2OLBA

Oligopeptide binding protein (oppa) complexed with tri-lysine
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (binding protein/peptide)
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title The crystal structures of the oligopeptide-binding protein OppA complexed with tripeptide and tetrapeptide ligands.
pubmed doi rcsb
total genus 190
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1995-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2olbA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2olbA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 2olbA02
4F1VA 4P11A 2XXYA 3C33A 2XX8A 3UGWA 4LATA 3M8UA 4ELRA 3H4ZA 3E13X 3FATA 4YKJA 1B3GA 3IOVA 2O69A 5IKBA 3MJNA 4F19A 1MXUA 1IXCA 1T0KA 1MY3A 3A3UA 1TFAA 4R9FA 4G68C 2THIA 1NNKA 2DYXA 3GBBA 4GF8A 3IJOB 3KOSA 3EN3A 1IXGA 3VV5A 3FVKA 1MPDA 3P7IA 3HHGA 5CMCA 4AB6A 2ZNSA 3THIA 1NKXA 3G3GA 2PYYA 2ZYKA 3KGCA 4U22A 5J1DA 2Y7IA 4G68A 4WKMA 2HZLA 3ILUB 3SETA 5TU0A 3K00A 4JXIA 4Q8RA 3U1OA 3WAFA 3FVOA 4HS7A 3UP9A 3H03A 3EPEA 2ANJA 1IXHA 1D4NA 2QS2A 2E1SA 3T22A 4PP0A 1QUKA 2ONSA 3MP1A 3DP8A 4R2BA 4WXJA 4Q0CA 1B05A 4U4XA 4IGTA 4DCYA 4NWDA 3T9UA 3O6PA 3KN7A 1A99A 2VD2A 5H8NB 4IO2A 4OETA 4IY6A 1QKBA 5L9SA 3MZ9A 1N84A 2ZNUA 3RTWB 3PMVA 1JVXA 5AA2D 4RPOA 1EZPA 3DRKA 5H8SA 4KQPA 2XXPA 1LBBA 4GIZA 4U23A 3N6TA 2GFEA 5I2NB 4QF9A 3IR1A 4PFUA 2YLNA 4IO3A 5A5XB 5HPQA 3W9WA 4R6YA 3V83A 3RPWA 1YTVA 3PUXE 2XXVA 1P1WA 1DOTA 4FIMA 3QSLA 5ELVA 1PB8A 4OWDA 5CBSA 1AIVA 1IEJA 4ZZEA 3E4RA 4IO5A 5TPAB 4FEDA 3SKPA 4GVOA 2HQ0A 4ESWA 4U2RA 3Q27A 1I6BA 4GD5A 2PVUA 1B3HA 3DP4A 3GZGA 1B0LA 2R9JA 1LCFA 4G8NA 2DWIA 4GLIA 2DE4A 1MDP1 2PT1A 4KHZE 4E0WA 2D3IA 3GLBA 5KCJB 4FATA 2RC9A 1ZIUA 1MXZA 4GXSB 2F8DA 2NUVA 2V3QA 1SW2A 4X1BA 3BFTA 3EHSA 3M3LA 1SI0A 1N7XA 3S4UA 3UN6A 1B3LA 5I57B 3TTLA 3CFZA 5I56A 4R73A 1ELJA 3TQLA 5DVFA 5ITPA 1B7HA 2A5TB 2UXAA 1B5JA 4JBZA 2DWAA 1TFDA 3ONMA 3S2VA 3LSFB 4O3AA 1XHYA 1FQAA 4NE4A 3EHUA 4KCDA 1MQGA 4LUBA 4NF5A 1RYXA 4OENA 4YB6A 3PAMA 1BTJA 3TTMA 3MP8A 3B6QA 3SESA 1J1NA 2NWJA 2GRVA 3M3KA 2NOOA 3A09A 1FCKA 2CMOA 1SDXA 3KG2A 4KYDA 3TAJA 2I4CA 1B5HA 1SW1A 4POXA 1FQEA 1SYHA 3U72A 3SEUA 3VLVA 5DT6A 4U1OA 2XXIA 5CC2A 5LOMA 1I6AA 4QFKA 1PBPA 4IO4A 5DTBA 2F34A 1M5FA 5AA3A 5I84A 5FTHA 5AA4B 3IX1A 1GV8A 4YKIA 3PV0E 5FHMA 1ZTYA 3OD7A 3QK6A 2Y84A 3OSRA 3K1MA 1ZJLA 4YZZA 5H8QB 1AOVA 1B7ZA 4K3FA 3PUWE 4LP2B 1S7YA 4DXUA 3K4UA 5AA1A 4O3CA 3GXAA 2HAUA 3TODA 3FGSA 3RYBA 3OSQA 1QW0A 3K6WA 2V3TA 3BFUA 3DM0A 3K1NA 1N3WA 1XT8A 3K6VA 3A3CA 1USYE 3MP6A 2I3WA 5I59B 2AIXA 3UK4A 1FTKA 4TLLB 1SD3A 1DTZA 1H45A 1B2HA 3V89B 4GXAA 1HSLA 4F22A 1XC1A 2QMWA 1Y1ZA 2O7UA 1BLFA 1Y9UA 2Q2CA 3T93B 3CHGA 1VFEA 4NF6B 1WDNA 4BDRA 1NH7A 3FUZA 1WODA 4IO6A 4H0WA 4R2FA 5FTIA 3CFLA 4OEUA 5ISUA 1JEUA 5B70A 2B3FA 3TQWA 4EF1A 1SBPA 3IO6A 3FXUA 2I0CA 2XXXA 4YMAA 4ZEBA 4QSEA 5CMKA 1B3EA 1GR2A 4F1YA 1HSJA 4POWA 2PT2A 3MBPA 1O64A 3FJ7A 1Y4TA 5DVJA 4RK2A 1URDA 2XD3A 4TLMB 4HTGA 1L5TA 4PFYA 4ISUA 2FNCA 3O2AA 3CSBA 2OWSA 5FHOA 4OTEA 3PPNA 3RNNA 3M3FA 2UVIA 5BUUA 2DXRA 2B4MA 1D9YA 3HV1A 1M5BA 4H65A 1RKMA 4RY1A 2QPQA 3U92A 1QJMA 3VVFA 4R9GA 3OEMA 3FV1A 2M8CA 4X9TA 2RC8A 1QUIA 1US5A 2HEUA 2HAVA 3C35A 1YAEA 4R75A 1MXVA 4RPNA 3RUMA 3TCHA 1NNTA 4OESA 2Y7KA 3H6TA 4Q30B 1IITA 1LBCA 3HSTA 2ABHA 4WEPA 2RC7A 4EUOA 3OO8A 1DMBA 3FD3A 4ZEKA 4H5FA 3ZSFA 2AL4A 4I1DA 2ONKE 1UIUA 1Y3PA 3U8QA 3IOTA 4UACA 1MG1A 2Y7PA 3TTKA 4OFOA 2A5SA 4NMYA 1VFDA 3I6VA 4EDPA 5F1QA 4F3PA 1UTBB 5AA2B 1NNPA 4F31B 4U4SA 5L8DA 3O66A 4DZ1A 3C32A 4H8JA 2AL5A 5AE4A 4OHNA 4NF4A 5I58B 3IO4A 3DRIA 4U1ZA 1MDQA 3TYHA 1XS5A 5CI5A 3GBAA 5H8HA 3UORA 3HO7A 1Y3QA 4XIGQ 2D21A 1B58A 4MFIA 3E3KA 2F7CA 4YKPA 2XXHA 3Q28A 2OCUA 3QAXA 3K6XA 1JETA 3LSLA 2AYSA 2UVJA 2F5XA 2Q89A 2P2AA 2XXQA 2XXTA 2VP1A 4ELQA 3O28A 2Z8FA 4R74A 2DSFA 4H5GA 1GVCA 2G29A 1MXYA 2V93A 3Q26A 3MVXA 2CZLA 2REJA 1SYIA 4F2OA 1AL3A 3RTFB 3MWBA 3UA8A 1A8EA 2O6AA 3OEKA 4U21A 4RA1A 3OOAA 1PC3A 3R7XA 4MBPA 4EF2A 3IOUA 3DELB 2VOZA 1MY0A 1IUDA 5L9MA 1B1XA 3F11A 4O3BA 4IB2A 3I5OA 1FTJA 3MZ1A 3C36A 3DRGA 3S9NC 3ZS6A 5HBCA 2Q8JA 3ECRA 4JDFA 4XTCQ 4BDOA 3TEPA 1NL5A 2O68A 3TPAA 4X1DA 4ZEDA 2Z8EA 4QRZA 3RT6B 3N94A 1A40A 1TXFA 1CB6A 5EHSA 1OQHA 5I2KB 3H6UA 2O7IA 5JTYB 3MVYA 4OMBA 4LA9A 4BDLA 2OLBA 2ZMBA 4PQJA 2R6GE 2DQVA 5H8NA 4GRKA 3TCFA 4R72A 4M1VA 1XVXA 3MW0A 4FE8A 2QMXA 3K1PA 1I6QA 4YAHX 2OWTA 2QRYA 4DE8A 1H3DA 1MQDA 4LQ5A 2GH9A 2XXWA 4KD5A 3EHTA 5CRYA 2PBWA 3PUYE 5I2NA 1ATGA 3PPRA 4RYAA 4WEDA 5I2KA 1M5CA 5A5XA 2I4BA 4P0GA 4FJPA 1NH8A 1LAHE 3FVNA 3HN0A 1P1QA 4TQUQ 4OFLA 4HCWA 2Y7RA 4OERA 1XVYA 3AXFA 3DRHA 4PFWA 1US4A 2QS3A 1I69A 1H43A 1MQJA 2F6GA 2V3UA 4KPTA 3KSJA 2KLFA 5TPAA 1M5DA 2DVZA 1TWYA 3USDA 1IZ1A 1ZU0A 4GL0A 3CG1A 3RT8A 3S9EA 4XKRA 4P0IA 4C1UA 2XHDA 1PB7A 4N6PA 4GQOA 4KCCA 2QS1A 1AMFA 3G3FA 2B65A 2PMSA 2ONRA 2O51A 3OELA 1BP5A 3KBRA 3W15C 4I8CA 2H5YA 1SQYA 3MVZA 4I9DA 3H3GA 2RF1A 3EQ1A 5KCJA 4EXKA 3LUYA 1RYOA 4G4PA 1FTMA 1OVTA 5I57A 4MF3A 2REGA 3K0VA 2A5TA 4LZ5A 3JV9A 4TOZA 3Q25A 1R9QA 4G8MA 3QIMA 1Q35A 1B0HA 5DEXB 1POY1 5L9OA 2O1MA 4ZECA 4OZ9A 3KN8A 1OQGA 3OO9A 2WOPA 3CVGA 4LZ8A 2UVHA 1QULA 3PPOA 1EZOA 3MZBA 1MM7A 4DDDA 2H4IA 1ZLQA 3TDJA 5KDTB 4NWCA 4XKQA 1VR5A 1WVJA 1A54A 3V8XB 1LFIA 1URGA 3L6HA 4OYVA 4UA8A 5M2VA 4EXLA 4X48A 1MH4A 3CSGA 1QVSA 4HCYA 2ZYMA 4G8HA 4R6KA 3LVUA 4N13A 1OMPA 1FW0A 2D5WA 3QYTA 5DEXA 4OXVA 1VE4A 3N5LA 1FQFA 2RKMA 1PDAA 1B1HA 3I3VA 5AA4A 1YPNA 1VSOA 4F39A 1N0TA 2I58A 3MAMA 3U94A 3OMBA 3ODBA 3IB0A 5B7DA 5H8QA 1Y3NA 3SERA 3TUSA 2DVCA 3D4GA 4G77A 2V84A 1N3XA 5TP9B 5H8FB 3G3KA 4NF8B 2F35A 1MRPA 1DTGA 2F97A 2VD3A 3VE1B 5I59A 1JQFA 4FEBA 3BKIB 4NEDA 1JEVA 2F6PA 4YKKA 4DIGA 2DWJA 4ZE8A 3B6WA 3K2DA 4GWOA 2Y7WA 4QFNA 1UQWA 2RCBA 1EZ9A 4RNSA 3FJGA 3B6TA 2NVUB 5CBRA 3CRBA 3C31A 4NF6A 1UTHB 5CM6A 1S9TA 2XX7A 2WOLA 3Q29A 4IY5A 2F36A 4LQ2A 1JW4A 3CFXA 2H98A 2QSXA 4Z7EA 3E9XA 3TTRA 4RJZA 3FVGA 1MQHA 3IORA 1B9JA 1Y4CA 1MY1A 2I6EA 4RK9A 1DPEA 3SEXA 4F3GA 5ICQA 1JNFA 4QFOA 1Z7NE 1H76A 3H6VA 5EHMA 4PETA 1B5IA 4PFTA 2Z23A 1A8FA 2YPNA 4ELOA 1FQDA 3KJTA 1HSEA 4G68B 4RXLA 3PUVE 1GTKA 2XXUA 4MLVA 3O6IA 3IOWA 2UVGA 3DLNA 4KR5A 4GFRA 4EQBA 2I3VA 1S50A 1R9LA 3T66A 2IEEA 1LB8A 3VVDA 1R6ZA 4OVJA 4BDQA 1LAFE 2XX9A 5CMBA 1DSNA 3CI8A 4JWXA 3S9LC 2RCAA 1UIVA 1MXXA 1Y20A 1Q1KA 1QKAA 3DRFA 4JSOA 1CE2A 2HZKA 5JEIA 2HXWA 1B4HA 4YB5A 3TZAA 4XKPA 2ZXTA 1JW1A 1UTBA 5AA2A 1LFGA 3T9XB 3RLFE 4AQ4A 1IXIA 3KOTA 1FQBA 1POTA 3FIRA 4H1XA 3G3HA 2I49A 5I58A 2F7AA 2HFBA 3T9VA 2BJJX 1JVYA 4ZEIA 1OLAA 1EH3A 4FAJA 1B52A 3D4CA 3KN3A 3MVWA 1D3KA 2GHBA 4ND9A 1QUJA 2DWHA 3QUJA 1JW5A 3LBSA 2GHAA 2Q2AA 3VLWA 3UIFA 4THIA 1B40A 2P0SA 4I62A 2Z8DA 5KZTA 2O1LA 2ZYNA 2Q88A 3LSXA 2XD2A 1OVBA 3FJMA 1BIYA 4XKNA 3H7MA 3FXQA 3QXMA 3K02A 1KWHA 2DS9A 3T9HB 1SI1A 2QJEA 2R71A 3C34A 2XXRA 1LGBC 3PUZE 4C1TA 1N7WA 1SW4A 1USYH 4LVQA 4QHQA 4F29A 3KJ7A 4JWYA 1IQ7A 3C4MA 1FTLA 3VXBA 4GOTA 4XXUA 1YCJA 2H25A 1MXWA 1ANFA 3TKDA 5I56B 3G3IA 1F9BA 5K2YA 3MQ9A 3HPIA 1A55A 3KZGA 3VFJA 3H6WA 2I48A 1O7TA 4QSDA 1PEBA 3H06B 3FTOA 3B7DA 3QUFA 4YMBA 5DYHA 4ZZAA 4BDMA 4EQ7A 4H8IA 3VVEA 4C0RA 5JTYA 4NF5B 2IA4A 3SEWA 4ZS9A 4KYEA 3PD8A 3ZKLA 3RN8A 3RGYA 3IB2A 3PD9A 1LSTA 3MC2A 4IO7A 2B3BA 3DP6A 4ZDMA 3LC8A 2ZYOA 1A7LA 3SDFA 3PMWA 3PPPA 3R26A 3SEYA 3ZKKA 1LAGE 1B51A 1P99A 4ESXA 3SEVA 4FORA 1URSA 3O6GA 3IB1A 3TMGA 3RQTA 2LAOA 3TCGA 4F3SA 4E0XA 2Q9TA 1N04A 2WOKA 2ALUA 2ESNA 2F7BA 1EU8A 2H99A 3MPKA 2YJPA 3VDFA 2DOJA 1NMUA 3VXCA 2PX1A 1MM6A 4QFPA 4M4GA 1PB9A 2X7QA 1SW5A 1H44A 4ECFA 3K6UA 3U93A 4F3BA 4F2QA 3TTNA 3OO7A 3KSXA 4G2ZA 4OEVA 3RY3A 4YICA 5JK4A 5ICTA 3BBRA 3G7WA 4JSDA 4ZE9A 1Z7ME 3IAZA 3VLUA 2RINA 3OENA 2UYEA 3W9VA 1SVXB 3PGFA 4QFLA 4Q5TA 3MPLA 5IAIA 2OZZA 4KYSA 3OXNA 1B46A 1MPBA 4IGRA 3IK6B 2DP8A 2X26A 1NNFA 4DLDA 2Z22A 4ELPA 4MH5A 3K01A 3CIJA 4R6HA 3FV2A 1LCTA 4YU0A 3PMXA 2FA7A 2OK2A 1LAXA 4KFQA 4OFJA 4JB7A 1ZBMA 3TFLA 3TELA 4N07A 1MQIA 3HCQA 1B3FA 3OO6A 3PU5A 4KI0E 3HHFA 1ZMGA 1O63A 2H9BA 2QL3A 2UYFA 5CMMA 2G93A 1P1NA 2WKYA 3IJXB 5BWJA 5EYFA 2P1SA 4F18A 2E0SA 1N76A 2DXYA 4ZEFA 2F78A 2O84X 1P1OA 3LR1A 1DPPA 3C9HA 5KDTA 2V25A 2VGQA 3JZJA 3L6GA 3G3JA 4ONYA 4YB7A 2OBGA 1II5A 1B32A 3R6UA 3RYAA 3S9MC 1B7UA 3O6HA 5F7VA 4DXBA 1D9VA 4AB5A 1ZKBA 4PE5B 1NFTA 3PPQA 1XOCA 1FTOA 4BDNA 5K2XA 2DE3A 3WAEA 1PBQA 4EQ9A 2I0BA 3FZVA 1R1NA 3ILTB 1FQCA 4H67A 3T96B 3O97A 3KFMA 3V5AA 4BLAA 4JWOA 4Z0IA 4NTLA 2VHAA 3DRJA 1OIBA 1TT1A 1LLSA 3O29A 2ZNTA 3N6UA 1MY4A 1MY2A 1MPCA 3KEIA 4DXCA 1B6HA 2B4LA 4LZ7A 3N26A 2OJTA 1AH5A 1MH3A 4NF4B 3FXRA 1LB9A 5TP9A 3FASA 5H8FA 3MUQA 4F1UA 1MS7A 5HM4B 4HW8A 4NF8A 3O9PA 4H6DA 1M5EA 2FYIA 3LSWA 4OQOA 2X7PA 4FECA 4GL8A 5H8HB 5ITOA 1GGGA 4MLQA 2DE2A 4L17A 2QS4A 5DVIA 1Y1MA 3EF7A 1IIWA 3CR9A 4QSCA 2NXOA 1BKAA 3JYRA 1LFHA 1P1UA 1B4ZA 2HCAA 5FHNA 4DCXA 2W7YA 1OLCA 1UTHA 3CG3A 4LONB 3IL1B
chains in the Genus database with same CATH superfamily
4F1VA 4P11A 2XXYA 3C33A 2XX8A 1YYZA 4LATA 3UGWA 3M8UA 3B50A 4ELRA 3H4ZA 3E13X 3FATA 4YKJA 1B3GA 3IOVA 1FSAA 2O69A 5IKBA 3MJNA 4F19A 1MXUA 1NV4A 1IXCA 1T0KA 1MY3A 3A3UA 1TFAA 1LBYA 4R9FA 4G68C 2THIA 1NNKA 2DYXA 3GBBA 4GF8A 3IJOB 3KOSA 3EN3A 1IXGA 3VV5A 3FVKA 5IGAA 1MPDA 3P7IA 3HHGA 5CMCA 4AB6A 2ZNSA 3THIA 1NKXA 3G3GA 2PYYA 2ZYKA 3KGCA 1LBVA 4U22A 5J1DA 4O94A 2Y7IA 4G68A 4WKMA 2HZLA 3ILUB 4P47A 3SETA 5TU0A 3K00A 4JXIA 4Q8RA 3U1OA 4X04A 3WAFA 3FVOA 4HS7A 3UP9A 3H03A 3EPEA 2ANJA 1IXHA 1D4NA 2QS2A 2E1SA 3T22A 4PP0A 3MYUA 1QUKA 2ONSA 4GX6A 3MP1A 3DP8A 4R2BA 4WXJA 4Q0CA 1B05A 4U4XA 4IGTA 4DCYA 4NWDA 3T9UA 3O6PA 1KA0A 3KN7A 1A99A 2VD2A 5H8NB 4IO2A 2VPOA 4OETA 4IY6A 1QKBA 2OWZA 5L9SA 3MZ9A 1FPIA 1N84A 2ZNUA 3RTWB 3PMVA 1NV5A 3RPLA 1JVXA 5AA2D 4RPOA 4I3EA 1IMEA 2HHMA 1EZPA 4KXPA 1IMAA 3DRKA 4XEQA 2JJKA 2Y5KA 4GX4A 5H8SA 4KQPA 2XXPA 1NV6A 1LBBA 4GIZA 4U23A 3N6TA 2GFEA 5I2NB 4QF9A 3IR1A 4PFUA 2YLNA 4IO3A 5A5XB 5HPQA 2WBDA 3W9WA 4R6YA 3V83A 3RPWA 1YTVA 3PUXE 2XXVA 1P1WA 1DOTA 4FIMA 3QSLA 5ELVA 1PB8A 4OWDA 5CBSA 1AIVA 3T0JA 1IEJA 4GBVA 4ZZEA 3E4RA 4PDDA 4IO5A 5TPAB 4FEDA 3SKPA 4GVOA 2HQ0A 4ESWA 4U2RA 3Q27A 1FPFA 1I6BA 4GD5A 2PVUA 1B3HA 4OVQA 3DP4A 1INPA 3GZGA 3SZPA 1B0LA 2R9JA 1LCFA 4G8NA 2DWIA 4GLIA 2DE4A 4OVSA 1MDP1 2PT1A 4KHZE 4E0WA 2D3IA 3GLBA 4XF5A 5KCJB 4FATA 2RC9A 1ZIUA 1MXZA 4GXSB 2F8DA 2NUVA 2V3QA 1SW2A 4GWWA 4X1BA 3BFTA 3EHSA 3M3LA 1SI0A 1N7XA 3S4UA 3UN6A 1B3LA 5I57B 3TTLA 3CFZA 2FHYA 5I56A 4R73A 1ELJA 3TQLA 5DVFA 5ITPA 1B7HA 2A5TB 2UXAA 1B5JA 4GX3A 4JBZA 5I7IA 3GYYA 4N81A 4NN3A 2DWAA 1TFDA 3ONMA 3S2VA 3LSFB 4O3AA 1XHYA 5T3JA 1FQAA 4NE4A 1NI9A 3EHUA 4KCDA 1MQGA 4LUBA 3LUZA 4NF5A 4NX1A 1RYXA 4OENA 3KC0A 4YB6A 2VT5A 3PAMA 1BTJA 3TTMA 3MP8A 4LN5A 3B6QA 3SESA 1J1NA 5F24A 2NWJA 4HXVA 2GRVA 3M3KA 5EQ8A 2NOOA 3A09A 1FCKA 2CMOA 1SDXA 3KG2A 4KYDA 3TAJA 2I4CA 1B5HA 1SW1A 2WBBA 4POXA 1FQEA 1SYHA 3U72A 3SEUA 3VLVA 5DT6A 4U1OA 2XXIA 5CC2A 5LOMA 1I6AA 4QFKA 1PBPA 4IO4A 5DTBA 2F34A 1M5FA 5AA3A 5I84A 5FTHA 5AA4B 3IX1A 1GV8A 4YKIA 3PV0E 5FHMA 1ZTYA 3OD7A 3QK6A 1G0HA 2Y84A 3OSRA 3K1MA 1ZJLA 4YZZA 5H8QB 1AOVA 4P1LA 1B7ZA 4N17A 4K3FA 3PUWE 1FRPA 4LP2B 1S7YA 4DXUA 4NAPA 3K4UA 5AA1A 4O3CA 1FBEA 3GXAA 4MX6A 2HAUA 3TODA 3FGSA 3RYBA 3OSQA 1QW0A 3K6WA 2V3TA 3BFUA 3DM0A 4PAFA 3K1NA 1N3WA 1XT8A 3K6VA 3A3CA 4PCDA 1USYE 3MP6A 2I3WA 3FXBA 5I59B 2AIXA 3UK4A 1FTKA 1NUZA 1SD3A 4TLLB 1DTZA 1H45A 1B2HA 4XFEA 3V89B 4GXAA 1HSLA 4F22A 1XC1A 2QMWA 1Y1ZA 2O7UA 4HE0A 1BLFA 1Y9UA 2Q2CA 3T93B 3CHGA 4HE2A 1VFEA 4NF6B 1WDNA 3PTYA 4BDRA 1NH7A 3FUZA 1WODA 4IO6A 4H0WA 4R2FA 5FTIA 3CFLA 4OEUA 2CZHA 5ISUA 1JEUA 5I3SA 5B70A 2B3FA 3TQWA 4EF1A 1SBPA 2CZKA 3IO6A 3FXUA 2I0CA 2XXXA 1FBHA 4YMAA 4ZEBA 4QSEA 5CMKA 1B3EA 4I40A 4GWZA 1GR2A 4F1YA 1HSJA 4POWA 2PT2A 3MBPA 1O64A 3FJ7A 1Y4TA 2FBPA 5DVJA 4RK2A 4P9KA 1URDA 3NOHA 5DW8A 2WEFA 2XD3A 4TLMB 4HTGA 1L5TA 4PFYA 4ISUA 2FNCA 3O2AA 3CSBA 2OWSA 5FHOA 4OTEA 3PPNA 2F3DA 3RNNA 3M3FA 2UVIA 5BUUA 2DXRA 2B4MA 1D9YA 3HV1A 1M5BA 4H65A 1RKMA 4RY1A 2QPQA 3U92A 1QJMA 2HXRA 3VVFA 4R9GA 3OEMA 3FV1A 2M8CA 4X9TA 2RC8A 1IMCA 1QUIA 1US5A 4N15A 2HEUA 2HAVA 3C35A 1YAEA 4R75A 1MXVA 4RPNA 5FBPA 3RUMA 3TCHA 1NNTA 4OESA 2Y7KA 3H6TA 4Q30B 1IITA 1LBCA 3HFUA 3HSTA 2ABHA 4WEPA 2RC7A 4EUOA 3OO8A 1DMBA 5LDZA 3FD3A 4ZEKA 4H5FA 3ZSFA 2AL4A 4I1DA 2ONKE 4PFRA 1UIUA 1Y3PA 3U8QA 3IOTA 4UACA 1MG1A 2Y7PA 2XA5A 3TTKA 4OFOA 1FBCA 2A5SA 1FJ6A 4NMYA 1VFDA 4GBWA 3I6VA 4EDPA 5F1QA 4F3PA 1UTBB 5AA2B 1NNPA 4F31B 4U4SA 5L8DA 3O66A 4DZ1A 3C32A 4H8JA 2AL5A 5AE4A 4OHNA 4NF4A 5I58B 3IO4A 3DRIA 4U1ZA 1MDQA 3TYHA 1XS5A 2Y5LA 5CI5A 3GBAA 5H8HA 3UORA 3HO7A 1Y3QA 4XIGQ 2D21A 1B58A 4MFIA 3E3KA 2F7CA 1K9ZA 2QVRA 4YKPA 2XXHA 1LBWA 3Q28A 2OCUA 3QAXA 3K6XA 1JETA 3LSLA 2AYSA 2UVJA 2F5XA 2Q89A 2P2AA 1JP4A 2XXQA 2XXTA 2VP1A 4ELQA 3O28A 2Z8FA 4R74A 1DK4A 4H46A 2DSFA 4H5GA 1GVCA 2G29A 1MXYA 2V93A 3Q26A 3MVXA 2CZLA 2REJA 1SYIA 4F2OA 1AL3A 3RTFB 3MWBA 3UA8A 1A8EA 2O6AA 3OEKA 4U21A 4RA1A 3OOAA 1PC3A 3R7XA 4MBPA 4EF2A 3IOUA 3DELB 2VOZA 1MY0A 1IUDA 5L9MA 1B1XA 3F11A 4NF0A 4O3BA 4IB2A 3I5OA 1FTJA 3MZ1A 3C36A 4OVRA 3DRGA 3S9NC 3ZS6A 5HBCA 2Q8JA 3ECRA 4JDFA 4XTCQ 4BDOA 3TEPA 1NL5A 2O68A 3TPAA 4X1DA 4ZEDA 2Z8EA 4QRZA 3RT6B 3N94A 1A40A 1RDZA 1TXFA 1CB6A 5EHSA 1OQHA 5I2KB 3H6UA 1XI6A 2O7IA 5JTYB 3MVYA 4OMBA 4LA9A 4BDLA 2OLBA 2ZMBA 4PQJA 1FBPA 2R6GE 2DQVA 2XXKA 5H8NA 1VDWA 4GRKA 3TCFA 4R72A 4M1VA 1XVXA 2F3BA 3MW0A 4FE8A 2QMXA 2P3NA 3K1PA 1I6QA 4YAHX 4QBAA 4P56A 2OWTA 2QRYA 4DE8A 1RDYA 1IMDA 2BJIA 1H3DA 1MQDA 4O8MA 4LQ5A 2GH9A 2XXWA 4KD5A 3EHTA 4OVTA 5CRYA 2PBWA 3PUYE 5LTCA 5I2NA 1ATGA 1LBXA 4N91A 2FIXA 3PPRA 4RYAA 5IM2A 4WEDA 5I2KA 1M5CA 5A5XA 2I4BA 4P0GA 4FJPA 1NH8A 1LAHE 3FVNA 3HN0A 1P1QA 4TQUQ 4OFLA 2WYPA 5J16A 4HCWA 4O7MA 2Y7RA 4OERA 1XVYA 3AXFA 3DRHA 1FTAA 4PFWA 1US4A 2QS3A 1I69A 1H43A 1MQJA 4PAIA 2F6GA 2V3UA 4KPTA 3KSJA 2KLFA 5TPAA 1M5DA 2DVZA 1TWYA 3USDA 1IZ1A 1ZU0A 4N4UA 4GL0A 3CG1A 3RT8A 3S9EA 4XKRA 4P0IA 4C1UA 2XHDA 1PB7A 2XWKA 4N6PA 2ZZVA 4GQOA 4KCCA 4NHBA 4PFIA 2QS1A 1AMFA 4X8RA 3G3FA 2B65A 2PMSA 2ONRA 2O51A 3OELA 1BP5A 3KBRA 3W15C 4I8CA 2H5YA 1SQYA 3MVZA 4I9DA 3H3GA 2RF1A 3EQ1A 4P8BA 5KCJA 4EXKA 3LUYA 5EQ9A 5EYGA 3ROJA 4G61A 1RYOA 4G4PA 1FTMA 1OVTA 2DDKA 2GQ1A 5I57A 4MF3A 2REGA 3K0VA 2A5TA 4LZ5A 3JV9A 4MAGA 4TOZA 3Q25A 1R9QA 4G8MA 3IFCA 3QIMA 1Q35A 1B0HA 5DEXB 1POY1 5L9OA 2O1MA 4ZECA 4OZ9A 3KN8A 1OQGA 3OO9A 2WOPA 3CVGA 4LZ8A 2UVHA 1QULA 3PPOA 1EZOA 3MZBA 1MM7A 4DDDA 2H4IA 1ZLQA 3D1RA 1NUYA 3BIHA 3TDJA 5KDTB 1FPDA 4NWCA 4XKQA 1VR5A 1WVJA 1A54A 3V8XB 1LFIA 4AS5A 1URGA 3L6HA 4OYVA 4UA8A 5M2VA 4EXLA 4X48A 1MH4A 3CSGA 1QVSA 4HCYA 2ZYMA 4G8HA 4R6KA 3LVUA 4N13A 1OMPA 1FW0A 2KQZA 2D5WA 3QYTA 5DEXA 4PFBA 4OXVA 1VE4A 1KZ8A 3N5LA 1FQFA 3FBPA 2RKMA 1Q9DA 1KA1A 1PDAA 1B1HA 3I3VA 5AA4A 1YPNA 1VSOA 3MSTA 4F39A 1N0TA 2I58A 3MAMA 1FPGA 3U94A 3OMBA 3ODBA 5IZ3B 3IB0A 3E78A 5B7DA 4QXDA 5H8QA 1Y3NA 3SERA 3TUSA 2DVCA 3D4GA 4G77A 2V84A 5IZ1A 1N3XA 3U65A 5TP9B 2WX9A 5H8FB 3G3KA 3QMFA 4NF8B 2F35A 1MRPA 1DTGA 2F97A 1FPEA 2VD3A 3VE1B 5I59A 1JQFA 4MNCA 4FEBA 3BKIB 4GWXA 4NEDA 1JEVA 2F6PA 4HE1A 4PTKA 4MIJA 4YKKA 4DIGA 2DWJA 4ZE8A 3B6WA 3KC1A 3K2DA 4GWOA 2Y7WA 4QFNA 1UQWA 2RCBA 1EZ9A 4RNSA 3FJGA 3B6TA 2NVUB 5CBRA 3CRBA 3BIGA 2Q74A 3C31A 4NF6A 1UTHB 5CM6A 1S9TA 2XX7A 2WOLA 3Q29A 3ISPA 4IY5A 2F36A 4LQ2A 1JW4A 3CFXA 2H98A 2QSXA 4Z7EA 3E9XA 2CZIA 3TTRA 4RJZA 3FVGA 4MEVA 1EYIA 1MQHA 3IORA 1B9JA 1Y4CA 4JVDA 1MY1A 1YZ0A 2I6EA 4RK9A 1DPEA 3SEXA 5A5LA 4PE3A 4F3GA 5ICQA 1JNFA 4QFOA 1NV7A 1Z7NE 1H76A 3H6VA 4OVPA 5EHMA 2OX3A 4PETA 1B5IA 4PFTA 4P3LA 4PDHA 2Z23A 2XWVA 1A8FA 2YPNA 4N8YA 4ELOA 1FQDA 3KJTA 1HSEA 4G68B 4RXLA 3PUVE 1GTKA 1FBGA 2XXUA 4MLVA 3O6IA 3IOWA 2UVGA 3DLNA 4KR5A 4GFRA 4EQBA 2I3VA 4UABA 1S50A 1R9LA 1SPIA 3T66A 2IEEA 1LB8A 3VVDA 1R6ZA 2QVUA 4OVJA 4BDQA 1LAFE 2XX9A 5CMBA 1DSNA 3CI8A 4JWXA 3S9LC 2RCAA 1FPJA 5I5PA 1UIVA 1MXXA 1Y20A 1Q1KA 3IFAA 1QKAA 3DRFA 2XWIA 4JSOA 3E79A 1CE2A 4AS4A 2HZKA 5JEIA 2HXWA 2P3VA 1B4HA 4YB5A 4I3YA 3TZAA 4XKPA 2ZXTA 4DI4B 1EYKA 1JW1A 1UTBA 3RPLB 5AA2A 1LFGA 3LV0A 3T9XB 1K9YA 3RLFE 4AQ4A 1IXIA 3KOTA 1FQBA 1POTA 3FIRA 4H1XA 3G3HA 2I49A 5EYHA 5I58A 2F7AA 4NQ8A 2HFBA 3T9VA 2BJJX 1JVYA 4ZEIA 1OLAA 1EH3A 4FAJA 1B52A 5ET6A 3D4CA 3KN3A 4N6KA 3MVWA 1D3KA 2GHBA 4ND9A 1QUJA 2DWHA 3QUJA 1JW5A 4PBQA 3LBSA 2GHAA 2Q2AA 3VLWA 3EKIA 3UIFA 4THIA 1B40A 2P0SA 3A29A 4OA4A 3RYDA 5EQAA 4I62A 4NGUA 5EQ7A 2XWOA 2Z8DA 4GWUA 5KZTA 4OANA 2O1LA 2ZYNA 2Q88A 2ZZXA 3LSXA 2XD2A 1OVBA 3FJMA 1BIYA 4XKNA 3H7MA 3FXQA 3QXMA 3K02A 1KWHA 2DS9A 3T9HB 1SI1A 2QJEA 2R71A 3C34A 2XXRA 1LGBC 3PUZE 4C1TA 4NG7A 1N7WA 1SW4A 1USYH 4LVQA 5IZZA 3B8BA 2KR0A 4QHQA 4F29A 3KJ7A 2V4CA 2R8TA 4JWYA 1IQ7A 3C4MA 1FTLA 3VXBA 4GOTA 4XXUA 1YCJA 2H25A 1NV1A 1MXWA 1ANFA 3TKDA 1DCUA 4JVCA 5I56B 3G3IA 1F9BA 5K2YA 3MQ9A 4MNPA 3HPIA 1A55A 4PGPA 3KZGA 3VFJA 4PF6A 3H6WA 2I48A 1O7TA 4QSDA 1PEBA 3H06B 3FTOA 3B7DA 1NV3A 3QUFA 2PFYA 4YMBA 5DYHA 4ZZAA 4BDMA 4EQ7A 4H8IA 3VVEA 4C0RA 4PAKA 5JTYA 4NF5B 2IA4A 3SEWA 4ZS9A 4KYEA 3PD8A 3ZKLA 3RN8A 1D9QA 3T1BA 3RGYA 3IB2A 2HPGA 4GWYA 3PD9A 1LSTA 3MC2A 1DBZA 4IO7A 2B3BA 3DP6A 4ZDMA 3LC8A 2ZYOA 1A7LA 3SDFA 3PMWA 1FPKA 3PPPA 3R26A 3SEYA 3ZKKA 1IMFA 1LAGE 1B51A 2WYKA 1P99A 4ESXA 3SEVA 4FORA 1URSA 3O6GA 2MKZA 3IB1A 3TMGA 3RQTA 2LAOA 3TCGA 4F3SA 4E0XA 2Q9TA 4IR8A 1N04A 2CEXA 2WOKA 2ALUA 2ESNA 2F7BA 1EU8A 1NV0A 1FPLA 2H99A 3MPKA 2YJPA 3VDFA 2DOJA 1NMUA 3VXCA 2PX1A 1MM6A 1AWBA 4QFPA 4M4GA 2FVZA 1PB9A 2X7QA 1SW5A 1H44A 4P1EA 2Q8MA 4ECFA 3K6UA 3U93A 4F3BA 1RDXA 1LBZA 4F2QA 3TTNA 3OO7A 3KSXA 4G2ZA 4OEVA 4JVIA 3RY3A 4YICA 5JK4A 5ICTA 3BBRA 3G7WA 2PFZA 4JSDA 4ZE9A 1Z7ME 3IAZA 3VLUA 2RINA 2ZZWA 3OENA 2UYEA 3W9VA 1SVXB 3PGFA 4QFLA 4Q5TA 3MPLA 1G0IA 2CEYA 5IAIA 2OZZA 5ESYA 4KYSA 3OXNA 5ET8A 1B46A 1MPBA 4IGRA 3IK6B 2DP8A 2X26A 1NNFA 4DLDA 2Z22A 4ELPA 4MHFA 4MH5A 3K01A 3CIJA 4R6HA 3FV2A 1LCTA 2QVVA 4FBPA 4YU0A 3PMXA 4O7IA 2FA7A 4MCOA 2OK2A 1LAXA 4KFQA 4OFJA 4JB7A 1NV2A 1FJ9A 4MJOA 1ZBMA 3TFLA 3TELA 4N07A 1MQIA 1FPBA 3HCQA 1B3FA 3OO6A 3PU5A 4KI0E 3HHFA 1ZMGA 1O63A 2H9BA 1CNQA 2QL3A 1FBFA 2VPNA 2UYFA 5CMMA 2G93A 1P1NA 2WKYA 1BK4A 3IJXB 5BWJA 5EYFA 2PCRA 2P1SA 4F18A 2E0SA 1N76A 2DXYA 4ZEFA 2F78A 2O84X 1P1OA 3LR1A 1DPPA 3C9HA 1FBDA 5KDTA 2V25A 2VGQA 3JZJA 3L6GA 3G3JA 1IMBA 1YXIA 4ONYA 4YB7A 2OBGA 1II5A 1B32A 3R6UA 3RYAA 3S9MC 1B7UA 5ET5A 3O6HA 5F7VA 4DXBA 1EYJA 1D9VA 4AB5A 1ZKBA 4PE5B 1NFTA 4N6DA 3PPQA 2QFLA 1XOCA 2FIEA 1FTOA 4BDNA 5K2XA 2DE3A 4H45A 3WAEA 1PBQA 2I0BA 3FZVA 4EQ9A 1R1NA 3ILTB 1NUWA 1FQCA 4PBHA 4H67A 3T96B 3O97A 3KFMA 3V5AA 4BLAA 4JWOA 4Z0IA 3KBZA 4NTLA 2VHAA 1QGXA 4PC9A 3DRJA 1OIBA 1TT1A 1LLSA 3O29A 4PF8A 2ZNTA 3N6UA 1MY4A 4DI3D 5IZ3A 1MY2A 1MPCA 3KEIA 2L5VA 4DXCA 1B6HA 2B4LA 1LEVA 4LZ7A 3N26A 2OJTA 1AH5A 1MH3A 4NF4B 3FXRA 1LB9A 5TP9A 3FASA 5H8FA 3MUQA 4F1UA 1MS7A 4MNIA 4PGNA 5HM4B 4HW8A 4NF8A 3O9PA 4H6DA 1M5EA 2FYIA 3LSWA 4OQOA 2X7PA 4FECA 4GL8A 5H8HB 1NUXA 5ITOA 1GGGA 4MLQA 2DE2A 4L17A 2QS4A 5ET7A 5DVIA 1Y1MA 3EF7A 4GWSA 1IIWA 3CR9A 4QSCA 2NXOA 1BKAA 4N8GA 3JYRA 1LFHA 1P1UA 4MMPA 1B4ZA 2HCAA 5FHNA 4DCXA 2W7YA 1OLCA 1UTHA 3CG3A 4LONB 3IL1B
chains in the Genus database with same CATH topology
4F1VA 4P11A 2XXYA 3C33A 2XX8A 3UGWA 4LATA 3M8UA 4ELRA 3H4ZA 3E13X 3FATA 4YKJA 1B3GA 3IOVA 2O69A 5IKBA 3MJNA 4F19A 1MXUA 1IXCA 1T0KA 1MY3A 3A3UA 1TFAA 4R9FA 4G68C 2THIA 1NNKA 2DYXA 3GBBA 4GF8A 3IJOB 3KOSA 3EN3A 1IXGA 3VV5A 3FVKA 1MPDA 3P7IA 3HHGA 5CMCA 4AB6A 2ZNSA 3THIA 1NKXA 3G3GA 2PYYA 2ZYKA 3KGCA 4U22A 5J1DA 2Y7IA 4G68A 4WKMA 2HZLA 3ILUB 3SETA 5TU0A 3K00A 4JXIA 4Q8RA 3U1OA 3WAFA 3FVOA 4HS7A 3UP9A 3H03A 3EPEA 2ANJA 1IXHA 1D4NA 2QS2A 2E1SA 3T22A 4PP0A 1QUKA 2ONSA 3MP1A 3DP8A 4R2BA 4WXJA 4Q0CA 1B05A 4U4XA 4IGTA 4DCYA 4NWDA 3T9UA 3O6PA 3KN7A 1A99A 2VD2A 5H8NB 4IO2A 4OETA 4IY6A 1QKBA 5L9SA 3MZ9A 1N84A 2ZNUA 3RTWB 3PMVA 1JVXA 5AA2D 4RPOA 1EZPA 3DRKA 5H8SA 4KQPA 2XXPA 1LBBA 4GIZA 4U23A 3N6TA 2GFEA 5I2NB 4QF9A 3IR1A 4PFUA 2YLNA 4IO3A 5A5XB 5HPQA 3W9WA 4R6YA 3V83A 3RPWA 1YTVA 3PUXE 2XXVA 1P1WA 1DOTA 4FIMA 3QSLA 5ELVA 1PB8A 4OWDA 5CBSA 1AIVA 1IEJA 4ZZEA 3E4RA 4IO5A 5TPAB 4FEDA 3SKPA 4GVOA 2HQ0A 4ESWA 4U2RA 3Q27A 1I6BA 4GD5A 2PVUA 1B3HA 3DP4A 3GZGA 1B0LA 2R9JA 1LCFA 4G8NA 2DWIA 4GLIA 2DE4A 1MDP1 2PT1A 4KHZE 4E0WA 2D3IA 3GLBA 5KCJB 4FATA 2RC9A 1ZIUA 1MXZA 4GXSB 2F8DA 2NUVA 2V3QA 1SW2A 4X1BA 3BFTA 3EHSA 3M3LA 1SI0A 1N7XA 3S4UA 3UN6A 1B3LA 5I57B 3TTLA 3CFZA 5I56A 4R73A 1ELJA 3TQLA 5DVFA 5ITPA 1B7HA 2A5TB 2UXAA 1B5JA 4JBZA 2DWAA 1TFDA 3ONMA 3S2VA 3LSFB 4O3AA 1XHYA 1FQAA 4NE4A 3EHUA 4KCDA 1MQGA 4LUBA 4NF5A 1RYXA 4OENA 4YB6A 3PAMA 1BTJA 3TTMA 3MP8A 3B6QA 3SESA 1J1NA 2NWJA 2GRVA 3M3KA 2NOOA 3A09A 1FCKA 2CMOA 1SDXA 3KG2A 4KYDA 3TAJA 2I4CA 1B5HA 1SW1A 4POXA 1FQEA 1SYHA 3U72A 3SEUA 3VLVA 5DT6A 4U1OA 2XXIA 5CC2A 5LOMA 1I6AA 4QFKA 1PBPA 4IO4A 5DTBA 2F34A 1M5FA 5AA3A 5I84A 5FTHA 5AA4B 3IX1A 1GV8A 4YKIA 3PV0E 5FHMA 1ZTYA 3OD7A 3QK6A 2Y84A 3OSRA 3K1MA 1ZJLA 4YZZA 5H8QB 1AOVA 1B7ZA 4K3FA 3PUWE 4LP2B 1S7YA 4DXUA 3K4UA 5AA1A 4O3CA 3GXAA 2HAUA 3TODA 3FGSA 3RYBA 3OSQA 1QW0A 3K6WA 2V3TA 3BFUA 3DM0A 3K1NA 1N3WA 1XT8A 3K6VA 3A3CA 1USYE 3MP6A 2I3WA 5I59B 2AIXA 3UK4A 1FTKA 4TLLB 1SD3A 1DTZA 1H45A 1B2HA 3V89B 4GXAA 1HSLA 4F22A 1XC1A 2QMWA 1Y1ZA 2O7UA 1BLFA 1Y9UA 2Q2CA 3T93B 3CHGA 1VFEA 4NF6B 1WDNA 4BDRA 1NH7A 3FUZA 1WODA 4IO6A 4H0WA 4R2FA 5FTIA 3CFLA 4OEUA 5ISUA 1JEUA 5B70A 2B3FA 3TQWA 4EF1A 1SBPA 3IO6A 3FXUA 2I0CA 2XXXA 4YMAA 4ZEBA 4QSEA 5CMKA 1B3EA 1GR2A 4F1YA 1HSJA 4POWA 2PT2A 3MBPA 1O64A 3FJ7A 1Y4TA 5DVJA 4RK2A 1URDA 2XD3A 4TLMB 4HTGA 1L5TA 4PFYA 4ISUA 2FNCA 3O2AA 3CSBA 2OWSA 5FHOA 4OTEA 3PPNA 3RNNA 3M3FA 2UVIA 5BUUA 2DXRA 2B4MA 1D9YA 3HV1A 1M5BA 4H65A 1RKMA 4RY1A 2QPQA 3U92A 1QJMA 3VVFA 4R9GA 3OEMA 3FV1A 2M8CA 4X9TA 2RC8A 1QUIA 1US5A 2HEUA 2HAVA 3C35A 1YAEA 4R75A 1MXVA 4RPNA 3RUMA 3TCHA 1NNTA 4OESA 2Y7KA 3H6TA 4Q30B 1IITA 1LBCA 3HSTA 2ABHA 4WEPA 2RC7A 4EUOA 3OO8A 1DMBA 3FD3A 4ZEKA 4H5FA 3ZSFA 2AL4A 4I1DA 2ONKE 1UIUA 1Y3PA 3U8QA 3IOTA 4UACA 1MG1A 2Y7PA 3TTKA 4OFOA 2A5SA 4NMYA 1VFDA 3I6VA 4EDPA 5F1QA 4F3PA 1UTBB 5AA2B 1NNPA 4F31B 4U4SA 5L8DA 3O66A 4DZ1A 3C32A 4H8JA 2AL5A 5AE4A 4OHNA 4NF4A 5I58B 3IO4A 3DRIA 4U1ZA 1MDQA 3TYHA 1XS5A 5CI5A 3GBAA 5H8HA 3UORA 3HO7A 1Y3QA 4XIGQ 2D21A 1B58A 4MFIA 3E3KA 2F7CA 4YKPA 2XXHA 3Q28A 2OCUA 3QAXA 3K6XA 1JETA 3LSLA 2AYSA 2UVJA 2F5XA 2Q89A 2P2AA 2XXQA 2XXTA 2VP1A 4ELQA 3O28A 2Z8FA 4R74A 2DSFA 4H5GA 1GVCA 2G29A 1MXYA 2V93A 3Q26A 3MVXA 2CZLA 2REJA 1SYIA 4F2OA 1AL3A 3RTFB 3MWBA 3UA8A 1A8EA 2O6AA 3OEKA 4U21A 4RA1A 3OOAA 1PC3A 3R7XA 4MBPA 4EF2A 3IOUA 3DELB 2VOZA 1MY0A 1IUDA 5L9MA 1B1XA 3F11A 4O3BA 4IB2A 3I5OA 1FTJA 3MZ1A 3C36A 3DRGA 3S9NC 3ZS6A 5HBCA 2Q8JA 3ECRA 4JDFA 4XTCQ 4BDOA 3TEPA 1NL5A 2O68A 3TPAA 4X1DA 4ZEDA 2Z8EA 4QRZA 3RT6B 3N94A 1A40A 1TXFA 1CB6A 5EHSA 1OQHA 5I2KB 3H6UA 2O7IA 5JTYB 3MVYA 4OMBA 4LA9A 4BDLA 2OLBA 2ZMBA 4PQJA 2R6GE 2DQVA 5H8NA 4GRKA 3TCFA 4R72A 4M1VA 1XVXA 3MW0A 4FE8A 2QMXA 3K1PA 1I6QA 4YAHX 2OWTA 2QRYA 4DE8A 1H3DA 1MQDA 4LQ5A 2GH9A 2XXWA 4KD5A 3EHTA 5CRYA 2PBWA 3PUYE 5I2NA 1ATGA 3PPRA 4RYAA 4WEDA 5I2KA 1M5CA 5A5XA 2I4BA 4P0GA 4FJPA 1NH8A 1LAHE 3FVNA 3HN0A 1P1QA 4TQUQ 4OFLA 4HCWA 2Y7RA 4OERA 1XVYA 3AXFA 3DRHA 4PFWA 1US4A 2QS3A 1I69A 1H43A 1MQJA 2F6GA 2V3UA 4KPTA 3KSJA 2KLFA 5TPAA 1M5DA 2DVZA 1TWYA 3USDA 1IZ1A 1ZU0A 4GL0A 3CG1A 3RT8A 3S9EA 4XKRA 4P0IA 4C1UA 2XHDA 1PB7A 4N6PA 4GQOA 4KCCA 2QS1A 1AMFA 3G3FA 2B65A 2PMSA 2ONRA 2O51A 3OELA 1BP5A 3KBRA 3W15C 4I8CA 2H5YA 1SQYA 3MVZA 4I9DA 3H3GA 2RF1A 3EQ1A 5KCJA 4EXKA 3LUYA 1RYOA 4G4PA 1FTMA 1OVTA 5I57A 4MF3A 2REGA 3K0VA 2A5TA 4LZ5A 3JV9A 4TOZA 3Q25A 1R9QA 4G8MA 3QIMA 1Q35A 1B0HA 5DEXB 1POY1 5L9OA 2O1MA 4ZECA 4OZ9A 3KN8A 1OQGA 3OO9A 2WOPA 3CVGA 4LZ8A 2UVHA 1QULA 3PPOA 1EZOA 3MZBA 1MM7A 4DDDA 2H4IA 1ZLQA 3TDJA 5KDTB 4NWCA 4XKQA 1VR5A 1WVJA 1A54A 3V8XB 1LFIA 1URGA 3L6HA 4OYVA 4UA8A 5M2VA 4EXLA 4X48A 1MH4A 3CSGA 1QVSA 4HCYA 2ZYMA 4G8HA 4R6KA 3LVUA 4N13A 1OMPA 1FW0A 2D5WA 3QYTA 5DEXA 4OXVA 1VE4A 3N5LA 1FQFA 2RKMA 1PDAA 1B1HA 3I3VA 5AA4A 1YPNA 1VSOA 4F39A 1N0TA 2I58A 3MAMA 3U94A 3OMBA 3ODBA 3IB0A 5B7DA 5H8QA 1Y3NA 3SERA 3TUSA 2DVCA 3D4GA 4G77A 2V84A 1N3XA 5TP9B 5H8FB 3G3KA 4NF8B 2F35A 1MRPA 1DTGA 2F97A 2VD3A 3VE1B 5I59A 1JQFA 4FEBA 3BKIB 4NEDA 1JEVA 2F6PA 4YKKA 4DIGA 2DWJA 4ZE8A 3B6WA 3K2DA 4GWOA 2Y7WA 4QFNA 1UQWA 2RCBA 1EZ9A 4RNSA 3FJGA 3B6TA 2NVUB 5CBRA 3CRBA 3C31A 4NF6A 1UTHB 5CM6A 1S9TA 2XX7A 2WOLA 3Q29A 4IY5A 2F36A 4LQ2A 1JW4A 3CFXA 2H98A 2QSXA 4Z7EA 3E9XA 3TTRA 4RJZA 3FVGA 1MQHA 3IORA 1B9JA 1Y4CA 1MY1A 2I6EA 4RK9A 1DPEA 3SEXA 4F3GA 5ICQA 1JNFA 4QFOA 1Z7NE 1H76A 3H6VA 5EHMA 4PETA 1B5IA 4PFTA 2Z23A 1A8FA 2YPNA 4ELOA 1FQDA 3KJTA 1HSEA 4G68B 4RXLA 3PUVE 1GTKA 2XXUA 4MLVA 3O6IA 3IOWA 2UVGA 3DLNA 4KR5A 4GFRA 4EQBA 2I3VA 1S50A 1R9LA 3T66A 2IEEA 1LB8A 3VVDA 1R6ZA 4OVJA 4BDQA 1LAFE 2XX9A 5CMBA 1DSNA 3CI8A 4JWXA 3S9LC 2RCAA 1UIVA 1MXXA 1Y20A 1Q1KA 1QKAA 3DRFA 4JSOA 1CE2A 2HZKA 5JEIA 2HXWA 1B4HA 4YB5A 3TZAA 4XKPA 2ZXTA 1JW1A 1UTBA 5AA2A 1LFGA 3T9XB 3RLFE 4AQ4A 1IXIA 3KOTA 1FQBA 1POTA 3FIRA 4H1XA 3G3HA 2I49A 5I58A 2F7AA 2HFBA 3T9VA 2BJJX 1JVYA 4ZEIA 1OLAA 1EH3A 4FAJA 1B52A 3D4CA 3KN3A 3MVWA 1D3KA 2GHBA 4ND9A 1QUJA 2DWHA 3QUJA 1JW5A 3LBSA 2GHAA 2Q2AA 3VLWA 3UIFA 4THIA 1B40A 2P0SA 4I62A 2Z8DA 5KZTA 2O1LA 2ZYNA 2Q88A 3LSXA 2XD2A 1OVBA 3FJMA 1BIYA 4XKNA 3H7MA 3FXQA 3QXMA 3K02A 1KWHA 2DS9A 3T9HB 1SI1A 2QJEA 2R71A 3C34A 2XXRA 1LGBC 3PUZE 4C1TA 1N7WA 1SW4A 1USYH 4LVQA 4QHQA 4F29A 3KJ7A 4JWYA 1IQ7A 3C4MA 1FTLA 3VXBA 4GOTA 4XXUA 1YCJA 2H25A 1MXWA 1ANFA 3TKDA 5I56B 3G3IA 1F9BA 5K2YA 3MQ9A 3HPIA 1A55A 3KZGA 3VFJA 3H6WA 2I48A 1O7TA 4QSDA 1PEBA 3H06B 3FTOA 3B7DA 3QUFA 4YMBA 5DYHA 4ZZAA 4BDMA 4EQ7A 4H8IA 3VVEA 4C0RA 5JTYA 4NF5B 2IA4A 3SEWA 4ZS9A 4KYEA 3PD8A 3ZKLA 3RN8A 3RGYA 3IB2A 3PD9A 1LSTA 3MC2A 4IO7A 2B3BA 3DP6A 4ZDMA 3LC8A 2ZYOA 1A7LA 3SDFA 3PMWA 3PPPA 3R26A 3SEYA 3ZKKA 1LAGE 1B51A 1P99A 4ESXA 3SEVA 4FORA 1URSA 3O6GA 3IB1A 3TMGA 3RQTA 2LAOA 3TCGA 4F3SA 4E0XA 2Q9TA 1N04A 2WOKA 2ALUA 2ESNA 2F7BA 1EU8A 2H99A 3MPKA 2YJPA 3VDFA 2DOJA 1NMUA 3VXCA 2PX1A 1MM6A 4QFPA 4M4GA 1PB9A 2X7QA 1SW5A 1H44A 4ECFA 3K6UA 3U93A 4F3BA 4F2QA 3TTNA 3OO7A 3KSXA 4G2ZA 4OEVA 3RY3A 4YICA 5JK4A 5ICTA 3BBRA 3G7WA 4JSDA 4ZE9A 1Z7ME 3IAZA 3VLUA 2RINA 3OENA 2UYEA 3W9VA 1SVXB 3PGFA 4QFLA 4Q5TA 3MPLA 5IAIA 2OZZA 4KYSA 3OXNA 1B46A 1MPBA 4IGRA 3IK6B 2DP8A 2X26A 1NNFA 4DLDA 2Z22A 4ELPA 4MH5A 3K01A 3CIJA 4R6HA 3FV2A 1LCTA 4YU0A 3PMXA 2FA7A 2OK2A 1LAXA 4KFQA 4OFJA 4JB7A 1ZBMA 3TFLA 3TELA 4N07A 1MQIA 3HCQA 1B3FA 3OO6A 3PU5A 4KI0E 3HHFA 1ZMGA 1O63A 2H9BA 2QL3A 2UYFA 5CMMA 2G93A 1P1NA 2WKYA 3IJXB 5BWJA 5EYFA 2P1SA 4F18A 2E0SA 1N76A 2DXYA 4ZEFA 2F78A 2O84X 1P1OA 3LR1A 1DPPA 3C9HA 5KDTA 2V25A 2VGQA 3JZJA 3L6GA 3G3JA 4ONYA 4YB7A 2OBGA 1II5A 1B32A 3R6UA 3RYAA 3S9MC 1B7UA 3O6HA 5F7VA 4DXBA 1D9VA 4AB5A 1ZKBA 4PE5B 1NFTA 3PPQA 1XOCA 1FTOA 4BDNA 5K2XA 2DE3A 3WAEA 1PBQA 4EQ9A 2I0BA 3FZVA 1R1NA 3ILTB 1FQCA 4H67A 3T96B 3O97A 3KFMA 3V5AA 4BLAA 4JWOA 4Z0IA 4NTLA 2VHAA 3DRJA 1OIBA 1TT1A 1LLSA 3O29A 2ZNTA 3N6UA 1MY4A 1MY2A 1MPCA 3KEIA 4DXCA 1B6HA 2B4LA 4LZ7A 3N26A 2OJTA 1AH5A 1MH3A 4NF4B 3FXRA 1LB9A 5TP9A 3FASA 5H8FA 3MUQA 4F1UA 1MS7A 5HM4B 4HW8A 4NF8A 3O9PA 4H6DA 1M5EA 2FYIA 3LSWA 4OQOA 2X7PA 4FECA 4GL8A 5H8HB 5ITOA 1GGGA 4MLQA 2DE2A 4L17A 2QS4A 5DVIA 1Y1MA 3EF7A 1IIWA 3CR9A 4QSCA 2NXOA 1BKAA 3JYRA 1LFHA 1P1UA 1B4ZA 2HCAA 5FHNA 4DCXA 2W7YA 1OLCA 1UTHA 3CG3A 4LONB 3IL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1V A;  4P11 A;  2XXY A;  3C33 A;  2XX8 A;  3UGW A;  4LAT A;  3M8U A;  4ELR A;  3H4Z A;  3E13 X;  3FAT A;  4YKJ A;  1B3G A;  3IOV A;  2O69 A;  5IKB A;  3MJN A;  4F19 A;  1MXU A;  1IXC A;  1T0K A;  1MY3 A;  3A3U A;  1TFA A;  4R9F A;  4G68 C;  2THI A;  1NNK A;  2DYX A;  3GBB A;  4GF8 A;  3IJO B;  3KOS A;  3EN3 A;  1IXG A;  3VV5 A;  3FVK A;  1MPD A;  3P7I A;  3HHG A;  5CMC A;  4AB6 A;  2ZNS A;  3THI A;  1NKX A;  3G3G A;  2PYY A;  2ZYK A;  3KGC A;  4U22 A;  5J1D A;  2Y7I A;  4G68 A;  4WKM A;  2HZL A;  3ILU B;  3SET A;  5TU0 A;  3K00 A;  4JXI A;  4Q8R A;  3U1O A;  3WAF A;  3FVO A;  4HS7 A;  3UP9 A;  3H03 A;  3EPE A;  2ANJ A;  1IXH A;  1D4N A;  2QS2 A;  2E1S A;  3T22 A;  4PP0 A;  1QUK A;  2ONS A;  3MP1 A;  3DP8 A;  4R2B A;  4WXJ A;  4Q0C A;  1B05 A;  4U4X A;  4IGT A;  4DCY A;  4NWD A;  3T9U A;  3O6P A;  3KN7 A;  1A99 A;  2VD2 A;  5H8N B;  4IO2 A;  4OET A;  4IY6 A;  1QKB A;  5L9S A;  3MZ9 A;  1N84 A;  2ZNU A;  3RTW B;  3PMV A;  1JVX A;  5AA2 D;  4RPO A;  1EZP A;  3DRK A;  5H8S A;  4KQP A;  2XXP A;  1LBB A;  4GIZ A;  4U23 A;  3N6T A;  2GFE A;  5I2N B;  4QF9 A;  3IR1 A;  4PFU A;  2YLN A;  4IO3 A;  5A5X B;  5HPQ A;  3W9W A;  4R6Y A;  3V83 A;  3RPW A;  1YTV A;  3PUX E;  2XXV A;  1P1W A;  1DOT A;  4FIM A;  3QSL A;  5ELV A;  1PB8 A;  4OWD A;  5CBS A;  1AIV A;  1IEJ A;  4ZZE A;  3E4R A;  4IO5 A;  5TPA B;  4FED A;  3SKP A;  4GVO A;  2HQ0 A;  4ESW A;  4U2R A;  3Q27 A;  1I6B A;  4GD5 A;  2PVU A;  1B3H A;  3DP4 A;  3GZG A;  1B0L A;  2R9J A;  1LCF A;  4G8N A;  2DWI A;  4GLI A;  2DE4 A;  1MDP 1;  2PT1 A;  4KHZ E;  4E0W A;  2D3I A;  3GLB A;  5KCJ B;  4FAT A;  2RC9 A;  1ZIU A;  1MXZ A;  4GXS B;  2F8D A;  2NUV A;  2V3Q A;  1SW2 A;  4X1B A;  3BFT A;  3EHS A;  3M3L A;  1SI0 A;  1N7X A;  3S4U A;  3UN6 A;  1B3L A;  5I57 B;  3TTL A;  3CFZ A;  5I56 A;  4R73 A;  1ELJ A;  3TQL A;  5DVF A;  5ITP A;  1B7H A;  2A5T B;  2UXA A;  1B5J A;  4JBZ A;  2DWA A;  1TFD A;  3ONM A;  3S2V A;  3LSF B;  4O3A A;  1XHY A;  1FQA A;  4NE4 A;  3EHU A;  4KCD A;  1MQG A;  4LUB A;  4NF5 A;  1RYX A;  4OEN A;  4YB6 A;  3PAM A;  1BTJ A;  3TTM A;  3MP8 A;  3B6Q A;  3SES A;  1J1N A;  2NWJ A;  2GRV A;  3M3K A;  2NOO A;  3A09 A;  1FCK A;  2CMO A;  1SDX A;  3KG2 A;  4KYD A;  3TAJ A;  2I4C A;  1B5H A;  1SW1 A;  4POX A;  1FQE A;  1SYH A;  3U72 A;  3SEU A;  3VLV A;  5DT6 A;  4U1O A;  2XXI A;  5CC2 A;  5LOM A;  1I6A A;  4QFK A;  1PBP A;  4IO4 A;  5DTB A;  2F34 A;  1M5F A;  5AA3 A;  5I84 A;  5FTH A;  5AA4 B;  3IX1 A;  1GV8 A;  4YKI A;  3PV0 E;  5FHM A;  1ZTY A;  3OD7 A;  3QK6 A;  2Y84 A;  3OSR A;  3K1M A;  1ZJL A;  4YZZ A;  5H8Q B;  1AOV A;  1B7Z A;  4K3F A;  3PUW E;  4LP2 B;  1S7Y A;  4DXU A;  3K4U A;  5AA1 A;  4O3C A;  3GXA A;  2HAU A;  3TOD A;  3FGS A;  3RYB A;  3OSQ A;  1QW0 A;  3K6W A;  2V3T A;  3BFU A;  3DM0 A;  3K1N A;  1N3W A;  1XT8 A;  3K6V A;  3A3C A;  1USY E;  3MP6 A;  2I3W A;  5I59 B;  2AIX A;  3UK4 A;  1FTK A;  4TLL B;  1SD3 A;  1DTZ A;  1H45 A;  1B2H A;  3V89 B;  4GXA A;  1HSL A;  4F22 A;  1XC1 A;  2QMW A;  1Y1Z A;  2O7U A;  1BLF A;  1Y9U A;  2Q2C A;  3T93 B;  3CHG A;  1VFE A;  4NF6 B;  1WDN A;  4BDR A;  1NH7 A;  3FUZ A;  1WOD A;  4IO6 A;  4H0W A;  4R2F A;  5FTI A;  3CFL A;  4OEU A;  5ISU A;  1JEU A;  5B70 A;  2B3F A;  3TQW A;  4EF1 A;  1SBP A;  3IO6 A;  3FXU A;  2I0C A;  2XXX A;  4YMA A;  4ZEB A;  4QSE A;  5CMK A;  1B3E A;  1GR2 A;  4F1Y A;  1HSJ A;  4POW A;  2PT2 A;  3MBP A;  1O64 A;  3FJ7 A;  1Y4T A;  5DVJ A;  4RK2 A;  1URD A;  2XD3 A;  4TLM B;  4HTG A;  1L5T A;  4PFY A;  4ISU A;  2FNC A;  3O2A A;  3CSB A;  2OWS A;  5FHO A;  4OTE A;  3PPN A;  3RNN A;  3M3F A;  2UVI A;  5BUU A;  2DXR A;  2B4M A;  1D9Y A;  3HV1 A;  1M5B A;  4H65 A;  1RKM A;  4RY1 A;  2QPQ A;  3U92 A;  1QJM A;  3VVF A;  4R9G A;  3OEM A;  3FV1 A;  2M8C A;  4X9T A;  2RC8 A;  1QUI A;  1US5 A;  2HEU A;  2HAV A;  3C35 A;  1YAE A;  4R75 A;  1MXV A;  4RPN A;  3RUM A;  3TCH A;  1NNT A;  4OES A;  2Y7K A;  3H6T A;  4Q30 B;  1IIT A;  1LBC A;  3HST A;  2ABH A;  4WEP A;  2RC7 A;  4EUO A;  3OO8 A;  1DMB A;  3FD3 A;  4ZEK A;  4H5F A;  3ZSF A;  2AL4 A;  4I1D A;  2ONK E;  1UIU A;  1Y3P A;  3U8Q A;  3IOT A;  4UAC A;  1MG1 A;  2Y7P A;  3TTK A;  4OFO A;  2A5S A;  4NMY A;  1VFD A;  3I6V A;  4EDP A;  5F1Q A;  4F3P A;  1UTB B;  5AA2 B;  1NNP A;  4F31 B;  4U4S A;  5L8D A;  3O66 A;  4DZ1 A;  3C32 A;  4H8J A;  2AL5 A;  5AE4 A;  4OHN A;  4NF4 A;  5I58 B;  3IO4 A;  3DRI A;  4U1Z A;  1MDQ A;  3TYH A;  1XS5 A;  5CI5 A;  3GBA A;  5H8H A;  3UOR A;  3HO7 A;  1Y3Q A;  4XIG Q;  2D21 A;  1B58 A;  4MFI A;  3E3K A;  2F7C A;  4YKP A;  2XXH A;  3Q28 A;  2OCU A;  3QAX A;  3K6X A;  1JET A;  3LSL A;  2AYS A;  2UVJ A;  2F5X A;  2Q89 A;  2P2A A;  2XXQ A;  2XXT A;  2VP1 A;  4ELQ A;  3O28 A;  2Z8F A;  4R74 A;  2DSF A;  4H5G A;  1GVC A;  2G29 A;  1MXY A;  2V93 A;  3Q26 A;  3MVX A;  2CZL A;  2REJ A;  1SYI A;  4F2O A;  1AL3 A;  3RTF B;  3MWB A;  3UA8 A;  1A8E A;  2O6A A;  3OEK A;  4U21 A;  4RA1 A;  3OOA A;  1PC3 A;  3R7X A;  4MBP A;  4EF2 A;  3IOU A;  3DEL B;  2VOZ A;  1MY0 A;  1IUD A;  5L9M A;  1B1X A;  3F11 A;  4O3B A;  4IB2 A;  3I5O A;  1FTJ A;  3MZ1 A;  3C36 A;  3DRG A;  3S9N C;  3ZS6 A;  5HBC A;  2Q8J A;  3ECR A;  4JDF A;  4XTC Q;  4BDO A;  3TEP A;  1NL5 A;  2O68 A;  3TPA A;  4X1D A;  4ZED A;  2Z8E A;  4QRZ A;  3RT6 B;  3N94 A;  1A40 A;  1TXF A;  1CB6 A;  5EHS A;  1OQH A;  5I2K B;  3H6U A;  2O7I A;  5JTY B;  3MVY A;  4OMB A;  4LA9 A;  4BDL A;  2OLB A;  2ZMB A;  4PQJ A;  2R6G E;  2DQV A;  5H8N A;  4GRK A;  3TCF A;  4R72 A;  4M1V A;  1XVX A;  3MW0 A;  4FE8 A;  2QMX A;  3K1P A;  1I6Q A;  4YAH X;  2OWT A;  2QRY A;  4DE8 A;  1H3D A;  1MQD A;  4LQ5 A;  2GH9 A;  2XXW A;  4KD5 A;  3EHT A;  5CRY A;  2PBW A;  3PUY E;  5I2N A;  1ATG A;  3PPR A;  4RYA A;  4WED A;  5I2K A;  1M5C A;  5A5X A;  2I4B A;  4P0G A;  4FJP A;  1NH8 A;  1LAH E;  3FVN A;  3HN0 A;  1P1Q A;  4TQU Q;  4OFL A;  4HCW A;  2Y7R A;  4OER A;  1XVY A;  3AXF A;  3DRH A;  4PFW A;  1US4 A;  2QS3 A;  1I69 A;  1H43 A;  1MQJ A;  2F6G A;  2V3U A;  4KPT A;  3KSJ A;  2KLF A;  5TPA A;  1M5D A;  2DVZ A;  1TWY A;  3USD A;  1IZ1 A;  1ZU0 A;  4GL0 A;  3CG1 A;  3RT8 A;  3S9E A;  4XKR A;  4P0I A;  4C1U A;  2XHD A;  1PB7 A;  4N6P A;  4GQO A;  4KCC A;  2QS1 A;  1AMF A;  3G3F A;  2B65 A;  2PMS A;  2ONR A;  2O51 A;  3OEL A;  1BP5 A;  3KBR A;  3W15 C;  4I8C A;  2H5Y A;  1SQY A;  3MVZ A;  4I9D A;  3H3G A;  2RF1 A;  3EQ1 A;  5KCJ A;  4EXK A;  3LUY A;  1RYO A;  4G4P A;  1FTM A;  1OVT A;  5I57 A;  4MF3 A;  2REG A;  3K0V A;  2A5T A;  4LZ5 A;  3JV9 A;  4TOZ A;  3Q25 A;  1R9Q A;  4G8M A;  3QIM A;  1Q35 A;  1B0H A;  5DEX B;  1POY 1;  5L9O A;  2O1M A;  4ZEC A;  4OZ9 A;  3KN8 A;  1OQG A;  3OO9 A;  2WOP A;  3CVG A;  4LZ8 A;  2UVH A;  1QUL A;  3PPO A;  1EZO A;  3MZB A;  1MM7 A;  4DDD A;  2H4I A;  1ZLQ A;  3TDJ A;  5KDT B;  4NWC A;  4XKQ A;  1VR5 A;  1WVJ A;  1A54 A;  3V8X B;  1LFI A;  1URG A;  3L6H A;  4OYV A;  4UA8 A;  5M2V A;  4EXL A;  4X48 A;  1MH4 A;  3CSG A;  1QVS A;  4HCY A;  2ZYM A;  4G8H A;  4R6K A;  3LVU A;  4N13 A;  1OMP A;  1FW0 A;  2D5W A;  3QYT A;  5DEX A;  4OXV A;  1VE4 A;  3N5L A;  1FQF A;  2RKM A;  1PDA A;  1B1H A;  3I3V A;  5AA4 A;  1YPN A;  1VSO A;  4F39 A;  1N0T A;  2I58 A;  3MAM A;  3U94 A;  3OMB A;  3ODB A;  3IB0 A;  5B7D A;  5H8Q A;  1Y3N A;  3SER A;  3TUS A;  2DVC A;  3D4G A;  4G77 A;  2V84 A;  1N3X A;  5TP9 B;  5H8F B;  3G3K A;  4NF8 B;  2F35 A;  1MRP A;  1DTG A;  2F97 A;  2VD3 A;  3VE1 B;  5I59 A;  1JQF A;  4FEB A;  3BKI B;  4NED A;  1JEV A;  2F6P A;  4YKK A;  4DIG A;  2DWJ A;  4ZE8 A;  3B6W A;  3K2D A;  4GWO A;  2Y7W A;  4QFN A;  1UQW A;  2RCB A;  1EZ9 A;  4RNS A;  3FJG A;  3B6T A;  2NVU B;  5CBR A;  3CRB A;  3C31 A;  4NF6 A;  1UTH B;  5CM6 A;  1S9T A;  2XX7 A;  2WOL A;  3Q29 A;  4IY5 A;  2F36 A;  4LQ2 A;  1JW4 A;  3CFX A;  2H98 A;  2QSX A;  4Z7E A;  3E9X A;  3TTR A;  4RJZ A;  3FVG A;  1MQH A;  3IOR A;  1B9J A;  1Y4C A;  1MY1 A;  2I6E A;  4RK9 A;  1DPE A;  3SEX A;  4F3G A;  5ICQ A;  1JNF A;  4QFO A;  1Z7N E;  1H76 A;  3H6V A;  5EHM A;  4PET A;  1B5I A;  4PFT A;  2Z23 A;  1A8F A;  2YPN A;  4ELO A;  1FQD A;  3KJT A;  1HSE A;  4G68 B;  4RXL A;  3PUV E;  1GTK A;  2XXU A;  4MLV A;  3O6I A;  3IOW A;  2UVG A;  3DLN A;  4KR5 A;  4GFR A;  4EQB A;  2I3V A;  1S50 A;  1R9L A;  3T66 A;  2IEE A;  1LB8 A;  3VVD A;  1R6Z A;  4OVJ A;  4BDQ A;  1LAF E;  2XX9 A;  5CMB A;  1DSN A;  3CI8 A;  4JWX A;  3S9L C;  2RCA A;  1UIV A;  1MXX A;  1Y20 A;  1Q1K A;  1QKA A;  3DRF A;  4JSO A;  1CE2 A;  2HZK A;  5JEI A;  2HXW A;  1B4H A;  4YB5 A;  3TZA A;  4XKP A;  2ZXT A;  1JW1 A;  1UTB A;  5AA2 A;  1LFG A;  3T9X B;  3RLF E;  4AQ4 A;  1IXI A;  3KOT A;  1FQB A;  1POT A;  3FIR A;  4H1X A;  3G3H A;  2I49 A;  5I58 A;  2F7A A;  2HFB A;  3T9V A;  2BJJ X;  1JVY A;  4ZEI A;  1OLA A;  1EH3 A;  4FAJ A;  1B52 A;  3D4C A;  3KN3 A;  3MVW A;  1D3K A;  2GHB A;  4ND9 A;  1QUJ A;  2DWH A;  3QUJ A;  1JW5 A;  3LBS A;  2GHA A;  2Q2A A;  3VLW A;  3UIF A;  4THI A;  1B40 A;  2P0S A;  4I62 A;  2Z8D A;  5KZT A;  2O1L A;  2ZYN A;  2Q88 A;  3LSX A;  2XD2 A;  1OVB A;  3FJM A;  1BIY A;  4XKN A;  3H7M A;  3FXQ A;  3QXM A;  3K02 A;  1KWH A;  2DS9 A;  3T9H B;  1SI1 A;  2QJE A;  2R71 A;  3C34 A;  2XXR A;  1LGB C;  3PUZ E;  4C1T A;  1N7W A;  1SW4 A;  1USY H;  4LVQ A;  4QHQ A;  4F29 A;  3KJ7 A;  4JWY A;  1IQ7 A;  3C4M A;  1FTL A;  3VXB A;  4GOT A;  4XXU A;  1YCJ A;  2H25 A;  1MXW A;  1ANF A;  3TKD A;  5I56 B;  3G3I A;  1F9B A;  5K2Y A;  3MQ9 A;  3HPI A;  1A55 A;  3KZG A;  3VFJ A;  3H6W A;  2I48 A;  1O7T A;  4QSD A;  1PEB A;  3H06 B;  3FTO A;  3B7D A;  3QUF A;  4YMB A;  5DYH A;  4ZZA A;  4BDM A;  4EQ7 A;  4H8I A;  3VVE A;  4C0R A;  5JTY A;  4NF5 B;  2IA4 A;  3SEW A;  4ZS9 A;  4KYE A;  3PD8 A;  3ZKL A;  3RN8 A;  3RGY A;  3IB2 A;  3PD9 A;  1LST A;  3MC2 A;  4IO7 A;  2B3B A;  3DP6 A;  4ZDM A;  3LC8 A;  2ZYO A;  1A7L A;  3SDF A;  3PMW A;  3PPP A;  3R26 A;  3SEY A;  3ZKK A;  1LAG E;  1B51 A;  1P99 A;  4ESX A;  3SEV A;  4FOR A;  1URS A;  3O6G A;  3IB1 A;  3TMG A;  3RQT A;  2LAO A;  3TCG A;  4F3S A;  4E0X A;  2Q9T A;  1N04 A;  2WOK A;  2ALU A;  2ESN A;  2F7B A;  1EU8 A;  2H99 A;  3MPK A;  2YJP A;  3VDF A;  2DOJ A;  1NMU A;  3VXC A;  2PX1 A;  1MM6 A;  4QFP A;  4M4G A;  1PB9 A;  2X7Q A;  1SW5 A;  1H44 A;  4ECF A;  3K6U A;  3U93 A;  4F3B A;  4F2Q A;  3TTN A;  3OO7 A;  3KSX A;  4G2Z A;  4OEV A;  3RY3 A;  4YIC A;  5JK4 A;  5ICT A;  3BBR A;  3G7W A;  4JSD A;  4ZE9 A;  1Z7M E;  3IAZ A;  3VLU A;  2RIN A;  3OEN A;  2UYE A;  3W9V A;  1SVX B;  3PGF A;  4QFL A;  4Q5T A;  3MPL A;  5IAI A;  2OZZ A;  4KYS A;  3OXN A;  1B46 A;  1MPB A;  4IGR A;  3IK6 B;  2DP8 A;  2X26 A;  1NNF A;  4DLD A;  2Z22 A;  4ELP A;  4MH5 A;  3K01 A;  3CIJ A;  4R6H A;  3FV2 A;  1LCT A;  4YU0 A;  3PMX A;  2FA7 A;  2OK2 A;  1LAX A;  4KFQ A;  4OFJ A;  4JB7 A;  1ZBM A;  3TFL A;  3TEL A;  4N07 A;  1MQI A;  3HCQ A;  1B3F A;  3OO6 A;  3PU5 A;  4KI0 E;  3HHF A;  1ZMG A;  1O63 A;  2H9B A;  2QL3 A;  2UYF A;  5CMM A;  2G93 A;  1P1N A;  2WKY A;  3IJX B;  5BWJ A;  5EYF A;  2P1S A;  4F18 A;  2E0S A;  1N76 A;  2DXY A;  4ZEF A;  2F78 A;  2O84 X;  1P1O A;  3LR1 A;  1DPP A;  3C9H A;  5KDT A;  2V25 A;  2VGQ A;  3JZJ A;  3L6G A;  3G3J A;  4ONY A;  4YB7 A;  2OBG A;  1II5 A;  1B32 A;  3R6U A;  3RYA A;  3S9M C;  1B7U A;  3O6H A;  5F7V A;  4DXB A;  1D9V A;  4AB5 A;  1ZKB A;  4PE5 B;  1NFT A;  3PPQ A;  1XOC A;  1FTO A;  4BDN A;  5K2X A;  2DE3 A;  3WAE A;  1PBQ A;  4EQ9 A;  2I0B A;  3FZV A;  1R1N A;  3ILT B;  1FQC A;  4H67 A;  3T96 B;  3O97 A;  3KFM A;  3V5A A;  4BLA A;  4JWO A;  4Z0I A;  4NTL A;  2VHA A;  3DRJ A;  1OIB A;  1TT1 A;  1LLS A;  3O29 A;  2ZNT A;  3N6U A;  1MY4 A;  1MY2 A;  1MPC A;  3KEI A;  4DXC A;  1B6H A;  2B4L A;  4LZ7 A;  3N26 A;  2OJT A;  1AH5 A;  1MH3 A;  4NF4 B;  3FXR A;  1LB9 A;  5TP9 A;  3FAS A;  5H8F A;  3MUQ A;  4F1U A;  1MS7 A;  5HM4 B;  4HW8 A;  4NF8 A;  3O9P A;  4H6D A;  1M5E A;  2FYI A;  3LSW A;  4OQO A;  2X7P A;  4FEC A;  4GL8 A;  5H8H B;  5ITO A;  1GGG A;  4MLQ A;  2DE2 A;  4L17 A;  2QS4 A;  5DVI A;  1Y1M A;  3EF7 A;  1IIW A;  3CR9 A;  4QSC A;  2NXO A;  1BKA A;  3JYR A;  1LFH A;  1P1U A;  1B4Z A;  2HCA A;  5FHN A;  4DCX A;  2W7Y A;  1OLC A;  1UTH A;  3CG3 A;  4LON B;  3IL1 B; 
#chains in the Genus database with same CATH topology
 4F1V A;  4P11 A;  2XXY A;  3C33 A;  2XX8 A;  1YYZ A;  4LAT A;  3UGW A;  3M8U A;  3B50 A;  4ELR A;  3H4Z A;  3E13 X;  3FAT A;  4YKJ A;  1B3G A;  3IOV A;  1FSA A;  2O69 A;  5IKB A;  3MJN A;  4F19 A;  1MXU A;  1NV4 A;  1IXC A;  1T0K A;  1MY3 A;  3A3U A;  1TFA A;  1LBY A;  4R9F A;  4G68 C;  2THI A;  1NNK A;  2DYX A;  3GBB A;  4GF8 A;  3IJO B;  3KOS A;  3EN3 A;  1IXG A;  3VV5 A;  3FVK A;  5IGA A;  1MPD A;  3P7I A;  3HHG A;  5CMC A;  4AB6 A;  2ZNS A;  3THI A;  1NKX A;  3G3G A;  2PYY A;  2ZYK A;  3KGC A;  1LBV A;  4U22 A;  5J1D A;  4O94 A;  2Y7I A;  4G68 A;  4WKM A;  2HZL A;  3ILU B;  4P47 A;  3SET A;  5TU0 A;  3K00 A;  4JXI A;  4Q8R A;  3U1O A;  4X04 A;  3WAF A;  3FVO A;  4HS7 A;  3UP9 A;  3H03 A;  3EPE A;  2ANJ A;  1IXH A;  1D4N A;  2QS2 A;  2E1S A;  3T22 A;  4PP0 A;  3MYU A;  1QUK A;  2ONS A;  4GX6 A;  3MP1 A;  3DP8 A;  4R2B A;  4WXJ A;  4Q0C A;  1B05 A;  4U4X A;  4IGT A;  4DCY A;  4NWD A;  3T9U A;  3O6P A;  1KA0 A;  3KN7 A;  1A99 A;  2VD2 A;  5H8N B;  4IO2 A;  2VPO A;  4OET A;  4IY6 A;  1QKB A;  2OWZ A;  5L9S A;  3MZ9 A;  1FPI A;  1N84 A;  2ZNU A;  3RTW B;  3PMV A;  1NV5 A;  3RPL A;  1JVX A;  5AA2 D;  4RPO A;  4I3E A;  1IME A;  2HHM A;  1EZP A;  4KXP A;  1IMA A;  3DRK A;  4XEQ A;  2JJK A;  2Y5K A;  4GX4 A;  5H8S A;  4KQP A;  2XXP A;  1NV6 A;  1LBB A;  4GIZ A;  4U23 A;  3N6T A;  2GFE A;  5I2N B;  4QF9 A;  3IR1 A;  4PFU A;  2YLN A;  4IO3 A;  5A5X B;  5HPQ A;  2WBD A;  3W9W A;  4R6Y A;  3V83 A;  3RPW A;  1YTV A;  3PUX E;  2XXV A;  1P1W A;  1DOT A;  4FIM A;  3QSL A;  5ELV A;  1PB8 A;  4OWD A;  5CBS A;  1AIV A;  3T0J A;  1IEJ A;  4GBV A;  4ZZE A;  3E4R A;  4PDD A;  4IO5 A;  5TPA B;  4FED A;  3SKP A;  4GVO A;  2HQ0 A;  4ESW A;  4U2R A;  3Q27 A;  1FPF A;  1I6B A;  4GD5 A;  2PVU A;  1B3H A;  4OVQ A;  3DP4 A;  1INP A;  3GZG A;  3SZP A;  1B0L A;  2R9J A;  1LCF A;  4G8N A;  2DWI A;  4GLI A;  2DE4 A;  4OVS A;  1MDP 1;  2PT1 A;  4KHZ E;  4E0W A;  2D3I A;  3GLB A;  4XF5 A;  5KCJ B;  4FAT A;  2RC9 A;  1ZIU A;  1MXZ A;  4GXS B;  2F8D A;  2NUV A;  2V3Q A;  1SW2 A;  4GWW A;  4X1B A;  3BFT A;  3EHS A;  3M3L A;  1SI0 A;  1N7X A;  3S4U A;  3UN6 A;  1B3L A;  5I57 B;  3TTL A;  3CFZ A;  2FHY A;  5I56 A;  4R73 A;  1ELJ A;  3TQL A;  5DVF A;  5ITP A;  1B7H A;  2A5T B;  2UXA A;  1B5J A;  4GX3 A;  4JBZ A;  5I7I A;  3GYY A;  4N81 A;  4NN3 A;  2DWA A;  1TFD A;  3ONM A;  3S2V A;  3LSF B;  4O3A A;  1XHY A;  5T3J A;  1FQA A;  4NE4 A;  1NI9 A;  3EHU A;  4KCD A;  1MQG A;  4LUB A;  3LUZ A;  4NF5 A;  4NX1 A;  1RYX A;  4OEN A;  3KC0 A;  4YB6 A;  2VT5 A;  3PAM A;  1BTJ A;  3TTM A;  3MP8 A;  4LN5 A;  3B6Q A;  3SES A;  1J1N A;  5F24 A;  2NWJ A;  4HXV A;  2GRV A;  3M3K A;  5EQ8 A;  2NOO A;  3A09 A;  1FCK A;  2CMO A;  1SDX A;  3KG2 A;  4KYD A;  3TAJ A;  2I4C A;  1B5H A;  1SW1 A;  2WBB A;  4POX A;  1FQE A;  1SYH A;  3U72 A;  3SEU A;  3VLV A;  5DT6 A;  4U1O A;  2XXI A;  5CC2 A;  5LOM A;  1I6A A;  4QFK A;  1PBP A;  4IO4 A;  5DTB A;  2F34 A;  1M5F A;  5AA3 A;  5I84 A;  5FTH A;  5AA4 B;  3IX1 A;  1GV8 A;  4YKI A;  3PV0 E;  5FHM A;  1ZTY A;  3OD7 A;  3QK6 A;  1G0H A;  2Y84 A;  3OSR A;  3K1M A;  1ZJL A;  4YZZ A;  5H8Q B;  1AOV A;  4P1L A;  1B7Z A;  4N17 A;  4K3F A;  3PUW E;  1FRP A;  4LP2 B;  1S7Y A;  4DXU A;  4NAP A;  3K4U A;  5AA1 A;  4O3C A;  1FBE A;  3GXA A;  4MX6 A;  2HAU A;  3TOD A;  3FGS A;  3RYB A;  3OSQ A;  1QW0 A;  3K6W A;  2V3T A;  3BFU A;  3DM0 A;  4PAF A;  3K1N A;  1N3W A;  1XT8 A;  3K6V A;  3A3C A;  4PCD A;  1USY E;  3MP6 A;  2I3W A;  3FXB A;  5I59 B;  2AIX A;  3UK4 A;  1FTK A;  1NUZ A;  1SD3 A;  4TLL B;  1DTZ A;  1H45 A;  1B2H A;  4XFE A;  3V89 B;  4GXA A;  1HSL A;  4F22 A;  1XC1 A;  2QMW A;  1Y1Z A;  2O7U A;  4HE0 A;  1BLF A;  1Y9U A;  2Q2C A;  3T93 B;  3CHG A;  4HE2 A;  1VFE A;  4NF6 B;  1WDN A;  3PTY A;  4BDR A;  1NH7 A;  3FUZ A;  1WOD A;  4IO6 A;  4H0W A;  4R2F A;  5FTI A;  3CFL A;  4OEU A;  2CZH A;  5ISU A;  1JEU A;  5I3S A;  5B70 A;  2B3F A;  3TQW A;  4EF1 A;  1SBP A;  2CZK A;  3IO6 A;  3FXU A;  2I0C A;  2XXX A;  1FBH A;  4YMA A;  4ZEB A;  4QSE A;  5CMK A;  1B3E A;  4I40 A;  4GWZ A;  1GR2 A;  4F1Y A;  1HSJ A;  4POW A;  2PT2 A;  3MBP A;  1O64 A;  3FJ7 A;  1Y4T A;  2FBP A;  5DVJ A;  4RK2 A;  4P9K A;  1URD A;  3NOH A;  5DW8 A;  2WEF A;  2XD3 A;  4TLM B;  4HTG A;  1L5T A;  4PFY A;  4ISU A;  2FNC A;  3O2A A;  3CSB A;  2OWS A;  5FHO A;  4OTE A;  3PPN A;  2F3D A;  3RNN A;  3M3F A;  2UVI A;  5BUU A;  2DXR A;  2B4M A;  1D9Y A;  3HV1 A;  1M5B A;  4H65 A;  1RKM A;  4RY1 A;  2QPQ A;  3U92 A;  1QJM A;  2HXR A;  3VVF A;  4R9G A;  3OEM A;  3FV1 A;  2M8C A;  4X9T A;  2RC8 A;  1IMC A;  1QUI A;  1US5 A;  4N15 A;  2HEU A;  2HAV A;  3C35 A;  1YAE A;  4R75 A;  1MXV A;  4RPN A;  5FBP A;  3RUM A;  3TCH A;  1NNT A;  4OES A;  2Y7K A;  3H6T A;  4Q30 B;  1IIT A;  1LBC A;  3HFU A;  3HST A;  2ABH A;  4WEP A;  2RC7 A;  4EUO A;  3OO8 A;  1DMB A;  5LDZ A;  3FD3 A;  4ZEK A;  4H5F A;  3ZSF A;  2AL4 A;  4I1D A;  2ONK E;  4PFR A;  1UIU A;  1Y3P A;  3U8Q A;  3IOT A;  4UAC A;  1MG1 A;  2Y7P A;  2XA5 A;  3TTK A;  4OFO A;  1FBC A;  2A5S A;  1FJ6 A;  4NMY A;  1VFD A;  4GBW A;  3I6V A;  4EDP A;  5F1Q A;  4F3P A;  1UTB B;  5AA2 B;  1NNP A;  4F31 B;  4U4S A;  5L8D A;  3O66 A;  4DZ1 A;  3C32 A;  4H8J A;  2AL5 A;  5AE4 A;  4OHN A;  4NF4 A;  5I58 B;  3IO4 A;  3DRI A;  4U1Z A;  1MDQ A;  3TYH A;  1XS5 A;  2Y5L A;  5CI5 A;  3GBA A;  5H8H A;  3UOR A;  3HO7 A;  1Y3Q A;  4XIG Q;  2D21 A;  1B58 A;  4MFI A;  3E3K A;  2F7C A;  1K9Z A;  2QVR A;  4YKP A;  2XXH A;  1LBW A;  3Q28 A;  2OCU A;  3QAX A;  3K6X A;  1JET A;  3LSL A;  2AYS A;  2UVJ A;  2F5X A;  2Q89 A;  2P2A A;  1JP4 A;  2XXQ A;  2XXT A;  2VP1 A;  4ELQ A;  3O28 A;  2Z8F A;  4R74 A;  1DK4 A;  4H46 A;  2DSF A;  4H5G A;  1GVC A;  2G29 A;  1MXY A;  2V93 A;  3Q26 A;  3MVX A;  2CZL A;  2REJ A;  1SYI A;  4F2O A;  1AL3 A;  3RTF B;  3MWB A;  3UA8 A;  1A8E A;  2O6A A;  3OEK A;  4U21 A;  4RA1 A;  3OOA A;  1PC3 A;  3R7X A;  4MBP A;  4EF2 A;  3IOU A;  3DEL B;  2VOZ A;  1MY0 A;  1IUD A;  5L9M A;  1B1X A;  3F11 A;  4NF0 A;  4O3B A;  4IB2 A;  3I5O A;  1FTJ A;  3MZ1 A;  3C36 A;  4OVR A;  3DRG A;  3S9N C;  3ZS6 A;  5HBC A;  2Q8J A;  3ECR A;  4JDF A;  4XTC Q;  4BDO A;  3TEP A;  1NL5 A;  2O68 A;  3TPA A;  4X1D A;  4ZED A;  2Z8E A;  4QRZ A;  3RT6 B;  3N94 A;  1A40 A;  1RDZ A;  1TXF A;  1CB6 A;  5EHS A;  1OQH A;  5I2K B;  3H6U A;  1XI6 A;  2O7I A;  5JTY B;  3MVY A;  4OMB A;  4LA9 A;  4BDL A;  2OLB A;  2ZMB A;  4PQJ A;  1FBP A;  2R6G E;  2DQV A;  2XXK A;  5H8N A;  1VDW A;  4GRK A;  3TCF A;  4R72 A;  4M1V A;  1XVX A;  2F3B A;  3MW0 A;  4FE8 A;  2QMX A;  2P3N A;  3K1P A;  1I6Q A;  4YAH X;  4QBA A;  4P56 A;  2OWT A;  2QRY A;  4DE8 A;  1RDY A;  1IMD A;  2BJI A;  1H3D A;  1MQD A;  4O8M A;  4LQ5 A;  2GH9 A;  2XXW A;  4KD5 A;  3EHT A;  4OVT A;  5CRY A;  2PBW A;  3PUY E;  5LTC A;  5I2N A;  1ATG A;  1LBX A;  4N91 A;  2FIX A;  3PPR A;  4RYA A;  5IM2 A;  4WED A;  5I2K A;  1M5C A;  5A5X A;  2I4B A;  4P0G A;  4FJP A;  1NH8 A;  1LAH E;  3FVN A;  3HN0 A;  1P1Q A;  4TQU Q;  4OFL A;  2WYP A;  5J16 A;  4HCW A;  4O7M A;  2Y7R A;  4OER A;  1XVY A;  3AXF A;  3DRH A;  1FTA A;  4PFW A;  1US4 A;  2QS3 A;  1I69 A;  1H43 A;  1MQJ A;  4PAI A;  2F6G A;  2V3U A;  4KPT A;  3KSJ A;  2KLF A;  5TPA A;  1M5D A;  2DVZ A;  1TWY A;  3USD A;  1IZ1 A;  1ZU0 A;  4N4U A;  4GL0 A;  3CG1 A;  3RT8 A;  3S9E A;  4XKR A;  4P0I A;  4C1U A;  2XHD A;  1PB7 A;  2XWK A;  4N6P A;  2ZZV A;  4GQO A;  4KCC A;  4NHB A;  4PFI A;  2QS1 A;  1AMF A;  4X8R A;  3G3F A;  2B65 A;  2PMS A;  2ONR A;  2O51 A;  3OEL A;  1BP5 A;  3KBR A;  3W15 C;  4I8C A;  2H5Y A;  1SQY A;  3MVZ A;  4I9D A;  3H3G A;  2RF1 A;  3EQ1 A;  4P8B A;  5KCJ A;  4EXK A;  3LUY A;  5EQ9 A;  5EYG A;  3ROJ A;  4G61 A;  1RYO A;  4G4P A;  1FTM A;  1OVT A;  2DDK A;  2GQ1 A;  5I57 A;  4MF3 A;  2REG A;  3K0V A;  2A5T A;  4LZ5 A;  3JV9 A;  4MAG A;  4TOZ A;  3Q25 A;  1R9Q A;  4G8M A;  3IFC A;  3QIM A;  1Q35 A;  1B0H A;  5DEX B;  1POY 1;  5L9O A;  2O1M A;  4ZEC A;  4OZ9 A;  3KN8 A;  1OQG A;  3OO9 A;  2WOP A;  3CVG A;  4LZ8 A;  2UVH A;  1QUL A;  3PPO A;  1EZO A;  3MZB A;  1MM7 A;  4DDD A;  2H4I A;  1ZLQ A;  3D1R A;  1NUY A;  3BIH A;  3TDJ A;  5KDT B;  1FPD A;  4NWC A;  4XKQ A;  1VR5 A;  1WVJ A;  1A54 A;  3V8X B;  1LFI A;  4AS5 A;  1URG A;  3L6H A;  4OYV A;  4UA8 A;  5M2V A;  4EXL A;  4X48 A;  1MH4 A;  3CSG A;  1QVS A;  4HCY A;  2ZYM A;  4G8H A;  4R6K A;  3LVU A;  4N13 A;  1OMP A;  1FW0 A;  2KQZ A;  2D5W A;  3QYT A;  5DEX A;  4PFB A;  4OXV A;  1VE4 A;  1KZ8 A;  3N5L A;  1FQF A;  3FBP A;  2RKM A;  1Q9D A;  1KA1 A;  1PDA A;  1B1H A;  3I3V A;  5AA4 A;  1YPN A;  1VSO A;  3MST A;  4F39 A;  1N0T A;  2I58 A;  3MAM A;  1FPG A;  3U94 A;  3OMB A;  3ODB A;  5IZ3 B;  3IB0 A;  3E78 A;  5B7D A;  4QXD A;  5H8Q A;  1Y3N A;  3SER A;  3TUS A;  2DVC A;  3D4G A;  4G77 A;  2V84 A;  5IZ1 A;  1N3X A;  3U65 A;  5TP9 B;  2WX9 A;  5H8F B;  3G3K A;  3QMF A;  4NF8 B;  2F35 A;  1MRP A;  1DTG A;  2F97 A;  1FPE A;  2VD3 A;  3VE1 B;  5I59 A;  1JQF A;  4MNC A;  4FEB A;  3BKI B;  4GWX A;  4NED A;  1JEV A;  2F6P A;  4HE1 A;  4PTK A;  4MIJ A;  4YKK A;  4DIG A;  2DWJ A;  4ZE8 A;  3B6W A;  3KC1 A;  3K2D A;  4GWO A;  2Y7W A;  4QFN A;  1UQW A;  2RCB A;  1EZ9 A;  4RNS A;  3FJG A;  3B6T A;  2NVU B;  5CBR A;  3CRB A;  3BIG A;  2Q74 A;  3C31 A;  4NF6 A;  1UTH B;  5CM6 A;  1S9T A;  2XX7 A;  2WOL A;  3Q29 A;  3ISP A;  4IY5 A;  2F36 A;  4LQ2 A;  1JW4 A;  3CFX A;  2H98 A;  2QSX A;  4Z7E A;  3E9X A;  2CZI A;  3TTR A;  4RJZ A;  3FVG A;  4MEV A;  1EYI A;  1MQH A;  3IOR A;  1B9J A;  1Y4C A;  4JVD A;  1MY1 A;  1YZ0 A;  2I6E A;  4RK9 A;  1DPE A;  3SEX A;  5A5L A;  4PE3 A;  4F3G A;  5ICQ A;  1JNF A;  4QFO A;  1NV7 A;  1Z7N E;  1H76 A;  3H6V A;  4OVP A;  5EHM A;  2OX3 A;  4PET A;  1B5I A;  4PFT A;  4P3L A;  4PDH A;  2Z23 A;  2XWV A;  1A8F A;  2YPN A;  4N8Y A;  4ELO A;  1FQD A;  3KJT A;  1HSE A;  4G68 B;  4RXL A;  3PUV E;  1GTK A;  1FBG A;  2XXU A;  4MLV A;  3O6I A;  3IOW A;  2UVG A;  3DLN A;  4KR5 A;  4GFR A;  4EQB A;  2I3V A;  4UAB A;  1S50 A;  1R9L A;  1SPI A;  3T66 A;  2IEE A;  1LB8 A;  3VVD A;  1R6Z A;  2QVU A;  4OVJ A;  4BDQ A;  1LAF E;  2XX9 A;  5CMB A;  1DSN A;  3CI8 A;  4JWX A;  3S9L C;  2RCA A;  1FPJ A;  5I5P A;  1UIV A;  1MXX A;  1Y20 A;  1Q1K A;  3IFA A;  1QKA A;  3DRF A;  2XWI A;  4JSO A;  3E79 A;  1CE2 A;  4AS4 A;  2HZK A;  5JEI A;  2HXW A;  2P3V A;  1B4H A;  4YB5 A;  4I3Y A;  3TZA A;  4XKP A;  2ZXT A;  4DI4 B;  1EYK A;  1JW1 A;  1UTB A;  3RPL B;  5AA2 A;  1LFG A;  3LV0 A;  3T9X B;  1K9Y A;  3RLF E;  4AQ4 A;  1IXI A;  3KOT A;  1FQB A;  1POT A;  3FIR A;  4H1X A;  3G3H A;  2I49 A;  5EYH A;  5I58 A;  2F7A A;  4NQ8 A;  2HFB A;  3T9V A;  2BJJ X;  1JVY A;  4ZEI A;  1OLA A;  1EH3 A;  4FAJ A;  1B52 A;  5ET6 A;  3D4C A;  3KN3 A;  4N6K A;  3MVW A;  1D3K A;  2GHB A;  4ND9 A;  1QUJ A;  2DWH A;  3QUJ A;  1JW5 A;  4PBQ A;  3LBS A;  2GHA A;  2Q2A A;  3VLW A;  3EKI A;  3UIF A;  4THI A;  1B40 A;  2P0S A;  3A29 A;  4OA4 A;  3RYD A;  5EQA A;  4I62 A;  4NGU A;  5EQ7 A;  2XWO A;  2Z8D A;  4GWU A;  5KZT A;  4OAN A;  2O1L A;  2ZYN A;  2Q88 A;  2ZZX A;  3LSX A;  2XD2 A;  1OVB A;  3FJM A;  1BIY A;  4XKN A;  3H7M A;  3FXQ A;  3QXM A;  3K02 A;  1KWH A;  2DS9 A;  3T9H B;  1SI1 A;  2QJE A;  2R71 A;  3C34 A;  2XXR A;  1LGB C;  3PUZ E;  4C1T A;  4NG7 A;  1N7W A;  1SW4 A;  1USY H;  4LVQ A;  5IZZ A;  3B8B A;  2KR0 A;  4QHQ A;  4F29 A;  3KJ7 A;  2V4C A;  2R8T A;  4JWY A;  1IQ7 A;  3C4M A;  1FTL A;  3VXB A;  4GOT A;  4XXU A;  1YCJ A;  2H25 A;  1NV1 A;  1MXW A;  1ANF A;  3TKD A;  1DCU A;  4JVC A;  5I56 B;  3G3I A;  1F9B A;  5K2Y A;  3MQ9 A;  4MNP A;  3HPI A;  1A55 A;  4PGP A;  3KZG A;  3VFJ A;  4PF6 A;  3H6W A;  2I48 A;  1O7T A;  4QSD A;  1PEB A;  3H06 B;  3FTO A;  3B7D A;  1NV3 A;  3QUF A;  2PFY A;  4YMB A;  5DYH A;  4ZZA A;  4BDM A;  4EQ7 A;  4H8I A;  3VVE A;  4C0R A;  4PAK A;  5JTY A;  4NF5 B;  2IA4 A;  3SEW A;  4ZS9 A;  4KYE A;  3PD8 A;  3ZKL A;  3RN8 A;  1D9Q A;  3T1B A;  3RGY A;  3IB2 A;  2HPG A;  4GWY A;  3PD9 A;  1LST A;  3MC2 A;  1DBZ A;  4IO7 A;  2B3B A;  3DP6 A;  4ZDM A;  3LC8 A;  2ZYO A;  1A7L A;  3SDF A;  3PMW A;  1FPK A;  3PPP A;  3R26 A;  3SEY A;  3ZKK A;  1IMF A;  1LAG E;  1B51 A;  2WYK A;  1P99 A;  4ESX A;  3SEV A;  4FOR A;  1URS A;  3O6G A;  2MKZ A;  3IB1 A;  3TMG A;  3RQT A;  2LAO A;  3TCG A;  4F3S A;  4E0X A;  2Q9T A;  4IR8 A;  1N04 A;  2CEX A;  2WOK A;  2ALU A;  2ESN A;  2F7B A;  1EU8 A;  1NV0 A;  1FPL A;  2H99 A;  3MPK A;  2YJP A;  3VDF A;  2DOJ A;  1NMU A;  3VXC A;  2PX1 A;  1MM6 A;  1AWB A;  4QFP A;  4M4G A;  2FVZ A;  1PB9 A;  2X7Q A;  1SW5 A;  1H44 A;  4P1E A;  2Q8M A;  4ECF A;  3K6U A;  3U93 A;  4F3B A;  1RDX A;  1LBZ A;  4F2Q A;  3TTN A;  3OO7 A;  3KSX A;  4G2Z A;  4OEV A;  4JVI A;  3RY3 A;  4YIC A;  5JK4 A;  5ICT A;  3BBR A;  3G7W A;  2PFZ A;  4JSD A;  4ZE9 A;  1Z7M E;  3IAZ A;  3VLU A;  2RIN A;  2ZZW A;  3OEN A;  2UYE A;  3W9V A;  1SVX B;  3PGF A;  4QFL A;  4Q5T A;  3MPL A;  1G0I A;  2CEY A;  5IAI A;  2OZZ A;  5ESY A;  4KYS A;  3OXN A;  5ET8 A;  1B46 A;  1MPB A;  4IGR A;  3IK6 B;  2DP8 A;  2X26 A;  1NNF A;  4DLD A;  2Z22 A;  4ELP A;  4MHF A;  4MH5 A;  3K01 A;  3CIJ A;  4R6H A;  3FV2 A;  1LCT A;  2QVV A;  4FBP A;  4YU0 A;  3PMX A;  4O7I A;  2FA7 A;  4MCO A;  2OK2 A;  1LAX A;  4KFQ A;  4OFJ A;  4JB7 A;  1NV2 A;  1FJ9 A;  4MJO A;  1ZBM A;  3TFL A;  3TEL A;  4N07 A;  1MQI A;  1FPB A;  3HCQ A;  1B3F A;  3OO6 A;  3PU5 A;  4KI0 E;  3HHF A;  1ZMG A;  1O63 A;  2H9B A;  1CNQ A;  2QL3 A;  1FBF A;  2VPN A;  2UYF A;  5CMM A;  2G93 A;  1P1N A;  2WKY A;  1BK4 A;  3IJX B;  5BWJ A;  5EYF A;  2PCR A;  2P1S A;  4F18 A;  2E0S A;  1N76 A;  2DXY A;  4ZEF A;  2F78 A;  2O84 X;  1P1O A;  3LR1 A;  1DPP A;  3C9H A;  1FBD A;  5KDT A;  2V25 A;  2VGQ A;  3JZJ A;  3L6G A;  3G3J A;  1IMB A;  1YXI A;  4ONY A;  4YB7 A;  2OBG A;  1II5 A;  1B32 A;  3R6U A;  3RYA A;  3S9M C;  1B7U A;  5ET5 A;  3O6H A;  5F7V A;  4DXB A;  1EYJ A;  1D9V A;  4AB5 A;  1ZKB A;  4PE5 B;  1NFT A;  4N6D A;  3PPQ A;  2QFL A;  1XOC A;  2FIE A;  1FTO A;  4BDN A;  5K2X A;  2DE3 A;  4H45 A;  3WAE A;  1PBQ A;  2I0B A;  3FZV A;  4EQ9 A;  1R1N A;  3ILT B;  1NUW A;  1FQC A;  4PBH A;  4H67 A;  3T96 B;  3O97 A;  3KFM A;  3V5A A;  4BLA A;  4JWO A;  4Z0I A;  3KBZ A;  4NTL A;  2VHA A;  1QGX A;  4PC9 A;  3DRJ A;  1OIB A;  1TT1 A;  1LLS A;  3O29 A;  4PF8 A;  2ZNT A;  3N6U A;  1MY4 A;  4DI3 D;  5IZ3 A;  1MY2 A;  1MPC A;  3KEI A;  2L5V A;  4DXC A;  1B6H A;  2B4L A;  1LEV A;  4LZ7 A;  3N26 A;  2OJT A;  1AH5 A;  1MH3 A;  4NF4 B;  3FXR A;  1LB9 A;  5TP9 A;  3FAS A;  5H8F A;  3MUQ A;  4F1U A;  1MS7 A;  4MNI A;  4PGN A;  5HM4 B;  4HW8 A;  4NF8 A;  3O9P A;  4H6D A;  1M5E A;  2FYI A;  3LSW A;  4OQO A;  2X7P A;  4FEC A;  4GL8 A;  5H8H B;  1NUX A;  5ITO A;  1GGG A;  4MLQ A;  2DE2 A;  4L17 A;  2QS4 A;  5ET7 A;  5DVI A;  1Y1M A;  3EF7 A;  4GWS A;  1IIW A;  3CR9 A;  4QSC A;  2NXO A;  1BKA A;  4N8G A;  3JYR A;  1LFH A;  1P1U A;  4MMP A;  1B4Z A;  2HCA A;  5FHN A;  4DCX A;  2W7Y A;  1OLC A;  1UTH A;  3CG3 A;  4LON B;  3IL1 B; 
#chains in the Genus database with same CATH homology
 4F1V A;  4P11 A;  2XXY A;  3C33 A;  2XX8 A;  3UGW A;  4LAT A;  3M8U A;  4ELR A;  3H4Z A;  3E13 X;  3FAT A;  4YKJ A;  1B3G A;  3IOV A;  2O69 A;  5IKB A;  3MJN A;  4F19 A;  1MXU A;  1IXC A;  1T0K A;  1MY3 A;  3A3U A;  1TFA A;  4R9F A;  4G68 C;  2THI A;  1NNK A;  2DYX A;  3GBB A;  4GF8 A;  3IJO B;  3KOS A;  3EN3 A;  1IXG A;  3VV5 A;  3FVK A;  1MPD A;  3P7I A;  3HHG A;  5CMC A;  4AB6 A;  2ZNS A;  3THI A;  1NKX A;  3G3G A;  2PYY A;  2ZYK A;  3KGC A;  4U22 A;  5J1D A;  2Y7I A;  4G68 A;  4WKM A;  2HZL A;  3ILU B;  3SET A;  5TU0 A;  3K00 A;  4JXI A;  4Q8R A;  3U1O A;  3WAF A;  3FVO A;  4HS7 A;  3UP9 A;  3H03 A;  3EPE A;  2ANJ A;  1IXH A;  1D4N A;  2QS2 A;  2E1S A;  3T22 A;  4PP0 A;  1QUK A;  2ONS A;  3MP1 A;  3DP8 A;  4R2B A;  4WXJ A;  4Q0C A;  1B05 A;  4U4X A;  4IGT A;  4DCY A;  4NWD A;  3T9U A;  3O6P A;  3KN7 A;  1A99 A;  2VD2 A;  5H8N B;  4IO2 A;  4OET A;  4IY6 A;  1QKB A;  5L9S A;  3MZ9 A;  1N84 A;  2ZNU A;  3RTW B;  3PMV A;  1JVX A;  5AA2 D;  4RPO A;  1EZP A;  3DRK A;  5H8S A;  4KQP A;  2XXP A;  1LBB A;  4GIZ A;  4U23 A;  3N6T A;  2GFE A;  5I2N B;  4QF9 A;  3IR1 A;  4PFU A;  2YLN A;  4IO3 A;  5A5X B;  5HPQ A;  3W9W A;  4R6Y A;  3V83 A;  3RPW A;  1YTV A;  3PUX E;  2XXV A;  1P1W A;  1DOT A;  4FIM A;  3QSL A;  5ELV A;  1PB8 A;  4OWD A;  5CBS A;  1AIV A;  1IEJ A;  4ZZE A;  3E4R A;  4IO5 A;  5TPA B;  4FED A;  3SKP A;  4GVO A;  2HQ0 A;  4ESW A;  4U2R A;  3Q27 A;  1I6B A;  4GD5 A;  2PVU A;  1B3H A;  3DP4 A;  3GZG A;  1B0L A;  2R9J A;  1LCF A;  4G8N A;  2DWI A;  4GLI A;  2DE4 A;  1MDP 1;  2PT1 A;  4KHZ E;  4E0W A;  2D3I A;  3GLB A;  5KCJ B;  4FAT A;  2RC9 A;  1ZIU A;  1MXZ A;  4GXS B;  2F8D A;  2NUV A;  2V3Q A;  1SW2 A;  4X1B A;  3BFT A;  3EHS A;  3M3L A;  1SI0 A;  1N7X A;  3S4U A;  3UN6 A;  1B3L A;  5I57 B;  3TTL A;  3CFZ A;  5I56 A;  4R73 A;  1ELJ A;  3TQL A;  5DVF A;  5ITP A;  1B7H A;  2A5T B;  2UXA A;  1B5J A;  4JBZ A;  2DWA A;  1TFD A;  3ONM A;  3S2V A;  3LSF B;  4O3A A;  1XHY A;  1FQA A;  4NE4 A;  3EHU A;  4KCD A;  1MQG A;  4LUB A;  4NF5 A;  1RYX A;  4OEN A;  4YB6 A;  3PAM A;  1BTJ A;  3TTM A;  3MP8 A;  3B6Q A;  3SES A;  1J1N A;  2NWJ A;  2GRV A;  3M3K A;  2NOO A;  3A09 A;  1FCK A;  2CMO A;  1SDX A;  3KG2 A;  4KYD A;  3TAJ A;  2I4C A;  1B5H A;  1SW1 A;  4POX A;  1FQE A;  1SYH A;  3U72 A;  3SEU A;  3VLV A;  5DT6 A;  4U1O A;  2XXI A;  5CC2 A;  5LOM A;  1I6A A;  4QFK A;  1PBP A;  4IO4 A;  5DTB A;  2F34 A;  1M5F A;  5AA3 A;  5I84 A;  5FTH A;  5AA4 B;  3IX1 A;  1GV8 A;  4YKI A;  3PV0 E;  5FHM A;  1ZTY A;  3OD7 A;  3QK6 A;  2Y84 A;  3OSR A;  3K1M A;  1ZJL A;  4YZZ A;  5H8Q B;  1AOV A;  1B7Z A;  4K3F A;  3PUW E;  4LP2 B;  1S7Y A;  4DXU A;  3K4U A;  5AA1 A;  4O3C A;  3GXA A;  2HAU A;  3TOD A;  3FGS A;  3RYB A;  3OSQ A;  1QW0 A;  3K6W A;  2V3T A;  3BFU A;  3DM0 A;  3K1N A;  1N3W A;  1XT8 A;  3K6V A;  3A3C A;  1USY E;  3MP6 A;  2I3W A;  5I59 B;  2AIX A;  3UK4 A;  1FTK A;  4TLL B;  1SD3 A;  1DTZ A;  1H45 A;  1B2H A;  3V89 B;  4GXA A;  1HSL A;  4F22 A;  1XC1 A;  2QMW A;  1Y1Z A;  2O7U A;  1BLF A;  1Y9U A;  2Q2C A;  3T93 B;  3CHG A;  1VFE A;  4NF6 B;  1WDN A;  4BDR A;  1NH7 A;  3FUZ A;  1WOD A;  4IO6 A;  4H0W A;  4R2F A;  5FTI A;  3CFL A;  4OEU A;  5ISU A;  1JEU A;  5B70 A;  2B3F A;  3TQW A;  4EF1 A;  1SBP A;  3IO6 A;  3FXU A;  2I0C A;  2XXX A;  4YMA A;  4ZEB A;  4QSE A;  5CMK A;  1B3E A;  1GR2 A;  4F1Y A;  1HSJ A;  4POW A;  2PT2 A;  3MBP A;  1O64 A;  3FJ7 A;  1Y4T A;  5DVJ A;  4RK2 A;  1URD A;  2XD3 A;  4TLM B;  4HTG A;  1L5T A;  4PFY A;  4ISU A;  2FNC A;  3O2A A;  3CSB A;  2OWS A;  5FHO A;  4OTE A;  3PPN A;  3RNN A;  3M3F A;  2UVI A;  5BUU A;  2DXR A;  2B4M A;  1D9Y A;  3HV1 A;  1M5B A;  4H65 A;  1RKM A;  4RY1 A;  2QPQ A;  3U92 A;  1QJM A;  3VVF A;  4R9G A;  3OEM A;  3FV1 A;  2M8C A;  4X9T A;  2RC8 A;  1QUI A;  1US5 A;  2HEU A;  2HAV A;  3C35 A;  1YAE A;  4R75 A;  1MXV A;  4RPN A;  3RUM A;  3TCH A;  1NNT A;  4OES A;  2Y7K A;  3H6T A;  4Q30 B;  1IIT A;  1LBC A;  3HST A;  2ABH A;  4WEP A;  2RC7 A;  4EUO A;  3OO8 A;  1DMB A;  3FD3 A;  4ZEK A;  4H5F A;  3ZSF A;  2AL4 A;  4I1D A;  2ONK E;  1UIU A;  1Y3P A;  3U8Q A;  3IOT A;  4UAC A;  1MG1 A;  2Y7P A;  3TTK A;  4OFO A;  2A5S A;  4NMY A;  1VFD A;  3I6V A;  4EDP A;  5F1Q A;  4F3P A;  1UTB B;  5AA2 B;  1NNP A;  4F31 B;  4U4S A;  5L8D A;  3O66 A;  4DZ1 A;  3C32 A;  4H8J A;  2AL5 A;  5AE4 A;  4OHN A;  4NF4 A;  5I58 B;  3IO4 A;  3DRI A;  4U1Z A;  1MDQ A;  3TYH A;  1XS5 A;  5CI5 A;  3GBA A;  5H8H A;  3UOR A;  3HO7 A;  1Y3Q A;  4XIG Q;  2D21 A;  1B58 A;  4MFI A;  3E3K A;  2F7C A;  4YKP A;  2XXH A;  3Q28 A;  2OCU A;  3QAX A;  3K6X A;  1JET A;  3LSL A;  2AYS A;  2UVJ A;  2F5X A;  2Q89 A;  2P2A A;  2XXQ A;  2XXT A;  2VP1 A;  4ELQ A;  3O28 A;  2Z8F A;  4R74 A;  2DSF A;  4H5G A;  1GVC A;  2G29 A;  1MXY A;  2V93 A;  3Q26 A;  3MVX A;  2CZL A;  2REJ A;  1SYI A;  4F2O A;  1AL3 A;  3RTF B;  3MWB A;  3UA8 A;  1A8E A;  2O6A A;  3OEK A;  4U21 A;  4RA1 A;  3OOA A;  1PC3 A;  3R7X A;  4MBP A;  4EF2 A;  3IOU A;  3DEL B;  2VOZ A;  1MY0 A;  1IUD A;  5L9M A;  1B1X A;  3F11 A;  4O3B A;  4IB2 A;  3I5O A;  1FTJ A;  3MZ1 A;  3C36 A;  3DRG A;  3S9N C;  3ZS6 A;  5HBC A;  2Q8J A;  3ECR A;  4JDF A;  4XTC Q;  4BDO A;  3TEP A;  1NL5 A;  2O68 A;  3TPA A;  4X1D A;  4ZED A;  2Z8E A;  4QRZ A;  3RT6 B;  3N94 A;  1A40 A;  1TXF A;  1CB6 A;  5EHS A;  1OQH A;  5I2K B;  3H6U A;  2O7I A;  5JTY B;  3MVY A;  4OMB A;  4LA9 A;  4BDL A;  2OLB A;  2ZMB A;  4PQJ A;  2R6G E;  2DQV A;  5H8N A;  4GRK A;  3TCF A;  4R72 A;  4M1V A;  1XVX A;  3MW0 A;  4FE8 A;  2QMX A;  3K1P A;  1I6Q A;  4YAH X;  2OWT A;  2QRY A;  4DE8 A;  1H3D A;  1MQD A;  4LQ5 A;  2GH9 A;  2XXW A;  4KD5 A;  3EHT A;  5CRY A;  2PBW A;  3PUY E;  5I2N A;  1ATG A;  3PPR A;  4RYA A;  4WED A;  5I2K A;  1M5C A;  5A5X A;  2I4B A;  4P0G A;  4FJP A;  1NH8 A;  1LAH E;  3FVN A;  3HN0 A;  1P1Q A;  4TQU Q;  4OFL A;  4HCW A;  2Y7R A;  4OER A;  1XVY A;  3AXF A;  3DRH A;  4PFW A;  1US4 A;  2QS3 A;  1I69 A;  1H43 A;  1MQJ A;  2F6G A;  2V3U A;  4KPT A;  3KSJ A;  2KLF A;  5TPA A;  1M5D A;  2DVZ A;  1TWY A;  3USD A;  1IZ1 A;  1ZU0 A;  4GL0 A;  3CG1 A;  3RT8 A;  3S9E A;  4XKR A;  4P0I A;  4C1U A;  2XHD A;  1PB7 A;  4N6P A;  4GQO A;  4KCC A;  2QS1 A;  1AMF A;  3G3F A;  2B65 A;  2PMS A;  2ONR A;  2O51 A;  3OEL A;  1BP5 A;  3KBR A;  3W15 C;  4I8C A;  2H5Y A;  1SQY A;  3MVZ A;  4I9D A;  3H3G A;  2RF1 A;  3EQ1 A;  5KCJ A;  4EXK A;  3LUY A;  1RYO A;  4G4P A;  1FTM A;  1OVT A;  5I57 A;  4MF3 A;  2REG A;  3K0V A;  2A5T A;  4LZ5 A;  3JV9 A;  4TOZ A;  3Q25 A;  1R9Q A;  4G8M A;  3QIM A;  1Q35 A;  1B0H A;  5DEX B;  1POY 1;  5L9O A;  2O1M A;  4ZEC A;  4OZ9 A;  3KN8 A;  1OQG A;  3OO9 A;  2WOP A;  3CVG A;  4LZ8 A;  2UVH A;  1QUL A;  3PPO A;  1EZO A;  3MZB A;  1MM7 A;  4DDD A;  2H4I A;  1ZLQ A;  3TDJ A;  5KDT B;  4NWC A;  4XKQ A;  1VR5 A;  1WVJ A;  1A54 A;  3V8X B;  1LFI A;  1URG A;  3L6H A;  4OYV A;  4UA8 A;  5M2V A;  4EXL A;  4X48 A;  1MH4 A;  3CSG A;  1QVS A;  4HCY A;  2ZYM A;  4G8H A;  4R6K A;  3LVU A;  4N13 A;  1OMP A;  1FW0 A;  2D5W A;  3QYT A;  5DEX A;  4OXV A;  1VE4 A;  3N5L A;  1FQF A;  2RKM A;  1PDA A;  1B1H A;  3I3V A;  5AA4 A;  1YPN A;  1VSO A;  4F39 A;  1N0T A;  2I58 A;  3MAM A;  3U94 A;  3OMB A;  3ODB A;  3IB0 A;  5B7D A;  5H8Q A;  1Y3N A;  3SER A;  3TUS A;  2DVC A;  3D4G A;  4G77 A;  2V84 A;  1N3X A;  5TP9 B;  5H8F B;  3G3K A;  4NF8 B;  2F35 A;  1MRP A;  1DTG A;  2F97 A;  2VD3 A;  3VE1 B;  5I59 A;  1JQF A;  4FEB A;  3BKI B;  4NED A;  1JEV A;  2F6P A;  4YKK A;  4DIG A;  2DWJ A;  4ZE8 A;  3B6W A;  3K2D A;  4GWO A;  2Y7W A;  4QFN A;  1UQW A;  2RCB A;  1EZ9 A;  4RNS A;  3FJG A;  3B6T A;  2NVU B;  5CBR A;  3CRB A;  3C31 A;  4NF6 A;  1UTH B;  5CM6 A;  1S9T A;  2XX7 A;  2WOL A;  3Q29 A;  4IY5 A;  2F36 A;  4LQ2 A;  1JW4 A;  3CFX A;  2H98 A;  2QSX A;  4Z7E A;  3E9X A;  3TTR A;  4RJZ A;  3FVG A;  1MQH A;  3IOR A;  1B9J A;  1Y4C A;  1MY1 A;  2I6E A;  4RK9 A;  1DPE A;  3SEX A;  4F3G A;  5ICQ A;  1JNF A;  4QFO A;  1Z7N E;  1H76 A;  3H6V A;  5EHM A;  4PET A;  1B5I A;  4PFT A;  2Z23 A;  1A8F A;  2YPN A;  4ELO A;  1FQD A;  3KJT A;  1HSE A;  4G68 B;  4RXL A;  3PUV E;  1GTK A;  2XXU A;  4MLV A;  3O6I A;  3IOW A;  2UVG A;  3DLN A;  4KR5 A;  4GFR A;  4EQB A;  2I3V A;  1S50 A;  1R9L A;  3T66 A;  2IEE A;  1LB8 A;  3VVD A;  1R6Z A;  4OVJ A;  4BDQ A;  1LAF E;  2XX9 A;  5CMB A;  1DSN A;  3CI8 A;  4JWX A;  3S9L C;  2RCA A;  1UIV A;  1MXX A;  1Y20 A;  1Q1K A;  1QKA A;  3DRF A;  4JSO A;  1CE2 A;  2HZK A;  5JEI A;  2HXW A;  1B4H A;  4YB5 A;  3TZA A;  4XKP A;  2ZXT A;  1JW1 A;  1UTB A;  5AA2 A;  1LFG A;  3T9X B;  3RLF E;  4AQ4 A;  1IXI A;  3KOT A;  1FQB A;  1POT A;  3FIR A;  4H1X A;  3G3H A;  2I49 A;  5I58 A;  2F7A A;  2HFB A;  3T9V A;  2BJJ X;  1JVY A;  4ZEI A;  1OLA A;  1EH3 A;  4FAJ A;  1B52 A;  3D4C A;  3KN3 A;  3MVW A;  1D3K A;  2GHB A;  4ND9 A;  1QUJ A;  2DWH A;  3QUJ A;  1JW5 A;  3LBS A;  2GHA A;  2Q2A A;  3VLW A;  3UIF A;  4THI A;  1B40 A;  2P0S A;  4I62 A;  2Z8D A;  5KZT A;  2O1L A;  2ZYN A;  2Q88 A;  3LSX A;  2XD2 A;  1OVB A;  3FJM A;  1BIY A;  4XKN A;  3H7M A;  3FXQ A;  3QXM A;  3K02 A;  1KWH A;  2DS9 A;  3T9H B;  1SI1 A;  2QJE A;  2R71 A;  3C34 A;  2XXR A;  1LGB C;  3PUZ E;  4C1T A;  1N7W A;  1SW4 A;  1USY H;  4LVQ A;  4QHQ A;  4F29 A;  3KJ7 A;  4JWY A;  1IQ7 A;  3C4M A;  1FTL A;  3VXB A;  4GOT A;  4XXU A;  1YCJ A;  2H25 A;  1MXW A;  1ANF A;  3TKD A;  5I56 B;  3G3I A;  1F9B A;  5K2Y A;  3MQ9 A;  3HPI A;  1A55 A;  3KZG A;  3VFJ A;  3H6W A;  2I48 A;  1O7T A;  4QSD A;  1PEB A;  3H06 B;  3FTO A;  3B7D A;  3QUF A;  4YMB A;  5DYH A;  4ZZA A;  4BDM A;  4EQ7 A;  4H8I A;  3VVE A;  4C0R A;  5JTY A;  4NF5 B;  2IA4 A;  3SEW A;  4ZS9 A;  4KYE A;  3PD8 A;  3ZKL A;  3RN8 A;  3RGY A;  3IB2 A;  3PD9 A;  1LST A;  3MC2 A;  4IO7 A;  2B3B A;  3DP6 A;  4ZDM A;  3LC8 A;  2ZYO A;  1A7L A;  3SDF A;  3PMW A;  3PPP A;  3R26 A;  3SEY A;  3ZKK A;  1LAG E;  1B51 A;  1P99 A;  4ESX A;  3SEV A;  4FOR A;  1URS A;  3O6G A;  3IB1 A;  3TMG A;  3RQT A;  2LAO A;  3TCG A;  4F3S A;  4E0X A;  2Q9T A;  1N04 A;  2WOK A;  2ALU A;  2ESN A;  2F7B A;  1EU8 A;  2H99 A;  3MPK A;  2YJP A;  3VDF A;  2DOJ A;  1NMU A;  3VXC A;  2PX1 A;  1MM6 A;  4QFP A;  4M4G A;  1PB9 A;  2X7Q A;  1SW5 A;  1H44 A;  4ECF A;  3K6U A;  3U93 A;  4F3B A;  4F2Q A;  3TTN A;  3OO7 A;  3KSX A;  4G2Z A;  4OEV A;  3RY3 A;  4YIC A;  5JK4 A;  5ICT A;  3BBR A;  3G7W A;  4JSD A;  4ZE9 A;  1Z7M E;  3IAZ A;  3VLU A;  2RIN A;  3OEN A;  2UYE A;  3W9V A;  1SVX B;  3PGF A;  4QFL A;  4Q5T A;  3MPL A;  5IAI A;  2OZZ A;  4KYS A;  3OXN A;  1B46 A;  1MPB A;  4IGR A;  3IK6 B;  2DP8 A;  2X26 A;  1NNF A;  4DLD A;  2Z22 A;  4ELP A;  4MH5 A;  3K01 A;  3CIJ A;  4R6H A;  3FV2 A;  1LCT A;  4YU0 A;  3PMX A;  2FA7 A;  2OK2 A;  1LAX A;  4KFQ A;  4OFJ A;  4JB7 A;  1ZBM A;  3TFL A;  3TEL A;  4N07 A;  1MQI A;  3HCQ A;  1B3F A;  3OO6 A;  3PU5 A;  4KI0 E;  3HHF A;  1ZMG A;  1O63 A;  2H9B A;  2QL3 A;  2UYF A;  5CMM A;  2G93 A;  1P1N A;  2WKY A;  3IJX B;  5BWJ A;  5EYF A;  2P1S A;  4F18 A;  2E0S A;  1N76 A;  2DXY A;  4ZEF A;  2F78 A;  2O84 X;  1P1O A;  3LR1 A;  1DPP A;  3C9H A;  5KDT A;  2V25 A;  2VGQ A;  3JZJ A;  3L6G A;  3G3J A;  4ONY A;  4YB7 A;  2OBG A;  1II5 A;  1B32 A;  3R6U A;  3RYA A;  3S9M C;  1B7U A;  3O6H A;  5F7V A;  4DXB A;  1D9V A;  4AB5 A;  1ZKB A;  4PE5 B;  1NFT A;  3PPQ A;  1XOC A;  1FTO A;  4BDN A;  5K2X A;  2DE3 A;  3WAE A;  1PBQ A;  4EQ9 A;  2I0B A;  3FZV A;  1R1N A;  3ILT B;  1FQC A;  4H67 A;  3T96 B;  3O97 A;  3KFM A;  3V5A A;  4BLA A;  4JWO A;  4Z0I A;  4NTL A;  2VHA A;  3DRJ A;  1OIB A;  1TT1 A;  1LLS A;  3O29 A;  2ZNT A;  3N6U A;  1MY4 A;  1MY2 A;  1MPC A;  3KEI A;  4DXC A;  1B6H A;  2B4L A;  4LZ7 A;  3N26 A;  2OJT A;  1AH5 A;  1MH3 A;  4NF4 B;  3FXR A;  1LB9 A;  5TP9 A;  3FAS A;  5H8F A;  3MUQ A;  4F1U A;  1MS7 A;  5HM4 B;  4HW8 A;  4NF8 A;  3O9P A;  4H6D A;  1M5E A;  2FYI A;  3LSW A;  4OQO A;  2X7P A;  4FEC A;  4GL8 A;  5H8H B;  5ITO A;  1GGG A;  4MLQ A;  2DE2 A;  4L17 A;  2QS4 A;  5DVI A;  1Y1M A;  3EF7 A;  1IIW A;  3CR9 A;  4QSC A;  2NXO A;  1BKA A;  3JYR A;  1LFH A;  1P1U A;  1B4Z A;  2HCA A;  5FHN A;  4DCX A;  2W7Y A;  1OLC A;  1UTH A;  3CG3 A;  4LON B;  3IL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...