1B52A

Oligo-peptide binding protein (oppa) complexed with ktk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
515
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTAPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 188
structure length 515
sequence length 517
ec nomenclature
pdb deposition date 1999-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b52A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b52A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b52A02
3U8QA 1LAHE 5DTBA 4G2ZA 1MQGA 4QSDA 4KFQA 2XD3A 3PUYE 4NWDA 1US5A 1FTJA 4F19A 4X48A 4F3BA 3MVYA 2D21A 3C9HA 3MPKA 4LZ8A 1O63A 3K1MA 4TLLB 1FCKA 2XXRA 3DELB 4F22A 2RINA 1FQBA 1POY1 1JVXA 3KSJA 4Z0IA 1OVTA 1L5TA 1BP5A 3M3FA 3UK4A 4H5GA 4NF5B 4LZ7A 3T9VA 1XT8A 5FHNA 1B32A 2GRVA 1LAXA 4ISUA 2I0CA 4PFWA 1SI1A 3GLBA 4P0GA 3SETA 3MVXA 1FQFA 4YZZA 4EDPA 3G3GA 1LFIA 1NNPA 2AL5A 4JWOA 5L9MA 5K2XA 2DWIA 3FTOA 4OESA 5L8DA 1P99A 1JETA 4YB6A 2H25A 2RCAA 4ELRA 3FXRA 3RUMA 1M5FA 5AA2A 3L6GA 4RJZA 1P1QA 1GVCA 1IIWA 2PBWA 4Q5TA 2ZNUA 4ZEIA 5I58B 1DPPA 3RNNA 1MY4A 3PMVA 1N76A 3FD3A 3ECRA 3GXAA 1TFDA 2O1MA 3K00A 4U22A 3PUXE 4OQOA 1QUJA 3TDJA 4LONB 1OLCA 1M5BA 1B58A 3WAFA 4F1VA 3C33A 1B7HA 2O7IA 4R6KA 2O84X 4RPOA 4G68B 1JQFA 3G3IA 4I1DA 1DMBA 3TYHA 3LBSA 4I62A 1D4NA 3T96B 4OFOA 4OXVA 2FYIA 5F7VA 3M3LA 2UYFA 1PB7A 4MBPA 3MZBA 1I6BA 4P11A 2LAOA 3ILUB 3LSFB 3R6UA 1RKMA 4G8HA 3B6QA 3D4GA 2VOZA 4R6HA 3W9VA 3A09A 3OMBA 3MAMA 4BDNA 5HBCA 4U1ZA 3S9LC 4BDMA 3IOWA 2XX7A 1URSA 4F3GA 1MXZA 4U21A 4I8CA 2DSFA 1P1OA 4DCXA 2ZYNA 5I57B 3A3UA 4XKRA 3O6GA 4YKJA 4ZZEA 3F11A 3T9XB 2REJA 2Y7KA 1UTBB 3I5OA 5CM6A 1MPDA 3SERA 3OSRA 1FQDA 4OERA 5I2NA 4IGTA 5H8NA 3KJTA 4EXLA 4ZDMA 2F8DA 1OIBA 5KDTB 4MLQA 4DXUA 3KSXA 1Y3PA 3K4UA 5B7DA 1B51A 2H9BA 3FVGA 3FZVA 5H8SA 1VSOA 1H3DA 3HSTA 1SI0A 4C0RA 1B0HA 1Z7ME 1B40A 4DXCA 4Z7EA 1IXCA 4YMAA 3HCQA 2PYYA 2NVUB 2Z8FA 3G7WA 3K6WA 3THIA 2Q88A 3U1OA 4ZEDA 3C31A 3TCFA 3B6TA 2X7PA 4H1XA 2Z8EA 2PT1A 3IAZA 3ZS6A 1AMFA 5AA2D 2ZYMA 1R9LA 3FASA 1YTVA 1B3GA 1DTGA 5ICTA 2DWJA 4F29A 4G77A 3DRJA 3PD8A 3IK6B 3K0VA 4YKPA 1A7LA 1TXFA 3D4CA 3HHGA 1FQCA 4X9TA 1I6QA 4OVJA 3PAMA 3KG2A 2UVHA 5IKBA 1B3HA 5JTYA 4R73A 3VLVA 4WEPA 4JB7A 3KOSA 3M8UA 4YKIA 3CFLA 3E4RA 4FATA 3SEXA 3R26A 2HAUA 3B6WA 5BUUA 3OEMA 3QIMA 1MM7A 3FXUA 3OXNA 5L9SA 1FTLA 1A8EA 3IOUA 4EF2A 1FQEA 3FJMA 2F6GA 2VD3A 5FTHA 1FTMA 3MZ9A 3HHFA 2UYEA 4DDDA 3PGFA 4LATA 4KD5A 2DS9A 2OZZA 1M5DA 4ZS9A 1AH5A 1POTA 4NF4B 4ELQA 1LBBA 1MQDA 5I59B 4YB7A 1MQJA 3DP6A 1A8FA 3VLUA 4BDQA 1DOTA 1RYXA 3EPEA 3QUFA 3JYRA 1H44A 3BFTA 3K6XA 2DXYA 4F18A 5DEXB 2CZLA 3VVEA 4H8IA 1BKAA 2F7CA 3K6VA 4LQ5A 2UVJA 4N07A 1UTHA 1Y1ZA 2I58A 2REGA 4IO6A 4F3PA 4ZZAA 1P1WA 1ZKBA 3ILTB 1MXVA 3MP6A 4ESXA 3FV2A 4F39A 3V5AA 1D9YA 4QSEA 1A40A 4OFJA 1GV8A 4PP0A 1H43A 2B65A 1A99A 5AA4A 4OFLA 4DCYA 2H4IA 3OSQA 1Y3NA 1OLAA 1GTKA 4H67A 5H8HA 1MXYA 4UACA 4C1UA 3G3HA 2OBGA 3H6WA 2ESNA 2F34A 4QRZA 3G3KA 4XIGQ 1B7ZA 3IX1A 1N04A 1SQYA 3S4UA 2QPQA 4PQJA 1LCFA 1TWYA 1B3EA 3WAEA 4TLMB 2F7BA 2QRYA 3G3JA 2D5WA 3LC8A 3OO8A 5LOMA 5DYHA 3OO7A 2GFEA 5I56A 4JDFA 2PX1A 4QSCA 5TPAA 1OQGA 1EZ9A 3FXQA 2I3WA 2DOJA 1UIVA 1IITA 4GD5A 1M5EA 2XHDA 3MVWA 2YPNA 1S50A 1P1NA 4OWDA 3PMXA 3O28A 5JK4A 3DRKA 4R6YA 4R9GA 1NL5A 4IGRA 1MXXA 1MDQA 1Y20A 3PPOA 2PT2A 1B3FA 3KJ7A 3VLWA 2B4MA 2THIA 5H8QA 5KCJA 3PPRA 4QHQA 3N94A 2QSXA 3CSBA 2E0SA 3ONMA 1LAFE 4H65A 4F2OA 5A5XA 3JZJA 5I2KB 5L9OA 1H45A 4IO4A 4FECA 1WDNA 3V89B 4IY6A 2XXPA 2NOOA 3SEWA 5ITOA 5TP9A 2HXWA 5TU0A 4DXBA 3CI8A 4GXAA 4PE5B 1QUKA 1MRPA 5M2VA 3UN6A 3FUZA 5AE4A 1RYOA 3MBPA 4OZ9A 5JEIA 4DLDA 3MUQA 2DE3A 2RCBA 2HQ0A 3DLNA 3RGYA 3OEKA 3TQWA 3PPNA 2G29A 3RT6B 3UIFA 3O2AA 3VVDA 4U4SA 4IO5A 1NH8A 1S9TA 1B1HA 3LSWA 3L6HA 3SEUA 2F5XA 2Y7IA 4EQBA 2WOPA 4K3FA 1LCTA 3QAXA 1B6HA 2XX8A 2A5TA 4GOTA 3TTLA 5A5XB 4NTLA 4ONYA 3PD9A 1Y3QA 4AQ4A 2BJJX 3GBAA 4JWXA 4WEDA 1LB9A 3IJXB 4OEUA 4BDRA 2VP1A 4FJPA 5DVJA 1B0LA 3V83A 3TPAA 3OO6A 3SESA 3U94A 4GLIA 4BDOA 3E3KA 3IO4A 3A3CA 4ZEFA 1N7XA 4FORA 1USYE 3KEIA 4GL0A 5AA2B 4ND9A 4POWA 1A55A 3T9HB 3IB0A 1PDAA 1DPEA 1Q1KA 2UVGA 3LVUA 3BFUA 2DYXA 4F3SA 4N6PA 4ZECA 4ELPA 4IO2A 4IY5A 4RY1A 3GBBA 2ZXTA 3QUJA 2NUVA 4QFPA 2HFBA 2E1SA 1QW0A 2I4BA 1XOCA 3C4MA 1MM6A 1SW1A 3KZGA 4HTGA 4M4GA 4P0IA 3TFLA 5H8FA 4NWCA 2GHAA 4IO7A 3CSGA 3PU5A 2VD2A 4QFNA 4NF6A 5EYFA 4ELOA 3KN8A 4RYAA 3PPPA 1N0TA 3PUWE 1NNFA 1SD3A 3K01A 3S9EA 1URDA 4WKMA 5I84A 2RC9A 1MH3A 1IEJA 2I49A 4R9FA 4YMBA 2ONSA 3MC2A 4F1YA 1BIYA 3IJOB 3RQTA 3R7XA 2NXOA 3ZKLA 4DZ1A 2YJPA 5F1QA 4NF8A 4NMYA 2QMXA 4ZEBA 2QS3A 5IAIA 4KCCA 4NF6B 4Q8RA 4KCDA 3TKDA 4U2RA 1I6AA 1USYH 5I2NB 5H8NB 2Y84A 2FNCA 3RLFE 1PC3A 3T66A 2NWJA 3C34A 2I6EA 2RKMA 1XHYA 4XKQA 4N13A 4GRKA 5AA3A 1B05A 1B3LA 4NE4A 1SW2A 3SKPA 1UIUA 4GXSB 2I0BA 2O69A 4OMBA 2H98A 1MQHA 3QSLA 2I3VA 2DWHA 3EHTA 1B4ZA 3CVGA 4GIZA 2KLFA 1Q35A 1PB9A 1MH4A 4R74A 4AB5A 3PUVE 2V3UA 4KQPA 4RNSA 1ZLQA 4XTCQ 1B1XA 3UP9A 2XXWA 2IA4A 1JNFA 3QK6A 1SYIA 3PUZE 2ALUA 3FJGA 1AL3A 4EXKA 4LA9A 3ODBA 1ELJA 3T9UA 1FW0A 3W9WA 5JTYB 5HPQA 3OENA 2HAVA 4H0WA 2V25A 2R6GE 3FIRA 1FTKA 4YAHX 4F31B 2A5SA 1WVJA 3H03A 1ZU0A 3QYTA 3TTMA 4G8NA 1HSEA 4OHNA 3N5LA 3TODA 3S9NC 1VR5A 2ZYOA 1R1NA 3K1NA 4R75A 3IORA 2X7QA 1ZBMA 2RC8A 3Q27A 1A54A 4MH5A 3DP8A 3KN3A 4JBZA 4IO3A 4YB5A 2GHBA 3RN8A 1LGBC 3VVFA 3PPQA 4KI0E 3KFMA 2B3FA 5EHSA 3LR1A 4TQUQ 4QFKA 3RY3A 2XD2A 4OETA 3KOTA 2F97A 3SDFA 3W15C 1ZIUA 1NNKA 3H06B 3U93A 1PEBA 3DRIA 4GL8A 3MZ1A 1M5CA 2OWTA 3E9XA 3TEPA 3MJNA 1QULA 5HM4B 1EZPA 3EN3A 4MLVA 3O66A 4RK2A 2GH9A 5ELVA 1EH3A 2O7UA 3GZGA 1P1UA 3IL1B 1WODA 3CIJA 4U4XA 1EU8A 1UTHB 2UXAA 4XKNA 3C36A 3OELA 3N26A 5FHMA 2Z22A 2IEEA 3PMWA 2QL3A 3EF7A 4NF5A 3FGSA 2Q8JA 1Y1MA 3H6UA 1QUIA 5AA4B 1MY0A 4QF9A 3O97A 5CMCA 1IXHA 2XXXA 3H4ZA 1JEVA 3CHGA 1MY2A 2F36A 4ZE8A 2M8CA 3Q29A 4NEDA 3FVKA 1B5JA 2OJTA 1JEUA 2O6AA 4PFYA 5H8HB 3IB1A 1HSLA 2DXRA 4OENA 3U92A 4LZ5A 2ZMBA 2P1SA 2AYSA 3CFZA 2I4CA 4GF8A 3HN0A 4PETA 2XXIA 4LP2B 2X26A 4ECFA 4R2BA 4WXJA 1MPCA 1LAGE 3RYAA 5FTIA 5I56B 5TPAB 5BWJA 5I58A 4UA8A 4U23A 2D3IA 4DIGA 4KHZE 3KGCA 1IZ1A 4E0XA 1B46A 3ZSFA 1MQIA 1IXIA 1OMPA 1OQHA 1YCJA 1LB8A 3IO6A 1T0KA 2F78A 3TCHA 3RTFB 1II5A 4LVQA 3IOVA 3CG1A 1B4HA 2WOLA 2V3TA 1MG1A 2VGQA 1LBCA 4G68A 5H8QB 5KCJB 4M1VA 2QS1A 4H6DA 1QKAA 3MW0A 1DTZA 4YKKA 1N3WA 2I48A 1AIVA 1JW5A 3MQ9A 3CRBA 2WOKA 4G4PA 3B7DA 1XVYA 5ITPA 5TP9B 5ISUA 3TTKA 4YICA 3MPLA 2WKYA 4PFTA 1D3KA 1SDXA 4LQ2A 1XS5A 4I9DA 3H7MA 2H5YA 3O6PA 1FQAA 2YLNA 2Y7PA 1Y4CA 4G8MA 1NKXA 2Q89A 1YPNA 2XX9A 5KZTA 1B5HA 2OLBA 4G68C 4RXLA 4PFUA 3N6TA 2OWSA 1MS7A 3MVZA 3P7IA 4GWOA 1LSTA 1OVBA 4QFLA 1LFGA 4C1TA 2ONKE 4HS7A 2A5TB 1MPBA 2V84A 4XXUA 5I57A 1N7WA 3N6UA 4U1OA 1QVSA 3MWBA 5CMBA 2F7AA 2HEUA 3TUSA 1DSNA 4THIA 1UTBA 4ZE9A 1S7YA 3TTRA 2OCUA 3K02A 2ZNTA 1BTJA 5KDTA 5DVIA 4JXIA 4F2QA 3EHSA 4RK9A 3FATA 4OTEA 3RTWB 1B5IA 1US4A 1TT1A 3VFJA 3IOTA 3DRHA 1IUDA 2AIXA 5EHMA 3TELA 1ANFA 4EF1A 1H76A 4L17A 2ANJA 2HZLA 3VXCA 1JW1A 3IB2A 3VE1B 2W7YA 4R2FA 2DE4A 1VE4A 3VV5A 3OD7A 3S2VA 3O6HA 3E13X 4FE8A 4EUOA 2PVUA 3HV1A 3H6VA 2Q2CA 2UVIA 3JV9A 4FIMA 2B4LA 1ATGA 5CMMA 1SW4A 3DM0A 3HPIA 5FHOA 2F35A 3DP4A 1N3XA 4H8JA 1N84A 1VFDA 4BLAA 3DRFA 2Q2AA 3Q25A 3UA8A 2XXYA 1B2HA 4KR5A 4JSDA 3AXFA 3DRGA 3IR1A 4H5FA 1D9VA 3OOAA 3FV1A 4X1DA 5CC2A 4HW8A 3C32A 3UGWA 2DP8A 4ESWA 4XKPA 3CR9A 5H8FB 4MFIA 1NH7A 3O9PA 2HZKA 4GQOA 3HO7A 1B7UA 5J1DA 4POXA 4IB2A 2XXQA 3TCGA 3TQLA 2O1LA 5CBSA 3V8XB 2QMWA 4GFRA 4LUBA 2R9JA 4RPNA 1PBPA 1Y9UA 3TTNA 1IXGA 1HSJA 2AL4A 4FEBA 3I6VA 3K2DA 1SVXB 4TOZA 4JWYA 3Q26A 4HCYA 3H3GA 1XC1A 4YU0A 1NNTA 4AB6A 4NF4A 5I59A 2F6PA 4R72A 4HCWA 1MDP1 2ONRA 2DWAA 3OO9A 3RYBA 3O29A 5ICQA 4NF8B 3I3VA 1MXWA 4QFOA 2H99A 3VDFA 2QJEA 2Q9TA 1ZJLA 1TFAA 1SYHA 4KPTA 3LSLA 3QXMA 3SEYA 1J1NA 5B70A 3MP8A 5DEXA 3FVOA 3T22A 3T93B 2RC7A 3O6IA 1BLFA 4DE8A 1PB8A 4BDLA 1B52A 1GGGA 5CI5A 3KBRA 4X1BA 3K6UA 2O68A 5CRYA 2Z23A 2DQVA 1Y4TA 2O51A 2ABHA 2P0SA 5CBRA 1QJMA 1MXUA 4KYDA 3BBRA 1I69A 1LLSA 1JW4A 2ZNSA 1LFHA 3TAJA 1URGA 3TZAA 3RT8A 2V3QA 3VXBA 5K2YA 4O3CA 1CB6A 3SEVA 3BKIB 1SW5A 2FA7A 1MY3A 4KYSA 4F1UA 2V93A 3USDA 4FEDA 3ZKKA 3M3KA 3U72A 3CFXA 1SBPA 1R9QA 3CG3A 1ZTYA 1O64A 1UQWA 1PBQA 3EQ1A 1IQ7A 1QKBA 1EZOA 1FTOA 5DT6A 3TMGA 2B3BA 4O3BA 1YAEA 4E0WA 5CMKA 3KN7A 3EHUA 1ZMGA 5DVFA 4MF3A 2ZYKA 2DE2A 4OEVA 2Y7WA 3UORA 3H6TA 2HCAA 3K1PA 1AOVA 1Z7NE 4KYEA 4GVOA 3S9MC 1XVXA 4Q30B 1GR2A 2DVZA 2DVCA 3Q28A 2VHAA 4RA1A 1NMUA 2QS4A 2PMSA 3PV0E 5AA1A 2XXHA 4EQ9A 1R6ZA 2XXVA 3G3FA 4O3AA 2R71A 2OK2A 2P2AA 1NFTA 1F9BA 2XXTA 4EQ7A 1JVYA 3C35A 2G93A 1O7TA 3FJ7A 1VFEA 3LSXA 4OYVA 1KWHA 1B9JA 2RF1A 4JSOA 2Y7RA 2Z8DA 3MP1A 3RPWA 5I2KA 2QS2A 4ZEKA 2XXUA 1MY1A 2CMOA 3LUYA 4Q0CA 3FVNA 4FAJA 1CE2A
chains in the Genus database with same CATH superfamily
3U8QA 1LAHE 3T1BA 5DTBA 4G2ZA 1MQGA 4QSDA 4KFQA 2XD3A 1G0IA 3PUYE 4NWDA 1US5A 1FTJA 4F19A 2ZZWA 4X48A 4F3BA 3MVYA 2D21A 3C9HA 3MPKA 4LZ8A 1O63A 3K1MA 4TLLB 1FCKA 2Q8MA 4O94A 2XXRA 3DELB 2XWVA 4F22A 2RINA 1FQBA 1POY1 1JVXA 3KSJA 4DI4B 1NV3A 4Z0IA 2CZHA 1OVTA 1L5TA 1BP5A 3M3FA 3UK4A 4H5GA 4NF5B 4LZ7A 3T9VA 1XT8A 5FHNA 1B32A 2GRVA 1LAXA 4ISUA 2I0CA 4PFWA 1SI1A 4PTKA 3GLBA 4P0GA 3SETA 3MVXA 5IZZA 1FQFA 4YZZA 4EDPA 3G3GA 1LFIA 1NNPA 3BIHA 2AL5A 4JWOA 5L9MA 5K2XA 1IMFA 2DWIA 3FTOA 4OESA 5L8DA 1P99A 1JETA 1FJ6A 4YB6A 2H25A 2RCAA 4ELRA 3FXRA 1Q9DA 3RUMA 1M5FA 5AA2A 3L6GA 4RJZA 1P1QA 1GVCA 1IIWA 2PBWA 4Q5TA 2ZNUA 4ZEIA 1FBHA 5I58B 1DPPA 3RNNA 1MY4A 3PMVA 1N76A 3FD3A 3ECRA 4PGPA 3GXAA 1TFDA 2O1MA 2FBPA 3K00A 4U22A 3PUXE 4OQOA 1QUJA 3TDJA 4LONB 1OLCA 1M5BA 1B58A 3WAFA 4F1VA 3C33A 2OWZA 1B7HA 1EYKA 2O7IA 4N8GA 1FJ9A 4R6KA 2O84X 4RPOA 4G68B 1JQFA 3G3IA 4I1DA 1DMBA 3TYHA 5IZ1A 3LBSA 4I62A 1D4NA 3T96B 4OFOA 4OXVA 2FYIA 5F7VA 3M3LA 4MIJA 2UYFA 1PB7A 4MBPA 3MZBA 1I6BA 4P11A 2LAOA 3ILUB 3LSFB 3R6UA 1RKMA 4G8HA 3B6QA 4MHFA 3D4GA 4N4UA 2VOZA 4R6HA 2F3DA 3W9VA 1IMEA 3A09A 3OMBA 3MAMA 4BDNA 1DK4A 5HBCA 4U1ZA 3S9LC 4BDMA 3IOWA 2ZZVA 2XX7A 1URSA 4F3GA 1MXZA 4U21A 4PDHA 1FSAA 2FVZA 4I8CA 2DSFA 1P1OA 4DCXA 2ZYNA 3ISPA 5I57B 3A3UA 4XKRA 3O6GA 4YKJA 4ZZEA 3F11A 3T9XB 2REJA 2Y7KA 2MKZA 1UTBB 4HE0A 3I5OA 5CM6A 4OVTA 4H46A 1MPDA 3SERA 3OSRA 1FQDA 4OERA 5I2NA 4IGTA 5H8NA 3KJTA 4EXLA 4ZDMA 2F8DA 1OIBA 5KDTB 4MLQA 4NGUA 4DXUA 3KSXA 1Y3PA 1LEVA 3K4UA 5B7DA 4PBQA 1B51A 2H9BA 4N15A 3FVGA 4P47A 3FZVA 1RDZA 5H8SA 1VSOA 1H3DA 3HSTA 1SI0A 4C0RA 1B0HA 1Z7ME 5LDZA 1B40A 3FXBA 4DXCA 1IXCA 4Z7EA 4YMAA 3HCQA 2PYYA 2NVUB 2Z8FA 3G7WA 3K6WA 3THIA 2Q88A 3U1OA 4ZEDA 3C31A 3TCFA 3B6TA 2X7PA 4H1XA 2Z8EA 2PT1A 3IAZA 3ZS6A 1AMFA 5IM2A 5AA2D 2ZYMA 1R9LA 3FASA 1FBDA 1YTVA 1B3GA 1DTGA 5ICTA 2DWJA 4F29A 4G77A 3DRJA 3PD8A 3IK6B 3K0VA 4YKPA 5I5PA 1LBZA 4MEVA 1A7LA 1TXFA 3D4CA 3HHGA 1FQCA 4GBVA 4X9TA 2XA5A 1I6QA 4OVJA 3PAMA 3KG2A 2UVHA 5IKBA 1B3HA 5JTYA 4R73A 3VLVA 4WEPA 4JB7A 3KOSA 5EYHA 3M8UA 3LV0A 4YKIA 3CFLA 3E4RA 4FATA 3SEXA 2XXKA 3R26A 3RYDA 2HAUA 3B6WA 5ET7A 5BUUA 5EQAA 3OEMA 3QIMA 1MM7A 3FXUA 3OXNA 5L9SA 1FTLA 1A8EA 2QVUA 3IOUA 4EF2A 1FQEA 3FJMA 2F6GA 2VD3A 4PF6A 5FTHA 3HFUA 1FTMA 3MZ9A 3HHFA 2UYEA 4DDDA 3PGFA 4LATA 4KD5A 4I3YA 2DS9A 2OZZA 4GBWA 1M5DA 4ZS9A 1AH5A 3MYUA 1POTA 4NF4B 4ELQA 1LBBA 1MQDA 5EQ8A 5I59B 4YB7A 4GWWA 1MQJA 4N81A 3DP6A 1A8FA 3VLUA 5I3SA 1FBCA 4BDQA 1DOTA 1LBWA 3KC0A 1RYXA 3EPEA 3QUFA 3JYRA 1H44A 3BFTA 3K6XA 2DXYA 4F18A 5DEXB 1VDWA 2CZLA 3VVEA 4H8IA 1BKAA 2F7CA 3K6VA 4LQ5A 1NUYA 3A29A 2UVJA 4N07A 1UTHA 1Y1ZA 2WEFA 2I58A 2REGA 4IO6A 4F3PA 4ZZAA 1P1WA 1ZKBA 3ILTB 4PFRA 1MXVA 3GYYA 3MP6A 4ESXA 3FV2A 1RDXA 4F39A 3V5AA 1D9YA 4QSEA 1A40A 4OFJA 1GV8A 4PP0A 1H43A 2B65A 1A99A 5AA4A 4OFLA 4DCYA 2H4IA 1NV1A 3OSQA 1Y3NA 3KC1A 1OLAA 4GWZA 5IZ3B 1GTKA 1KZ8A 4H67A 5H8HA 4KXPA 1MXYA 4UACA 4C1UA 3G3HA 4NQ8A 2VPOA 2OBGA 3H6WA 2ESNA 2F34A 4QRZA 3G3KA 4XIGQ 1B7ZA 3IX1A 1N04A 1SQYA 3QMFA 2QPQA 3S4UA 4PQJA 1LCFA 1TWYA 1B3EA 3WAEA 2HPGA 4TLMB 2F7BA 2QRYA 3G3JA 2D5WA 3LC8A 3OO8A 1FPKA 5LOMA 4NAPA 5DYHA 3OO7A 4OVQA 2GFEA 5I56A 4JDFA 1IMCA 1LBYA 2PX1A 4QSCA 5F24A 1OQGA 5TPAA 1EZ9A 3FXQA 2I3WA 2DOJA 1UIVA 1IITA 4GD5A 2PFYA 4PAFA 4MX6A 1M5EA 2XHDA 3MVWA 2YPNA 3FBPA 1S50A 2WX9A 1P1NA 4OWDA 1DCUA 3PMXA 3O28A 5JK4A 3NOHA 3DRKA 4R6YA 2QVRA 4R9GA 1NL5A 4IGRA 1MXXA 1MDQA 1Y20A 3PPOA 2PT2A 1B3FA 3KJ7A 5LTCA 3VLWA 2B4MA 2THIA 4PC9A 5H8QA 5KCJA 3PPRA 4QHQA 3N94A 2QSXA 3CSBA 2E0SA 3ONMA 1LAFE 4H65A 4F2OA 5A5XA 2Y5KA 3JZJA 5I2KB 5L9OA 1H45A 4IO4A 4FECA 1WDNA 3V89B 4IY6A 2XXPA 2NOOA 3SEWA 5ITOA 5TP9A 1D9QA 2HXWA 5I7IA 5TU0A 4DXBA 3CI8A 4GXAA 4PE5B 1QUKA 1NV4A 1MRPA 5M2VA 3U65A 3UN6A 3FUZA 4QXDA 4GWXA 5AE4A 1RYOA 3MBPA 4OZ9A 5JEIA 4DLDA 3MUQA 2DE3A 2RCBA 2HQ0A 3DLNA 3RGYA 3OEKA 3TQWA 3PPNA 2G29A 3RT6B 3UIFA 3RPLA 4HE2A 3O2AA 1QGXA 4IR8A 3VVDA 4U4SA 4IO5A 1NH8A 1S9TA 1B1HA 3LSWA 3L6HA 3SEUA 2F5XA 2Y7IA 2WOPA 4EQBA 4K3FA 1LCTA 3QAXA 1B6HA 2XX8A 2A5TA 4GOTA 3TTLA 5A5XB 4NTLA 4ONYA 3PD9A 1Y3QA 4AQ4A 2BJJX 3GBAA 5A5LA 4JWXA 4WEDA 2FIXA 3MSTA 2GQ1A 4P56A 1LB9A 3IJXB 4OEUA 4BDRA 2VP1A 4FJPA 5DVJA 4AS4A 1B0LA 3V83A 3TPAA 3OO6A 3SESA 3D1RA 3U94A 4GLIA 1EYIA 4BDOA 3E3KA 3IO4A 4O8MA 4NF0A 3A3CA 4MNIA 4ZEFA 1N7XA 4FORA 1FPBA 1USYE 3KEIA 4GL0A 5AA2B 4ND9A 4POWA 4GWUA 1A55A 4QBAA 3T9HB 1FTAA 3IB0A 1PDAA 1DPEA 1Q1KA 1NV2A 3LVUA 2UVGA 3BFUA 2DYXA 1FBGA 4F3SA 4N6PA 4ZECA 4PAIA 4ELPA 4IO2A 4IY5A 4RY1A 3GBBA 2ZXTA 3QUJA 2NUVA 4PDDA 1FBEA 4QFPA 2HFBA 4OVRA 4PAKA 2E1SA 1QW0A 2I4BA 1XOCA 3C4MA 2R8TA 1MM6A 1SW1A 3KZGA 4HTGA 4M4GA 4P0IA 4P9KA 3TFLA 5H8FA 4NWCA 2GHAA 4IO7A 4AS5A 2VT5A 4N8YA 5ET5A 3CSGA 3PU5A 2VD2A 4QFNA 4NF6A 5EYFA 3KN8A 4ELOA 4RYAA 3PPPA 1N0TA 3PUWE 1NNFA 1SD3A 3K01A 1RDYA 3S9EA 1URDA 3B50A 4WKMA 4G61A 5I84A 4I3EA 2RC9A 1MH3A 1IEJA 2I49A 4R9FA 4YMBA 5IGAA 2ONSA 5ET6A 4NHBA 3MC2A 4XFEA 4F1YA 4MMPA 1BIYA 3IJOB 3RQTA 3R7XA 2NXOA 3ZKLA 4DZ1A 4JVDA 5FBPA 1NV0A 2YJPA 5F1QA 4NF8A 4NMYA 2QMXA 4ZEBA 2QS3A 5IAIA 2HXRA 4KCCA 4NF6B 4Q8RA 4KCDA 2WBDA 2WYPA 3TKDA 4U2RA 1I6AA 1USYH 5I2NB 5H8NB 2Y84A 2FNCA 3RLFE 4N6KA 1PC3A 4OVPA 3T66A 2NWJA 3C34A 2I6EA 4JVCA 2RKMA 1FPIA 1XHYA 4XKQA 4N13A 5T3JA 3KBZA 4GRKA 5AA3A 1B05A 1B3LA 4NE4A 1SW2A 3SKPA 1UIUA 4MAGA 4GXSB 2I0BA 2O69A 1NUWA 4OMBA 2H98A 1MQHA 3QSLA 2I3VA 2DWHA 3EHTA 1B4ZA 3CVGA 4GIZA 2KLFA 1Q35A 1PB9A 1MH4A 4R74A 4AB5A 2OX3A 3PUVE 2V3UA 4KQPA 4RNSA 1ZLQA 1CNQA 4XTCQ 1B1XA 3UP9A 2XXWA 2IA4A 1JNFA 3QK6A 1SYIA 3IFCA 3PUZE 2ALUA 3FJGA 1AL3A 4EXKA 4LA9A 3ODBA 1ELJA 3T9UA 2Y5LA 1FW0A 3W9WA 5JTYB 5HPQA 3OENA 2HAVA 4H0WA 2V25A 2R6GE 3FIRA 1FTKA 4YAHX 4F31B 2A5SA 1WVJA 3H03A 1ZU0A 3QYTA 3TTMA 4G8NA 1HSEA 4OHNA 3N5LA 2L5VA 3TODA 3S9NC 1VR5A 2ZYOA 1R1NA 3K1NA 4MNPA 4R75A 3IORA 2X7QA 1ZBMA 2RC8A 3Q27A 1A54A 2WYKA 4MH5A 3DP8A 3KN3A 4JBZA 4IO3A 4YB5A 2GHBA 3RN8A 1LGBC 3VVFA 3PPQA 1FBFA 4KI0E 3KFMA 2B3FA 5EHSA 4H45A 3LR1A 4TQUQ 4DI3D 4QFKA 3RY3A 2XD2A 4OETA 3KOTA 2F97A 3SDFA 3W15C 1JP4A 1ZIUA 1NNKA 3H06B 2DDKA 3U93A 1PEBA 3DRIA 4LN5A 2XWKA 4GL8A 3MZ1A 1M5CA 2OWTA 3E9XA 3TEPA 3MJNA 1QULA 5HM4B 1K9YA 1EZPA 3EN3A 4MLVA 3O66A 4RK2A 2GH9A 5ELVA 1EH3A 1EYJA 3BIGA 2O7UA 3GZGA 1P1UA 3IL1B 1WODA 4NN3A 3CIJA 4U4XA 1EU8A 4N6DA 1UTHB 2UXAA 4XKNA 3C36A 4GWYA 3OELA 3N26A 5FHMA 2Z22A 2JJKA 2IEEA 3PMWA 4MCOA 2QL3A 3EF7A 4NF5A 1BK4A 3FGSA 2Q8JA 1Y1MA 3H6UA 2CZKA 1QUIA 4X04A 1YYZA 5EYGA 5AA4B 5DW8A 1MY0A 4QF9A 3O97A 3E78A 5CMCA 1IXHA 2XXXA 3H4ZA 1JEVA 3CHGA 3SZPA 1MY2A 2F36A 1FPGA 4ZE8A 2M8CA 3Q29A 2XWIA 4NEDA 1LBVA 3FVKA 1B5JA 2OJTA 1JEUA 2O6AA 4PFYA 5H8HB 3IB1A 1HSLA 2DXRA 2BJIA 4OENA 3U92A 4HXVA 2ZZXA 4LZ5A 4PGNA 2ZMBA 2P1SA 2AYSA 3CFZA 2I4CA 4GF8A 3HN0A 4PETA 2XXIA 4LP2B 3ROJA 1SPIA 2X26A 5EQ7A 4ECFA 4R2BA 4WXJA 1MPCA 1LAGE 3RYAA 5FTIA 5I56B 2P3VA 4PCDA 5TPAB 5BWJA 5I58A 4XF5A 4UA8A 4U23A 2D3IA 4DIGA 4KHZE 3KGCA 1IZ1A 4E0XA 1B46A 3ZSFA 1MQIA 1IXIA 1OMPA 1OQHA 1YCJA 1LB8A 3IO6A 1T0KA 2F78A 3TCHA 3RTFB 1II5A 4LVQA 4N17A 3IOVA 3CG1A 1B4HA 2WOLA 2V3TA 1MG1A 2CEYA 2VGQA 1FPDA 1LBCA 4G68A 5H8QB 5KCJB 4M1VA 2QS1A 4H6DA 1QKAA 3MW0A 1DTZA 4YKKA 4JVIA 1N3WA 2I48A 2KR0A 1AIVA 1JW5A 3MQ9A 3CRBA 2WOKA 4G4PA 3B7DA 1LBXA 2QFLA 1XVYA 2PCRA 5ITPA 5TP9B 5ISUA 4I40A 3TTKA 1FPEA 4YICA 3MPLA 2WKYA 4PFTA 3B8BA 1D3KA 4MNCA 1SDXA 4LQ2A 4X8RA 1XS5A 4I9DA 1NI9A 3H7MA 2H5YA 3O6PA 1AWBA 1FQAA 2YLNA 2Y7PA 1Y4CA 4G8MA 1NKXA 2Q89A 1YPNA 2KQZA 2XX9A 5KZTA 1B5HA 2OLBA 4G68C 4RXLA 4PFUA 3RPLB 3N6TA 2OWSA 1MS7A 3MVZA 3E79A 3P7IA 4GWOA 1LSTA 1OVBA 4QFLA 1LFGA 4C1TA 2ONKE 4OVSA 4HS7A 2A5TB 1MPBA 2V84A 4XXUA 5I57A 5ET8A 1N7WA 4N91A 3N6UA 4U1OA 1QVSA 3MWBA 5CMBA 2F7AA 2HEUA 3TUSA 1DSNA 4THIA 1UTBA 4ZE9A 1S7YA 3TTRA 2OCUA 1NV5A 3K02A 2ZNTA 1BTJA 1G0HA 5KDTA 5DVIA 4JXIA 4F2QA 3EHSA 4RK9A 3FATA 4OTEA 3RTWB 1B5IA 1US4A 3PTYA 1TT1A 4XEQA 3VFJA 3IOTA 3DRHA 1IUDA 2AIXA 5EHMA 3TELA 1ANFA 2FHYA 4EF1A 1H76A 4L17A 2ANJA 2HZLA 2P3NA 3VXCA 1JW1A 3IB2A 3VE1B 2W7YA 4R2FA 2DE4A 1VE4A 3VV5A 3OD7A 3S2VA 3O6HA 3E13X 4FE8A 4EUOA 2PVUA 3HV1A 3H6VA 4O7IA 4P1EA 2Q2CA 5EQ9A 2UVIA 3JV9A 2CEXA 4FIMA 2B4LA 1ATGA 2WBBA 5CMMA 1SW4A 3DM0A 3HPIA 2HHMA 5FHOA 2F35A 3DP4A 1N3XA 4H8JA 1N84A 1VFDA 4BLAA 3DRFA 2Q2AA 3Q25A 2F3BA 3UA8A 2XXYA 1B2HA 4P3LA 4KR5A 4JSDA 3AXFA 3DRGA 3IR1A 4H5FA 1D9VA 3OOAA 3FV1A 4X1DA 5CC2A 4HW8A 3C32A 5ESYA 3UGWA 2PFZA 4FBPA 3T0JA 2DP8A 4ESWA 4XKPA 3CR9A 4PF8A 5H8FB 4MFIA 1NH7A 3O9PA 2HZKA 4UABA 4GQOA 3HO7A 1B7UA 5J1DA 4POXA 4IB2A 2XXQA 3TCGA 3TQLA 4PBHA 2O1LA 5CBSA 3V8XB 2QMWA 4GFRA 4LUBA 2R9JA 4RPNA 4NG7A 4O7MA 1PBPA 1YXIA 1Y9UA 3TTNA 1IXGA 1HSJA 2AL4A 4FEBA 3I6VA 3K2DA 1SVXB 4TOZA 4JWYA 2Q74A 3Q26A 4HCYA 1K9ZA 3H3GA 1XC1A 4YU0A 4P1LA 2XWOA 1NNTA 4AB6A 4NF4A 5I59A 2F6PA 4R72A 3EKIA 1NV7A 4HCWA 1IMDA 2FIEA 1MDP1 2ONRA 2DWAA 3OO9A 3RYBA 3O29A 5ICQA 4NF8B 3I3VA 1MXWA 4QFOA 2H99A 3VDFA 2QJEA 2Q9TA 1ZJLA 1TFAA 1SYHA 4PE3A 4KPTA 3LSLA 1IMAA 3QXMA 3SEYA 1J1NA 5B70A 3MP8A 5DEXA 2CZIA 3FVOA 3T22A 3T93B 4GWSA 1INPA 2RC7A 3O6IA 1BLFA 4DE8A 4P8BA 4GX3A 1PB8A 4BDLA 1B52A 1GGGA 5CI5A 3KBRA 4X1BA 3K6UA 2O68A 5CRYA 2Z23A 2DQVA 4PFIA 1Y4TA 2O51A 2ABHA 2P0SA 5CBRA 4OANA 1QJMA 1DBZA 1MXUA 4KYDA 3BBRA 1I69A 1LLSA 1XI6A 1JW4A 2ZNSA 1LFHA 3TAJA 1URGA 3TZAA 3RT8A 2V3QA 3VXBA 5K2YA 4MJOA 4O3CA 1CB6A 3SEVA 3BKIB 1KA0A 1SW5A 2QVVA 2FA7A 5IZ3A 3IFAA 1YZ0A 1MY3A 4KYSA 4F1UA 2V93A 4PFBA 2VPNA 3USDA 4FEDA 3ZKKA 3M3KA 1NUXA 3U72A 3CFXA 1SBPA 1R9QA 3CG3A 1ZTYA 1O64A 1UQWA 4GX4A 1PBQA 3EQ1A 1IQ7A 1QKBA 1FPJA 4OA4A 1EZOA 1FTOA 5DT6A 3TMGA 2B3BA 4O3BA 1YAEA 1IMBA 4E0WA 5CMKA 3KN7A 3EHUA 1ZMGA 5DVFA 4MF3A 2ZYKA 2DE2A 4OEVA 2Y7WA 3UORA 3H6TA 2HCAA 3K1PA 1AOVA 1Z7NE 4KYEA 4GVOA 3S9MC 1XVXA 4Q30B 1GR2A 2DVZA 2DVCA 1FBPA 3Q28A 2VHAA 4RA1A 1NMUA 2QS4A 2PMSA 3PV0E 5AA1A 2XXHA 4HE1A 4EQ9A 1R6ZA 2XXVA 3G3FA 4O3AA 2R71A 4NX1A 2OK2A 2P2AA 2V4CA 1NFTA 5J16A 3LUZA 1FRPA 1F9BA 2XXTA 4EQ7A 1JVYA 3C35A 2G93A 1O7TA 3FJ7A 1VFEA 3LSXA 4OYVA 1KA1A 1KWHA 1B9JA 2RF1A 1NV6A 4JSOA 1NUZA 2Y7RA 2Z8DA 3MP1A 3RPWA 5I2KA 2QS2A 4ZEKA 1FPFA 2XXUA 1MY1A 2CMOA 3LUYA 4Q0CA 1FPLA 3FVNA 4FAJA 4GX6A 1CE2A
chains in the Genus database with same CATH topology
3U8QA 1LAHE 5DTBA 4G2ZA 1MQGA 4QSDA 4KFQA 2XD3A 3PUYE 4NWDA 1US5A 1FTJA 4F19A 4X48A 4F3BA 3MVYA 2D21A 3C9HA 3MPKA 4LZ8A 1O63A 3K1MA 4TLLB 1FCKA 2XXRA 3DELB 4F22A 2RINA 1FQBA 1POY1 1JVXA 3KSJA 4Z0IA 1OVTA 1L5TA 1BP5A 3M3FA 3UK4A 4H5GA 4NF5B 4LZ7A 3T9VA 1XT8A 5FHNA 1B32A 2GRVA 1LAXA 4ISUA 2I0CA 4PFWA 1SI1A 3GLBA 4P0GA 3SETA 3MVXA 1FQFA 4YZZA 4EDPA 3G3GA 1LFIA 1NNPA 2AL5A 4JWOA 5L9MA 5K2XA 2DWIA 3FTOA 4OESA 5L8DA 1P99A 1JETA 4YB6A 2H25A 2RCAA 4ELRA 3FXRA 3RUMA 1M5FA 5AA2A 3L6GA 4RJZA 1P1QA 1GVCA 1IIWA 2PBWA 4Q5TA 2ZNUA 4ZEIA 5I58B 1DPPA 3RNNA 1MY4A 3PMVA 1N76A 3FD3A 3ECRA 3GXAA 1TFDA 2O1MA 3K00A 4U22A 3PUXE 4OQOA 1QUJA 3TDJA 4LONB 1OLCA 1M5BA 1B58A 3WAFA 4F1VA 3C33A 1B7HA 2O7IA 4R6KA 2O84X 4RPOA 4G68B 1JQFA 3G3IA 4I1DA 1DMBA 3TYHA 3LBSA 4I62A 1D4NA 3T96B 4OFOA 4OXVA 2FYIA 5F7VA 3M3LA 2UYFA 1PB7A 4MBPA 3MZBA 1I6BA 4P11A 2LAOA 3ILUB 3LSFB 3R6UA 1RKMA 4G8HA 3B6QA 3D4GA 2VOZA 4R6HA 3W9VA 3A09A 3OMBA 3MAMA 4BDNA 5HBCA 4U1ZA 3S9LC 4BDMA 3IOWA 2XX7A 1URSA 4F3GA 1MXZA 4U21A 4I8CA 2DSFA 1P1OA 4DCXA 2ZYNA 5I57B 3A3UA 4XKRA 3O6GA 4YKJA 4ZZEA 3F11A 3T9XB 2REJA 2Y7KA 1UTBB 3I5OA 5CM6A 1MPDA 3SERA 3OSRA 1FQDA 4OERA 5I2NA 4IGTA 5H8NA 3KJTA 4EXLA 4ZDMA 2F8DA 1OIBA 5KDTB 4MLQA 4DXUA 3KSXA 1Y3PA 3K4UA 5B7DA 1B51A 2H9BA 3FVGA 3FZVA 5H8SA 1VSOA 1H3DA 3HSTA 1SI0A 4C0RA 1B0HA 1Z7ME 1B40A 4DXCA 4Z7EA 1IXCA 4YMAA 3HCQA 2PYYA 2NVUB 2Z8FA 3G7WA 3K6WA 3THIA 2Q88A 3U1OA 4ZEDA 3C31A 3TCFA 3B6TA 2X7PA 4H1XA 2Z8EA 2PT1A 3IAZA 3ZS6A 1AMFA 5AA2D 2ZYMA 1R9LA 3FASA 1YTVA 1B3GA 1DTGA 5ICTA 2DWJA 4F29A 4G77A 3DRJA 3PD8A 3IK6B 3K0VA 4YKPA 1A7LA 1TXFA 3D4CA 3HHGA 1FQCA 4X9TA 1I6QA 4OVJA 3PAMA 3KG2A 2UVHA 5IKBA 1B3HA 5JTYA 4R73A 3VLVA 4WEPA 4JB7A 3KOSA 3M8UA 4YKIA 3CFLA 3E4RA 4FATA 3SEXA 3R26A 2HAUA 3B6WA 5BUUA 3OEMA 3QIMA 1MM7A 3FXUA 3OXNA 5L9SA 1FTLA 1A8EA 3IOUA 4EF2A 1FQEA 3FJMA 2F6GA 2VD3A 5FTHA 1FTMA 3MZ9A 3HHFA 2UYEA 4DDDA 3PGFA 4LATA 4KD5A 2DS9A 2OZZA 1M5DA 4ZS9A 1AH5A 1POTA 4NF4B 4ELQA 1LBBA 1MQDA 5I59B 4YB7A 1MQJA 3DP6A 1A8FA 3VLUA 4BDQA 1DOTA 1RYXA 3EPEA 3QUFA 3JYRA 1H44A 3BFTA 3K6XA 2DXYA 4F18A 5DEXB 2CZLA 3VVEA 4H8IA 1BKAA 2F7CA 3K6VA 4LQ5A 2UVJA 4N07A 1UTHA 1Y1ZA 2I58A 2REGA 4IO6A 4F3PA 4ZZAA 1P1WA 1ZKBA 3ILTB 1MXVA 3MP6A 4ESXA 3FV2A 4F39A 3V5AA 1D9YA 4QSEA 1A40A 4OFJA 1GV8A 4PP0A 1H43A 2B65A 1A99A 5AA4A 4OFLA 4DCYA 2H4IA 3OSQA 1Y3NA 1OLAA 1GTKA 4H67A 5H8HA 1MXYA 4UACA 4C1UA 3G3HA 2OBGA 3H6WA 2ESNA 2F34A 4QRZA 3G3KA 4XIGQ 1B7ZA 3IX1A 1N04A 1SQYA 3S4UA 2QPQA 4PQJA 1LCFA 1TWYA 1B3EA 3WAEA 4TLMB 2F7BA 2QRYA 3G3JA 2D5WA 3LC8A 3OO8A 5LOMA 5DYHA 3OO7A 2GFEA 5I56A 4JDFA 2PX1A 4QSCA 5TPAA 1OQGA 1EZ9A 3FXQA 2I3WA 2DOJA 1UIVA 1IITA 4GD5A 1M5EA 2XHDA 3MVWA 2YPNA 1S50A 1P1NA 4OWDA 3PMXA 3O28A 5JK4A 3DRKA 4R6YA 4R9GA 1NL5A 4IGRA 1MXXA 1MDQA 1Y20A 3PPOA 2PT2A 1B3FA 3KJ7A 3VLWA 2B4MA 2THIA 5H8QA 5KCJA 3PPRA 4QHQA 3N94A 2QSXA 3CSBA 2E0SA 3ONMA 1LAFE 4H65A 4F2OA 5A5XA 3JZJA 5I2KB 5L9OA 1H45A 4IO4A 4FECA 1WDNA 3V89B 4IY6A 2XXPA 2NOOA 3SEWA 5ITOA 5TP9A 2HXWA 5TU0A 4DXBA 3CI8A 4GXAA 4PE5B 1QUKA 1MRPA 5M2VA 3UN6A 3FUZA 5AE4A 1RYOA 3MBPA 4OZ9A 5JEIA 4DLDA 3MUQA 2DE3A 2RCBA 2HQ0A 3DLNA 3RGYA 3OEKA 3TQWA 3PPNA 2G29A 3RT6B 3UIFA 3O2AA 3VVDA 4U4SA 4IO5A 1NH8A 1S9TA 1B1HA 3LSWA 3L6HA 3SEUA 2F5XA 2Y7IA 4EQBA 2WOPA 4K3FA 1LCTA 3QAXA 1B6HA 2XX8A 2A5TA 4GOTA 3TTLA 5A5XB 4NTLA 4ONYA 3PD9A 1Y3QA 4AQ4A 2BJJX 3GBAA 4JWXA 4WEDA 1LB9A 3IJXB 4OEUA 4BDRA 2VP1A 4FJPA 5DVJA 1B0LA 3V83A 3TPAA 3OO6A 3SESA 3U94A 4GLIA 4BDOA 3E3KA 3IO4A 3A3CA 4ZEFA 1N7XA 4FORA 1USYE 3KEIA 4GL0A 5AA2B 4ND9A 4POWA 1A55A 3T9HB 3IB0A 1PDAA 1DPEA 1Q1KA 2UVGA 3LVUA 3BFUA 2DYXA 4F3SA 4N6PA 4ZECA 4ELPA 4IO2A 4IY5A 4RY1A 3GBBA 2ZXTA 3QUJA 2NUVA 4QFPA 2HFBA 2E1SA 1QW0A 2I4BA 1XOCA 3C4MA 1MM6A 1SW1A 3KZGA 4HTGA 4M4GA 4P0IA 3TFLA 5H8FA 4NWCA 2GHAA 4IO7A 3CSGA 3PU5A 2VD2A 4QFNA 4NF6A 5EYFA 4ELOA 3KN8A 4RYAA 3PPPA 1N0TA 3PUWE 1NNFA 1SD3A 3K01A 3S9EA 1URDA 4WKMA 5I84A 2RC9A 1MH3A 1IEJA 2I49A 4R9FA 4YMBA 2ONSA 3MC2A 4F1YA 1BIYA 3IJOB 3RQTA 3R7XA 2NXOA 3ZKLA 4DZ1A 2YJPA 5F1QA 4NF8A 4NMYA 2QMXA 4ZEBA 2QS3A 5IAIA 4KCCA 4NF6B 4Q8RA 4KCDA 3TKDA 4U2RA 1I6AA 1USYH 5I2NB 5H8NB 2Y84A 2FNCA 3RLFE 1PC3A 3T66A 2NWJA 3C34A 2I6EA 2RKMA 1XHYA 4XKQA 4N13A 4GRKA 5AA3A 1B05A 1B3LA 4NE4A 1SW2A 3SKPA 1UIUA 4GXSB 2I0BA 2O69A 4OMBA 2H98A 1MQHA 3QSLA 2I3VA 2DWHA 3EHTA 1B4ZA 3CVGA 4GIZA 2KLFA 1Q35A 1PB9A 1MH4A 4R74A 4AB5A 3PUVE 2V3UA 4KQPA 4RNSA 1ZLQA 4XTCQ 1B1XA 3UP9A 2XXWA 2IA4A 1JNFA 3QK6A 1SYIA 3PUZE 2ALUA 3FJGA 1AL3A 4EXKA 4LA9A 3ODBA 1ELJA 3T9UA 1FW0A 3W9WA 5JTYB 5HPQA 3OENA 2HAVA 4H0WA 2V25A 2R6GE 3FIRA 1FTKA 4YAHX 4F31B 2A5SA 1WVJA 3H03A 1ZU0A 3QYTA 3TTMA 4G8NA 1HSEA 4OHNA 3N5LA 3TODA 3S9NC 1VR5A 2ZYOA 1R1NA 3K1NA 4R75A 3IORA 2X7QA 1ZBMA 2RC8A 3Q27A 1A54A 4MH5A 3DP8A 3KN3A 4JBZA 4IO3A 4YB5A 2GHBA 3RN8A 1LGBC 3VVFA 3PPQA 4KI0E 3KFMA 2B3FA 5EHSA 3LR1A 4TQUQ 4QFKA 3RY3A 2XD2A 4OETA 3KOTA 2F97A 3SDFA 3W15C 1ZIUA 1NNKA 3H06B 3U93A 1PEBA 3DRIA 4GL8A 3MZ1A 1M5CA 2OWTA 3E9XA 3TEPA 3MJNA 1QULA 5HM4B 1EZPA 3EN3A 4MLVA 3O66A 4RK2A 2GH9A 5ELVA 1EH3A 2O7UA 3GZGA 1P1UA 3IL1B 1WODA 3CIJA 4U4XA 1EU8A 1UTHB 2UXAA 4XKNA 3C36A 3OELA 3N26A 5FHMA 2Z22A 2IEEA 3PMWA 2QL3A 3EF7A 4NF5A 3FGSA 2Q8JA 1Y1MA 3H6UA 1QUIA 5AA4B 1MY0A 4QF9A 3O97A 5CMCA 1IXHA 2XXXA 3H4ZA 1JEVA 3CHGA 1MY2A 2F36A 4ZE8A 2M8CA 3Q29A 4NEDA 3FVKA 1B5JA 2OJTA 1JEUA 2O6AA 4PFYA 5H8HB 3IB1A 1HSLA 2DXRA 4OENA 3U92A 4LZ5A 2ZMBA 2P1SA 2AYSA 3CFZA 2I4CA 4GF8A 3HN0A 4PETA 2XXIA 4LP2B 2X26A 4ECFA 4R2BA 4WXJA 1MPCA 1LAGE 3RYAA 5FTIA 5I56B 5TPAB 5BWJA 5I58A 4UA8A 4U23A 2D3IA 4DIGA 4KHZE 3KGCA 1IZ1A 4E0XA 1B46A 3ZSFA 1MQIA 1IXIA 1OMPA 1OQHA 1YCJA 1LB8A 3IO6A 1T0KA 2F78A 3TCHA 3RTFB 1II5A 4LVQA 3IOVA 3CG1A 1B4HA 2WOLA 2V3TA 1MG1A 2VGQA 1LBCA 4G68A 5H8QB 5KCJB 4M1VA 2QS1A 4H6DA 1QKAA 3MW0A 1DTZA 4YKKA 1N3WA 2I48A 1AIVA 1JW5A 3MQ9A 3CRBA 2WOKA 4G4PA 3B7DA 1XVYA 5ITPA 5TP9B 5ISUA 3TTKA 4YICA 3MPLA 2WKYA 4PFTA 1D3KA 1SDXA 4LQ2A 1XS5A 4I9DA 3H7MA 2H5YA 3O6PA 1FQAA 2YLNA 2Y7PA 1Y4CA 4G8MA 1NKXA 2Q89A 1YPNA 2XX9A 5KZTA 1B5HA 2OLBA 4G68C 4RXLA 4PFUA 3N6TA 2OWSA 1MS7A 3MVZA 3P7IA 4GWOA 1LSTA 1OVBA 4QFLA 1LFGA 4C1TA 2ONKE 4HS7A 2A5TB 1MPBA 2V84A 4XXUA 5I57A 1N7WA 3N6UA 4U1OA 1QVSA 3MWBA 5CMBA 2F7AA 2HEUA 3TUSA 1DSNA 4THIA 1UTBA 4ZE9A 1S7YA 3TTRA 2OCUA 3K02A 2ZNTA 1BTJA 5KDTA 5DVIA 4JXIA 4F2QA 3EHSA 4RK9A 3FATA 4OTEA 3RTWB 1B5IA 1US4A 1TT1A 3VFJA 3IOTA 3DRHA 1IUDA 2AIXA 5EHMA 3TELA 1ANFA 4EF1A 1H76A 4L17A 2ANJA 2HZLA 3VXCA 1JW1A 3IB2A 3VE1B 2W7YA 4R2FA 2DE4A 1VE4A 3VV5A 3OD7A 3S2VA 3O6HA 3E13X 4FE8A 4EUOA 2PVUA 3HV1A 3H6VA 2Q2CA 2UVIA 3JV9A 4FIMA 2B4LA 1ATGA 5CMMA 1SW4A 3DM0A 3HPIA 5FHOA 2F35A 3DP4A 1N3XA 4H8JA 1N84A 1VFDA 4BLAA 3DRFA 2Q2AA 3Q25A 3UA8A 2XXYA 1B2HA 4KR5A 4JSDA 3AXFA 3DRGA 3IR1A 4H5FA 1D9VA 3OOAA 3FV1A 4X1DA 5CC2A 4HW8A 3C32A 3UGWA 2DP8A 4ESWA 4XKPA 3CR9A 5H8FB 4MFIA 1NH7A 3O9PA 2HZKA 4GQOA 3HO7A 1B7UA 5J1DA 4POXA 4IB2A 2XXQA 3TCGA 3TQLA 2O1LA 5CBSA 3V8XB 2QMWA 4GFRA 4LUBA 2R9JA 4RPNA 1PBPA 1Y9UA 3TTNA 1IXGA 1HSJA 2AL4A 4FEBA 3I6VA 3K2DA 1SVXB 4TOZA 4JWYA 3Q26A 4HCYA 3H3GA 1XC1A 4YU0A 1NNTA 4AB6A 4NF4A 5I59A 2F6PA 4R72A 4HCWA 1MDP1 2ONRA 2DWAA 3OO9A 3RYBA 3O29A 5ICQA 4NF8B 3I3VA 1MXWA 4QFOA 2H99A 3VDFA 2QJEA 2Q9TA 1ZJLA 1TFAA 1SYHA 4KPTA 3LSLA 3QXMA 3SEYA 1J1NA 5B70A 3MP8A 5DEXA 3FVOA 3T22A 3T93B 2RC7A 3O6IA 1BLFA 4DE8A 1PB8A 4BDLA 1B52A 1GGGA 5CI5A 3KBRA 4X1BA 3K6UA 2O68A 5CRYA 2Z23A 2DQVA 1Y4TA 2O51A 2ABHA 2P0SA 5CBRA 1QJMA 1MXUA 4KYDA 3BBRA 1I69A 1LLSA 1JW4A 2ZNSA 1LFHA 3TAJA 1URGA 3TZAA 3RT8A 2V3QA 3VXBA 5K2YA 4O3CA 1CB6A 3SEVA 3BKIB 1SW5A 2FA7A 1MY3A 4KYSA 4F1UA 2V93A 3USDA 4FEDA 3ZKKA 3M3KA 3U72A 3CFXA 1SBPA 1R9QA 3CG3A 1ZTYA 1O64A 1UQWA 1PBQA 3EQ1A 1IQ7A 1QKBA 1EZOA 1FTOA 5DT6A 3TMGA 2B3BA 4O3BA 1YAEA 4E0WA 5CMKA 3KN7A 3EHUA 1ZMGA 5DVFA 4MF3A 2ZYKA 2DE2A 4OEVA 2Y7WA 3UORA 3H6TA 2HCAA 3K1PA 1AOVA 1Z7NE 4KYEA 4GVOA 3S9MC 1XVXA 4Q30B 1GR2A 2DVZA 2DVCA 3Q28A 2VHAA 4RA1A 1NMUA 2QS4A 2PMSA 3PV0E 5AA1A 2XXHA 4EQ9A 1R6ZA 2XXVA 3G3FA 4O3AA 2R71A 2OK2A 2P2AA 1NFTA 1F9BA 2XXTA 4EQ7A 1JVYA 3C35A 2G93A 1O7TA 3FJ7A 1VFEA 3LSXA 4OYVA 1KWHA 1B9JA 2RF1A 4JSOA 2Y7RA 2Z8DA 3MP1A 3RPWA 5I2KA 2QS2A 4ZEKA 2XXUA 1MY1A 2CMOA 3LUYA 4Q0CA 3FVNA 4FAJA 1CE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8Q A;  1LAH E;  5DTB A;  4G2Z A;  1MQG A;  4QSD A;  4KFQ A;  2XD3 A;  3PUY E;  4NWD A;  1US5 A;  1FTJ A;  4F19 A;  4X48 A;  4F3B A;  3MVY A;  2D21 A;  3C9H A;  3MPK A;  4LZ8 A;  1O63 A;  3K1M A;  4TLL B;  1FCK A;  2XXR A;  3DEL B;  4F22 A;  2RIN A;  1FQB A;  1POY 1;  1JVX A;  3KSJ A;  4Z0I A;  1OVT A;  1L5T A;  1BP5 A;  3M3F A;  3UK4 A;  4H5G A;  4NF5 B;  4LZ7 A;  3T9V A;  1XT8 A;  5FHN A;  1B32 A;  2GRV A;  1LAX A;  4ISU A;  2I0C A;  4PFW A;  1SI1 A;  3GLB A;  4P0G A;  3SET A;  3MVX A;  1FQF A;  4YZZ A;  4EDP A;  3G3G A;  1LFI A;  1NNP A;  2AL5 A;  4JWO A;  5L9M A;  5K2X A;  2DWI A;  3FTO A;  4OES A;  5L8D A;  1P99 A;  1JET A;  4YB6 A;  2H25 A;  2RCA A;  4ELR A;  3FXR A;  3RUM A;  1M5F A;  5AA2 A;  3L6G A;  4RJZ A;  1P1Q A;  1GVC A;  1IIW A;  2PBW A;  4Q5T A;  2ZNU A;  4ZEI A;  5I58 B;  1DPP A;  3RNN A;  1MY4 A;  3PMV A;  1N76 A;  3FD3 A;  3ECR A;  3GXA A;  1TFD A;  2O1M A;  3K00 A;  4U22 A;  3PUX E;  4OQO A;  1QUJ A;  3TDJ A;  4LON B;  1OLC A;  1M5B A;  1B58 A;  3WAF A;  4F1V A;  3C33 A;  1B7H A;  2O7I A;  4R6K A;  2O84 X;  4RPO A;  4G68 B;  1JQF A;  3G3I A;  4I1D A;  1DMB A;  3TYH A;  3LBS A;  4I62 A;  1D4N A;  3T96 B;  4OFO A;  4OXV A;  2FYI A;  5F7V A;  3M3L A;  2UYF A;  1PB7 A;  4MBP A;  3MZB A;  1I6B A;  4P11 A;  2LAO A;  3ILU B;  3LSF B;  3R6U A;  1RKM A;  4G8H A;  3B6Q A;  3D4G A;  2VOZ A;  4R6H A;  3W9V A;  3A09 A;  3OMB A;  3MAM A;  4BDN A;  5HBC A;  4U1Z A;  3S9L C;  4BDM A;  3IOW A;  2XX7 A;  1URS A;  4F3G A;  1MXZ A;  4U21 A;  4I8C A;  2DSF A;  1P1O A;  4DCX A;  2ZYN A;  5I57 B;  3A3U A;  4XKR A;  3O6G A;  4YKJ A;  4ZZE A;  3F11 A;  3T9X B;  2REJ A;  2Y7K A;  1UTB B;  3I5O A;  5CM6 A;  1MPD A;  3SER A;  3OSR A;  1FQD A;  4OER A;  5I2N A;  4IGT A;  5H8N A;  3KJT A;  4EXL A;  4ZDM A;  2F8D A;  1OIB A;  5KDT B;  4MLQ A;  4DXU A;  3KSX A;  1Y3P A;  3K4U A;  5B7D A;  1B51 A;  2H9B A;  3FVG A;  3FZV A;  5H8S A;  1VSO A;  1H3D A;  3HST A;  1SI0 A;  4C0R A;  1B0H A;  1Z7M E;  1B40 A;  4DXC A;  4Z7E A;  1IXC A;  4YMA A;  3HCQ A;  2PYY A;  2NVU B;  2Z8F A;  3G7W A;  3K6W A;  3THI A;  2Q88 A;  3U1O A;  4ZED A;  3C31 A;  3TCF A;  3B6T A;  2X7P A;  4H1X A;  2Z8E A;  2PT1 A;  3IAZ A;  3ZS6 A;  1AMF A;  5AA2 D;  2ZYM A;  1R9L A;  3FAS A;  1YTV A;  1B3G A;  1DTG A;  5ICT A;  2DWJ A;  4F29 A;  4G77 A;  3DRJ A;  3PD8 A;  3IK6 B;  3K0V A;  4YKP A;  1A7L A;  1TXF A;  3D4C A;  3HHG A;  1FQC A;  4X9T A;  1I6Q A;  4OVJ A;  3PAM A;  3KG2 A;  2UVH A;  5IKB A;  1B3H A;  5JTY A;  4R73 A;  3VLV A;  4WEP A;  4JB7 A;  3KOS A;  3M8U A;  4YKI A;  3CFL A;  3E4R A;  4FAT A;  3SEX A;  3R26 A;  2HAU A;  3B6W A;  5BUU A;  3OEM A;  3QIM A;  1MM7 A;  3FXU A;  3OXN A;  5L9S A;  1FTL A;  1A8E A;  3IOU A;  4EF2 A;  1FQE A;  3FJM A;  2F6G A;  2VD3 A;  5FTH A;  1FTM A;  3MZ9 A;  3HHF A;  2UYE A;  4DDD A;  3PGF A;  4LAT A;  4KD5 A;  2DS9 A;  2OZZ A;  1M5D A;  4ZS9 A;  1AH5 A;  1POT A;  4NF4 B;  4ELQ A;  1LBB A;  1MQD A;  5I59 B;  4YB7 A;  1MQJ A;  3DP6 A;  1A8F A;  3VLU A;  4BDQ A;  1DOT A;  1RYX A;  3EPE A;  3QUF A;  3JYR A;  1H44 A;  3BFT A;  3K6X A;  2DXY A;  4F18 A;  5DEX B;  2CZL A;  3VVE A;  4H8I A;  1BKA A;  2F7C A;  3K6V A;  4LQ5 A;  2UVJ A;  4N07 A;  1UTH A;  1Y1Z A;  2I58 A;  2REG A;  4IO6 A;  4F3P A;  4ZZA A;  1P1W A;  1ZKB A;  3ILT B;  1MXV A;  3MP6 A;  4ESX A;  3FV2 A;  4F39 A;  3V5A A;  1D9Y A;  4QSE A;  1A40 A;  4OFJ A;  1GV8 A;  4PP0 A;  1H43 A;  2B65 A;  1A99 A;  5AA4 A;  4OFL A;  4DCY A;  2H4I A;  3OSQ A;  1Y3N A;  1OLA A;  1GTK A;  4H67 A;  5H8H A;  1MXY A;  4UAC A;  4C1U A;  3G3H A;  2OBG A;  3H6W A;  2ESN A;  2F34 A;  4QRZ A;  3G3K A;  4XIG Q;  1B7Z A;  3IX1 A;  1N04 A;  1SQY A;  3S4U A;  2QPQ A;  4PQJ A;  1LCF A;  1TWY A;  1B3E A;  3WAE A;  4TLM B;  2F7B A;  2QRY A;  3G3J A;  2D5W A;  3LC8 A;  3OO8 A;  5LOM A;  5DYH A;  3OO7 A;  2GFE A;  5I56 A;  4JDF A;  2PX1 A;  4QSC A;  5TPA A;  1OQG A;  1EZ9 A;  3FXQ A;  2I3W A;  2DOJ A;  1UIV A;  1IIT A;  4GD5 A;  1M5E A;  2XHD A;  3MVW A;  2YPN A;  1S50 A;  1P1N A;  4OWD A;  3PMX A;  3O28 A;  5JK4 A;  3DRK A;  4R6Y A;  4R9G A;  1NL5 A;  4IGR A;  1MXX A;  1MDQ A;  1Y20 A;  3PPO A;  2PT2 A;  1B3F A;  3KJ7 A;  3VLW A;  2B4M A;  2THI A;  5H8Q A;  5KCJ A;  3PPR A;  4QHQ A;  3N94 A;  2QSX A;  3CSB A;  2E0S A;  3ONM A;  1LAF E;  4H65 A;  4F2O A;  5A5X A;  3JZJ A;  5I2K B;  5L9O A;  1H45 A;  4IO4 A;  4FEC A;  1WDN A;  3V89 B;  4IY6 A;  2XXP A;  2NOO A;  3SEW A;  5ITO A;  5TP9 A;  2HXW A;  5TU0 A;  4DXB A;  3CI8 A;  4GXA A;  4PE5 B;  1QUK A;  1MRP A;  5M2V A;  3UN6 A;  3FUZ A;  5AE4 A;  1RYO A;  3MBP A;  4OZ9 A;  5JEI A;  4DLD A;  3MUQ A;  2DE3 A;  2RCB A;  2HQ0 A;  3DLN A;  3RGY A;  3OEK A;  3TQW A;  3PPN A;  2G29 A;  3RT6 B;  3UIF A;  3O2A A;  3VVD A;  4U4S A;  4IO5 A;  1NH8 A;  1S9T A;  1B1H A;  3LSW A;  3L6H A;  3SEU A;  2F5X A;  2Y7I A;  4EQB A;  2WOP A;  4K3F A;  1LCT A;  3QAX A;  1B6H A;  2XX8 A;  2A5T A;  4GOT A;  3TTL A;  5A5X B;  4NTL A;  4ONY A;  3PD9 A;  1Y3Q A;  4AQ4 A;  2BJJ X;  3GBA A;  4JWX A;  4WED A;  1LB9 A;  3IJX B;  4OEU A;  4BDR A;  2VP1 A;  4FJP A;  5DVJ A;  1B0L A;  3V83 A;  3TPA A;  3OO6 A;  3SES A;  3U94 A;  4GLI A;  4BDO A;  3E3K A;  3IO4 A;  3A3C A;  4ZEF A;  1N7X A;  4FOR A;  1USY E;  3KEI A;  4GL0 A;  5AA2 B;  4ND9 A;  4POW A;  1A55 A;  3T9H B;  3IB0 A;  1PDA A;  1DPE A;  1Q1K A;  2UVG A;  3LVU A;  3BFU A;  2DYX A;  4F3S A;  4N6P A;  4ZEC A;  4ELP A;  4IO2 A;  4IY5 A;  4RY1 A;  3GBB A;  2ZXT A;  3QUJ A;  2NUV A;  4QFP A;  2HFB A;  2E1S A;  1QW0 A;  2I4B A;  1XOC A;  3C4M A;  1MM6 A;  1SW1 A;  3KZG A;  4HTG A;  4M4G A;  4P0I A;  3TFL A;  5H8F A;  4NWC A;  2GHA A;  4IO7 A;  3CSG A;  3PU5 A;  2VD2 A;  4QFN A;  4NF6 A;  5EYF A;  4ELO A;  3KN8 A;  4RYA A;  3PPP A;  1N0T A;  3PUW E;  1NNF A;  1SD3 A;  3K01 A;  3S9E A;  1URD A;  4WKM A;  5I84 A;  2RC9 A;  1MH3 A;  1IEJ A;  2I49 A;  4R9F A;  4YMB A;  2ONS A;  3MC2 A;  4F1Y A;  1BIY A;  3IJO B;  3RQT A;  3R7X A;  2NXO A;  3ZKL A;  4DZ1 A;  2YJP A;  5F1Q A;  4NF8 A;  4NMY A;  2QMX A;  4ZEB A;  2QS3 A;  5IAI A;  4KCC A;  4NF6 B;  4Q8R A;  4KCD A;  3TKD A;  4U2R A;  1I6A A;  1USY H;  5I2N B;  5H8N B;  2Y84 A;  2FNC A;  3RLF E;  1PC3 A;  3T66 A;  2NWJ A;  3C34 A;  2I6E A;  2RKM A;  1XHY A;  4XKQ A;  4N13 A;  4GRK A;  5AA3 A;  1B05 A;  1B3L A;  4NE4 A;  1SW2 A;  3SKP A;  1UIU A;  4GXS B;  2I0B A;  2O69 A;  4OMB A;  2H98 A;  1MQH A;  3QSL A;  2I3V A;  2DWH A;  3EHT A;  1B4Z A;  3CVG A;  4GIZ A;  2KLF A;  1Q35 A;  1PB9 A;  1MH4 A;  4R74 A;  4AB5 A;  3PUV E;  2V3U A;  4KQP A;  4RNS A;  1ZLQ A;  4XTC Q;  1B1X A;  3UP9 A;  2XXW A;  2IA4 A;  1JNF A;  3QK6 A;  1SYI A;  3PUZ E;  2ALU A;  3FJG A;  1AL3 A;  4EXK A;  4LA9 A;  3ODB A;  1ELJ A;  3T9U A;  1FW0 A;  3W9W A;  5JTY B;  5HPQ A;  3OEN A;  2HAV A;  4H0W A;  2V25 A;  2R6G E;  3FIR A;  1FTK A;  4YAH X;  4F31 B;  2A5S A;  1WVJ A;  3H03 A;  1ZU0 A;  3QYT A;  3TTM A;  4G8N A;  1HSE A;  4OHN A;  3N5L A;  3TOD A;  3S9N C;  1VR5 A;  2ZYO A;  1R1N A;  3K1N A;  4R75 A;  3IOR A;  2X7Q A;  1ZBM A;  2RC8 A;  3Q27 A;  1A54 A;  4MH5 A;  3DP8 A;  3KN3 A;  4JBZ A;  4IO3 A;  4YB5 A;  2GHB A;  3RN8 A;  1LGB C;  3VVF A;  3PPQ A;  4KI0 E;  3KFM A;  2B3F A;  5EHS A;  3LR1 A;  4TQU Q;  4QFK A;  3RY3 A;  2XD2 A;  4OET A;  3KOT A;  2F97 A;  3SDF A;  3W15 C;  1ZIU A;  1NNK A;  3H06 B;  3U93 A;  1PEB A;  3DRI A;  4GL8 A;  3MZ1 A;  1M5C A;  2OWT A;  3E9X A;  3TEP A;  3MJN A;  1QUL A;  5HM4 B;  1EZP A;  3EN3 A;  4MLV A;  3O66 A;  4RK2 A;  2GH9 A;  5ELV A;  1EH3 A;  2O7U A;  3GZG A;  1P1U A;  3IL1 B;  1WOD A;  3CIJ A;  4U4X A;  1EU8 A;  1UTH B;  2UXA A;  4XKN A;  3C36 A;  3OEL A;  3N26 A;  5FHM A;  2Z22 A;  2IEE A;  3PMW A;  2QL3 A;  3EF7 A;  4NF5 A;  3FGS A;  2Q8J A;  1Y1M A;  3H6U A;  1QUI A;  5AA4 B;  1MY0 A;  4QF9 A;  3O97 A;  5CMC A;  1IXH A;  2XXX A;  3H4Z A;  1JEV A;  3CHG A;  1MY2 A;  2F36 A;  4ZE8 A;  2M8C A;  3Q29 A;  4NED A;  3FVK A;  1B5J A;  2OJT A;  1JEU A;  2O6A A;  4PFY A;  5H8H B;  3IB1 A;  1HSL A;  2DXR A;  4OEN A;  3U92 A;  4LZ5 A;  2ZMB A;  2P1S A;  2AYS A;  3CFZ A;  2I4C A;  4GF8 A;  3HN0 A;  4PET A;  2XXI A;  4LP2 B;  2X26 A;  4ECF A;  4R2B A;  4WXJ A;  1MPC A;  1LAG E;  3RYA A;  5FTI A;  5I56 B;  5TPA B;  5BWJ A;  5I58 A;  4UA8 A;  4U23 A;  2D3I A;  4DIG A;  4KHZ E;  3KGC A;  1IZ1 A;  4E0X A;  1B46 A;  3ZSF A;  1MQI A;  1IXI A;  1OMP A;  1OQH A;  1YCJ A;  1LB8 A;  3IO6 A;  1T0K A;  2F78 A;  3TCH A;  3RTF B;  1II5 A;  4LVQ A;  3IOV A;  3CG1 A;  1B4H A;  2WOL A;  2V3T A;  1MG1 A;  2VGQ A;  1LBC A;  4G68 A;  5H8Q B;  5KCJ B;  4M1V A;  2QS1 A;  4H6D A;  1QKA A;  3MW0 A;  1DTZ A;  4YKK A;  1N3W A;  2I48 A;  1AIV A;  1JW5 A;  3MQ9 A;  3CRB A;  2WOK A;  4G4P A;  3B7D A;  1XVY A;  5ITP A;  5TP9 B;  5ISU A;  3TTK A;  4YIC A;  3MPL A;  2WKY A;  4PFT A;  1D3K A;  1SDX A;  4LQ2 A;  1XS5 A;  4I9D A;  3H7M A;  2H5Y A;  3O6P A;  1FQA A;  2YLN A;  2Y7P A;  1Y4C A;  4G8M A;  1NKX A;  2Q89 A;  1YPN A;  2XX9 A;  5KZT A;  1B5H A;  2OLB A;  4G68 C;  4RXL A;  4PFU A;  3N6T A;  2OWS A;  1MS7 A;  3MVZ A;  3P7I A;  4GWO A;  1LST A;  1OVB A;  4QFL A;  1LFG A;  4C1T A;  2ONK E;  4HS7 A;  2A5T B;  1MPB A;  2V84 A;  4XXU A;  5I57 A;  1N7W A;  3N6U A;  4U1O A;  1QVS A;  3MWB A;  5CMB A;  2F7A A;  2HEU A;  3TUS A;  1DSN A;  4THI A;  1UTB A;  4ZE9 A;  1S7Y A;  3TTR A;  2OCU A;  3K02 A;  2ZNT A;  1BTJ A;  5KDT A;  5DVI A;  4JXI A;  4F2Q A;  3EHS A;  4RK9 A;  3FAT A;  4OTE A;  3RTW B;  1B5I A;  1US4 A;  1TT1 A;  3VFJ A;  3IOT A;  3DRH A;  1IUD A;  2AIX A;  5EHM A;  3TEL A;  1ANF A;  4EF1 A;  1H76 A;  4L17 A;  2ANJ A;  2HZL A;  3VXC A;  1JW1 A;  3IB2 A;  3VE1 B;  2W7Y A;  4R2F A;  2DE4 A;  1VE4 A;  3VV5 A;  3OD7 A;  3S2V A;  3O6H A;  3E13 X;  4FE8 A;  4EUO A;  2PVU A;  3HV1 A;  3H6V A;  2Q2C A;  2UVI A;  3JV9 A;  4FIM A;  2B4L A;  1ATG A;  5CMM A;  1SW4 A;  3DM0 A;  3HPI A;  5FHO A;  2F35 A;  3DP4 A;  1N3X A;  4H8J A;  1N84 A;  1VFD A;  4BLA A;  3DRF A;  2Q2A A;  3Q25 A;  3UA8 A;  2XXY A;  1B2H A;  4KR5 A;  4JSD A;  3AXF A;  3DRG A;  3IR1 A;  4H5F A;  1D9V A;  3OOA A;  3FV1 A;  4X1D A;  5CC2 A;  4HW8 A;  3C32 A;  3UGW A;  2DP8 A;  4ESW A;  4XKP A;  3CR9 A;  5H8F B;  4MFI A;  1NH7 A;  3O9P A;  2HZK A;  4GQO A;  3HO7 A;  1B7U A;  5J1D A;  4POX A;  4IB2 A;  2XXQ A;  3TCG A;  3TQL A;  2O1L A;  5CBS A;  3V8X B;  2QMW A;  4GFR A;  4LUB A;  2R9J A;  4RPN A;  1PBP A;  1Y9U A;  3TTN A;  1IXG A;  1HSJ A;  2AL4 A;  4FEB A;  3I6V A;  3K2D A;  1SVX B;  4TOZ A;  4JWY A;  3Q26 A;  4HCY A;  3H3G A;  1XC1 A;  4YU0 A;  1NNT A;  4AB6 A;  4NF4 A;  5I59 A;  2F6P A;  4R72 A;  4HCW A;  1MDP 1;  2ONR A;  2DWA A;  3OO9 A;  3RYB A;  3O29 A;  5ICQ A;  4NF8 B;  3I3V A;  1MXW A;  4QFO A;  2H99 A;  3VDF A;  2QJE A;  2Q9T A;  1ZJL A;  1TFA A;  1SYH A;  4KPT A;  3LSL A;  3QXM A;  3SEY A;  1J1N A;  5B70 A;  3MP8 A;  5DEX A;  3FVO A;  3T22 A;  3T93 B;  2RC7 A;  3O6I A;  1BLF A;  4DE8 A;  1PB8 A;  4BDL A;  1B52 A;  1GGG A;  5CI5 A;  3KBR A;  4X1B A;  3K6U A;  2O68 A;  5CRY A;  2Z23 A;  2DQV A;  1Y4T A;  2O51 A;  2ABH A;  2P0S A;  5CBR A;  1QJM A;  1MXU A;  4KYD A;  3BBR A;  1I69 A;  1LLS A;  1JW4 A;  2ZNS A;  1LFH A;  3TAJ A;  1URG A;  3TZA A;  3RT8 A;  2V3Q A;  3VXB A;  5K2Y A;  4O3C A;  1CB6 A;  3SEV A;  3BKI B;  1SW5 A;  2FA7 A;  1MY3 A;  4KYS A;  4F1U A;  2V93 A;  3USD A;  4FED A;  3ZKK A;  3M3K A;  3U72 A;  3CFX A;  1SBP A;  1R9Q A;  3CG3 A;  1ZTY A;  1O64 A;  1UQW A;  1PBQ A;  3EQ1 A;  1IQ7 A;  1QKB A;  1EZO A;  1FTO A;  5DT6 A;  3TMG A;  2B3B A;  4O3B A;  1YAE A;  4E0W A;  5CMK A;  3KN7 A;  3EHU A;  1ZMG A;  5DVF A;  4MF3 A;  2ZYK A;  2DE2 A;  4OEV A;  2Y7W A;  3UOR A;  3H6T A;  2HCA A;  3K1P A;  1AOV A;  1Z7N E;  4KYE A;  4GVO A;  3S9M C;  1XVX A;  4Q30 B;  1GR2 A;  2DVZ A;  2DVC A;  3Q28 A;  2VHA A;  4RA1 A;  1NMU A;  2QS4 A;  2PMS A;  3PV0 E;  5AA1 A;  2XXH A;  4EQ9 A;  1R6Z A;  2XXV A;  3G3F A;  4O3A A;  2R71 A;  2OK2 A;  2P2A A;  1NFT A;  1F9B A;  2XXT A;  4EQ7 A;  1JVY A;  3C35 A;  2G93 A;  1O7T A;  3FJ7 A;  1VFE A;  3LSX A;  4OYV A;  1KWH A;  1B9J A;  2RF1 A;  4JSO A;  2Y7R A;  2Z8D A;  3MP1 A;  3RPW A;  5I2K A;  2QS2 A;  4ZEK A;  2XXU A;  1MY1 A;  2CMO A;  3LUY A;  4Q0C A;  3FVN A;  4FAJ A;  1CE2 A; 
#chains in the Genus database with same CATH topology
 3U8Q A;  1LAH E;  3T1B A;  5DTB A;  4G2Z A;  1MQG A;  4QSD A;  4KFQ A;  2XD3 A;  1G0I A;  3PUY E;  4NWD A;  1US5 A;  1FTJ A;  4F19 A;  2ZZW A;  4X48 A;  4F3B A;  3MVY A;  2D21 A;  3C9H A;  3MPK A;  4LZ8 A;  1O63 A;  3K1M A;  4TLL B;  1FCK A;  2Q8M A;  4O94 A;  2XXR A;  3DEL B;  2XWV A;  4F22 A;  2RIN A;  1FQB A;  1POY 1;  1JVX A;  3KSJ A;  4DI4 B;  1NV3 A;  4Z0I A;  2CZH A;  1OVT A;  1L5T A;  1BP5 A;  3M3F A;  3UK4 A;  4H5G A;  4NF5 B;  4LZ7 A;  3T9V A;  1XT8 A;  5FHN A;  1B32 A;  2GRV A;  1LAX A;  4ISU A;  2I0C A;  4PFW A;  1SI1 A;  4PTK A;  3GLB A;  4P0G A;  3SET A;  3MVX A;  5IZZ A;  1FQF A;  4YZZ A;  4EDP A;  3G3G A;  1LFI A;  1NNP A;  3BIH A;  2AL5 A;  4JWO A;  5L9M A;  5K2X A;  1IMF A;  2DWI A;  3FTO A;  4OES A;  5L8D A;  1P99 A;  1JET A;  1FJ6 A;  4YB6 A;  2H25 A;  2RCA A;  4ELR A;  3FXR A;  1Q9D A;  3RUM A;  1M5F A;  5AA2 A;  3L6G A;  4RJZ A;  1P1Q A;  1GVC A;  1IIW A;  2PBW A;  4Q5T A;  2ZNU A;  4ZEI A;  1FBH A;  5I58 B;  1DPP A;  3RNN A;  1MY4 A;  3PMV A;  1N76 A;  3FD3 A;  3ECR A;  4PGP A;  3GXA A;  1TFD A;  2O1M A;  2FBP A;  3K00 A;  4U22 A;  3PUX E;  4OQO A;  1QUJ A;  3TDJ A;  4LON B;  1OLC A;  1M5B A;  1B58 A;  3WAF A;  4F1V A;  3C33 A;  2OWZ A;  1B7H A;  1EYK A;  2O7I A;  4N8G A;  1FJ9 A;  4R6K A;  2O84 X;  4RPO A;  4G68 B;  1JQF A;  3G3I A;  4I1D A;  1DMB A;  3TYH A;  5IZ1 A;  3LBS A;  4I62 A;  1D4N A;  3T96 B;  4OFO A;  4OXV A;  2FYI A;  5F7V A;  3M3L A;  4MIJ A;  2UYF A;  1PB7 A;  4MBP A;  3MZB A;  1I6B A;  4P11 A;  2LAO A;  3ILU B;  3LSF B;  3R6U A;  1RKM A;  4G8H A;  3B6Q A;  4MHF A;  3D4G A;  4N4U A;  2VOZ A;  4R6H A;  2F3D A;  3W9V A;  1IME A;  3A09 A;  3OMB A;  3MAM A;  4BDN A;  1DK4 A;  5HBC A;  4U1Z A;  3S9L C;  4BDM A;  3IOW A;  2ZZV A;  2XX7 A;  1URS A;  4F3G A;  1MXZ A;  4U21 A;  4PDH A;  1FSA A;  2FVZ A;  4I8C A;  2DSF A;  1P1O A;  4DCX A;  2ZYN A;  3ISP A;  5I57 B;  3A3U A;  4XKR A;  3O6G A;  4YKJ A;  4ZZE A;  3F11 A;  3T9X B;  2REJ A;  2Y7K A;  2MKZ A;  1UTB B;  4HE0 A;  3I5O A;  5CM6 A;  4OVT A;  4H46 A;  1MPD A;  3SER A;  3OSR A;  1FQD A;  4OER A;  5I2N A;  4IGT A;  5H8N A;  3KJT A;  4EXL A;  4ZDM A;  2F8D A;  1OIB A;  5KDT B;  4MLQ A;  4NGU A;  4DXU A;  3KSX A;  1Y3P A;  1LEV A;  3K4U A;  5B7D A;  4PBQ A;  1B51 A;  2H9B A;  4N15 A;  3FVG A;  4P47 A;  3FZV A;  1RDZ A;  5H8S A;  1VSO A;  1H3D A;  3HST A;  1SI0 A;  4C0R A;  1B0H A;  1Z7M E;  5LDZ A;  1B40 A;  3FXB A;  4DXC A;  1IXC A;  4Z7E A;  4YMA A;  3HCQ A;  2PYY A;  2NVU B;  2Z8F A;  3G7W A;  3K6W A;  3THI A;  2Q88 A;  3U1O A;  4ZED A;  3C31 A;  3TCF A;  3B6T A;  2X7P A;  4H1X A;  2Z8E A;  2PT1 A;  3IAZ A;  3ZS6 A;  1AMF A;  5IM2 A;  5AA2 D;  2ZYM A;  1R9L A;  3FAS A;  1FBD A;  1YTV A;  1B3G A;  1DTG A;  5ICT A;  2DWJ A;  4F29 A;  4G77 A;  3DRJ A;  3PD8 A;  3IK6 B;  3K0V A;  4YKP A;  5I5P A;  1LBZ A;  4MEV A;  1A7L A;  1TXF A;  3D4C A;  3HHG A;  1FQC A;  4GBV A;  4X9T A;  2XA5 A;  1I6Q A;  4OVJ A;  3PAM A;  3KG2 A;  2UVH A;  5IKB A;  1B3H A;  5JTY A;  4R73 A;  3VLV A;  4WEP A;  4JB7 A;  3KOS A;  5EYH A;  3M8U A;  3LV0 A;  4YKI A;  3CFL A;  3E4R A;  4FAT A;  3SEX A;  2XXK A;  3R26 A;  3RYD A;  2HAU A;  3B6W A;  5ET7 A;  5BUU A;  5EQA A;  3OEM A;  3QIM A;  1MM7 A;  3FXU A;  3OXN A;  5L9S A;  1FTL A;  1A8E A;  2QVU A;  3IOU A;  4EF2 A;  1FQE A;  3FJM A;  2F6G A;  2VD3 A;  4PF6 A;  5FTH A;  3HFU A;  1FTM A;  3MZ9 A;  3HHF A;  2UYE A;  4DDD A;  3PGF A;  4LAT A;  4KD5 A;  4I3Y A;  2DS9 A;  2OZZ A;  4GBW A;  1M5D A;  4ZS9 A;  1AH5 A;  3MYU A;  1POT A;  4NF4 B;  4ELQ A;  1LBB A;  1MQD A;  5EQ8 A;  5I59 B;  4YB7 A;  4GWW A;  1MQJ A;  4N81 A;  3DP6 A;  1A8F A;  3VLU A;  5I3S A;  1FBC A;  4BDQ A;  1DOT A;  1LBW A;  3KC0 A;  1RYX A;  3EPE A;  3QUF A;  3JYR A;  1H44 A;  3BFT A;  3K6X A;  2DXY A;  4F18 A;  5DEX B;  1VDW A;  2CZL A;  3VVE A;  4H8I A;  1BKA A;  2F7C A;  3K6V A;  4LQ5 A;  1NUY A;  3A29 A;  2UVJ A;  4N07 A;  1UTH A;  1Y1Z A;  2WEF A;  2I58 A;  2REG A;  4IO6 A;  4F3P A;  4ZZA A;  1P1W A;  1ZKB A;  3ILT B;  4PFR A;  1MXV A;  3GYY A;  3MP6 A;  4ESX A;  3FV2 A;  1RDX A;  4F39 A;  3V5A A;  1D9Y A;  4QSE A;  1A40 A;  4OFJ A;  1GV8 A;  4PP0 A;  1H43 A;  2B65 A;  1A99 A;  5AA4 A;  4OFL A;  4DCY A;  2H4I A;  1NV1 A;  3OSQ A;  1Y3N A;  3KC1 A;  1OLA A;  4GWZ A;  5IZ3 B;  1GTK A;  1KZ8 A;  4H67 A;  5H8H A;  4KXP A;  1MXY A;  4UAC A;  4C1U A;  3G3H A;  4NQ8 A;  2VPO A;  2OBG A;  3H6W A;  2ESN A;  2F34 A;  4QRZ A;  3G3K A;  4XIG Q;  1B7Z A;  3IX1 A;  1N04 A;  1SQY A;  3QMF A;  2QPQ A;  3S4U A;  4PQJ A;  1LCF A;  1TWY A;  1B3E A;  3WAE A;  2HPG A;  4TLM B;  2F7B A;  2QRY A;  3G3J A;  2D5W A;  3LC8 A;  3OO8 A;  1FPK A;  5LOM A;  4NAP A;  5DYH A;  3OO7 A;  4OVQ A;  2GFE A;  5I56 A;  4JDF A;  1IMC A;  1LBY A;  2PX1 A;  4QSC A;  5F24 A;  1OQG A;  5TPA A;  1EZ9 A;  3FXQ A;  2I3W A;  2DOJ A;  1UIV A;  1IIT A;  4GD5 A;  2PFY A;  4PAF A;  4MX6 A;  1M5E A;  2XHD A;  3MVW A;  2YPN A;  3FBP A;  1S50 A;  2WX9 A;  1P1N A;  4OWD A;  1DCU A;  3PMX A;  3O28 A;  5JK4 A;  3NOH A;  3DRK A;  4R6Y A;  2QVR A;  4R9G A;  1NL5 A;  4IGR A;  1MXX A;  1MDQ A;  1Y20 A;  3PPO A;  2PT2 A;  1B3F A;  3KJ7 A;  5LTC A;  3VLW A;  2B4M A;  2THI A;  4PC9 A;  5H8Q A;  5KCJ A;  3PPR A;  4QHQ A;  3N94 A;  2QSX A;  3CSB A;  2E0S A;  3ONM A;  1LAF E;  4H65 A;  4F2O A;  5A5X A;  2Y5K A;  3JZJ A;  5I2K B;  5L9O A;  1H45 A;  4IO4 A;  4FEC A;  1WDN A;  3V89 B;  4IY6 A;  2XXP A;  2NOO A;  3SEW A;  5ITO A;  5TP9 A;  1D9Q A;  2HXW A;  5I7I A;  5TU0 A;  4DXB A;  3CI8 A;  4GXA A;  4PE5 B;  1QUK A;  1NV4 A;  1MRP A;  5M2V A;  3U65 A;  3UN6 A;  3FUZ A;  4QXD A;  4GWX A;  5AE4 A;  1RYO A;  3MBP A;  4OZ9 A;  5JEI A;  4DLD A;  3MUQ A;  2DE3 A;  2RCB A;  2HQ0 A;  3DLN A;  3RGY A;  3OEK A;  3TQW A;  3PPN A;  2G29 A;  3RT6 B;  3UIF A;  3RPL A;  4HE2 A;  3O2A A;  1QGX A;  4IR8 A;  3VVD A;  4U4S A;  4IO5 A;  1NH8 A;  1S9T A;  1B1H A;  3LSW A;  3L6H A;  3SEU A;  2F5X A;  2Y7I A;  2WOP A;  4EQB A;  4K3F A;  1LCT A;  3QAX A;  1B6H A;  2XX8 A;  2A5T A;  4GOT A;  3TTL A;  5A5X B;  4NTL A;  4ONY A;  3PD9 A;  1Y3Q A;  4AQ4 A;  2BJJ X;  3GBA A;  5A5L A;  4JWX A;  4WED A;  2FIX A;  3MST A;  2GQ1 A;  4P56 A;  1LB9 A;  3IJX B;  4OEU A;  4BDR A;  2VP1 A;  4FJP A;  5DVJ A;  4AS4 A;  1B0L A;  3V83 A;  3TPA A;  3OO6 A;  3SES A;  3D1R A;  3U94 A;  4GLI A;  1EYI A;  4BDO A;  3E3K A;  3IO4 A;  4O8M A;  4NF0 A;  3A3C A;  4MNI A;  4ZEF A;  1N7X A;  4FOR A;  1FPB A;  1USY E;  3KEI A;  4GL0 A;  5AA2 B;  4ND9 A;  4POW A;  4GWU A;  1A55 A;  4QBA A;  3T9H B;  1FTA A;  3IB0 A;  1PDA A;  1DPE A;  1Q1K A;  1NV2 A;  3LVU A;  2UVG A;  3BFU A;  2DYX A;  1FBG A;  4F3S A;  4N6P A;  4ZEC A;  4PAI A;  4ELP A;  4IO2 A;  4IY5 A;  4RY1 A;  3GBB A;  2ZXT A;  3QUJ A;  2NUV A;  4PDD A;  1FBE A;  4QFP A;  2HFB A;  4OVR A;  4PAK A;  2E1S A;  1QW0 A;  2I4B A;  1XOC A;  3C4M A;  2R8T A;  1MM6 A;  1SW1 A;  3KZG A;  4HTG A;  4M4G A;  4P0I A;  4P9K A;  3TFL A;  5H8F A;  4NWC A;  2GHA A;  4IO7 A;  4AS5 A;  2VT5 A;  4N8Y A;  5ET5 A;  3CSG A;  3PU5 A;  2VD2 A;  4QFN A;  4NF6 A;  5EYF A;  3KN8 A;  4ELO A;  4RYA A;  3PPP A;  1N0T A;  3PUW E;  1NNF A;  1SD3 A;  3K01 A;  1RDY A;  3S9E A;  1URD A;  3B50 A;  4WKM A;  4G61 A;  5I84 A;  4I3E A;  2RC9 A;  1MH3 A;  1IEJ A;  2I49 A;  4R9F A;  4YMB A;  5IGA A;  2ONS A;  5ET6 A;  4NHB A;  3MC2 A;  4XFE A;  4F1Y A;  4MMP A;  1BIY A;  3IJO B;  3RQT A;  3R7X A;  2NXO A;  3ZKL A;  4DZ1 A;  4JVD A;  5FBP A;  1NV0 A;  2YJP A;  5F1Q A;  4NF8 A;  4NMY A;  2QMX A;  4ZEB A;  2QS3 A;  5IAI A;  2HXR A;  4KCC A;  4NF6 B;  4Q8R A;  4KCD A;  2WBD A;  2WYP A;  3TKD A;  4U2R A;  1I6A A;  1USY H;  5I2N B;  5H8N B;  2Y84 A;  2FNC A;  3RLF E;  4N6K A;  1PC3 A;  4OVP A;  3T66 A;  2NWJ A;  3C34 A;  2I6E A;  4JVC A;  2RKM A;  1FPI A;  1XHY A;  4XKQ A;  4N13 A;  5T3J A;  3KBZ A;  4GRK A;  5AA3 A;  1B05 A;  1B3L A;  4NE4 A;  1SW2 A;  3SKP A;  1UIU A;  4MAG A;  4GXS B;  2I0B A;  2O69 A;  1NUW A;  4OMB A;  2H98 A;  1MQH A;  3QSL A;  2I3V A;  2DWH A;  3EHT A;  1B4Z A;  3CVG A;  4GIZ A;  2KLF A;  1Q35 A;  1PB9 A;  1MH4 A;  4R74 A;  4AB5 A;  2OX3 A;  3PUV E;  2V3U A;  4KQP A;  4RNS A;  1ZLQ A;  1CNQ A;  4XTC Q;  1B1X A;  3UP9 A;  2XXW A;  2IA4 A;  1JNF A;  3QK6 A;  1SYI A;  3IFC A;  3PUZ E;  2ALU A;  3FJG A;  1AL3 A;  4EXK A;  4LA9 A;  3ODB A;  1ELJ A;  3T9U A;  2Y5L A;  1FW0 A;  3W9W A;  5JTY B;  5HPQ A;  3OEN A;  2HAV A;  4H0W A;  2V25 A;  2R6G E;  3FIR A;  1FTK A;  4YAH X;  4F31 B;  2A5S A;  1WVJ A;  3H03 A;  1ZU0 A;  3QYT A;  3TTM A;  4G8N A;  1HSE A;  4OHN A;  3N5L A;  2L5V A;  3TOD A;  3S9N C;  1VR5 A;  2ZYO A;  1R1N A;  3K1N A;  4MNP A;  4R75 A;  3IOR A;  2X7Q A;  1ZBM A;  2RC8 A;  3Q27 A;  1A54 A;  2WYK A;  4MH5 A;  3DP8 A;  3KN3 A;  4JBZ A;  4IO3 A;  4YB5 A;  2GHB A;  3RN8 A;  1LGB C;  3VVF A;  3PPQ A;  1FBF A;  4KI0 E;  3KFM A;  2B3F A;  5EHS A;  4H45 A;  3LR1 A;  4TQU Q;  4DI3 D;  4QFK A;  3RY3 A;  2XD2 A;  4OET A;  3KOT A;  2F97 A;  3SDF A;  3W15 C;  1JP4 A;  1ZIU A;  1NNK A;  3H06 B;  2DDK A;  3U93 A;  1PEB A;  3DRI A;  4LN5 A;  2XWK A;  4GL8 A;  3MZ1 A;  1M5C A;  2OWT A;  3E9X A;  3TEP A;  3MJN A;  1QUL A;  5HM4 B;  1K9Y A;  1EZP A;  3EN3 A;  4MLV A;  3O66 A;  4RK2 A;  2GH9 A;  5ELV A;  1EH3 A;  1EYJ A;  3BIG A;  2O7U A;  3GZG A;  1P1U A;  3IL1 B;  1WOD A;  4NN3 A;  3CIJ A;  4U4X A;  1EU8 A;  4N6D A;  1UTH B;  2UXA A;  4XKN A;  3C36 A;  4GWY A;  3OEL A;  3N26 A;  5FHM A;  2Z22 A;  2JJK A;  2IEE A;  3PMW A;  4MCO A;  2QL3 A;  3EF7 A;  4NF5 A;  1BK4 A;  3FGS A;  2Q8J A;  1Y1M A;  3H6U A;  2CZK A;  1QUI A;  4X04 A;  1YYZ A;  5EYG A;  5AA4 B;  5DW8 A;  1MY0 A;  4QF9 A;  3O97 A;  3E78 A;  5CMC A;  1IXH A;  2XXX A;  3H4Z A;  1JEV A;  3CHG A;  3SZP A;  1MY2 A;  2F36 A;  1FPG A;  4ZE8 A;  2M8C A;  3Q29 A;  2XWI A;  4NED A;  1LBV A;  3FVK A;  1B5J A;  2OJT A;  1JEU A;  2O6A A;  4PFY A;  5H8H B;  3IB1 A;  1HSL A;  2DXR A;  2BJI A;  4OEN A;  3U92 A;  4HXV A;  2ZZX A;  4LZ5 A;  4PGN A;  2ZMB A;  2P1S A;  2AYS A;  3CFZ A;  2I4C A;  4GF8 A;  3HN0 A;  4PET A;  2XXI A;  4LP2 B;  3ROJ A;  1SPI A;  2X26 A;  5EQ7 A;  4ECF A;  4R2B A;  4WXJ A;  1MPC A;  1LAG E;  3RYA A;  5FTI A;  5I56 B;  2P3V A;  4PCD A;  5TPA B;  5BWJ A;  5I58 A;  4XF5 A;  4UA8 A;  4U23 A;  2D3I A;  4DIG A;  4KHZ E;  3KGC A;  1IZ1 A;  4E0X A;  1B46 A;  3ZSF A;  1MQI A;  1IXI A;  1OMP A;  1OQH A;  1YCJ A;  1LB8 A;  3IO6 A;  1T0K A;  2F78 A;  3TCH A;  3RTF B;  1II5 A;  4LVQ A;  4N17 A;  3IOV A;  3CG1 A;  1B4H A;  2WOL A;  2V3T A;  1MG1 A;  2CEY A;  2VGQ A;  1FPD A;  1LBC A;  4G68 A;  5H8Q B;  5KCJ B;  4M1V A;  2QS1 A;  4H6D A;  1QKA A;  3MW0 A;  1DTZ A;  4YKK A;  4JVI A;  1N3W A;  2I48 A;  2KR0 A;  1AIV A;  1JW5 A;  3MQ9 A;  3CRB A;  2WOK A;  4G4P A;  3B7D A;  1LBX A;  2QFL A;  1XVY A;  2PCR A;  5ITP A;  5TP9 B;  5ISU A;  4I40 A;  3TTK A;  1FPE A;  4YIC A;  3MPL A;  2WKY A;  4PFT A;  3B8B A;  1D3K A;  4MNC A;  1SDX A;  4LQ2 A;  4X8R A;  1XS5 A;  4I9D A;  1NI9 A;  3H7M A;  2H5Y A;  3O6P A;  1AWB A;  1FQA A;  2YLN A;  2Y7P A;  1Y4C A;  4G8M A;  1NKX A;  2Q89 A;  1YPN A;  2KQZ A;  2XX9 A;  5KZT A;  1B5H A;  2OLB A;  4G68 C;  4RXL A;  4PFU A;  3RPL B;  3N6T A;  2OWS A;  1MS7 A;  3MVZ A;  3E79 A;  3P7I A;  4GWO A;  1LST A;  1OVB A;  4QFL A;  1LFG A;  4C1T A;  2ONK E;  4OVS A;  4HS7 A;  2A5T B;  1MPB A;  2V84 A;  4XXU A;  5I57 A;  5ET8 A;  1N7W A;  4N91 A;  3N6U A;  4U1O A;  1QVS A;  3MWB A;  5CMB A;  2F7A A;  2HEU A;  3TUS A;  1DSN A;  4THI A;  1UTB A;  4ZE9 A;  1S7Y A;  3TTR A;  2OCU A;  1NV5 A;  3K02 A;  2ZNT A;  1BTJ A;  1G0H A;  5KDT A;  5DVI A;  4JXI A;  4F2Q A;  3EHS A;  4RK9 A;  3FAT A;  4OTE A;  3RTW B;  1B5I A;  1US4 A;  3PTY A;  1TT1 A;  4XEQ A;  3VFJ A;  3IOT A;  3DRH A;  1IUD A;  2AIX A;  5EHM A;  3TEL A;  1ANF A;  2FHY A;  4EF1 A;  1H76 A;  4L17 A;  2ANJ A;  2HZL A;  2P3N A;  3VXC A;  1JW1 A;  3IB2 A;  3VE1 B;  2W7Y A;  4R2F A;  2DE4 A;  1VE4 A;  3VV5 A;  3OD7 A;  3S2V A;  3O6H A;  3E13 X;  4FE8 A;  4EUO A;  2PVU A;  3HV1 A;  3H6V A;  4O7I A;  4P1E A;  2Q2C A;  5EQ9 A;  2UVI A;  3JV9 A;  2CEX A;  4FIM A;  2B4L A;  1ATG A;  2WBB A;  5CMM A;  1SW4 A;  3DM0 A;  3HPI A;  2HHM A;  5FHO A;  2F35 A;  3DP4 A;  1N3X A;  4H8J A;  1N84 A;  1VFD A;  4BLA A;  3DRF A;  2Q2A A;  3Q25 A;  2F3B A;  3UA8 A;  2XXY A;  1B2H A;  4P3L A;  4KR5 A;  4JSD A;  3AXF A;  3DRG A;  3IR1 A;  4H5F A;  1D9V A;  3OOA A;  3FV1 A;  4X1D A;  5CC2 A;  4HW8 A;  3C32 A;  5ESY A;  3UGW A;  2PFZ A;  4FBP A;  3T0J A;  2DP8 A;  4ESW A;  4XKP A;  3CR9 A;  4PF8 A;  5H8F B;  4MFI A;  1NH7 A;  3O9P A;  2HZK A;  4UAB A;  4GQO A;  3HO7 A;  1B7U A;  5J1D A;  4POX A;  4IB2 A;  2XXQ A;  3TCG A;  3TQL A;  4PBH A;  2O1L A;  5CBS A;  3V8X B;  2QMW A;  4GFR A;  4LUB A;  2R9J A;  4RPN A;  4NG7 A;  4O7M A;  1PBP A;  1YXI A;  1Y9U A;  3TTN A;  1IXG A;  1HSJ A;  2AL4 A;  4FEB A;  3I6V A;  3K2D A;  1SVX B;  4TOZ A;  4JWY A;  2Q74 A;  3Q26 A;  4HCY A;  1K9Z A;  3H3G A;  1XC1 A;  4YU0 A;  4P1L A;  2XWO A;  1NNT A;  4AB6 A;  4NF4 A;  5I59 A;  2F6P A;  4R72 A;  3EKI A;  1NV7 A;  4HCW A;  1IMD A;  2FIE A;  1MDP 1;  2ONR A;  2DWA A;  3OO9 A;  3RYB A;  3O29 A;  5ICQ A;  4NF8 B;  3I3V A;  1MXW A;  4QFO A;  2H99 A;  3VDF A;  2QJE A;  2Q9T A;  1ZJL A;  1TFA A;  1SYH A;  4PE3 A;  4KPT A;  3LSL A;  1IMA A;  3QXM A;  3SEY A;  1J1N A;  5B70 A;  3MP8 A;  5DEX A;  2CZI A;  3FVO A;  3T22 A;  3T93 B;  4GWS A;  1INP A;  2RC7 A;  3O6I A;  1BLF A;  4DE8 A;  4P8B A;  4GX3 A;  1PB8 A;  4BDL A;  1B52 A;  1GGG A;  5CI5 A;  3KBR A;  4X1B A;  3K6U A;  2O68 A;  5CRY A;  2Z23 A;  2DQV A;  4PFI A;  1Y4T A;  2O51 A;  2ABH A;  2P0S A;  5CBR A;  4OAN A;  1QJM A;  1DBZ A;  1MXU A;  4KYD A;  3BBR A;  1I69 A;  1LLS A;  1XI6 A;  1JW4 A;  2ZNS A;  1LFH A;  3TAJ A;  1URG A;  3TZA A;  3RT8 A;  2V3Q A;  3VXB A;  5K2Y A;  4MJO A;  4O3C A;  1CB6 A;  3SEV A;  3BKI B;  1KA0 A;  1SW5 A;  2QVV A;  2FA7 A;  5IZ3 A;  3IFA A;  1YZ0 A;  1MY3 A;  4KYS A;  4F1U A;  2V93 A;  4PFB A;  2VPN A;  3USD A;  4FED A;  3ZKK A;  3M3K A;  1NUX A;  3U72 A;  3CFX A;  1SBP A;  1R9Q A;  3CG3 A;  1ZTY A;  1O64 A;  1UQW A;  4GX4 A;  1PBQ A;  3EQ1 A;  1IQ7 A;  1QKB A;  1FPJ A;  4OA4 A;  1EZO A;  1FTO A;  5DT6 A;  3TMG A;  2B3B A;  4O3B A;  1YAE A;  1IMB A;  4E0W A;  5CMK A;  3KN7 A;  3EHU A;  1ZMG A;  5DVF A;  4MF3 A;  2ZYK A;  2DE2 A;  4OEV A;  2Y7W A;  3UOR A;  3H6T A;  2HCA A;  3K1P A;  1AOV A;  1Z7N E;  4KYE A;  4GVO A;  3S9M C;  1XVX A;  4Q30 B;  1GR2 A;  2DVZ A;  2DVC A;  1FBP A;  3Q28 A;  2VHA A;  4RA1 A;  1NMU A;  2QS4 A;  2PMS A;  3PV0 E;  5AA1 A;  2XXH A;  4HE1 A;  4EQ9 A;  1R6Z A;  2XXV A;  3G3F A;  4O3A A;  2R71 A;  4NX1 A;  2OK2 A;  2P2A A;  2V4C A;  1NFT A;  5J16 A;  3LUZ A;  1FRP A;  1F9B A;  2XXT A;  4EQ7 A;  1JVY A;  3C35 A;  2G93 A;  1O7T A;  3FJ7 A;  1VFE A;  3LSX A;  4OYV A;  1KA1 A;  1KWH A;  1B9J A;  2RF1 A;  1NV6 A;  4JSO A;  1NUZ A;  2Y7R A;  2Z8D A;  3MP1 A;  3RPW A;  5I2K A;  2QS2 A;  4ZEK A;  1FPF A;  2XXU A;  1MY1 A;  2CMO A;  3LUY A;  4Q0C A;  1FPL A;  3FVN A;  4FAJ A;  4GX6 A;  1CE2 A; 
#chains in the Genus database with same CATH homology
 3U8Q A;  1LAH E;  5DTB A;  4G2Z A;  1MQG A;  4QSD A;  4KFQ A;  2XD3 A;  3PUY E;  4NWD A;  1US5 A;  1FTJ A;  4F19 A;  4X48 A;  4F3B A;  3MVY A;  2D21 A;  3C9H A;  3MPK A;  4LZ8 A;  1O63 A;  3K1M A;  4TLL B;  1FCK A;  2XXR A;  3DEL B;  4F22 A;  2RIN A;  1FQB A;  1POY 1;  1JVX A;  3KSJ A;  4Z0I A;  1OVT A;  1L5T A;  1BP5 A;  3M3F A;  3UK4 A;  4H5G A;  4NF5 B;  4LZ7 A;  3T9V A;  1XT8 A;  5FHN A;  1B32 A;  2GRV A;  1LAX A;  4ISU A;  2I0C A;  4PFW A;  1SI1 A;  3GLB A;  4P0G A;  3SET A;  3MVX A;  1FQF A;  4YZZ A;  4EDP A;  3G3G A;  1LFI A;  1NNP A;  2AL5 A;  4JWO A;  5L9M A;  5K2X A;  2DWI A;  3FTO A;  4OES A;  5L8D A;  1P99 A;  1JET A;  4YB6 A;  2H25 A;  2RCA A;  4ELR A;  3FXR A;  3RUM A;  1M5F A;  5AA2 A;  3L6G A;  4RJZ A;  1P1Q A;  1GVC A;  1IIW A;  2PBW A;  4Q5T A;  2ZNU A;  4ZEI A;  5I58 B;  1DPP A;  3RNN A;  1MY4 A;  3PMV A;  1N76 A;  3FD3 A;  3ECR A;  3GXA A;  1TFD A;  2O1M A;  3K00 A;  4U22 A;  3PUX E;  4OQO A;  1QUJ A;  3TDJ A;  4LON B;  1OLC A;  1M5B A;  1B58 A;  3WAF A;  4F1V A;  3C33 A;  1B7H A;  2O7I A;  4R6K A;  2O84 X;  4RPO A;  4G68 B;  1JQF A;  3G3I A;  4I1D A;  1DMB A;  3TYH A;  3LBS A;  4I62 A;  1D4N A;  3T96 B;  4OFO A;  4OXV A;  2FYI A;  5F7V A;  3M3L A;  2UYF A;  1PB7 A;  4MBP A;  3MZB A;  1I6B A;  4P11 A;  2LAO A;  3ILU B;  3LSF B;  3R6U A;  1RKM A;  4G8H A;  3B6Q A;  3D4G A;  2VOZ A;  4R6H A;  3W9V A;  3A09 A;  3OMB A;  3MAM A;  4BDN A;  5HBC A;  4U1Z A;  3S9L C;  4BDM A;  3IOW A;  2XX7 A;  1URS A;  4F3G A;  1MXZ A;  4U21 A;  4I8C A;  2DSF A;  1P1O A;  4DCX A;  2ZYN A;  5I57 B;  3A3U A;  4XKR A;  3O6G A;  4YKJ A;  4ZZE A;  3F11 A;  3T9X B;  2REJ A;  2Y7K A;  1UTB B;  3I5O A;  5CM6 A;  1MPD A;  3SER A;  3OSR A;  1FQD A;  4OER A;  5I2N A;  4IGT A;  5H8N A;  3KJT A;  4EXL A;  4ZDM A;  2F8D A;  1OIB A;  5KDT B;  4MLQ A;  4DXU A;  3KSX A;  1Y3P A;  3K4U A;  5B7D A;  1B51 A;  2H9B A;  3FVG A;  3FZV A;  5H8S A;  1VSO A;  1H3D A;  3HST A;  1SI0 A;  4C0R A;  1B0H A;  1Z7M E;  1B40 A;  4DXC A;  4Z7E A;  1IXC A;  4YMA A;  3HCQ A;  2PYY A;  2NVU B;  2Z8F A;  3G7W A;  3K6W A;  3THI A;  2Q88 A;  3U1O A;  4ZED A;  3C31 A;  3TCF A;  3B6T A;  2X7P A;  4H1X A;  2Z8E A;  2PT1 A;  3IAZ A;  3ZS6 A;  1AMF A;  5AA2 D;  2ZYM A;  1R9L A;  3FAS A;  1YTV A;  1B3G A;  1DTG A;  5ICT A;  2DWJ A;  4F29 A;  4G77 A;  3DRJ A;  3PD8 A;  3IK6 B;  3K0V A;  4YKP A;  1A7L A;  1TXF A;  3D4C A;  3HHG A;  1FQC A;  4X9T A;  1I6Q A;  4OVJ A;  3PAM A;  3KG2 A;  2UVH A;  5IKB A;  1B3H A;  5JTY A;  4R73 A;  3VLV A;  4WEP A;  4JB7 A;  3KOS A;  3M8U A;  4YKI A;  3CFL A;  3E4R A;  4FAT A;  3SEX A;  3R26 A;  2HAU A;  3B6W A;  5BUU A;  3OEM A;  3QIM A;  1MM7 A;  3FXU A;  3OXN A;  5L9S A;  1FTL A;  1A8E A;  3IOU A;  4EF2 A;  1FQE A;  3FJM A;  2F6G A;  2VD3 A;  5FTH A;  1FTM A;  3MZ9 A;  3HHF A;  2UYE A;  4DDD A;  3PGF A;  4LAT A;  4KD5 A;  2DS9 A;  2OZZ A;  1M5D A;  4ZS9 A;  1AH5 A;  1POT A;  4NF4 B;  4ELQ A;  1LBB A;  1MQD A;  5I59 B;  4YB7 A;  1MQJ A;  3DP6 A;  1A8F A;  3VLU A;  4BDQ A;  1DOT A;  1RYX A;  3EPE A;  3QUF A;  3JYR A;  1H44 A;  3BFT A;  3K6X A;  2DXY A;  4F18 A;  5DEX B;  2CZL A;  3VVE A;  4H8I A;  1BKA A;  2F7C A;  3K6V A;  4LQ5 A;  2UVJ A;  4N07 A;  1UTH A;  1Y1Z A;  2I58 A;  2REG A;  4IO6 A;  4F3P A;  4ZZA A;  1P1W A;  1ZKB A;  3ILT B;  1MXV A;  3MP6 A;  4ESX A;  3FV2 A;  4F39 A;  3V5A A;  1D9Y A;  4QSE A;  1A40 A;  4OFJ A;  1GV8 A;  4PP0 A;  1H43 A;  2B65 A;  1A99 A;  5AA4 A;  4OFL A;  4DCY A;  2H4I A;  3OSQ A;  1Y3N A;  1OLA A;  1GTK A;  4H67 A;  5H8H A;  1MXY A;  4UAC A;  4C1U A;  3G3H A;  2OBG A;  3H6W A;  2ESN A;  2F34 A;  4QRZ A;  3G3K A;  4XIG Q;  1B7Z A;  3IX1 A;  1N04 A;  1SQY A;  3S4U A;  2QPQ A;  4PQJ A;  1LCF A;  1TWY A;  1B3E A;  3WAE A;  4TLM B;  2F7B A;  2QRY A;  3G3J A;  2D5W A;  3LC8 A;  3OO8 A;  5LOM A;  5DYH A;  3OO7 A;  2GFE A;  5I56 A;  4JDF A;  2PX1 A;  4QSC A;  5TPA A;  1OQG A;  1EZ9 A;  3FXQ A;  2I3W A;  2DOJ A;  1UIV A;  1IIT A;  4GD5 A;  1M5E A;  2XHD A;  3MVW A;  2YPN A;  1S50 A;  1P1N A;  4OWD A;  3PMX A;  3O28 A;  5JK4 A;  3DRK A;  4R6Y A;  4R9G A;  1NL5 A;  4IGR A;  1MXX A;  1MDQ A;  1Y20 A;  3PPO A;  2PT2 A;  1B3F A;  3KJ7 A;  3VLW A;  2B4M A;  2THI A;  5H8Q A;  5KCJ A;  3PPR A;  4QHQ A;  3N94 A;  2QSX A;  3CSB A;  2E0S A;  3ONM A;  1LAF E;  4H65 A;  4F2O A;  5A5X A;  3JZJ A;  5I2K B;  5L9O A;  1H45 A;  4IO4 A;  4FEC A;  1WDN A;  3V89 B;  4IY6 A;  2XXP A;  2NOO A;  3SEW A;  5ITO A;  5TP9 A;  2HXW A;  5TU0 A;  4DXB A;  3CI8 A;  4GXA A;  4PE5 B;  1QUK A;  1MRP A;  5M2V A;  3UN6 A;  3FUZ A;  5AE4 A;  1RYO A;  3MBP A;  4OZ9 A;  5JEI A;  4DLD A;  3MUQ A;  2DE3 A;  2RCB A;  2HQ0 A;  3DLN A;  3RGY A;  3OEK A;  3TQW A;  3PPN A;  2G29 A;  3RT6 B;  3UIF A;  3O2A A;  3VVD A;  4U4S A;  4IO5 A;  1NH8 A;  1S9T A;  1B1H A;  3LSW A;  3L6H A;  3SEU A;  2F5X A;  2Y7I A;  4EQB A;  2WOP A;  4K3F A;  1LCT A;  3QAX A;  1B6H A;  2XX8 A;  2A5T A;  4GOT A;  3TTL A;  5A5X B;  4NTL A;  4ONY A;  3PD9 A;  1Y3Q A;  4AQ4 A;  2BJJ X;  3GBA A;  4JWX A;  4WED A;  1LB9 A;  3IJX B;  4OEU A;  4BDR A;  2VP1 A;  4FJP A;  5DVJ A;  1B0L A;  3V83 A;  3TPA A;  3OO6 A;  3SES A;  3U94 A;  4GLI A;  4BDO A;  3E3K A;  3IO4 A;  3A3C A;  4ZEF A;  1N7X A;  4FOR A;  1USY E;  3KEI A;  4GL0 A;  5AA2 B;  4ND9 A;  4POW A;  1A55 A;  3T9H B;  3IB0 A;  1PDA A;  1DPE A;  1Q1K A;  2UVG A;  3LVU A;  3BFU A;  2DYX A;  4F3S A;  4N6P A;  4ZEC A;  4ELP A;  4IO2 A;  4IY5 A;  4RY1 A;  3GBB A;  2ZXT A;  3QUJ A;  2NUV A;  4QFP A;  2HFB A;  2E1S A;  1QW0 A;  2I4B A;  1XOC A;  3C4M A;  1MM6 A;  1SW1 A;  3KZG A;  4HTG A;  4M4G A;  4P0I A;  3TFL A;  5H8F A;  4NWC A;  2GHA A;  4IO7 A;  3CSG A;  3PU5 A;  2VD2 A;  4QFN A;  4NF6 A;  5EYF A;  4ELO A;  3KN8 A;  4RYA A;  3PPP A;  1N0T A;  3PUW E;  1NNF A;  1SD3 A;  3K01 A;  3S9E A;  1URD A;  4WKM A;  5I84 A;  2RC9 A;  1MH3 A;  1IEJ A;  2I49 A;  4R9F A;  4YMB A;  2ONS A;  3MC2 A;  4F1Y A;  1BIY A;  3IJO B;  3RQT A;  3R7X A;  2NXO A;  3ZKL A;  4DZ1 A;  2YJP A;  5F1Q A;  4NF8 A;  4NMY A;  2QMX A;  4ZEB A;  2QS3 A;  5IAI A;  4KCC A;  4NF6 B;  4Q8R A;  4KCD A;  3TKD A;  4U2R A;  1I6A A;  1USY H;  5I2N B;  5H8N B;  2Y84 A;  2FNC A;  3RLF E;  1PC3 A;  3T66 A;  2NWJ A;  3C34 A;  2I6E A;  2RKM A;  1XHY A;  4XKQ A;  4N13 A;  4GRK A;  5AA3 A;  1B05 A;  1B3L A;  4NE4 A;  1SW2 A;  3SKP A;  1UIU A;  4GXS B;  2I0B A;  2O69 A;  4OMB A;  2H98 A;  1MQH A;  3QSL A;  2I3V A;  2DWH A;  3EHT A;  1B4Z A;  3CVG A;  4GIZ A;  2KLF A;  1Q35 A;  1PB9 A;  1MH4 A;  4R74 A;  4AB5 A;  3PUV E;  2V3U A;  4KQP A;  4RNS A;  1ZLQ A;  4XTC Q;  1B1X A;  3UP9 A;  2XXW A;  2IA4 A;  1JNF A;  3QK6 A;  1SYI A;  3PUZ E;  2ALU A;  3FJG A;  1AL3 A;  4EXK A;  4LA9 A;  3ODB A;  1ELJ A;  3T9U A;  1FW0 A;  3W9W A;  5JTY B;  5HPQ A;  3OEN A;  2HAV A;  4H0W A;  2V25 A;  2R6G E;  3FIR A;  1FTK A;  4YAH X;  4F31 B;  2A5S A;  1WVJ A;  3H03 A;  1ZU0 A;  3QYT A;  3TTM A;  4G8N A;  1HSE A;  4OHN A;  3N5L A;  3TOD A;  3S9N C;  1VR5 A;  2ZYO A;  1R1N A;  3K1N A;  4R75 A;  3IOR A;  2X7Q A;  1ZBM A;  2RC8 A;  3Q27 A;  1A54 A;  4MH5 A;  3DP8 A;  3KN3 A;  4JBZ A;  4IO3 A;  4YB5 A;  2GHB A;  3RN8 A;  1LGB C;  3VVF A;  3PPQ A;  4KI0 E;  3KFM A;  2B3F A;  5EHS A;  3LR1 A;  4TQU Q;  4QFK A;  3RY3 A;  2XD2 A;  4OET A;  3KOT A;  2F97 A;  3SDF A;  3W15 C;  1ZIU A;  1NNK A;  3H06 B;  3U93 A;  1PEB A;  3DRI A;  4GL8 A;  3MZ1 A;  1M5C A;  2OWT A;  3E9X A;  3TEP A;  3MJN A;  1QUL A;  5HM4 B;  1EZP A;  3EN3 A;  4MLV A;  3O66 A;  4RK2 A;  2GH9 A;  5ELV A;  1EH3 A;  2O7U A;  3GZG A;  1P1U A;  3IL1 B;  1WOD A;  3CIJ A;  4U4X A;  1EU8 A;  1UTH B;  2UXA A;  4XKN A;  3C36 A;  3OEL A;  3N26 A;  5FHM A;  2Z22 A;  2IEE A;  3PMW A;  2QL3 A;  3EF7 A;  4NF5 A;  3FGS A;  2Q8J A;  1Y1M A;  3H6U A;  1QUI A;  5AA4 B;  1MY0 A;  4QF9 A;  3O97 A;  5CMC A;  1IXH A;  2XXX A;  3H4Z A;  1JEV A;  3CHG A;  1MY2 A;  2F36 A;  4ZE8 A;  2M8C A;  3Q29 A;  4NED A;  3FVK A;  1B5J A;  2OJT A;  1JEU A;  2O6A A;  4PFY A;  5H8H B;  3IB1 A;  1HSL A;  2DXR A;  4OEN A;  3U92 A;  4LZ5 A;  2ZMB A;  2P1S A;  2AYS A;  3CFZ A;  2I4C A;  4GF8 A;  3HN0 A;  4PET A;  2XXI A;  4LP2 B;  2X26 A;  4ECF A;  4R2B A;  4WXJ A;  1MPC A;  1LAG E;  3RYA A;  5FTI A;  5I56 B;  5TPA B;  5BWJ A;  5I58 A;  4UA8 A;  4U23 A;  2D3I A;  4DIG A;  4KHZ E;  3KGC A;  1IZ1 A;  4E0X A;  1B46 A;  3ZSF A;  1MQI A;  1IXI A;  1OMP A;  1OQH A;  1YCJ A;  1LB8 A;  3IO6 A;  1T0K A;  2F78 A;  3TCH A;  3RTF B;  1II5 A;  4LVQ A;  3IOV A;  3CG1 A;  1B4H A;  2WOL A;  2V3T A;  1MG1 A;  2VGQ A;  1LBC A;  4G68 A;  5H8Q B;  5KCJ B;  4M1V A;  2QS1 A;  4H6D A;  1QKA A;  3MW0 A;  1DTZ A;  4YKK A;  1N3W A;  2I48 A;  1AIV A;  1JW5 A;  3MQ9 A;  3CRB A;  2WOK A;  4G4P A;  3B7D A;  1XVY A;  5ITP A;  5TP9 B;  5ISU A;  3TTK A;  4YIC A;  3MPL A;  2WKY A;  4PFT A;  1D3K A;  1SDX A;  4LQ2 A;  1XS5 A;  4I9D A;  3H7M A;  2H5Y A;  3O6P A;  1FQA A;  2YLN A;  2Y7P A;  1Y4C A;  4G8M A;  1NKX A;  2Q89 A;  1YPN A;  2XX9 A;  5KZT A;  1B5H A;  2OLB A;  4G68 C;  4RXL A;  4PFU A;  3N6T A;  2OWS A;  1MS7 A;  3MVZ A;  3P7I A;  4GWO A;  1LST A;  1OVB A;  4QFL A;  1LFG A;  4C1T A;  2ONK E;  4HS7 A;  2A5T B;  1MPB A;  2V84 A;  4XXU A;  5I57 A;  1N7W A;  3N6U A;  4U1O A;  1QVS A;  3MWB A;  5CMB A;  2F7A A;  2HEU A;  3TUS A;  1DSN A;  4THI A;  1UTB A;  4ZE9 A;  1S7Y A;  3TTR A;  2OCU A;  3K02 A;  2ZNT A;  1BTJ A;  5KDT A;  5DVI A;  4JXI A;  4F2Q A;  3EHS A;  4RK9 A;  3FAT A;  4OTE A;  3RTW B;  1B5I A;  1US4 A;  1TT1 A;  3VFJ A;  3IOT A;  3DRH A;  1IUD A;  2AIX A;  5EHM A;  3TEL A;  1ANF A;  4EF1 A;  1H76 A;  4L17 A;  2ANJ A;  2HZL A;  3VXC A;  1JW1 A;  3IB2 A;  3VE1 B;  2W7Y A;  4R2F A;  2DE4 A;  1VE4 A;  3VV5 A;  3OD7 A;  3S2V A;  3O6H A;  3E13 X;  4FE8 A;  4EUO A;  2PVU A;  3HV1 A;  3H6V A;  2Q2C A;  2UVI A;  3JV9 A;  4FIM A;  2B4L A;  1ATG A;  5CMM A;  1SW4 A;  3DM0 A;  3HPI A;  5FHO A;  2F35 A;  3DP4 A;  1N3X A;  4H8J A;  1N84 A;  1VFD A;  4BLA A;  3DRF A;  2Q2A A;  3Q25 A;  3UA8 A;  2XXY A;  1B2H A;  4KR5 A;  4JSD A;  3AXF A;  3DRG A;  3IR1 A;  4H5F A;  1D9V A;  3OOA A;  3FV1 A;  4X1D A;  5CC2 A;  4HW8 A;  3C32 A;  3UGW A;  2DP8 A;  4ESW A;  4XKP A;  3CR9 A;  5H8F B;  4MFI A;  1NH7 A;  3O9P A;  2HZK A;  4GQO A;  3HO7 A;  1B7U A;  5J1D A;  4POX A;  4IB2 A;  2XXQ A;  3TCG A;  3TQL A;  2O1L A;  5CBS A;  3V8X B;  2QMW A;  4GFR A;  4LUB A;  2R9J A;  4RPN A;  1PBP A;  1Y9U A;  3TTN A;  1IXG A;  1HSJ A;  2AL4 A;  4FEB A;  3I6V A;  3K2D A;  1SVX B;  4TOZ A;  4JWY A;  3Q26 A;  4HCY A;  3H3G A;  1XC1 A;  4YU0 A;  1NNT A;  4AB6 A;  4NF4 A;  5I59 A;  2F6P A;  4R72 A;  4HCW A;  1MDP 1;  2ONR A;  2DWA A;  3OO9 A;  3RYB A;  3O29 A;  5ICQ A;  4NF8 B;  3I3V A;  1MXW A;  4QFO A;  2H99 A;  3VDF A;  2QJE A;  2Q9T A;  1ZJL A;  1TFA A;  1SYH A;  4KPT A;  3LSL A;  3QXM A;  3SEY A;  1J1N A;  5B70 A;  3MP8 A;  5DEX A;  3FVO A;  3T22 A;  3T93 B;  2RC7 A;  3O6I A;  1BLF A;  4DE8 A;  1PB8 A;  4BDL A;  1B52 A;  1GGG A;  5CI5 A;  3KBR A;  4X1B A;  3K6U A;  2O68 A;  5CRY A;  2Z23 A;  2DQV A;  1Y4T A;  2O51 A;  2ABH A;  2P0S A;  5CBR A;  1QJM A;  1MXU A;  4KYD A;  3BBR A;  1I69 A;  1LLS A;  1JW4 A;  2ZNS A;  1LFH A;  3TAJ A;  1URG A;  3TZA A;  3RT8 A;  2V3Q A;  3VXB A;  5K2Y A;  4O3C A;  1CB6 A;  3SEV A;  3BKI B;  1SW5 A;  2FA7 A;  1MY3 A;  4KYS A;  4F1U A;  2V93 A;  3USD A;  4FED A;  3ZKK A;  3M3K A;  3U72 A;  3CFX A;  1SBP A;  1R9Q A;  3CG3 A;  1ZTY A;  1O64 A;  1UQW A;  1PBQ A;  3EQ1 A;  1IQ7 A;  1QKB A;  1EZO A;  1FTO A;  5DT6 A;  3TMG A;  2B3B A;  4O3B A;  1YAE A;  4E0W A;  5CMK A;  3KN7 A;  3EHU A;  1ZMG A;  5DVF A;  4MF3 A;  2ZYK A;  2DE2 A;  4OEV A;  2Y7W A;  3UOR A;  3H6T A;  2HCA A;  3K1P A;  1AOV A;  1Z7N E;  4KYE A;  4GVO A;  3S9M C;  1XVX A;  4Q30 B;  1GR2 A;  2DVZ A;  2DVC A;  3Q28 A;  2VHA A;  4RA1 A;  1NMU A;  2QS4 A;  2PMS A;  3PV0 E;  5AA1 A;  2XXH A;  4EQ9 A;  1R6Z A;  2XXV A;  3G3F A;  4O3A A;  2R71 A;  2OK2 A;  2P2A A;  1NFT A;  1F9B A;  2XXT A;  4EQ7 A;  1JVY A;  3C35 A;  2G93 A;  1O7T A;  3FJ7 A;  1VFE A;  3LSX A;  4OYV A;  1KWH A;  1B9J A;  2RF1 A;  4JSO A;  2Y7R A;  2Z8D A;  3MP1 A;  3RPW A;  5I2K A;  2QS2 A;  4ZEK A;  2XXU A;  1MY1 A;  2CMO A;  3LUY A;  4Q0C A;  3FVN A;  4FAJ A;  1CE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...