;  4F18 A;  5AA1 A;  1S7Y A;  5I2K B;  5EYF A;  4AQ4 A;  2I4C A;  2I0C A;  2DYX A;  3RT6 B;  1UQW A;  1POY 1;  2QRY A;  1HSL A;  1OLA A;  2UXA A;  4U2R A;  2XXR A;  5DTB A;  4E0X A;  1QUJ A;  4JSD A;  1I6B A;  1NL5 A;  1Z7M E;  3USD A;  1QUI A;  2XX7 A;  3H6W A;  3HO7 A;  4JWY A;  5ELV A;  2F35 A;  3TTR A;  4EDP A;  1P1O A;  5AA4 A;  4TQU Q;  3Q25 A;  3DRF A;  1VE4 A;  4GXS B;  3EPE A;  3AXF A;  4R73 A;  1MDP 1;  4KCD A;  4NF4 B;  4BLA A;  4LZ7 A;  4GIZ A;  5F1Q A;  2O1L A;  2QMX A;  2XHD A;  4GRK A;  3TKD A;  3DP4 A;  5H8F B;  3LBS A;  2VD2 A;  3LSL A;  5I59 B;  4WKM A;  5JK4 A;  4DIG A;  5CMM A;  3G3H A;  3TZA A;  1N7X A;  2PMS A;  2XXH A;  3G3G A;  3MWB A;  3OO6 A;  5KDT B;  2H9B A;  3UN6 A;  1QKA A;  1EZO A;  4PFU A;  3RY3 A;  2QJE A;  4F1V A;  2BJJ X;  4OEN A;  2X7P A;  3ILU B;  1LAG E;  4MH5 A;  2DXR A;  2GH9 A;  4IGT A;  4YIC A;  4F39 A;  4ELR A;  4OYV A;  1J1N A;  1BTJ A;  1PBP A;  4ELP A;  3MUQ A;  4OET A;  3GBB A;  4YKK A;  1NNK A;  2REJ A;  1LBB A;  1ZKB A;  2XXW A;  2YPN A;  3LUY A;  5H8Q A;  5TPA B;  1BIY A;  4ZE8 A;  1D9Y A;  5DT6 A;  5F7V A;  2WOL A;  1GV8 A;  5I59 A;  2I49 A;  1OQH A;  3FV2 A;  3E3K A;  4H5G A;  1H3D A;  1OMP A;  3VV5 A;  4DE8 A;  4F2Q A;  4NWD A;  3K6W A;  2HQ0 A;  3RGY A;  3U94 A;  3QSL A;  1N7W A;  4YB6 A;  3FGS A;  5H8Q B;  5TPA A;  4I9D A;  3PV0 E;  4KR5 A;  4ND9 A;  3T66 A;  1FQF A;  1M5D A;  3H7M A;  3IL1 B;  4RY1 A;  1QW0 A;  4DXU A;  3FVO A;  4ZS9 A;  5CBS A;  3CSB A;  1L5T A;  1D3K A;  1OQG A;  2PT2 A;  3OXN A;  1YCJ A;  3MBP A;  2R71 A;  4F3B A;  1LAF E;  1B5J A;  5HBC A;  3TQW A;  3KJT A;  1IUD A;  3G3I A;  3KZG A;  3PPQ A;  4LQ2 A;  3S9L C;  1MPC A;  2V93 A;  1SI0 A;  3I5O A;  3MZB A;  4PFT A;  3TCF A;  1NH7 A;  1XC1 A;  2DQV A;  3OO8 A;  4ZE9 A;  3D4C A;  4M4G A;  4YKP A;  2HFB A;  1M5C A;  1N3X A;  5KDT A;  2A5T B;  3GBA A;  1LB9 A;  3CIJ A;  1ELJ A;  1IZ1 A;  1I6Q A;  1B2H A;  1MXX A;  3G3K A;  3G7W A;  5AE4 A;  3FAT A;  1MY1 A;  1URS A;  1MDQ A;  1GGG A;  3OO7 A;  4GLI A;  2Z8E A;  3EHT A;  3I3V A;  2G29 A;  3DP6 A;  3PMV A;  3M3K A;  1R9L A;  2OWT A;  3TAJ A;  4ISU A;  2UYE A;  3KSJ A;  4NWC A;  1AMF A;  3N5L A;  1MQJ A;  3SEV A;  3TFL A;  1LAH E;  3IOV A;  1MXW A;  2HEU A;  3O2A A;  5TP9 A;  4GQO A;  4DCX A;  1ZU0 A;  2Z23 A;  3SEY A;  2RC9 A;  5I2K A;  1FQE A;  3IB0 A;  4KFQ A;  4EQB A;  3KFM A;  1O64 A;  4ZED A;  4KYE A;  2I0B A;  3S9E A;  1CB6 A;  3LSX A;  3W15 C;  4LVQ A;  4R75 A;  3VXB A;  1LCF A;  3FXQ A;  1P1U A;  2XXI A;  3DRG A;  4H8J A;  3UOR A;  3OEM A;  3VVD A;  4OFO A;  1JVY A;  3C32 A;  5H8N B;  4OXV A;  5HPQ A;  2DWI A;  2YJP A;  3DEL B;  4HCW A;  3SEW A;  4Z7E A;  4LA9 A;  2UVI A;  1HSE A;  2GFE A;  5I84 A;  3N6U A;  1YPN A;  3E9X A;  2V84 A;  1MQI A;  4RXL A;  4F31 B;  1QUK A;  1I6A A;  1MY2 A;  5H8N A;  3QK6 A;  2V3T A;  3WAE A;  2Q88 A;  3Q28 A;  4XKN A;  3QUF A;  1EZP A;  1QUL A;  1PBQ A;  3O66 A;  3FJG A;  5KCJ A;  3PPP A;  4POW A;  4OES A;  1MQG A;  3DLN A;  4EXL A;  2ZNT A;  2PYY A;  5AA2 A;  3O29 A;  3F11 A;  2O69 A;  4R9F A;  1PB8 A;  3JV9 A;  4U1Z A;  2YLN A;  2CMO A;  3K2D A;  3ECR A;  3K01 A;  3TMG A;  1FQA A;  3MVX A;  1GR2 A;  2OCU A;  3PPN A;  4KCC A;  4OMB A;  4ELQ A;  3B6Q A;  2P0S A;  4RJZ A;  4LQ5 A;  1ZJL A;  1JNF A;  3BBR A;  1MM6 A;  4R72 A;  4X1B A;  4DLD A;  4R74 A;  1M5B A;  3ODB A;  4JWO A;  3EQ1 A;  4QFK A;  3RLF E;  3CHG A;  3S4U A;  1B3F A;  1B58 A;  1A8E A;  3O6G A;  3PUX E;  4G8M A;  2ZYK A;  1IEJ A;  3TPA A;  1EZ9 A;  4U4S A;  1GTK A;  1MH4 A;  2A5T A;  1II5 A;  1B5H A;  2DE4 A;  3IO6 A;  1QVS A;  4I62 A;  3RQT A;  1JW5 A;  4TLM B;  3T9H B;  1D9V A;  1M5F A;  4PFY A;  4ONY A;  2NXO A;  1A40 A;  2ALU A;  2O84 X;  3MP1 A;  1LBC A;  2I3W A;  1P1W A;  1MY3 A;  3KBR A;  1P1Q A;  4YMA A;  5A5X B;  1XVY A;  4N07 A;  1DPE A;  4EUO A;  1FQB A;  1US4 A;  4RA1 A;  3HV1 A;  1NKX A;  4N6P A;  1XS5 A;  1MS7 A;  2RKM A;  2F7C A;  2H5Y A;  1PB9 A;  5DVF A;  1NFT A;  2Z8D A;  3MAM A;  3ZKL A;  5TP9 B;  3KN8 A;  4OVJ A;  3SER A;  4YKJ A;  3K6V A;  1B46 A;  1URG A;  2F6P A;  4U1O A;  3TEP A;  3KG2 A;  1T0K A;  2DOJ A;  3HCQ A;  4QFL A;  1TWY A;  2B65 A;  2E1S A;  3EF7 A;  3MJN A;  3PMW A;  4G4P A;  4O3B A;  5K2X A;  3UA8 A;  1MPD A;  4OZ9 A;  2ONR A;  3KN3 A;  1B0H A;  1MQD A;  5TU0 A;  2XXU A;  5AA2 B;  3O97 A;  1R1N A;  3ONM A;  3ZKK A;  4F3G A;  4TOZ A;  1JW4 A;  3DRI A;  1H44 A;  1LFG A;  4PP0 A;  3M8U A;  4H5F A;  1Y1Z A;  4GWO A;  4THI A;  4EQ9 A;  3CRB A;  3K0V A;  2VD3 A;  3JZJ A;  1MH3 A;  4XKP A;  2B3B A;  2M8C A;  1P99 A;  3C33 A;  4E0W A;  4RYA A;  2ZNU A;  5L8D A;  1POT A;  4NF6 B;  4U22 A;  4GL8 A;  3FVG A;  2H25 A;  4GXA A;  3RYB A;  2ZNS A;  1WVJ A;  1B3H A;  4QHQ A;  2WOK A;  2ONK E;  1SYI A;  4RPN A;  3SEU A;  1MRP A;  4AB6 A;  4NTL A;  2FA7 A;  2DP8 A;  4OWD A;  1PEB A;  4Q8R A;  2PX1 A;  1SBP A;  5DEX A;  3LSF B;  4GFR A;  1BP5 A;  1LFI A;  3QYT A;  2ZYN A;  3Q26 A;  3UIF A;  2QS1 A;  1ATG A;  2Y7P A;  3H03 A;  3IK6 B;  5CC2 A;  1H76 A;  1N0T A;  3U92 A;  1R9Q A;  2XXQ A;  1VFD A;  1Z7N E;  1XOC A;  1B7U A;  2UVH A;  3D4G A;  3EHS A;  4IB2 A;  3VDF A;  2I48 A;  3PGF A;  3PUV E;  5BWJ A;  3CG1 A;  3MVY A;  4Z0I A;  4R6H A;  2QMW A;  1B9J A;  3R26 A;  4FEB A;  1B1X A;  3RNN A;  4MBP A;  5LOM A;  3WAF A;  4PQJ A;  5ITP A;  1RYX A;  2DWH A;  2WKY A;  1FCK A;  3PU5 A;  2G93 A;  3KJ7 A;  2F7A A;  4MLQ A;  1DMB A;  3B6W A;  4DDD A;  4FEC A;  1MXV A;  4R2F A;  1LB8 A;  1USY H;  3O6I A;  1AH5 A;  1URD A;  3RTW B;  1JET A;  2QS3 A;  2XXX A;  3IJX B;  4YU0 A;  2UYF A;  3C35 A;  4BDO A;  5I2N A;  1A99 A;  1B3E A;  4H1X A;  2NVU B;  1UIU A;  3IB1 A;  3QUJ A;  4ZDM A;  3MVW A;  2Y7R A;  3U8Q A;  3O28 A;  3C36 A;  5AA4 B;  4L17 A;  1ANF A;  3DRJ A;  4QFO A;  3V8X B;  4TLL B;  5DYH A;  1IIW A;  4P11 A;  3TEL A;  4C1T A;  5ITO A;  4F19 A;  4F29 A;  1Y3N A;  5L9M A;  3T96 B;  2W7Y A;  1MPB A;  2DWA A;  1BLF A;  2ABH A;  1RYO A;  4QFN A;  3IAZ A;  1B4H A;  4JXI A;  1SQY A;  2NWJ A;  3W9V A;  4F2O A;  3S9N C;  3U1O A;  1B51 A;  4EF1 A;  3OEN A;  4ZEB A;  1LCT A;  3VLW A;  3C31 A;  1SW5 A;  3Q27 A;  4H0W A;  3C9H A;  4WEP A;  1MXZ A;  2OWS A;  3TTL A;  2CZL A;  4U4X A;  5CI5 A;  5I56 A;  3IJO B;  1IIT A;  1UTH A;  3MPL A;  4I8C A;  2D5W A;  3V89 B;  2Z22 A;  3RN8 A;  3SES A;  4EQ7 A;  4NF8 B;  5H8H B;  4NE4 A;  2KLF A;  4BDQ A;  2IEE A;  2GRV A;  4FE8 A;  4NF5 A;  2QPQ A;  2I58 A;  1Y1M A;  1UIV A;  2B3F A;  4H6D A;  4DXC A;  2V3Q A;  3CFZ A;  1FQD A;  3MC2 A;  3N94 A;  3R6U A;  2F78 A;  3RPW A;  5KZT A;  2H99 A;  2F34 A;  2XXP A;  1MQH A;  4LZ5 A;  3U72 A;  4OFJ A;  3VLU A;  2P1S A;  4HTG A;  4ESW A;  1Y20 A;  1Q1K A;  2V3U A;  4LAT A;  4Q5T A;  2Q2A A;  3DP8 A;  1UTB A;  1LAX A;  4OTE A;  1D4N A;  3DRH A;  1HSJ A;  3A3U A;  3N6T A;  4G77 A;  4R6Y A;  4QSE A;  3TCG A;  3PUZ E;  2B4L A;  5B7D A;  4RK2 A;  3T9U A;  3IX1 A;  2D21 A;  3FAS A;  1B7H A;  3B6T A;  2RIN A;  1ZLQ A;  3OO9 A;  4EF2 A;  3SET A;  3VVF A;  3ZSF A;  2F7B A;  1VFE A;  1Y4C A;  3MQ9 A;  1Y3P A;  5CMC A;  3THI A;  3BFT A;  3FIR A;  3FVN A;  3Q29 A;  2HCA A;  2Y84 A;  4QF9 A;  3HST A;  1R6Z A;  4KYD A;  3E4R A;  1TFA A;  4UA8 A;  4F1Y A;  4OFL A;  3N26 A;  1AIV A;  1DSN A;  1FTK A;  4FOR A;  3KOT A;  3K1P A;  3CR9 A;  4NF6 A;  4R6K A;  2Q2C A;  3KN7 A;  2LAO A;  3PD8 A;  1LFH A;  2OBG A;  4PFW A;  5H8S A;  1B1H A;  3VXC A;  1WOD A;  2UVJ A;  2QS4 A;  4OER A;  1I69 A;  3HHG A;  4NF4 A;  4NMY A;  1MXU A;  4KPT A;  2X26 A;  5FHN A;  3T22 A;  5JEI A;  4R9G A;  4BDN A;  4G8N A;  1QKB A;  4GVO A;  5DVJ A;  4FED A;  4G68 B;  2ZMB A;  4MFI A;  4ZEI A;  2I6E A;  4IY6 A;  1ZTY A;  4QSC A;  3VLV A;  2OLB A;  3M3L A;  1PB7 A;  2XX9 A;  4KHZ E;  4OHN A;  1P1N A;  2THI A;  1AL3 A;  4JBZ A;  4LON B;  4YKI A;  5DVI A;  2VGQ A;  3K02 A;  2ONS A;  3DM0 A;  1Q35 A;  5I58 A;  3TUS A;  1DOT A;  1CE2 A;  4FJP A;  4G2Z A;  3RT8 A;  1JW1 A;  3EHU A;  4XKR A;  1A8F A;  3H6V A;  5KCJ B;  1UTB B;  1DTG A;  2E0S A;  2F97 A;  1JQF A;  2REG A;  3E13 X;  3L6G A;  5DEX B;  5CMB A;  1TFD A;  5FTH A;  1NH8 A;  5L9S A;  3ILT B;  3T93 B;  2AYS A;  5FHO A;  4EXK A;  3K1N A;  2V25 A;  4ZEK A;  3PUY E;  4IO3 A;  4JWX A;  2ESN A;  2R9J A;  3IR1 A;  3OD7 A;  3QIM A;  3KOS A;  3OEK A;  1MG1 A;  2NUV A;  3K1M A;  4F1U A;  4F3P A;  4H65 A;  3P7I A;  4HW8 A;  3IO4 A;  5H8H A;  1N04 A;  3TTK A;  3PD9 A;  1DPP A;  3TDJ A;  3UK4 A;  2I4B A;  2XXY A;  2Y7I A;  3FJ7 A;  3FXR A;  4G68 C;  4G8H A;  1SI1 A;  2Z8F A;  1KWH A;  5FHM A;  2XX8 A;  2O68 A;  1IXG A;  2IA4 A;  2B4M A;  4LUB A;  2O6A A;  1A54 A;  3PPR A;  4U23 A;  4XIG Q;  1LLS A;  2NOO A;  1B05 A;  2FNC A;  2VHA A;  4X48 A;  1FTJ A;  2ZYO A;  1YTV A;  5K2Y A;  2FYI A;  1EU8 A;  4FAT A;  3W9W A;  3VFJ A;  3O6P A;  1FW0 A;  4OQO A;  3H6T A;  1SVX B;  2DVC A;  1Y4T A;  4P0I A;  3GLB A;  4QSD A;  2Y7W A;  5B70 A;  1OLC A;  2DSF A;  4U21 A;  3KEI A;  4PE5 B;  1XHY A;  5EHS A;  1FTL A;  2O51 A;  2OJT A;  4YAH X;  5AA2 D;  2RCB A;  4IO5 A;  4DCY A;  2X7Q A;  1SDX A;  3FVK A;  1RKM A;  1Y9U A;  3LSW A;  3TTM A;  3SEX A;  1OIB A;  1PDA A;  2DXY A;  4MLV A;  1NNF A;  4QRZ A;  5CMK A;  4XKQ A;  4BDR A;  1MY0 A;  1USY E;  2O1M A;  2OK2 A;  1IQ7 A;  1B0L A;  1B4Z A;  3MPK A;  4LP2 B;  2PBW A;  3U93 A;  3VE1 B;  1FTM A;  5H8F A;  2O7U A;  1M5E A;  4WED A;  1Y3Q A;  3TTN A;  4LZ8 A;  3FZV A;  2ANJ A;  4FAJ A;  1B32 A;  5IAI A;  2R6G E;  3EN3 A;  2WOP A;  5AA3 A;  3OSQ A;  2O7I A;  1JVX A;  2QL3 A;  5I58 B;  3C4M A;  3H3G A;  2DWJ A;  1N84 A;  1SW1 A;  4WXJ A;  1TT1 A;  2I3V A;  3H06 B;  2GHB A;  2Q89 A;  3KSX A;  4KI0 E;  1XVX A;  2QS2 A;  4I1D A;  4X1D A;  3UP9 A;  1GVC A;  4YB7 A;  3TOD A;  4PET A;  3DRK A;  2F36 A;  4G68 A;  4AB5 A;  1FQC A;  3FXU A;  5M2V A;  2Q8J A;  2DS9 A;  4IO4 A;  2RF1 A;  4Q30 B;  3T9X B;  3MZ9 A;  3H4Z A;  1JEU A;  4YMB A;  4MF3 A;  4RK9 A;  1SW4 A;  1TXF A;  4HCY A;  4QFP A;  3MP8 A;  3C34 A;  3KGC A;  4IO2 A;  3IOT A;  2ZXT A;  3A09 A;  1B40 A;  1IXC A;  1AOV A;  1O63 A;  2DE3 A;  4XXU A;  4C1U A;  5I57 B;  4IGR A;  1A55 A;  1S50 A;  1BKA A;  1O7T A;  3M3F A;  3OSR A;  1QJM A;  3OEL A;  2P2A A;  1F9B A;  5L9O A;  2QSX A;  3K6X A;  3PAM A;  1OVT A;  4ZEF A;  5CBR A;  2RC8 A;  5I2N B;  3ZS6 A;  4BDM A;  4FIM A;  1N3W A;  4R2B A;  3PUW E;  3JYR A;  3I6V A;  4DXB A;  3GZG A;  4YB5 A;  3V5A A;  2UVG A;  3CFL A;  1XT8 A;  3PPO A;  3QAX A;  2PVU A;  3HPI A;  4JB7 A;  1LGB C;  4F22 A;  3MW0 A;  2DE2 A;  3K4U A;  3CG3 A;  4POX A;  3SKP A;  4DZ1 A;  3OMB A;  4XTC Q;  1MM7 A;  3LR1 A;  2OZZ A;  4YZZ A;  2AIX A;  3PMX A;  4GOT A;  4OEU A;  3K00 A;  4NED A;  3SDF A;  3IB2 A;  1H45 A;  1JEV A;  1MY4 A;  5ICT A;  4OEV A;  5ISU A;  3FD3 A;  1SW2 A;  2D3I A;  5J1D A;  3BFU A;  1IXI A;  2AL4 A;  4IY5 A;  4KQP A;  5A5X A;  2DVZ A;  1NNP A;  4ZZA A;  1B7Z A;  5JTY B;  3A3C A;  4ESX A;  4H8I A;  2XXV A;  1US5 A;  3O9P A;  4BDL A;  2GHA A;  4NF5 B;  4GF8 A;  3S9M C;  3MZ1 A;  4P0G A;  1B52 A;  5FTI A;  3CVG A;  3QXM A;  4GL0 A;  4Q0C A;  2A5S A;  1ZMG A;  2F5X A;  5JTY A;  3B7D A;  5I56 B;  4HS7 A;  2XD3 A;  1EH3 A;  4JSO A;  2RCA A;  1VR5 A;  4K3F A;  1UTH B;  3TQL A;  1B3G A;  3MVZ A;  2F8D A;  3GXA A;  3H6U A;  3L6H A;  3LC8 A;  4F3S A;  1SD3 A;  3K6U A;  1N76 A;  2AL5 A;  4IO6 A;  5HM4 B;  3FJM A;  4ZEC A;  1S9T A;  1IXH A;  3CI8 A;  1B3L A;  3RUM A;  1MXY A;  3HN0 A;  4ECF A;  2F6G A;  3S2V A;  4X9T A;  5ICQ A;  2Y7K A;  2VOZ A;  3BKI B;  3RYA A;  3T9V A;  4UAC A;  3FV1 A;  3IOW A;  5CM6 A;  3UGW A;  4RNS A;  2ZYM A;  2HZK A;  2HZL A;  3FUZ A;  4H67 A;  3OOA A;  4O3A A;  3V83 A;  1PC3 A;  2VP1 A;  3VVE A;  3IOR A;  2Q9T A;  1ZBM A;  1NNT A;  5I57 A;  3TCH A;  3IOU A;  1VSO A;  5IKB A;  3CSG A;  1A7L A;  1OVB A; 
#chains in the Genus database with same CATH topology
 3LVU A;  2HXW A;  4GBW A;  2HAV A;  1FPL A;  1DCU A;  2XXT A;  4NF8 A;  1NMU A;  1FTO A;  4ELO A;  1SYH A;  1WDN A;  5I2K B;  2QRY A;  4JSD A;  4EDP A;  3HO7 A;  3AXF A;  2QMX A;  4WKM A;  4DIG A;  5CMM A;  3G3H A;  2FIE A;  2H9B A;  4F1V A;  2BJJ X;  2X7P A;  3ILU B;  1LAG E;  1LBY A;  4F39 A;  1BTJ A;  1PBP A;  4HE2 A;  3GBB A;  3LUY A;  2YPN A;  5I59 A;  1D9Y A;  3FV2 A;  1H3D A;  1OMP A;  2Y5L A;  3U94 A;  3QSL A;  1NI9 A;  5H8Q B;  5TPA A;  4KR5 A;  4DXU A;  1FPK A;  1B5J A;  1LAF E;  3G3I A;  3KZG A;  1MPC A;  3I5O A;  1SI0 A;  5JK4 A;  2DQV A;  4YKP A;  3D4C A;  1M5C A;  1N3X A;  4NN3 A;  1ELJ A;  1IZ1 A;  1B2H A;  1MY1 A;  1GGG A;  3DP6 A;  3PMV A;  4X04 A;  1R9L A;  2UYE A;  1MXW A;  5TP9 A;  4GQO A;  3SEY A;  3S9E A;  4KYE A;  2I0B A;  1CB6 A;  4PDD A;  4R75 A;  1LCF A;  3FXQ A;  3DRG A;  3VVD A;  4OFO A;  3C32 A;  5H8N B;  4OXV A;  3DEL B;  4HCW A;  1HSE A;  3N6U A;  3E9X A;  1MY2 A;  3WAE A;  1EZP A;  5KCJ A;  1NV7 A;  4POW A;  4OES A;  2O69 A;  1PB8 A;  2CMO A;  3K01 A;  1FQA A;  3B6Q A;  4RJZ A;  1ZJL A;  1MM6 A;  4X1B A;  4R74 A;  1M5B A;  1A8E A;  3PUX E;  1EZ9 A;  1GTK A;  4I62 A;  3T9H B;  2O84 X;  5I5P A;  2I3W A;  3KBR A;  4YMA A;  4OAN A;  5A5X B;  1XVY A;  1DPE A;  1US4 A;  1NKX A;  1LBW A;  1MS7 A;  2F7C A;  1PB9 A;  1NFT A;  3ZKL A;  4OVJ A;  1URG A;  2F6P A;  1T0K A;  3HCQ A;  3EF7 A;  2ONR A;  1MQD A;  1R1N A;  3ZKK A;  4OVP A;  3DRI A;  1LFG A;  2HXR A;  4PP0 A;  4H5F A;  4THI A;  5ET8 A;  1MH3 A;  4XKP A;  4E0W A;  4RYA A;  5L8D A;  4GL8 A;  4RPN A;  1WVJ A;  1B3H A;  1SYI A;  3SEU A;  1KZ8 A;  4OWD A;  2PX1 A;  5DEX A;  4GFR A;  4P8B A;  2ZYN A;  3Q26 A;  3UIF A;  2QS1 A;  3EHS A;  2I48 A;  3CG1 A;  2QMW A;  1B9J A;  3WAF A;  4PQJ A;  5ITP A;  2G93 A;  4O8M A;  3B6W A;  3O6I A;  3RTW B;  3IJX B;  2NVU B;  4ZDM A;  3QUJ A;  3MVW A;  3U8Q A;  1FBG A;  2PFY A;  2PFZ A;  1DK4 A;  4QFO A;  5DYH A;  4C1T A;  4F19 A;  3BIH A;  4DXB A;  1MPB A;  2DWA A;  2ABH A;  2NWJ A;  3W9V A;  1B51 A;  4EF1 A;  3VLW A;  3Q27 A;  1MXZ A;  3TTL A;  4U4X A;  3V89 B;  3SES A;  4EQ7 A;  4NF8 B;  4NE4 A;  4UAB A;  2QPQ A;  2V3Q A;  3RPW A;  2XXP A;  2H99 A;  5H8F A;  1MQH A;  4HTG A;  1Y20 A;  4LAT A;  2Q2A A;  4OTE A;  4I3E A;  3N6T A;  4GBV A;  5B7D A;  3T9U A;  4GWU A;  1B7H A;  1LBV A;  3VVF A;  3ZSF A;  3BFT A;  3Q29 A;  2Y84 A;  4NQ8 A;  4MX6 A;  3PD8 A;  2OBG A;  4PFW A;  5H8S A;  4OER A;  5FHN A;  4G8N A;  1QKB A;  5DVJ A;  4FED A;  4KHZ E;  4LON B;  2THI A;  1AL3 A;  5DVI A;  5I58 A;  3DM0 A;  1Q35 A;  1DOT A;  4GX6 A;  4GWZ A;  1JW1 A;  3EHU A;  2E0S A;  1JQF A;  5DEX B;  3ILT B;  4EXK A;  2AYS A;  4DI4 B;  3PUY E;  2Q8M A;  4F1U A;  4HW8 A;  1N04 A;  1DPP A;  2I4B A;  3FXR A;  1KWH A;  2O68 A;  4LUB A;  2B4M A;  1YXI A;  3PPR A;  2NOO A;  2VHA A;  4PBH A;  4FAT A;  1FW0 A;  4OQO A;  1Y4T A;  3KEI A;  2OJT A;  5AA2 D;  2X7Q A;  1SDX A;  3LSW A;  3BIG A;  3SEX A;  2DXY A;  2QVU A;  4QRZ A;  4BDR A;  3MPK A;  4LP2 B;  3VE1 B;  2O7U A;  1Y3Q A;  3TTN A;  2ANJ A;  4FAJ A;  5AA3 A;  3OSQ A;  3C4M A;  4AS5 A;  1FPJ A;  4X1D A;  3KSX A;  1XVX A;  2QS2 A;  1GVC A;  3DRK A;  2DS9 A;  1JEU A;  4YMB A;  4QFP A;  3MP8 A;  3IOT A;  1O63 A;  4C1U A;  4G61 A;  4IGR A;  4NG7 A;  5L9O A;  5A5L A;  5CBR A;  2RC8 A;  4PF8 A;  1NV1 A;  4F22 A;  3MW0 A;  3K4U A;  4ELQ A;  3CG3 A;  3SKP A;  1MM7 A;  4PFB A;  1MY4 A;  4GX3 A;  4OEV A;  1NV6 A;  2D3I A;  2DVZ A;  5JTY B;  1B7Z A;  3A3C A;  1NUY A;  2GHA A;  3MZ1 A;  4P0G A;  2WYP A;  4MCO A;  3QXM A;  4GL0 A;  2A5S A;  3B7D A;  3MVZ A;  3GXA A;  3H6U A;  5HM4 B;  3FJM A;  4ZEC A;  1S9T A;  5IZZ A;  3CI8 A;  3S2V A;  2VOZ A;  4RNS A;  1IMA A;  2HZL A;  4MJO A;  2VP1 A;  3VVE A;  2Q9T A;  1NNT A;  4N15 A;  1OVB A;  2RC7 A;  4X8R A;  3TYH A;  4JDF A;  4C0R A;  4KD5 A;  3CFX A;  4RPO A;  4ZZE A;  4N6K A;  4GD5 A;  1B6H A;  3FTO A;  4KYS A;  3R7X A;  3HHF A;  3G3J A;  4F18 A;  4PAF A;  4N4U A;  4AQ4 A;  5EQ9 A;  2I4C A;  2DYX A;  3RT6 B;  1HSL A;  2XXR A;  1QUJ A;  1NL5 A;  1Z7M E;  3PTY A;  4JWY A;  5ELV A;  3TTR A;  4QBA A;  1P1O A;  4TQU Q;  4N8G A;  4GXS B;  4R73 A;  1MDP 1;  4KCD A;  4NF4 B;  3LBS A;  3LSL A;  2PMS A;  2XXH A;  3OO6 A;  1EZO A;  4OEN A;  4MH5 A;  4IGT A;  4OYV A;  1J1N A;  3MUQ A;  4YKK A;  5H8Q A;  5TPA B;  1BIY A;  2I49 A;  4F2Q A;  3K6W A;  3RGY A;  5I59 B;  4I9D A;  3IFA A;  4ZS9 A;  5CBS A;  1OQG A;  5AA4 A;  2R71 A;  4LQ2 A;  2V93 A;  1XC1 A;  3MZB A;  3TCF A;  3OO8 A;  4M4G A;  5KDT A;  3GBA A;  2CZI A;  3G7W A;  1URS A;  3EHT A;  3KC1 A;  1LAH E;  3IOV A;  2HEU A;  1ZU0 A;  1FQE A;  4EQB A;  2R8T A;  3VXB A;  1P1U A;  4H8J A;  3OEM A;  1JVY A;  5HPQ A;  2DWI A;  3SEW A;  2UVI A;  4O7I A;  1MQI A;  4F31 B;  1QUK A;  1I6A A;  5H8N A;  2V3T A;  3Q28 A;  3QUF A;  1PBQ A;  3FJG A;  3NOH A;  2P3V A;  4R9F A;  3JV9 A;  4U1Z A;  4MNC A;  3TMG A;  1GR2 A;  3PPN A;  4KCC A;  4OMB A;  4HXV A;  1AWB A;  4LQ5 A;  1JNF A;  4I3Y A;  4PF6 A;  4DLD A;  4JWO A;  3S4U A;  2VPO A;  1IEJ A;  4JVC A;  1II5 A;  3IO6 A;  1QVS A;  1D9V A;  1A40 A;  3MP1 A;  2FVZ A;  1FQB A;  1XS5 A;  4PBQ A;  5DVF A;  3SER A;  3K6V A;  1FJ9 A;  2DOJ A;  1TWY A;  3MJN A;  3UA8 A;  5EYG A;  3KN3 A;  3E78 A;  2XXU A;  3O97 A;  4F3G A;  4QXD A;  4TOZ A;  1H44 A;  4EQ9 A;  3CRB A;  2XWO A;  1RDZ A;  4O94 A;  2ZNU A;  1POT A;  4U22 A;  2H25 A;  3USD A;  3RYB A;  2ZNS A;  1MRP A;  4AB6 A;  2OWZ A;  4NTL A;  2FA7 A;  3LSF B;  3QYT A;  5ET7 A;  3IK6 B;  3U92 A;  3EKI A;  3VDF A;  2FBP A;  3PGF A;  5BWJ A;  1NUW A;  3R26 A;  1RYX A;  1FCK A;  1MXV A;  4R2F A;  4PCD A;  1URD A;  2BJI A;  1EYI A;  2UYF A;  4XFE A;  1A99 A;  1B3E A;  3IB1 A;  2Y7R A;  3O28 A;  5AA4 B;  2CZH A;  2VPN A;  2Q74 A;  3V8X B;  4TLL B;  4F29 A;  5IZ1 A;  1Y3N A;  3T96 B;  4MAG A;  4NX1 A;  4F2O A;  1LEV A;  4MNI A;  4ZEB A;  3C9H A;  2CZL A;  5CI5 A;  3T1B A;  4I8C A;  2Z22 A;  3RN8 A;  2KLF A;  2IEE A;  4FE8 A;  4NF5 A;  2I58 A;  1Y1M A;  1FQD A;  4LZ5 A;  4ESW A;  4OFJ A;  2P1S A;  5EQ7 A;  1Q1K A;  4Q5T A;  1LAX A;  2WEF A;  1D4N A;  3DRH A;  4QSE A;  1RDY A;  2B4L A;  3IX1 A;  3FAS A;  1ZLQ A;  4NGU A;  3SET A;  1FJ6 A;  1Y4C A;  3MQ9 A;  1JP4 A;  3FIR A;  1R6Z A;  4KYD A;  4HE0 A;  3KBZ A;  1FTK A;  4FOR A;  3CR9 A;  4R6K A;  5F7V A;  4NMY A;  2UVJ A;  2QS4 A;  4KPT A;  4G68 B;  4MFI A;  4ZEI A;  4QSC A;  5IM2 A;  2OLB A;  4AS4 A;  2P3N A;  4FJP A;  4G2Z A;  1YZ0 A;  4XKR A;  3L6G A;  1FBF A;  1FPB A;  1NH8 A;  4P9K A;  5FHO A;  3K1N A;  4IO3 A;  4ZEK A;  4JWX A;  5FBP A;  3OEK A;  3K1M A;  2NUV A;  4DI3 D;  5H8H A;  3TTK A;  3UK4 A;  3FJ7 A;  4G68 C;  1SI1 A;  2F3D A;  2O6A A;  5ET6 A;  2FYI A;  1EU8 A;  3W9W A;  2OX3 A;  4U21 A;  1FTL A;  4YAH X;  3MYU A;  4DCY A;  1RKM A;  1RDX A;  3TTM A;  1OIB A;  4MLV A;  4XKQ A;  2OK2 A;  4HE1 A;  1FTM A;  4MMP A;  3GYY A;  3RPL A;  3FZV A;  1B32 A;  5IAI A;  2R6G E;  3EN3 A;  2WOP A;  5I58 B;  2O7I A;  2QL3 A;  1N84 A;  1TT1 A;  2I3V A;  3H06 B;  3UP9 A;  4KI0 E;  2F36 A;  4AB5 A;  1FQC A;  4O7M A;  4Q30 B;  3T9X B;  3MZ9 A;  4RK9 A;  1SW4 A;  1TXF A;  4GWY A;  3KGC A;  3RYD A;  1IXC A;  1AOV A;  5I57 B;  1S50 A;  2HPG A;  1BKA A;  3OSR A;  5EYH A;  2WYK A;  4ZEF A;  5I2N B;  3ZS6 A;  1K9Z A;  4FIM A;  3PUW E;  4YB5 A;  2UVG A;  1XT8 A;  3PPO A;  3HPI A;  4JB7 A;  4POX A;  1IMC A;  3LR1 A;  2OZZ A;  5ICT A;  1JEV A;  4IY5 A;  4XEQ A;  1NNP A;  1KA1 A;  4H8I A;  2XXV A;  3O9P A;  4IR8 A;  2QVR A;  5JTY A;  1EH3 A;  1UTH B;  3L6H A;  3K6U A;  4MHF A;  1N76 A;  2AL5 A;  1IXH A;  1B3L A;  3RUM A;  2F6G A;  2Y7K A;  3BKI B;  3RYA A;  3T9V A;  3FV1 A;  3UGW A;  1PC3 A;  3IOR A;  3IOU A;  3RLF E;  5A5X A;  3CSG A;  3RTF B;  1LST A;  2HAU A;  5BUU A;  2PT1 A;  1ZIU A;  1B5I A;  1DTZ A;  4IO7 A;  2H98 A;  3U65 A;  1YAE A;  4O3C A;  3G3F A;  5AA1 A;  1S7Y A;  1UQW A;  1OLA A;  5DTB A;  1I6B A;  1QUI A;  4H46 A;  4LZ7 A;  5F1Q A;  2O1L A;  2XHD A;  4GRK A;  3TKD A;  3DP4 A;  3TZA A;  5EQ8 A;  3G3G A;  3MWB A;  4PFU A;  3RY3 A;  2QJE A;  2DXR A;  4YIC A;  4OET A;  1LBB A;  1ZKB A;  2XXW A;  5EQA A;  4ZE8 A;  5DT6 A;  1GV8 A;  3A29 A;  3E3K A;  3RPL B;  4NWD A;  2HQ0 A;  3FGS A;  4ND9 A;  3SZP A;  3T66 A;  1FQF A;  1M5D A;  1QW0 A;  4PC9 A;  3CSB A;  1L5T A;  2PT2 A;  1YCJ A;  5KDT B;  5HBC A;  3PPQ A;  1IUD A;  3S9L C;  1NV5 A;  1NH7 A;  4ZE9 A;  2HFB A;  2A5T B;  2XWV A;  1MXX A;  5AE4 A;  3FAT A;  4GX4 A;  4PE3 A;  2Z8E A;  2OWT A;  3TAJ A;  4ISU A;  4NWC A;  3KSJ A;  3TFL A;  1AMF A;  1MQJ A;  4DCX A;  3KFM A;  1O64 A;  5T3J A;  3LSX A;  3W15 C;  4LVQ A;  1IMF A;  2GFE A;  1YPN A;  2V84 A;  4RXL A;  3QK6 A;  4XKN A;  1QUL A;  5AA2 A;  3DLN A;  1MQG A;  3F11 A;  2YLN A;  3K2D A;  2OCU A;  2P0S A;  4PGN A;  4R72 A;  5F24 A;  3ODB A;  3EQ1 A;  3CHG A;  1YYZ A;  2V4C A;  1B58 A;  4G8M A;  2ZYK A;  3TPA A;  4I40 A;  2GQ1 A;  4PDH A;  2DE4 A;  4TLM B;  4ONY A;  2NXO A;  2ALU A;  4EUO A;  4RA1 A;  3HV1 A;  1FBD A;  2RKM A;  3MAM A;  4YKJ A;  1B46 A;  4U1O A;  2E1S A;  2XXK A;  4NAP A;  1FBE A;  1B0H A;  5TU0 A;  5AA2 B;  3ONM A;  4LN5 A;  3K0V A;  2VD3 A;  3JZJ A;  2B3B A;  3C33 A;  4NF6 B;  3SEV A;  2WOK A;  4N8Y A;  2WX9 A;  4Q8R A;  1PEB A;  1SBP A;  1BP5 A;  1LFI A;  1ATG A;  1N0T A;  1H76 A;  4IB2 A;  1R9Q A;  2UVH A;  1B7U A;  2Y5K A;  3PUV E;  3MVY A;  4Z0I A;  4R6H A;  4FEB A;  1B1X A;  4MBP A;  5LOM A;  2WKY A;  3PU5 A;  3KJ7 A;  1DMB A;  1FTA A;  4DDD A;  3LV0 A;  1JET A;  2XXX A;  4YU0 A;  4H1X A;  1UIU A;  4L17 A;  1IIW A;  4P11 A;  5ITO A;  5L9M A;  1RYO A;  3IAZ A;  1B4H A;  4JXI A;  1SQY A;  3S9N C;  3U1O A;  1LCT A;  2XWK A;  3C31 A;  4H0W A;  2OWS A;  1SPI A;  5I56 A;  1IIT A;  1UTH A;  3MPL A;  3ROJ A;  2D5W A;  5H8H B;  4GWS A;  4PFR A;  4BDQ A;  2GRV A;  4DXC A;  3CFZ A;  3MC2 A;  3TQL A;  5KZT A;  2F34 A;  3VLU A;  2V3U A;  1UTB A;  4G77 A;  3A3U A;  4R6Y A;  3TCG A;  4P47 A;  2D21 A;  2CZK A;  4P1E A;  3OO9 A;  2F7B A;  3THI A;  1Y3P A;  5CMC A;  3FVN A;  4QF9 A;  2HCA A;  1K9Y A;  3E4R A;  1TFA A;  2KR0 A;  4NF6 A;  2Q2C A;  3KN7 A;  1NV4 A;  3HHG A;  3T22 A;  5JEI A;  1CNQ A;  2ZMB A;  2I6E A;  2XWI A;  4IY6 A;  3M3L A;  5DW8 A;  1P1N A;  5ET5 A;  4YKI A;  2VGQ A;  3TUS A;  1CE2 A;  1A8F A;  3H6V A;  5KCJ B;  1UTB B;  2F97 A;  2REG A;  5CMB A;  5L9S A;  5LTC A;  3T93 B;  2R9J A;  3OD7 A;  3QIM A;  3KOS A;  1MG1 A;  4H65 A;  3P7I A;  3TDJ A;  2XXY A;  2Y7I A;  4G8H A;  2Z8F A;  5FHM A;  1IXG A;  2IA4 A;  4XIG Q;  1A54 A;  4U23 A;  4MNP A;  2FNC A;  1B05 A;  1FTJ A;  2ZYO A;  1YTV A;  5K2Y A;  3VFJ A;  2KQZ A;  1D9Q A;  2DVC A;  4QSD A;  2DSF A;  1FPG A;  4PE5 B;  1XHY A;  2O51 A;  1MY0 A;  1USY E;  2O1M A;  5LDZ A;  1B4Z A;  3U93 A;  1M5E A;  4OVQ A;  4LZ8 A;  3H3G A;  2DWJ A;  1SW1 A;  2GHB A;  2Q89 A;  4I1D A;  4YB7 A;  3TOD A;  4G68 A;  3FXU A;  4IO4 A;  2RF1 A;  3B50 A;  4OVR A;  4MF3 A;  2ZXT A;  1FRP A;  3A09 A;  1B40 A;  2DE3 A;  3OEL A;  2P2A A;  3PAM A;  4BDM A;  1NV3 A;  1QGX A;  1N3W A;  4R2B A;  3I6V A;  3QAX A;  3HFU A;  4DZ1 A;  3TEP A;  4YZZ A;  3SDF A;  3PMX A;  4GOT A;  3K00 A;  1IMB A;  1H45 A;  2XA5 A;  5ISU A;  3FD3 A;  1SW2 A;  5J1D A;  3BFU A;  1IXI A;  2AL4 A;  4KQP A;  5IZ3 A;  3S9M C;  1B52 A;  5FTI A;  4Q0C A;  5I56 B;  4HS7 A;  2XD3 A;  4JSO A;  2RCA A;  1VR5 A;  2F8D A;  4F3S A;  1SD3 A;  4IO6 A;  2WBB A;  1MXY A;  4ECF A;  5ICQ A;  4UAC A;  1FPE A;  4PAK A;  2HZK A;  4NF0 A;  4H67 A;  3OOA A;  2FHY A;  1IME A;  5I57 A;  4PET A;  5IKB A;  1A7L A;  2XD2 A;  1EYK A;  1VDW A;  5CRY A;  3MP6 A;  1H43 A;  4N91 A;  4N6D A;  2H4I A;  4N13 A;  1DBZ A;  4M1V A;  1IMD A;  3O6H A;  5EHM A;  5EYF A;  2I0C A;  1POY 1;  2UXA A;  4U2R A;  4E0X A;  5I2N A;  4ELR A;  2XX7 A;  3H6W A;  2F35 A;  3Q25 A;  3DRF A;  1VE4 A;  3EPE A;  4BLA A;  4GWX A;  4GIZ A;  5H8F B;  2VD2 A;  1N7X A;  3UN6 A;  1QKA A;  1Q9D A;  2GH9 A;  4ELP A;  1NNK A;  2REJ A;  2CEY A;  4OVS A;  2L5V A;  2WOL A;  1OQH A;  4H5G A;  3VV5 A;  4DE8 A;  2MKZ A;  2ZZX A;  1N7W A;  4YB6 A;  1LBZ A;  3PV0 E;  3H7M A;  3IL1 B;  4RY1 A;  3FVO A;  1D3K A;  4F3B A;  3OXN A;  3MBP A;  1FBC A;  3B8B A;  5IZ3 B;  3KJT A;  3TQW A;  4H45 A;  4PFT A;  1LB9 A;  3CIJ A;  1I6Q A;  3G3K A;  4GWW A;  4JVD A;  3OO7 A;  1MDQ A;  4GLI A;  3I3V A;  2G29 A;  1G0I A;  3M3K A;  1FSA A;  2JJK A;  1FBH A;  3N5L A;  3O2A A;  2Z23 A;  2RC9 A;  5I2K A;  3IB0 A;  4KFQ A;  4ZED A;  2XXI A;  3UOR A;  2YJP A;  4Z7E A;  4LA9 A;  2Q88 A;  5I7I A;  3O66 A;  3PPP A;  4EXL A;  2ZNT A;  2PYY A;  3O29 A;  3ECR A;  3MVX A;  1EYJ A;  3BBR A;  3QMF A;  4QFK A;  1B3F A;  3O6G A;  1INP A;  3FBP A;  4U4S A;  1MH4 A;  2A5T A;  1B5H A;  3RQT A;  1JW5 A;  1M5F A;  4PFY A;  2ZZV A;  1LBC A;  1P1W A;  1MY3 A;  1P1Q A;  4N07 A;  4N6P A;  3T0J A;  2H5Y A;  2Z8D A;  5TP9 B;  3KN8 A;  3KG2 A;  4QFL A;  2B65 A;  5K2X A;  3PMW A;  4G4P A;  4O3B A;  1MPD A;  4OZ9 A;  1JW4 A;  3M8U A;  1Y1Z A;  4GWO A;  1NV2 A;  2M8C A;  1P99 A;  3IFC A;  3FVG A;  4GXA A;  3V83 A;  4QHQ A;  2CEX A;  2ONK E;  2DP8 A;  3KC0 A;  2Y7P A;  5CC2 A;  3H03 A;  3D1R A;  2XXQ A;  1VFD A;  1Z7N E;  1XOC A;  3D4G A;  2PCR A;  2QVV A;  3RNN A;  1G0H A;  2DWH A;  2F7A A;  4MLQ A;  4FEC A;  1KA0 A;  1LB8 A;  1USY H;  1NUX A;  1AH5 A;  2QS3 A;  4BDO A;  3C35 A;  4FBP A;  3C36 A;  1ANF A;  3DRJ A;  3TEL A;  2W7Y A;  1BLF A;  4QFN A;  4JVI A;  3OEN A;  1SW5 A;  4WEP A;  4N17 A;  1NV0 A;  3IJO B;  2F3B A;  4H6D A;  2B3F A;  1UIV A;  4MEV A;  3N94 A;  4NHB A;  3R6U A;  2F78 A;  3U72 A;  3DP8 A;  1HSJ A;  4MIJ A;  4P56 A;  3ISP A;  3PUZ E;  4RK2 A;  2FIX A;  3B6T A;  2RIN A;  4EF2 A;  4OVT A;  1VFE A;  5I84 A;  3HST A;  1LBX A;  4UA8 A;  4F1Y A;  4OFL A;  3N26 A;  1FPF A;  1FPI A;  1DSN A;  3KOT A;  3K1P A;  2LAO A;  3FXB A;  1LFH A;  3VXC A;  1B1H A;  1WOD A;  4N81 A;  1I69 A;  4NF4 A;  1MXU A;  2X26 A;  4R9G A;  4BDN A;  4GVO A;  4P3L A;  3VLV A;  5J16 A;  1ZTY A;  4P1L A;  1PB7 A;  2XX9 A;  4OHN A;  4JBZ A;  3K02 A;  2ONS A;  3RT8 A;  1DTG A;  3E13 X;  5FTH A;  1TFD A;  1FBP A;  2V25 A;  2ESN A;  3IR1 A;  4F3P A;  3IO4 A;  3PD9 A;  4PGP A;  2XX8 A;  2WBD A;  2ZZW A;  1LLS A;  4X48 A;  3O6P A;  2DDK A;  1SVX B;  3H6T A;  4P0I A;  3GLB A;  2Y7W A;  5B70 A;  1OLC A;  4XF5 A;  5EHS A;  2RCB A;  4IO5 A;  3FVK A;  4PAI A;  1Y9U A;  1PDA A;  1NNF A;  5IGA A;  5CMK A;  1IQ7 A;  1B0L A;  4PFI A;  2PBW A;  2QFL A;  4PTK A;  4WED A;  3E79 A;  1BK4 A;  1JVX A;  4WXJ A;  4KXP A;  5M2V A;  2Q8J A;  3H4Z A;  4HCY A;  3C34 A;  4IO2 A;  5ESY A;  3MST A;  4XXU A;  1A55 A;  1O7T A;  3M3F A;  1QJM A;  1F9B A;  2QSX A;  3K6X A;  1OVT A;  3JYR A;  3GZG A;  3V5A A;  3CFL A;  2PVU A;  1LGB C;  1AIV A;  2DE2 A;  3OMB A;  4XTC Q;  2AIX A;  4NED A;  4OEU A;  3IB2 A;  4ZZA A;  4ESX A;  1US5 A;  4BDL A;  4NF5 B;  4GF8 A;  3CVG A;  3LUZ A;  5I3S A;  1ZMG A;  2F5X A;  1FPD A;  4OA4 A;  4K3F A;  1B3G A;  2HHM A;  3LC8 A;  3HN0 A;  4X9T A;  1NUZ A;  3IOW A;  5CM6 A;  1XI6 A;  2ZYM A;  3FUZ A;  4O3A A;  2VT5 A;  1ZBM A;  3TCH A;  1VSO A; 
#chains in the Genus database with same CATH homology
 2RC7 A;  3RTF B;  1LST A;  2XD2 A;  3LVU A;  2HXW A;  2HAV A;  3TYH A;  2HAU A;  4JDF A;  2PT1 A;  5BUU A;  1ZIU A;  1B5I A;  1DTZ A;  5CRY A;  2XXT A;  3CFX A;  3MP6 A;  4KD5 A;  4NF8 A;  1H43 A;  4C0R A;  1NMU A;  1FTO A;  4RPO A;  2H4I A;  4IO7 A;  4N13 A;  4M1V A;  4ZZE A;  4ELO A;  4GD5 A;  1SYH A;  2H98 A;  1YAE A;  1B6H A;  3FTO A;  4KYS A;  4O3C A;  1WDN A;  3G3F A;  3HHF A;  3G3J A;  3O6H A;  3R7X A;  5EHM A;  4F18 A;  5AA1 A;  1S7Y A;  5I2K B;  5EYF A;  4AQ4 A;  2I4C A;  2I0C A;  2DYX A;  3RT6 B;  1UQW A;  1POY 1;  2QRY A;  1HSL A;  1OLA A;  2UXA A;  4U2R A;  2XXR A;  5DTB A;  4E0X A;  1QUJ A;  4JSD A;  1I6B A;  1NL5 A;  1Z7M E;  3USD A;  1QUI A;  2XX7 A;  3H6W A;  3HO7 A;  4JWY A;  5ELV A;  2F35 A;  3TTR A;  4EDP A;  1P1O A;  5AA4 A;  4TQU Q;  3Q25 A;  3DRF A;  1VE4 A;  4GXS B;  3EPE A;  3AXF A;  4R73 A;  1MDP 1;  4KCD A;  4NF4 B;  4BLA A;  4LZ7 A;  4GIZ A;  5F1Q A;  2O1L A;  2QMX A;  2XHD A;  4GRK A;  3TKD A;  3DP4 A;  5H8F B;  3LBS A;  2VD2 A;  3LSL A;  5I59 B;  4WKM A;  5JK4 A;  4DIG A;  5CMM A;  3G3H A;  3TZA A;  1N7X A;  2PMS A;  2XXH A;  3G3G A;  3MWB A;  3OO6 A;  5KDT B;  2H9B A;  3UN6 A;  1QKA A;  1EZO A;  4PFU A;  3RY3 A;  2QJE A;  4F1V A;  2BJJ X;  4OEN A;  2X7P A;  3ILU B;  1LAG E;  4MH5 A;  2DXR A;  2GH9 A;  4IGT A;  4YIC A;  4F39 A;  4ELR A;  4OYV A;  1J1N A;  1BTJ A;  1PBP A;  4ELP A;  3MUQ A;  4OET A;  3GBB A;  4YKK A;  1NNK A;  2REJ A;  1LBB A;  1ZKB A;  2XXW A;  2YPN A;  3LUY A;  5H8Q A;  5TPA B;  1BIY A;  4ZE8 A;  1D9Y A;  5DT6 A;  5F7V A;  2WOL A;  1GV8 A;  5I59 A;  2I49 A;  1OQH A;  3FV2 A;  3E3K A;  4H5G A;  1H3D A;  1OMP A;  3VV5 A;  4DE8 A;  4F2Q A;  4NWD A;  3K6W A;  2HQ0 A;  3RGY A;  3U94 A;  3QSL A;  1N7W A;  4YB6 A;  3FGS A;  5H8Q B;  5TPA A;  4I9D A;  3PV0 E;  4KR5 A;  4ND9 A;  3T66 A;  1FQF A;  1M5D A;  3H7M A;  3IL1 B;  4RY1 A;  1QW0 A;  4DXU A;  3FVO A;  4ZS9 A;  5CBS A;  3CSB A;  1L5T A;  1D3K A;  1OQG A;  2PT2 A;  3OXN A;  1YCJ A;  3MBP A;  2R71 A;  4F3B A;  1LAF E;  1B5J A;  5HBC A;  3TQW A;  3KJT A;  1IUD A;  3G3I A;  3KZG A;  3PPQ A;  4LQ2 A;  3S9L C;  1MPC A;  2V93 A;  1SI0 A;  3I5O A;  3MZB A;  4PFT A;  3TCF A;  1NH7 A;  1XC1 A;  2DQV A;  3OO8 A;  4ZE9 A;  3D4C A;  4M4G A;  4YKP A;  2HFB A;  1M5C A;  1N3X A;  5KDT A;  2A5T B;  3GBA A;  1LB9 A;  3CIJ A;  1ELJ A;  1IZ1 A;  1I6Q A;  1B2H A;  1MXX A;  3G3K A;  3G7W A;  5AE4 A;  3FAT A;  1MY1 A;  1URS A;  1MDQ A;  1GGG A;  3OO7 A;  4GLI A;  2Z8E A;  3EHT A;  3I3V A;  2G29 A;  3DP6 A;  3PMV A;  3M3K A;  1R9L A;  2OWT A;  3TAJ A;  4ISU A;  2UYE A;  3KSJ A;  4NWC A;  1AMF A;  3N5L A;  1MQJ A;  3SEV A;  3TFL A;  1LAH E;  3IOV A;  1MXW A;  2HEU A;  3O2A A;  5TP9 A;  4GQO A;  4DCX A;  1ZU0 A;  2Z23 A;  3SEY A;  2RC9 A;  5I2K A;  1FQE A;  3IB0 A;  4KFQ A;  4EQB A;  3KFM A;  1O64 A;  4ZED A;  4KYE A;  2I0B A;  3S9E A;  1CB6 A;  3LSX A;  3W15 C;  4LVQ A;  4R75 A;  3VXB A;  1LCF A;  3FXQ A;  1P1U A;  2XXI A;  3DRG A;  4H8J A;  3UOR A;  3OEM A;  3VVD A;  4OFO A;  1JVY A;  3C32 A;  5H8N B;  4OXV A;  5HPQ A;  2DWI A;  2YJP A;  3DEL B;  4HCW A;  3SEW A;  4Z7E A;  4LA9 A;  2UVI A;  1HSE A;  2GFE A;  5I84 A;  3N6U A;  1YPN A;  3E9X A;  2V84 A;  1MQI A;  4RXL A;  4F31 B;  1QUK A;  1I6A A;  1MY2 A;  5H8N A;  3QK6 A;  2V3T A;  3WAE A;  2Q88 A;  3Q28 A;  4XKN A;  3QUF A;  1EZP A;  1QUL A;  1PBQ A;  3O66 A;  3FJG A;  5KCJ A;  3PPP A;  4POW A;  4OES A;  1MQG A;  3DLN A;  4EXL A;  2ZNT A;  2PYY A;  5AA2 A;  3O29 A;  3F11 A;  2O69 A;  4R9F A;  1PB8 A;  3JV9 A;  4U1Z A;  2YLN A;  2CMO A;  3K2D A;  3ECR A;  3K01 A;  3TMG A;  1FQA A;  3MVX A;  1GR2 A;  2OCU A;  3PPN A;  4KCC A;  4OMB A;  4ELQ A;  3B6Q A;  2P0S A;  4RJZ A;  4LQ5 A;  1ZJL A;  1JNF A;  3BBR A;  1MM6 A;  4R72 A;  4X1B A;  4DLD A;  4R74 A;  1M5B A;  3ODB A;  4JWO A;  3EQ1 A;  4QFK A;  3RLF E;  3CHG A;  3S4U A;  1B3F A;  1B58 A;  1A8E A;  3O6G A;  3PUX E;  4G8M A;  2ZYK A;  1IEJ A;  3TPA A;  1EZ9 A;  4U4S A;  1GTK A;  1MH4 A;  2A5T A;  1II5 A;  1B5H A;  2DE4 A;  3IO6 A;  1QVS A;  4I62 A;  3RQT A;  1JW5 A;  4TLM B;  3T9H B;  1D9V A;  1M5F A;  4PFY A;  4ONY A;  2NXO A;  1A40 A;  2ALU A;  2O84 X;  3MP1 A;  1LBC A;  2I3W A;  1P1W A;  1MY3 A;  3KBR A;  1P1Q A;  4YMA A;  5A5X B;  1XVY A;  4N07 A;  1DPE A;  4EUO A;  1FQB A;  1US4 A;  4RA1 A;  3HV1 A;  1NKX A;  4N6P A;  1XS5 A;  1MS7 A;  2RKM A;  2F7C A;  2H5Y A;  1PB9 A;  5DVF A;  1NFT A;  2Z8D A;  3MAM A;  3ZKL A;  5TP9 B;  3KN8 A;  4OVJ A;  3SER A;  4YKJ A;  3K6V A;  1B46 A;  1URG A;  2F6P A;  4U1O A;  3TEP A;  3KG2 A;  1T0K A;  2DOJ A;  3HCQ A;  4QFL A;  1TWY A;  2B65 A;  2E1S A;  3EF7 A;  3MJN A;  3PMW A;  4G4P A;  4O3B A;  5K2X A;  3UA8 A;  1MPD A;  4OZ9 A;  2ONR A;  3KN3 A;  1B0H A;  1MQD A;  5TU0 A;  2XXU A;  5AA2 B;  3O97 A;  1R1N A;  3ONM A;  3ZKK A;  4F3G A;  4TOZ A;  1JW4 A;  3DRI A;  1H44 A;  1LFG A;  4PP0 A;  3M8U A;  4H5F A;  1Y1Z A;  4GWO A;  4THI A;  4EQ9 A;  3CRB A;  3K0V A;  2VD3 A;  3JZJ A;  1MH3 A;  4XKP A;  2B3B A;  2M8C A;  1P99 A;  3C33 A;  4E0W A;  4RYA A;  2ZNU A;  5L8D A;  1POT A;  4NF6 B;  4U22 A;  4GL8 A;  3FVG A;  2H25 A;  4GXA A;  3RYB A;  2ZNS A;  1WVJ A;  1B3H A;  4QHQ A;  2WOK A;  2ONK E;  1SYI A;  4RPN A;  3SEU A;  1MRP A;  4AB6 A;  4NTL A;  2FA7 A;  2DP8 A;  4OWD A;  1PEB A;  4Q8R A;  2PX1 A;  1SBP A;  5DEX A;  3LSF B;  4GFR A;  1BP5 A;  1LFI A;  3QYT A;  2ZYN A;  3Q26 A;  3UIF A;  2QS1 A;  1ATG A;  2Y7P A;  3H03 A;  3IK6 B;  5CC2 A;  1H76 A;  1N0T A;  3U92 A;  1R9Q A;  2XXQ A;  1VFD A;  1Z7N E;  1XOC A;  1B7U A;  2UVH A;  3D4G A;  3EHS A;  4IB2 A;  3VDF A;  2I48 A;  3PGF A;  3PUV E;  5BWJ A;  3CG1 A;  3MVY A;  4Z0I A;  4R6H A;  2QMW A;  1B9J A;  3R26 A;  4FEB A;  1B1X A;  3RNN A;  4MBP A;  5LOM A;  3WAF A;  4PQJ A;  5ITP A;  1RYX A;  2DWH A;  2WKY A;  1FCK A;  3PU5 A;  2G93 A;  3KJ7 A;  2F7A A;  4MLQ A;  1DMB A;  3B6W A;  4DDD A;  4FEC A;  1MXV A;  4R2F A;  1LB8 A;  1USY H;  3O6I A;  1AH5 A;  1URD A;  3RTW B;  1JET A;  2QS3 A;  2XXX A;  3IJX B;  4YU0 A;  2UYF A;  3C35 A;  4BDO A;  5I2N A;  1A99 A;  1B3E A;  4H1X A;  2NVU B;  1UIU A;  3IB1 A;  3QUJ A;  4ZDM A;  3MVW A;  2Y7R A;  3U8Q A;  3O28 A;  3C36 A;  5AA4 B;  4L17 A;  1ANF A;  3DRJ A;  4QFO A;  3V8X B;  4TLL B;  5DYH A;  1IIW A;  4P11 A;  3TEL A;  4C1T A;  5ITO A;  4F19 A;  4F29 A;  1Y3N A;  5L9M A;  3T96 B;  2W7Y A;  1MPB A;  2DWA A;  1BLF A;  2ABH A;  1RYO A;  4QFN A;  3IAZ A;  1B4H A;  4JXI A;  1SQY A;  2NWJ A;  3W9V A;  4F2O A;  3S9N C;  3U1O A;  1B51 A;  4EF1 A;  3OEN A;  4ZEB A;  1LCT A;  3VLW A;  3C31 A;  1SW5 A;  3Q27 A;  4H0W A;  3C9H A;  4WEP A;  1MXZ A;  2OWS A;  3TTL A;  2CZL A;  4U4X A;  5CI5 A;  5I56 A;  3IJO B;  1IIT A;  1UTH A;  3MPL A;  4I8C A;  2D5W A;  3V89 B;  2Z22 A;  3RN8 A;  3SES A;  4EQ7 A;  4NF8 B;  5H8H B;  4NE4 A;  2KLF A;  4BDQ A;  2IEE A;  2GRV A;  4FE8 A;  4NF5 A;  2QPQ A;  2I58 A;  1Y1M A;  1UIV A;  2B3F A;  4H6D A;  4DXC A;  2V3Q A;  3CFZ A;  1FQD A;  3MC2 A;  3N94 A;  3R6U A;  2F78 A;  3RPW A;  5KZT A;  2H99 A;  2F34 A;  2XXP A;  1MQH A;  4LZ5 A;  3U72 A;  4OFJ A;  3VLU A;  2P1S A;  4HTG A;  4ESW A;  1Y20 A;  1Q1K A;  2V3U A;  4LAT A;  4Q5T A;  2Q2A A;  3DP8 A;  1UTB A;  1LAX A;  4OTE A;  1D4N A;  3DRH A;  1HSJ A;  3A3U A;  3N6T A;  4G77 A;  4R6Y A;  4QSE A;  3TCG A;  3PUZ E;  2B4L A;  5B7D A;  4RK2 A;  3T9U A;  3IX1 A;  2D21 A;  3FAS A;  1B7H A;  3B6T A;  2RIN A;  1ZLQ A;  3OO9 A;  4EF2 A;  3SET A;  3VVF A;  3ZSF A;  2F7B A;  1VFE A;  1Y4C A;  3MQ9 A;  1Y3P A;  5CMC A;  3THI A;  3BFT A;  3FIR A;  3FVN A;  3Q29 A;  2HCA A;  2Y84 A;  4QF9 A;  3HST A;  1R6Z A;  4KYD A;  3E4R A;  1TFA A;  4UA8 A;  4F1Y A;  4OFL A;  3N26 A;  1AIV A;  1DSN A;  1FTK A;  4FOR A;  3KOT A;  3K1P A;  3CR9 A;  4NF6 A;  4R6K A;  2Q2C A;  3KN7 A;  2LAO A;  3PD8 A;  1LFH A;  2OBG A;  4PFW A;  5H8S A;  1B1H A;  3VXC A;  1WOD A;  2UVJ A;  2QS4 A;  4OER A;  1I69 A;  3HHG A;  4NF4 A;  4NMY A;  1MXU A;  4KPT A;  2X26 A;  5FHN A;  3T22 A;  5JEI A;  4R9G A;  4BDN A;  4G8N A;  1QKB A;  4GVO A;  5DVJ A;  4FED A;  4G68 B;  2ZMB A;  4MFI A;  4ZEI A;  2I6E A;  4IY6 A;  1ZTY A;  4QSC A;  3VLV A;  2OLB A;  3M3L A;  1PB7 A;  2XX9 A;  4KHZ E;  4OHN A;  1P1N A;  2THI A;  1AL3 A;  4JBZ A;  4LON B;  4YKI A;  5DVI A;  2VGQ A;  3K02 A;  2ONS A;  3DM0 A;  1Q35 A;  5I58 A;  3TUS A;  1DOT A;  1CE2 A;  4FJP A;  4G2Z A;  3RT8 A;  1JW1 A;  3EHU A;  4XKR A;  1A8F A;  3H6V A;  5KCJ B;  1UTB B;  1DTG A;  2E0S A;  2F97 A;  1JQF A;  2REG A;  3E13 X;  3L6G A;  5DEX B;  5CMB A;  1TFD A;  5FTH A;  1NH8 A;  5L9S A;  3ILT B;  3T93 B;  2AYS A;  5FHO A;  4EXK A;  3K1N A;  2V25 A;  4ZEK A;  3PUY E;  4IO3 A;  4JWX A;  2ESN A;  2R9J A;  3IR1 A;  3OD7 A;  3QIM A;  3KOS A;  3OEK A;  1MG1 A;  2NUV A;  3K1M A;  4F1U A;  4F3P A;  4H65 A;  3P7I A;  4HW8 A;  3IO4 A;  5H8H A;  1N04 A;  3TTK A;  3PD9 A;  1DPP A;  3TDJ A;  3UK4 A;  2I4B A;  2XXY A;  2Y7I A;  3FJ7 A;  3FXR A;  4G68 C;  4G8H A;  1SI1 A;  2Z8F A;  1KWH A;  5FHM A;  2XX8 A;  2O68 A;  1IXG A;  2IA4 A;  2B4M A;  4LUB A;  2O6A A;  1A54 A;  3PPR A;  4U23 A;  4XIG Q;  1LLS A;  2NOO A;  1B05 A;  2FNC A;  2VHA A;  4X48 A;  1FTJ A;  2ZYO A;  1YTV A;  5K2Y A;  2FYI A;  1EU8 A;  4FAT A;  3W9W A;  3VFJ A;  3O6P A;  1FW0 A;  4OQO A;  3H6T A;  1SVX B;  2DVC A;  1Y4T A;  4P0I A;  3GLB A;  4QSD A;  2Y7W A;  5B70 A;  1OLC A;  2DSF A;  4U21 A;  3KEI A;  4PE5 B;  1XHY A;  5EHS A;  1FTL A;  2O51 A;  2OJT A;  4YAH X;  5AA2 D;  2RCB A;  4IO5 A;  4DCY A;  2X7Q A;  1SDX A;  3FVK A;  1RKM A;  1Y9U A;  3LSW A;  3TTM A;  3SEX A;  1OIB A;  1PDA A;  2DXY A;  4MLV A;  1NNF A;  4QRZ A;  5CMK A;  4XKQ A;  4BDR A;  1MY0 A;  1USY E;  2O1M A;  2OK2 A;  1IQ7 A;  1B0L A;  1B4Z A;  3MPK A;  4LP2 B;  2PBW A;  3U93 A;  3VE1 B;  1FTM A;  5H8F A;  2O7U A;  1M5E A;  4WED A;  1Y3Q A;  3TTN A;  4LZ8 A;  3FZV A;  2ANJ A;  4FAJ A;  1B32 A;  5IAI A;  2R6G E;  3EN3 A;  2WOP A;  5AA3 A;  3OSQ A;  2O7I A;  1JVX A;  2QL3 A;  5I58 B;  3C4M A;  3H3G A;  2DWJ A;  1N84 A;  1SW1 A;  4WXJ A;  1TT1 A;  2I3V A;  3H06 B;  2GHB A;  2Q89 A;  3KSX A;  4KI0 E;  1XVX A;  2QS2 A;  4I1D A;  4X1D A;  3UP9 A;  1GVC A;  4YB7 A;  3TOD A;  4PET A;  3DRK A;  2F36 A;  4G68 A;  4AB5 A;  1FQC A;  3FXU A;  5M2V A;  2Q8J A;  2DS9 A;  4IO4 A;  2RF1 A;  4Q30 B;  3T9X B;  3MZ9 A;  3H4Z A;  1JEU A;  4YMB A;  4MF3 A;  4RK9 A;  1SW4 A;  1TXF A;  4HCY A;  4QFP A;  3MP8 A;  3C34 A;  3KGC A;  4IO2 A;  3IOT A;  2ZXT A;  3A09 A;  1B40 A;  1IXC A;  1AOV A;  1O63 A;  2DE3 A;  4XXU A;  4C1U A;  5I57 B;  4IGR A;  1A55 A;  1S50 A;  1BKA A;  1O7T A;  3M3F A;  3OSR A;  1QJM A;  3OEL A;  2P2A A;  1F9B A;  5L9O A;  2QSX A;  3K6X A;  3PAM A;  1OVT A;  4ZEF A;  5CBR A;  2RC8 A;  5I2N B;  3ZS6 A;  4BDM A;  4FIM A;  1N3W A;  4R2B A;  3PUW E;  3JYR A;  3I6V A;  4DXB A;  3GZG A;  4YB5 A;  3V5A A;  2UVG A;  3CFL A;  1XT8 A;  3PPO A;  3QAX A;  2PVU A;  3HPI A;  4JB7 A;  1LGB C;  4F22 A;  3MW0 A;  2DE2 A;  3K4U A;  3CG3 A;  4POX A;  3SKP A;  4DZ1 A;  3OMB A;  4XTC Q;  1MM7 A;  3LR1 A;  2OZZ A;  4YZZ A;  2AIX A;  3PMX A;  4GOT A;  4OEU A;  3K00 A;  4NED A;  3SDF A;  3IB2 A;  1H45 A;  1JEV A;  1MY4 A;  5ICT A;  4OEV A;  5ISU A;  3FD3 A;  1SW2 A;  2D3I A;  5J1D A;  3BFU A;  1IXI A;  2AL4 A;  4IY5 A;  4KQP A;  5A5X A;  2DVZ A;  1NNP A;  4ZZA A;  1B7Z A;  5JTY B;  3A3C A;  4ESX A;  4H8I A;  2XXV A;  1US5 A;  3O9P A;  4BDL A;  2GHA A;  4NF5 B;  4GF8 A;  3S9M C;  3MZ1 A;  4P0G A;  1B52 A;  5FTI A;  3CVG A;  3QXM A;  4GL0 A;  4Q0C A;  2A5S A;  1ZMG A;  2F5X A;  5JTY A;  3B7D A;  5I56 B;  4HS7 A;  2XD3 A;  1EH3 A;  4JSO A;  2RCA A;  1VR5 A;  4K3F A;  1UTH B;  3TQL A;  1B3G A;  3MVZ A;  2F8D A;  3GXA A;  3H6U A;  3L6H A;  3LC8 A;  4F3S A;  1SD3 A;  3K6U A;  1N76 A;  2AL5 A;  4IO6 A;  5HM4 B;  3FJM A;  4ZEC A;  1S9T A;  1IXH A;  3CI8 A;  1B3L A;  3RUM A;  1MXY A;  3HN0 A;  4ECF A;  2F6G A;  3S2V A;  4X9T A;  5ICQ A;  2Y7K A;  2VOZ A;  3BKI B;  3RYA A;  3T9V A;  4UAC A;  3FV1 A;  3IOW A;  5CM6 A;  3UGW A;  4RNS A;  2ZYM A;  2HZK A;  2HZL A;  3FUZ A;  4H67 A;  3OOA A;  4O3A A;  3V83 A;  1PC3 A;  2VP1 A;  3VVE A;  3IOR A;  2Q9T A;  1ZBM A;  1NNT A;  5I57 A;  3TCH A;  3IOU A;  1VSO A;  5IKB A;  3CSG A;  1A7L A;  1OVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...