1B3HA

Oligo-peptide binding protein complexed with lysyl-cyclohexylalanyl-lysine
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 192
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b3hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b3hA02
3VDFA 1YPNA 4LZ8A 3UGWA 3N5LA 1M5FA 1B7HA 2RKMA 2F35A 5TU0A 4OWDA 2X26A 1OVTA 2A5SA 2H4IA 1N3XA 2OWTA 1SYIA 3TTRA 2DVZA 3M3FA 4Z0IA 1XC1A 4FECA 1MY0A 3UA8A 5KZTA 3WAFA 3OO6A 1B6HA 1JW5A 3RT6B 2VD3A 4LA9A 4NWDA 3H4ZA 2ZNTA 1N7XA 4RJZA 4KYEA 3S2VA 1LCFA 3HHFA 3TCGA 1IZ1A 4WEPA 2VD2A 4ELOA 2F34A 2NXOA 2H9BA 3TODA 3SEUA 5AA1A 4EQ7A 5EHMA 4EQBA 3PPRA 4YZZA 1PB9A 4C0RA 1LFHA 3TEPA 3QIMA 3EHUA 4U1ZA 1B3LA 4F1VA 4THIA 4RNSA 4GL0A 3RUMA 4IB2A 3QK6A 3M3KA 4YB6A 2RC7A 1B9JA 3TAJA 2F6GA 3VLWA 1MQHA 1II5A 3CSGA 4H5FA 2Y7WA 2XXXA 2OCUA 3G3GA 4DZ1A 1USYE 3IOWA 4JSOA 5HM4B 1BIYA 2UVJA 2WOLA 2ONSA 3MZBA 2DE3A 1JVXA 4R6YA 4R75A 3S4UA 3B7DA 3MVWA 1MM6A 2LAOA 3CI8A 1NKXA 5H8NA 3K01A 3C36A 3JV9A 1VE4A 2QJEA 1MPCA 4G8MA 1FCKA 1S7YA 1IXIA 4BLAA 2ZYKA 3T9UA 2HAVA 2O1MA 1FQDA 4EQ9A 1FQEA 2PMSA 4U4SA 1H43A 1URGA 4F22A 3G3HA 4AB6A 4FAJA 1NL5A 2FA7A 2D5WA 1A99A 4JBZA 1YTVA 4KD5A 3IB2A 5FHNA 1UIVA 1IXHA 5CMCA 2DWAA 2G29A 3G7WA 3PUZE 4POXA 5JTYA 1B3HA 3O6IA 1OVBA 3CG3A 3DP8A 2DE2A 4GF8A 3JZJA 4OMBA 1VSOA 1TFDA 5CBSA 4JWOA 2OK2A 5I56A 3H6TA 2ZNUA 4LQ5A 4FIMA 2GH9A 1B3GA 4YB5A 2ZYNA 3TKDA 1L5TA 2I0BA 3SESA 3MP6A 3FJ7A 1MPDA 3N6UA 3GZGA 1SW2A 4KHZE 5FTHA 3PPOA 5FTIA 4NF8A 4ZECA 1Y3PA 2V25A 2XXIA 5CRYA 4NF5A 1R9LA 3PUXE 4G68C 4GRKA 4OENA 1MPBA 4R9GA 3TQWA 1LB9A 2M8CA 4HS7A 4BDNA 3OSRA 2RF1A 1FTLA 3U1OA 4I9DA 4R2FA 3SKPA 1ZU0A 4GXSB 2WOKA 2F7BA 1MH4A 1MG1A 2KLFA 2VHAA 4OFOA 2QMWA 1UQWA 1Y9UA 3RTFB 4LQ2A 3W9VA 2ONRA 4KQPA 4H1XA 5H8QB 1GGGA 5IKBA 3VV5A 5AA3A 3KN7A 1SI0A 4H8IA 2X7PA 1Z7ME 4NF4B 4I1DA 4DIGA 4EXKA 5I84A 2DYXA 3A3UA 4MFIA 3U93A 4IGTA 2O7IA 3PUYE 1ANFA 3H06B 4YKPA 2AYSA 1NFTA 3WAEA 3LSWA 4R72A 2XHDA 2UYFA 3ZKKA 1JW4A 5A5XA 3K2DA 2ANJA 1B46A 5H8HA 2DP8A 3CR9A 4QFNA 3FZVA 2G93A 1MQJA 4O3CA 2AL4A 3T66A 3KG2A 3TFLA 1D4NA 3TTNA 1MXWA 3N94A 1GR2A 2HEUA 2V3QA 3E13X 2PX1A 2DS9A 3C35A 2ZXTA 1OIBA 4G8NA 2E0SA 4G8HA 4PFYA 1DSNA 3CHGA 2RCBA 4YMBA 3F11A 2DWIA 4EF1A 4U4XA 5DVJA 3T9VA 2YPNA 4PFUA 2IEEA 5B70A 1VFDA 3UK4A 4F29A 1B3EA 4R9FA 5CMBA 3OEMA 5ICQA 1WDNA 3ZS6A 2A5TA 1A40A 2DWJA 3R6UA 3W9WA 2F6PA 1DMBA 4MBPA 3S9MC 4NF6B 3R7XA 4XIGQ 4I62A 3N26A 1VR5A 3HPIA 1YAEA 3K1MA 2HFBA 1TWYA 3GXAA 3OD7A 1LLSA 1JEVA 2DXYA 3KZGA 1QVSA 3KJTA 3CFLA 3TDJA 3EF7A 1N84A 1TXFA 2THIA 1HSEA 4XKQA 5DVIA 4KFQA 4KYSA 3VVDA 1DPPA 4ZZAA 3FXQA 1N76A 4QSCA 4Q8RA 4NF8B 4R6HA 3ECRA 4FJPA 3FXUA 3OEKA 3HV1A 3H3GA 1UTHA 3B6QA 1I69A 4NF5B 4Q0CA 2O51A 3RT8A 1ZBMA 1DPEA 3MVYA 2I3VA 2QS1A 3V5AA 3SEYA 2FNCA 3PPPA 2QL3A 2X7QA 3O6HA 3Q25A 4P11A 1MXZA 1A54A 4TOZA 3I5OA 5ICTA 3U8QA 4QF9A 3LSLA 2QS4A 2Y7IA 1M5EA 3MVZA 3VE1B 4P0IA 3BBRA 4I8CA 1POTA 3UN6A 3PD8A 2BJJX 3VLVA 3KN3A 1MS7A 5BUUA 2P1SA 4HW8A 4ZEBA 1FTKA 1NH8A 3UP9A 1MQIA 3USDA 2Q8JA 4HTGA 2Y7KA 5A5XB 4GLIA 4FEBA 4OVJA 1MM7A 4O3AA 2XX8A 4XKPA 5AA2B 1US5A 2OLBA 1MQGA 2DQVA 2HAUA 2B65A 4OETA 2XXVA 3T9XB 4P0GA 3HHGA 4ZS9A 5I2KB 1IXCA 1FQBA 3O6GA 4ISUA 3ILTB 2PVUA 4ESWA 2REGA 5CM6A 2NUVA 2XXPA 1RYOA 3TZAA 3E9XA 5H8QA 3IOTA 4EF2A 3G3IA 4RA1A 4DXUA 1B1HA 5LOMA 1LAHE 1HSJA 4X1BA 3HN0A 5CI5A 4BDLA 4NF4A 3MQ9A 1N7WA 3PAMA 4Q30B 2ZNSA 3KBRA 3RYAA 4DCYA 4C1TA 1NNKA 4U21A 3CSBA 2A5TB 1PB8A 1JEUA 4XTCQ 1M5CA 1GVCA 2VGQA 4BDRA 2F97A 4YKIA 4IY5A 3TELA 4XKNA 3LC8A 2I4CA 4R6KA 3DRIA 3MPLA 5L8DA 2I49A 4X1DA 3FJGA 1LBBA 3ONMA 2F36A 1UTBA 1FTJA 2WOPA 2O6AA 3K6UA 1B7ZA 2O69A 1R6ZA 2UYEA 3FV2A 1IITA 3CG1A 4M4GA 3MVXA 4ZEKA 3SERA 3QUJA 4FE8A 4LZ7A 4ELRA 1BKAA 4BDQA 2ONKE 4ESXA 2F8DA 2XXTA 1SW4A 4ND9A 1EZPA 3FUZA 3H6VA 3DRFA 3K0VA 1UTHB 3C33A 1Q1KA 4IO4A 4PQJA 3ODBA 3KOTA 4H8JA 5DYHA 1TFAA 1B4HA 4MLVA 3FIRA 4NF6A 2PBWA 2XXHA 3D4GA 1MH3A 3ZKLA 4RPOA 2D3IA 3TCFA 4O3BA 2P2AA 1MXUA 3VVFA 3KEIA 4H6DA 3HO7A 3TTMA 4QSEA 2Q9TA 1JQFA 3LBSA 4DDDA 1PB7A 4F1YA 1LAGE 4QFOA 3G3FA 5JK4A 5DEXA 2GRVA 5F1QA 3PMVA 3C9HA 5H8FB 1SBPA 4XKRA 1WODA 2O84X 3H7MA 4GOTA 4GD5A 5TPAB 4IO5A 4OERA 4BDMA 1YCJA 1MXVA 5FHOA 3PV0E 4F3GA 3V83A 4F19A 1XT8A 3EPEA 5K2YA 3K02A 3P7IA 3H03A 3BKIB 1P1UA 2XXUA 1SW5A 3O28A 4Q5TA 3OELA 2ESNA 4NE4A 1SW1A 2GHBA 4FEDA 2F5XA 3DP6A 1NNTA 4F1UA 1N04A 3CFXA 1OQHA 4OEVA 4HCWA 3S9LC 4FATA 2Q89A 3K1PA 3U72A 2XX9A 3OENA 3V8XB 4Z7EA 4RPNA 1DTZA 1A8EA 3SEWA 1P1OA 1JETA 3OSQA 2P0SA 4NTLA 3PPQA 3OO8A 3IO6A 1NH7A 2I0CA 1OLCA 1B0LA 4F18A 1H76A 3U92A 3QUFA 4EUOA 1GV8A 5DTBA 3HCQA 1QUIA 5AA2A 3KJ7A 4ZDMA 3S9EA 1O7TA 3VLUA 1TT1A 3MP1A 4N07A 1QKAA 1MRPA 3O97A 1URDA 5DVFA 3VVEA 1MDP1 1SD3A 3TTKA 1UTBB 3GLBA 5I2KA 1FQFA 3B6WA 2OJTA 5M2VA 1B7UA 1D9VA 1BTJA 4ZZEA 3H6UA 3FASA 1P1QA 4F2OA 5I2NB 3A3CA 3SEVA 4PFWA 3T22A 1NNFA 2Q88A 3KN8A 2GFEA 3RTWB 2HQ0A 2QMXA 2B4LA 3ZSFA 2RCAA 4L17A 3DRJA 2Y7RA 3FJMA 2AL5A 2QS2A 4IO7A 4H5GA 3T93B 3ILUB 1LBCA 2V3TA 3FXRA 3FVOA 4EDPA 3W15C 3CFZA 4MH5A 5I57B 1MXYA 3M8UA 1LGBC 4QFPA 2E1SA 5ITOA 3QYTA 4F3PA 1OLAA 3PMXA 3T96B 3K6XA 4F3SA 5DT6A 5HBCA 2R71A 3MJNA 1H44A 1NNPA 3IJOB 1IQ7A 3QAXA 4HCYA 3OOAA 1A55A 2F78A 3QSLA 1UIUA 1MY4A 2H5YA 4TLMB 5KDTA 1R9QA 4PE5B 1B5IA 2Z22A 4R2BA 5I58B 4ZEFA 3IOUA 1EU8A 5DEXB 2PYYA 3VXBA 5BWJA 1ZJLA 4GL8A 3TYHA 4NMYA 4QSDA 5HPQA 3Q28A 4OEUA 4F3BA 2ZMBA 3C32A 1ZLQA 3MPKA 3K6VA 5TP9A 3Q26A 3O66A 4DXCA 1ATGA 2H99A 4LZ5A 5ITPA 3L6HA 3EN3A 1JNFA 2VOZA 4RK9A 1NMUA 2IA4A 2R6GE 2RC8A 1JVYA 3PU5A 1QULA 3IB0A 2RINA 3IX1A 1CB6A 2V84A 3Q29A 3IL1B 3S9NC 3BFTA 3KOSA 3DLNA 2QRYA 5AE4A 1FW0A 2DVCA 2O68A 2I3WA 4LUBA 1DTGA 2AIXA 1IUDA 1I6QA 4H0WA 4JB7A 2ALUA 1I6BA 1H3DA 1OMPA 2XXRA 3V89B 4XXUA 3KSJA 1M5DA 2Z8DA 3FD3A 4YKJA 3BFUA 1KWHA 4F2QA 4R74A 5H8FA 1LCTA 4OESA 1T0KA 1Y20A 1XHYA 1SI1A 1PC3A 3K1NA 5TPAA 2Y84A 4F39A 5KCJB 3O29A 2RC9A 1HSLA 2O7UA 4OYVA 4N6PA 2H98A 4G77A 2XX7A 1Y4TA 3FATA 1D9YA 3O2AA 4DXBA 1MY1A 2DSFA 1LFGA 1ELJA 4X9TA 2XD3A 3O9PA 3FVGA 1MXXA 1Y3NA 4YMAA 2FYIA 4IO2A 2QS3A 3U94A 3OO9A 1XOCA 4G2ZA 3D4CA 4QFLA 4JSDA 4U23A 1OQGA 2REJA 4PFTA 2DE4A 4GIZA 3IR1A 2XXWA 1A7LA 3CVGA 3IO4A 4H67A 2XXYA 4GVOA 5I59B 3IOVA 1USYH 4GFRA 3C34A 1B2HA 3RQTA 4OQOA 4WXJA 4EXLA 4OHNA 1F9BA 4PP0A 2NWJA 3LVUA 3RLFE 1FQCA 4U1OA 1JW1A 4MLQA 2Q2AA 5EHSA 1ZMGA 4LATA 2B3FA 4BDOA 4RY1A 3IAZA 2QPQA 4GXAA 4DE8A 1P1WA 2CZLA 1B0HA 2I58A 3THIA 3MZ9A 3RY3A 2DXRA 3RYBA 1A8FA 2YJPA 1O63A 3OMBA 2GHAA 1AOVA 3LSXA 1LFIA 2Z23A 4JDFA 3MUQA 3HSTA 5L9OA 4MF3A 2HZLA 5I2NA 4KR5A 5KDTB 3PMWA 1B51A 2O1LA 1SDXA 3EHTA 5L9MA 4IO6A 2ABHA 1PDAA 3GBBA 5TP9B 2ZYMA 1LAXA 2NOOA 1B5JA 2W7YA 2CMOA 1SQYA 3G3KA 4LONB 3PUWE 5AA4A 2HZKA 2V3UA 1CE2A 1D3KA 5I57A 2Z8EA 3K6WA 3MZ1A 3K4UA 3KFMA 1B40A 2UVGA 4U2RA 4DLDA 4F31B 1BLFA 3FGSA 3LSFB 4POWA 1RYXA 1QUKA 4E0WA 3B6TA 3OO7A 3SETA 4GWOA 4AQ4A 1P1NA 1US4A 5ELVA 1N3WA 2Y7PA 5I58A 1AMFA 5J1DA 1S9TA 2Q2CA 3T9HB 3PPNA 1FTMA 3DRGA 3LUYA 5FHMA 2HXWA 3TTLA 4YAHX 4YICA 3K00A 1P99A 1AL3A 1EH3A 2QSXA 3CRBA 4G68B 1Y4CA 3DELB 4WKMA 3A09A 5EYFA 2B4MA 2F7AA 3QXMA 3GBAA 3KGCA 4ECFA 3E4RA 3I3VA 1IEJA 1VFEA 1M5BA 2DOJA 4U22A 2WKYA 3RPWA 1GTKA 4UACA 1B52A 4DCXA 4PETA 4JWXA 1QUJA 2XD2A 3MAMA 1Z7NE 5KCJA 3CIJA 3IK6B 1PBQA 3MW0A 3UIFA 3MBPA 5JEIA 4RK2A 1N0TA 2UVIA 4RYAA 3M3LA 2I6EA 3PGFA 2OBGA 5CBRA 3FTOA 3FVNA 5ISUA 4OZ9A 1EZOA 4LP2B 3R26A 3MWBA 1I6AA 1J1NA 1ZTYA 1URSA 4GQOA 1R1NA 4R73A 4OFJA 3VXCA 4IY6A 3JYRA 1PEBA 4KYDA 5H8SA 5CMMA 2OWSA 2YLNA 4ZE8A 1B4ZA 1DOTA 4FORA 3H6WA 3LR1A 1B58A 5H8NB 4TLLB 3UORA 3TCHA 4YU0A 1B05A 4QRZA 4OFLA 1FQAA 1XVYA 4NEDA 5I59A 1MQDA 4LVQA 2R9JA 3TUSA 5CMKA 3PUVE 5AA4B 3L6GA 4UA8A 4K3FA 2V93A 1FTOA 4KCCA 4ZE9A 1QW0A 2PT1A 3DRKA 1Y1ZA 2DWHA 1PBPA 3O6PA 3TMGA 1B3FA 2I4BA 5JTYB 5L9SA 3KSXA 3SDFA 3C4MA 4C1UA 5IAIA 2XXQA 3C31A 2ZYOA 4YB7A 1LSTA 3SEXA 4M1VA 3RGYA 3TQLA 4KI0E 1Q35A 3EQ1A 4WEDA 2VP1A 3IORA 4IO3A 5I56B 2D21A 4N13A 3DP4A 3RNNA 1WVJA 4QFKA 4ONYA 4TQUQ 1B32A 3DM0A 1B1XA 4ELQA 4IGRA 4NWCA 3VFJA 2UVHA 4X48A 4RXLA 5K2XA 1LB8A 2Z8FA 3PD9A 3I6VA 2H25A 2PT2A 3EHSA 1AH5A 1Y3QA 1IXGA 1MDQA 4QHQA 3TPAA 4E0XA 1Y1MA 1MY2A 1ZKBA 3E3KA 1LAFE 4H65A 3Q27A 5CC2A 5AA2D 2F7CA 4KCDA 1IIWA 3N6TA 1EZ9A 2OZZA 4ZEDA 1H45A 4KPTA 2I48A 1SYHA 1S50A 1ZIUA 1AIVA 4ZEIA 4OXVA 1XVXA 3MP8A 3FV1A 3OXNA 4YKKA 4JXIA 1POY1 1MY3A 2UXAA 1SVXB 4ELPA 1QKBA 1XS5A 5B7DA 4G4PA 3IB1A 3RN8A 1QJMA 3G3JA 3MC2A 3IJXB 1RKMA 2NVUB 5F7VA 1BP5A 3AXFA 2HCAA 3FVKA 4OTEA 4G68A 1O64A 4JWYA 2B3BA 3DRHA 1B5HA 4AB5A 5H8HB
chains in the Genus database with same CATH superfamily
3VDFA 1YPNA 4LZ8A 3UGWA 3N5LA 1M5FA 1B7HA 2RKMA 2F35A 2KR0A 5TU0A 4OWDA 2X26A 1OVTA 2A5SA 2H4IA 1N3XA 2OWTA 1SYIA 2DDKA 3TTRA 2DVZA 3M3FA 4Z0IA 1XC1A 4FECA 1MY0A 3UA8A 5KZTA 3WAFA 3OO6A 1B6HA 1JW5A 3RT6B 4NHBA 2VD3A 4LA9A 4NWDA 2HXRA 3H4ZA 2ZNTA 1N7XA 4RJZA 4KYEA 3S2VA 1LCFA 5T3JA 4PFIA 3HHFA 3TCGA 1IZ1A 4WEPA 2VD2A 4ELOA 2F34A 2NXOA 2H9BA 3TODA 3SEUA 5AA1A 4EQ7A 5EHMA 4EQBA 3PPRA 4YZZA 1PB9A 4C0RA 1LFHA 3TEPA 3QIMA 4P1LA 3EHUA 4U1ZA 1B3LA 4F1VA 4THIA 4RNSA 4GL0A 3RUMA 4JVCA 4IB2A 3QK6A 3M3KA 4YB6A 2RC7A 1B9JA 3TAJA 2F6GA 3VLWA 4PF6A 1MQHA 1II5A 3CSGA 4O7MA 1Q9DA 4H5FA 2Y7WA 2XXXA 2OCUA 3G3GA 2OX3A 4DZ1A 1USYE 3IOWA 3BIGA 5IZ3A 4JSOA 1NUXA 5HM4B 4PGPA 1BIYA 2UVJA 2WOLA 2ONSA 3KC1A 3MZBA 2DE3A 1JVXA 4R6YA 4R75A 3S4UA 3B7DA 3MVWA 2XWVA 1MM6A 2LAOA 1FBPA 3CI8A 4I3EA 1NKXA 5H8NA 3K01A 3C36A 3JV9A 1VE4A 2WX9A 2QJEA 1DCUA 1MPCA 4G8MA 5ET5A 1FCKA 1S7YA 1NV1A 1IXIA 4BLAA 2ZYKA 3T9UA 2HAVA 2O1MA 1FQDA 4EQ9A 1FQEA 2PMSA 4GX4A 4U4SA 1NV2A 1H43A 1URGA 4F22A 3G3HA 4QBAA 4AB6A 4GBVA 4FAJA 1NL5A 2FA7A 2D5WA 4XF5A 1A99A 4JBZA 1YTVA 4KD5A 3IB2A 3FBPA 4NF0A 5FHNA 4PAIA 1UIVA 1IXHA 5CMCA 2DWAA 2G29A 3G7WA 3PUZE 4POXA 5JTYA 1B3HA 3O6IA 1OVBA 3CG3A 2ZZWA 3DP8A 2DE2A 4DI4B 4GF8A 3JZJA 4DI3D 4OMBA 1VSOA 1TFDA 5CBSA 4JWOA 2OK2A 5I56A 3H6TA 2ZNUA 4LQ5A 4FIMA 2GH9A 1B3GA 4O8MA 4YB5A 2ZYNA 3TKDA 1L5TA 2I0BA 3SESA 3MP6A 4GWSA 4XFEA 4KXPA 3FJ7A 1MPDA 3N6UA 3GZGA 1SW2A 5EQ7A 4KHZE 5FTHA 2FBPA 3PPOA 5FTIA 1NV7A 4NF8A 1LBYA 4ZECA 1Y3PA 2V25A 4MNPA 2XXIA 4NF5A 5CRYA 1R9LA 3PUXE 4G68C 4GRKA 4OENA 1KZ8A 1MPBA 4R9GA 3TQWA 1LB9A 2M8CA 4HS7A 5F24A 4BDNA 3OSRA 2RF1A 1FTLA 5LTCA 3U1OA 1FPGA 4I9DA 4R2FA 3SKPA 1FBFA 1ZU0A 3MSTA 4GXSB 2WOKA 2F7BA 1MH4A 1MG1A 2KLFA 2VHAA 4OFOA 4MAGA 2QMWA 3E79A 1UQWA 1Y9UA 3RTFB 4LQ2A 3W9VA 2ONRA 4KQPA 1CNQA 4H1XA 2XXKA 5H8QB 1GGGA 4GWXA 5IKBA 3VV5A 5AA3A 3KN7A 1SI0A 4H8IA 2X7PA 3T0JA 1Z7ME 4NF4B 4I1DA 4DIGA 4EXKA 5I84A 2DYXA 3A3UA 4MFIA 3U93A 4IGTA 2O7IA 3PUYE 1ANFA 3H06B 4YKPA 2AYSA 1NFTA 3WAEA 1IMFA 3LSWA 4R72A 2XHDA 2UYFA 3ZKKA 1JW4A 5A5XA 3K2DA 2ANJA 1B46A 5H8HA 2DP8A 3CR9A 4QFNA 3FZVA 1RDXA 2G93A 1MQJA 4O3CA 2AL4A 3T66A 3KG2A 3TFLA 1D9QA 1D4NA 3TTNA 1MXWA 1NUYA 3N94A 1GR2A 2HEUA 2V3QA 3E13X 2WBDA 2PX1A 2ZZVA 2DS9A 2P3NA 3FXBA 3C35A 2ZXTA 1OIBA 1QGXA 4G8NA 2E0SA 4G8HA 4PFYA 1DSNA 3CHGA 2RCBA 4YMBA 3F11A 2DWIA 2HPGA 4EF1A 4U4XA 5DVJA 3T9VA 2YPNA 1FBEA 4PFUA 2QVUA 4X8RA 2IEEA 5B70A 1VFDA 3UK4A 4F29A 1B3EA 4R9FA 1FPIA 5CMBA 1DK4A 2V4CA 3OEMA 5ICQA 1WDNA 3ZS6A 2A5TA 1A40A 2DWJA 3R6UA 3W9WA 2F6PA 1DMBA 4MBPA 3S9MC 4NF6B 3R7XA 4JVDA 3RYDA 4PF8A 4XIGQ 4I62A 4NAPA 3N26A 1VR5A 1FPBA 3HPIA 1YAEA 3K1MA 2HFBA 1YZ0A 4UABA 1TWYA 3GXAA 3OD7A 2FHYA 4NX1A 1FTAA 1LLSA 1JEVA 2DXYA 3KZGA 1QVSA 3KJTA 2CZIA 3CFLA 3TDJA 3EF7A 1FBDA 1N84A 1TXFA 2THIA 4O94A 1HSEA 4N81A 4XKQA 5DVIA 4KFQA 4KYSA 3VVDA 1DPPA 4ZZAA 2XA5A 3FXQA 4G61A 1N76A 4QSCA 4Q8RA 4NF8B 4R6HA 3ECRA 4FJPA 3FXUA 3OEKA 3HV1A 3H3GA 1UTHA 4NQ8A 3B6QA 1I69A 4JVIA 4NF5B 1FBGA 4Q0CA 2O51A 3RT8A 1ZBMA 1DPEA 3MVYA 2I3VA 1IMCA 2QS1A 3V5AA 3SEYA 3E78A 2FNCA 3PPPA 2QL3A 2X7QA 4MEVA 3O6HA 3Q25A 4P11A 1MXZA 1A54A 4TOZA 3BIHA 3I5OA 5ICTA 3U8QA 4QF9A 4PBHA 3LSLA 2QS4A 2Y7IA 1M5EA 3MVZA 3VE1B 4P0IA 3BBRA 4I8CA 1POTA 3UN6A 5FBPA 1FPEA 3PD8A 2BJJX 1DBZA 3VLVA 3KN3A 3NOHA 1MS7A 5BUUA 2P1SA 5A5LA 4HW8A 4ZEBA 1FTKA 1NH8A 3UP9A 1MQIA 4MX6A 3USDA 2Q8JA 2WYPA 4HTGA 2Y7KA 5A5XB 4PDHA 4GLIA 4FEBA 4OVJA 1MM7A 4O3AA 2XX8A 4XKPA 5AA2B 1US5A 2OLBA 1MQGA 2DQVA 2HAUA 2B65A 4OETA 2XXVA 4OVPA 3T9XB 4P0GA 4FBPA 3HHGA 4ZS9A 5I2KB 4GBWA 1IXCA 1FQBA 3O6GA 4ISUA 3ILTB 2PVUA 2QVVA 2REGA 4ESWA 5CM6A 2KQZA 2NUVA 2XXPA 1RYOA 3TZAA 1FBCA 3E9XA 5H8QA 3IOTA 4H46A 4EF2A 1FPKA 4RA1A 3G3IA 3RPLA 4DXUA 1B1HA 5LOMA 1LAHE 1HSJA 4X1BA 3HN0A 5CI5A 1IMBA 4BDLA 4NF4A 3MQ9A 1N7WA 3PAMA 4Q30B 2ZNSA 3KBRA 3RYAA 4HE1A 4DCYA 4C1TA 1LBZA 1NNKA 4U21A 3CSBA 5ET8A 2A5TB 1PB8A 1JEUA 4XTCQ 1M5CA 1GVCA 2VGQA 2Q8MA 4BDRA 2F97A 4YKIA 4N15A 4IY5A 3TELA 4XKNA 3LC8A 4OVSA 2I4CA 4R6KA 3DRIA 3MPLA 5L8DA 2I49A 4I3YA 4X1DA 2CEYA 3FJGA 1LBBA 3ONMA 2F36A 5I7IA 1UTBA 1FTJA 2WEFA 2WOPA 2O6AA 3K6UA 2Y5KA 1B7ZA 2O69A 1R6ZA 2UYEA 3FV2A 4OANA 1IITA 3CG1A 4M4GA 2QFLA 3ISPA 3MVXA 4ZEKA 3SERA 3QUJA 4FE8A 4LZ7A 4ELRA 2P3VA 1BKAA 4BDQA 2ONKE 4ESXA 4GWUA 2F8DA 2XXTA 1SW4A 4ND9A 1EZPA 3FUZA 3H6VA 3DRFA 3K0VA 2MKZA 1UTHB 3C33A 1Q1KA 4IO4A 4PQJA 3ODBA 2WBBA 3KOTA 4H8JA 5DYHA 2CZKA 1NUZA 1TFAA 4PDDA 2HHMA 1B4HA 4MLVA 3FIRA 4O7IA 4NF6A 2PBWA 2XXHA 3D4GA 1MH3A 3ZKLA 5EQ8A 4RPOA 2D3IA 4PE3A 5I3SA 3TCFA 4OA4A 4PCDA 4O3BA 2P2AA 1MXUA 3VVFA 3KEIA 4H6DA 4IR8A 3HO7A 3TTMA 4QSEA 2Q9TA 1JQFA 3LBSA 4DDDA 1PB7A 5IGAA 4F1YA 1LAGE 4QFOA 3G3FA 5JK4A 5DEXA 2GRVA 5F1QA 3PMVA 3C9HA 5H8FB 1SBPA 4XKRA 1WODA 2O84X 3H7MA 4GOTA 4GD5A 5TPAB 4IO5A 4OERA 4BDMA 1YCJA 1MXVA 5FHOA 3PV0E 4F3GA 3V83A 5EYGA 4F19A 1XT8A 3EPEA 5K2YA 3K02A 3P7IA 3H03A 3BKIB 1P1UA 2XXUA 1SW5A 3O28A 4Q5TA 3OELA 2ESNA 4NE4A 1K9YA 1SW1A 2GHBA 1FJ6A 4FEDA 2F5XA 3DP6A 1NNTA 4F1UA 3A29A 1N04A 3CFXA 1OQHA 4OEVA 4HCWA 4PBQA 3S9LC 4FATA 2Q89A 3K1PA 4MIJA 3U72A 2XX9A 3OENA 3V8XB 3RPLB 4Z7EA 4RPNA 1DTZA 1A8EA 3SEWA 1P1OA 3MYUA 3D1RA 1JETA 4PFBA 3OSQA 4LN5A 2P0SA 4GX3A 4NTLA 3PPQA 3OO8A 3IO6A 4P3LA 4PAKA 1NH7A 2I0CA 1OLCA 1B0LA 4F18A 1H76A 3U92A 3QUFA 1LBWA 4EUOA 1GV8A 5DTBA 1FPLA 3HCQA 1QUIA 5AA2A 3KJ7A 4ZDMA 3S9EA 1O7TA 3VLUA 1TT1A 4P8BA 3MP1A 2ZZXA 4N07A 1QKAA 1MRPA 1NV3A 1G0IA 3O97A 1URDA 4PAFA 1VDWA 5DVFA 3VVEA 1MDP1 1SD3A 3TTKA 2BJIA 1UTBB 3GLBA 5EQAA 5I2KA 1FQFA 4P9KA 3B6WA 2OJTA 5M2VA 1B7UA 1D9VA 1BTJA 4ZZEA 2PFZA 3H6UA 3PTYA 3FASA 1P1QA 5IZ1A 4F2OA 5I2NB 3A3CA 3SEVA 4PFWA 1EYJA 3T22A 1NNFA 2Q88A 3KN8A 1IMDA 2GFEA 3RTWB 2OWZA 2HQ0A 2QMXA 2B4LA 3ZSFA 2RCAA 2L5VA 4L17A 5IZZA 4N8YA 3DRJA 2Y7RA 3FJMA 2AL5A 2QS2A 4IO7A 5ET7A 4H5GA 3T93B 3ILUB 1LBCA 2V3TA 3FXRA 3FVOA 4EDPA 3W15C 3CFZA 4MH5A 5I57B 1MXYA 3M8UA 1LGBC 4QFPA 2E1SA 5ITOA 3QYTA 4F3PA 1OLAA 3PMXA 3T96B 3K6XA 4F3SA 5DT6A 1LEVA 5HBCA 2R71A 3MJNA 1H44A 1NNPA 3IJOB 1IQ7A 3QAXA 4HCYA 4NN3A 3OOAA 1A55A 3QSLA 2F78A 2XWOA 1UIUA 1MY4A 1AWBA 3T1BA 2H5YA 4TLMB 2XWIA 5KDTA 1R9QA 4PE5B 1B5IA 2Z22A 4R2BA 1NV0A 4ZEFA 2VPNA 3IOUA 5I58B 1INPA 1EU8A 5DEXB 2PYYA 3VXBA 5BWJA 1ZJLA 4GL8A 2WYKA 3TYHA 4NMYA 4QSDA 4AS5A 5HPQA 3Q28A 4OEUA 1KA0A 4F3BA 2ZMBA 3C32A 1ZLQA 3MPKA 3K6VA 5TP9A 3Q26A 3O66A 4DXCA 1ATGA 2H99A 4LZ5A 5ITPA 3L6HA 3EN3A 1JNFA 2VOZA 4RK9A 1NMUA 2IA4A 2R6GE 2RC8A 1JVYA 3PU5A 1QULA 3IB0A 3IFAA 2RINA 3IX1A 1CB6A 2V84A 3Q29A 4GWYA 3IL1B 3S9NC 3BFTA 3KOSA 3DLNA 2QRYA 5AE4A 1FW0A 2DVCA 2O68A 2I3WA 4LUBA 1DTGA 2FIEA 1RDYA 2AIXA 2JJKA 1IUDA 1EYKA 1I6QA 1BK4A 4H0WA 4JB7A 2ALUA 1I6BA 1H3DA 1OMPA 2XXRA 3V89B 4XXUA 3KSJA 1M5DA 2Z8DA 3FD3A 4YKJA 1YXIA 1RDZA 3BFUA 1KWHA 4F2QA 4R74A 2VT5A 5H8FA 1LCTA 4OESA 1T0KA 1Y20A 1XHYA 1SI1A 2PFYA 1PC3A 2FIXA 3U65A 3K1NA 5TPAA 2GQ1A 2Y84A 4F39A 5KCJB 3O29A 2RC9A 1HSLA 2O7UA 4OYVA 4N6PA 2H98A 4G77A 2XX7A 1Y4TA 3FATA 4N4UA 4X04A 1D9YA 3O2AA 4DXBA 1MY1A 2DSFA 4OVTA 1LFGA 1ELJA 4X9TA 2XD3A 3O9PA 1NV4A 3FVGA 1MXXA 1Y3NA 4YMAA 2FYIA 4IO2A 2QS3A 3U94A 2VPOA 3OO9A 1XOCA 4G2ZA 3D4CA 4QFLA 4JSDA 4QXDA 4U23A 1OQGA 2REJA 4PFTA 2DE4A 4GIZA 2R8TA 3IR1A 2XXWA 1A7LA 3CVGA 3IO4A 4H67A 1K9ZA 2XXYA 4GVOA 5I59B 3IOVA 1USYH 4GFRA 3C34A 1B2HA 3RQTA 4OQOA 4WXJA 4EXLA 4OHNA 4PFRA 1F9BA 4PP0A 2NWJA 3LVUA 3RLFE 1FQCA 4U1OA 1JW1A 4MLQA 2Q2AA 2QVRA 5EHSA 1ZMGA 1NUWA 4LATA 2B3FA 3B50A 4PTKA 4BDOA 4RY1A 3IAZA 2QPQA 5DW8A 4GXAA 4DE8A 1P1WA 2CZLA 1B0HA 2I58A 3THIA 3MZ9A 3RY3A 2DXRA 3RYBA 1A8FA 2YJPA 1O63A 2F3BA 3OMBA 2GHAA 4MHFA 1AOVA 3LSXA 1LFIA 2Z23A 4JDFA 3MUQA 3HSTA 5L9OA 4N91A 4MF3A 4P47A 2HZLA 5I2NA 4KR5A 5KDTB 5EQ9A 3PMWA 1B51A 2O1LA 1SDXA 3EHTA 5L9MA 4IO6A 4NG7A 3EKIA 5ESYA 1NV6A 2ABHA 1PDAA 4PGNA 3GBBA 4OVRA 5TP9B 2ZYMA 1LAXA 2NOOA 2Q74A 1B5JA 2W7YA 2CMOA 1SQYA 3G3KA 4LONB 3PUWE 5AA4A 2HZKA 5LDZA 2V3UA 1CE2A 1D3KA 5I57A 2Z8EA 3K6WA 3MZ1A 3K4UA 3KFMA 1B40A 2UVGA 4U2RA 4HE0A 4DLDA 4F31B 4HE2A 1BLFA 3FGSA 3LSFB 4POWA 5EYHA 1RYXA 1QUKA 4E0WA 3B6TA 3OO7A 2CZHA 3SETA 3ROJA 4GWOA 4AQ4A 1P1NA 4N6DA 1US4A 4PC9A 5ELVA 1LBVA 1N3WA 2Y7PA 3GYYA 5I58A 1AMFA 1FSAA 2FVZA 5IM2A 5J1DA 1S9TA 2Q2CA 3QMFA 3T9HB 3PPNA 1FTMA 3DRGA 3LUYA 5FHMA 2HXWA 3TTLA 4NGUA 4YAHX 4YICA 4GWZA 3K00A 1P99A 1AL3A 3B8BA 1EH3A 2QSXA 2PCRA 3CRBA 4G68B 1Y4CA 3DELB 4MMPA 4WKMA 3A09A 5EYFA 2B4MA 2F7AA 3SZPA 3QXMA 3GBAA 1JP4A 3KGCA 3LV0A 4ECFA 3E4RA 3I3VA 1IEJA 1VFEA 1M5BA 1EYIA 2DOJA 4U22A 2WKYA 3RPWA 1GTKA 4UACA 1B52A 4DCXA 4PETA 1FPJA 4JWXA 1QUJA 2XD2A 4I40A 3MAMA 1IMAA 1Z7NE 5KCJA 4N17A 3CIJA 3IK6B 1PBQA 3MW0A 3UIFA 2CEXA 3MBPA 5JEIA 4RK2A 1N0TA 2UVIA 4RYAA 3M3LA 2I6EA 4HXVA 3PGFA 2OBGA 5CBRA 3FTOA 3FVNA 5ISUA 3HFUA 4OZ9A 1EZOA 4LP2B 3R26A 3MWBA 1I6AA 3IFCA 1J1NA 1ZTYA 1URSA 4GQOA 1R1NA 4R73A 5J16A 4OFJA 3VXCA 4IY6A 3JYRA 1PEBA 5IZ3B 1NI9A 4MJOA 4KYDA 5H8SA 5CMMA 2OWSA 2YLNA 4ZE8A 1B4ZA 1DOTA 4FORA 3H6WA 3LR1A 1B58A 5H8NB 4TLLB 3UORA 3TCHA 4YU0A 1B05A 4QRZA 4OFLA 4NEDA 1FQAA 1G0HA 1XVYA 5I59A 1MQDA 1SPIA 4LVQA 2R9JA 3TUSA 1FPDA 1NV5A 5CMKA 3PUVE 5AA4B 4P56A 3L6GA 4UA8A 4K3FA 2V93A 1FTOA 1FRPA 4MNIA 4KCCA 4ZE9A 1QW0A 4H45A 1YYZA 5I5PA 2PT1A 3DRKA 1Y1ZA 1LBXA 2DWHA 1PBPA 3O6PA 4N8GA 3TMGA 1B3FA 2I4BA 5JTYB 5L9SA 3KSXA 1FBHA 5ET6A 3SDFA 3C4MA 4C1UA 5IAIA 2XXQA 3C31A 2ZYOA 1IMEA 4YB7A 1LSTA 3SEXA 1FPFA 4M1VA 4XEQA 3RGYA 3TQLA 4KI0E 1Q35A 3EQ1A 2F3DA 4WEDA 2VP1A 3IORA 4IO3A 3KBZA 5I56B 2D21A 4N13A 3DP4A 3RNNA 1WVJA 4QFKA 4MCOA 4ONYA 4TQUQ 1B32A 3DM0A 1B1XA 4ELQA 4P1EA 4IGRA 4NWCA 3VFJA 2UVHA 4X48A 4RXLA 5K2XA 1LB8A 2Z8FA 3PD9A 3I6VA 2H25A 2PT2A 1XI6A 3EHSA 1AH5A 1Y3QA 1IXGA 2Y5LA 1MDQA 4QHQA 3TPAA 4E0XA 2XWKA 1Y1MA 1MY2A 1ZKBA 3E3KA 1LAFE 4H65A 4MNCA 3Q27A 5CC2A 5AA2D 2F7CA 4KCDA 1IIWA 3N6TA 1EZ9A 4OVQA 2OZZA 3KC0A 4ZEDA 1H45A 4KPTA 2I48A 1SYHA 1S50A 1ZIUA 1AIVA 4ZEIA 3LUZA 4OXVA 1XVXA 3MP8A 3FV1A 1KA1A 3OXNA 4GX6A 4YKKA 4JXIA 1POY1 1MY3A 2UXAA 1SVXB 4ELPA 1QKBA 1XS5A 4N6KA 5B7DA 4G4PA 3IB1A 3RN8A 1QJMA 3G3JA 3MC2A 3IJXB 1RKMA 2NVUB 5F7VA 1BP5A 3AXFA 4GWWA 1FJ9A 2HCAA 3FVKA 4OTEA 4G68A 1O64A 4JWYA 4AS4A 2B3BA 3DRHA 1B5HA 4AB5A 5H8HB
chains in the Genus database with same CATH topology
3VDFA 1YPNA 4LZ8A 3UGWA 3N5LA 1M5FA 1B7HA 2RKMA 2F35A 5TU0A 4OWDA 2X26A 1OVTA 2A5SA 2H4IA 1N3XA 2OWTA 1SYIA 3TTRA 2DVZA 3M3FA 4Z0IA 1XC1A 4FECA 1MY0A 3UA8A 5KZTA 3WAFA 3OO6A 1B6HA 1JW5A 3RT6B 2VD3A 4LA9A 4NWDA 3H4ZA 2ZNTA 1N7XA 4RJZA 4KYEA 3S2VA 1LCFA 3HHFA 3TCGA 1IZ1A 4WEPA 2VD2A 4ELOA 2F34A 2NXOA 2H9BA 3TODA 3SEUA 5AA1A 4EQ7A 5EHMA 4EQBA 3PPRA 4YZZA 1PB9A 4C0RA 1LFHA 3TEPA 3QIMA 3EHUA 4U1ZA 1B3LA 4F1VA 4THIA 4RNSA 4GL0A 3RUMA 4IB2A 3QK6A 3M3KA 4YB6A 2RC7A 1B9JA 3TAJA 2F6GA 3VLWA 1MQHA 1II5A 3CSGA 4H5FA 2Y7WA 2XXXA 2OCUA 3G3GA 4DZ1A 1USYE 3IOWA 4JSOA 5HM4B 1BIYA 2UVJA 2WOLA 2ONSA 3MZBA 2DE3A 1JVXA 4R6YA 4R75A 3S4UA 3B7DA 3MVWA 1MM6A 2LAOA 3CI8A 1NKXA 5H8NA 3K01A 3C36A 3JV9A 1VE4A 2QJEA 1MPCA 4G8MA 1FCKA 1S7YA 1IXIA 4BLAA 2ZYKA 3T9UA 2HAVA 2O1MA 1FQDA 4EQ9A 1FQEA 2PMSA 4U4SA 1H43A 1URGA 4F22A 3G3HA 4AB6A 4FAJA 1NL5A 2FA7A 2D5WA 1A99A 4JBZA 1YTVA 4KD5A 3IB2A 5FHNA 1UIVA 1IXHA 5CMCA 2DWAA 2G29A 3G7WA 3PUZE 4POXA 5JTYA 1B3HA 3O6IA 1OVBA 3CG3A 3DP8A 2DE2A 4GF8A 3JZJA 4OMBA 1VSOA 1TFDA 5CBSA 4JWOA 2OK2A 5I56A 3H6TA 2ZNUA 4LQ5A 4FIMA 2GH9A 1B3GA 4YB5A 2ZYNA 3TKDA 1L5TA 2I0BA 3SESA 3MP6A 3FJ7A 1MPDA 3N6UA 3GZGA 1SW2A 4KHZE 5FTHA 3PPOA 5FTIA 4NF8A 4ZECA 1Y3PA 2V25A 2XXIA 5CRYA 4NF5A 1R9LA 3PUXE 4G68C 4GRKA 4OENA 1MPBA 4R9GA 3TQWA 1LB9A 2M8CA 4HS7A 4BDNA 3OSRA 2RF1A 1FTLA 3U1OA 4I9DA 4R2FA 3SKPA 1ZU0A 4GXSB 2WOKA 2F7BA 1MH4A 1MG1A 2KLFA 2VHAA 4OFOA 2QMWA 1UQWA 1Y9UA 3RTFB 4LQ2A 3W9VA 2ONRA 4KQPA 4H1XA 5H8QB 1GGGA 5IKBA 3VV5A 5AA3A 3KN7A 1SI0A 4H8IA 2X7PA 1Z7ME 4NF4B 4I1DA 4DIGA 4EXKA 5I84A 2DYXA 3A3UA 4MFIA 3U93A 4IGTA 2O7IA 3PUYE 1ANFA 3H06B 4YKPA 2AYSA 1NFTA 3WAEA 3LSWA 4R72A 2XHDA 2UYFA 3ZKKA 1JW4A 5A5XA 3K2DA 2ANJA 1B46A 5H8HA 2DP8A 3CR9A 4QFNA 3FZVA 2G93A 1MQJA 4O3CA 2AL4A 3T66A 3KG2A 3TFLA 1D4NA 3TTNA 1MXWA 3N94A 1GR2A 2HEUA 2V3QA 3E13X 2PX1A 2DS9A 3C35A 2ZXTA 1OIBA 4G8NA 2E0SA 4G8HA 4PFYA 1DSNA 3CHGA 2RCBA 4YMBA 3F11A 2DWIA 4EF1A 4U4XA 5DVJA 3T9VA 2YPNA 4PFUA 2IEEA 5B70A 1VFDA 3UK4A 4F29A 1B3EA 4R9FA 5CMBA 3OEMA 5ICQA 1WDNA 3ZS6A 2A5TA 1A40A 2DWJA 3R6UA 3W9WA 2F6PA 1DMBA 4MBPA 3S9MC 4NF6B 3R7XA 4XIGQ 4I62A 3N26A 1VR5A 3HPIA 1YAEA 3K1MA 2HFBA 1TWYA 3GXAA 3OD7A 1LLSA 1JEVA 2DXYA 3KZGA 1QVSA 3KJTA 3CFLA 3TDJA 3EF7A 1N84A 1TXFA 2THIA 1HSEA 4XKQA 5DVIA 4KFQA 4KYSA 3VVDA 1DPPA 4ZZAA 3FXQA 1N76A 4QSCA 4Q8RA 4NF8B 4R6HA 3ECRA 4FJPA 3FXUA 3OEKA 3HV1A 3H3GA 1UTHA 3B6QA 1I69A 4NF5B 4Q0CA 2O51A 3RT8A 1ZBMA 1DPEA 3MVYA 2I3VA 2QS1A 3V5AA 3SEYA 2FNCA 3PPPA 2QL3A 2X7QA 3O6HA 3Q25A 4P11A 1MXZA 1A54A 4TOZA 3I5OA 5ICTA 3U8QA 4QF9A 3LSLA 2QS4A 2Y7IA 1M5EA 3MVZA 3VE1B 4P0IA 3BBRA 4I8CA 1POTA 3UN6A 3PD8A 2BJJX 3VLVA 3KN3A 1MS7A 5BUUA 2P1SA 4HW8A 4ZEBA 1FTKA 1NH8A 3UP9A 1MQIA 3USDA 2Q8JA 4HTGA 2Y7KA 5A5XB 4GLIA 4FEBA 4OVJA 1MM7A 4O3AA 2XX8A 4XKPA 5AA2B 1US5A 2OLBA 1MQGA 2DQVA 2HAUA 2B65A 4OETA 2XXVA 3T9XB 4P0GA 3HHGA 4ZS9A 5I2KB 1IXCA 1FQBA 3O6GA 4ISUA 3ILTB 2PVUA 4ESWA 2REGA 5CM6A 2NUVA 2XXPA 1RYOA 3TZAA 3E9XA 5H8QA 3IOTA 4EF2A 3G3IA 4RA1A 4DXUA 1B1HA 5LOMA 1LAHE 1HSJA 4X1BA 3HN0A 5CI5A 4BDLA 4NF4A 3MQ9A 1N7WA 3PAMA 4Q30B 2ZNSA 3KBRA 3RYAA 4DCYA 4C1TA 1NNKA 4U21A 3CSBA 2A5TB 1PB8A 1JEUA 4XTCQ 1M5CA 1GVCA 2VGQA 4BDRA 2F97A 4YKIA 4IY5A 3TELA 4XKNA 3LC8A 2I4CA 4R6KA 3DRIA 3MPLA 5L8DA 2I49A 4X1DA 3FJGA 1LBBA 3ONMA 2F36A 1UTBA 1FTJA 2WOPA 2O6AA 3K6UA 1B7ZA 2O69A 1R6ZA 2UYEA 3FV2A 1IITA 3CG1A 4M4GA 3MVXA 4ZEKA 3SERA 3QUJA 4FE8A 4LZ7A 4ELRA 1BKAA 4BDQA 2ONKE 4ESXA 2F8DA 2XXTA 1SW4A 4ND9A 1EZPA 3FUZA 3H6VA 3DRFA 3K0VA 1UTHB 3C33A 1Q1KA 4IO4A 4PQJA 3ODBA 3KOTA 4H8JA 5DYHA 1TFAA 1B4HA 4MLVA 3FIRA 4NF6A 2PBWA 2XXHA 3D4GA 1MH3A 3ZKLA 4RPOA 2D3IA 3TCFA 4O3BA 2P2AA 1MXUA 3VVFA 3KEIA 4H6DA 3HO7A 3TTMA 4QSEA 2Q9TA 1JQFA 3LBSA 4DDDA 1PB7A 4F1YA 1LAGE 4QFOA 3G3FA 5JK4A 5DEXA 2GRVA 5F1QA 3PMVA 3C9HA 5H8FB 1SBPA 4XKRA 1WODA 2O84X 3H7MA 4GOTA 4GD5A 5TPAB 4IO5A 4OERA 4BDMA 1YCJA 1MXVA 5FHOA 3PV0E 4F3GA 3V83A 4F19A 1XT8A 3EPEA 5K2YA 3K02A 3P7IA 3H03A 3BKIB 1P1UA 2XXUA 1SW5A 3O28A 4Q5TA 3OELA 2ESNA 4NE4A 1SW1A 2GHBA 4FEDA 2F5XA 3DP6A 1NNTA 4F1UA 1N04A 3CFXA 1OQHA 4OEVA 4HCWA 3S9LC 4FATA 2Q89A 3K1PA 3U72A 2XX9A 3OENA 3V8XB 4Z7EA 4RPNA 1DTZA 1A8EA 3SEWA 1P1OA 1JETA 3OSQA 2P0SA 4NTLA 3PPQA 3OO8A 3IO6A 1NH7A 2I0CA 1OLCA 1B0LA 4F18A 1H76A 3U92A 3QUFA 4EUOA 1GV8A 5DTBA 3HCQA 1QUIA 5AA2A 3KJ7A 4ZDMA 3S9EA 1O7TA 3VLUA 1TT1A 3MP1A 4N07A 1QKAA 1MRPA 3O97A 1URDA 5DVFA 3VVEA 1MDP1 1SD3A 3TTKA 1UTBB 3GLBA 5I2KA 1FQFA 3B6WA 2OJTA 5M2VA 1B7UA 1D9VA 1BTJA 4ZZEA 3H6UA 3FASA 1P1QA 4F2OA 5I2NB 3A3CA 3SEVA 4PFWA 3T22A 1NNFA 2Q88A 3KN8A 2GFEA 3RTWB 2HQ0A 2QMXA 2B4LA 3ZSFA 2RCAA 4L17A 3DRJA 2Y7RA 3FJMA 2AL5A 2QS2A 4IO7A 4H5GA 3T93B 3ILUB 1LBCA 2V3TA 3FXRA 3FVOA 4EDPA 3W15C 3CFZA 4MH5A 5I57B 1MXYA 3M8UA 1LGBC 4QFPA 2E1SA 5ITOA 3QYTA 4F3PA 1OLAA 3PMXA 3T96B 3K6XA 4F3SA 5DT6A 5HBCA 2R71A 3MJNA 1H44A 1NNPA 3IJOB 1IQ7A 3QAXA 4HCYA 3OOAA 1A55A 2F78A 3QSLA 1UIUA 1MY4A 2H5YA 4TLMB 5KDTA 1R9QA 4PE5B 1B5IA 2Z22A 4R2BA 5I58B 4ZEFA 3IOUA 1EU8A 5DEXB 2PYYA 3VXBA 5BWJA 1ZJLA 4GL8A 3TYHA 4NMYA 4QSDA 5HPQA 3Q28A 4OEUA 4F3BA 2ZMBA 3C32A 1ZLQA 3MPKA 3K6VA 5TP9A 3Q26A 3O66A 4DXCA 1ATGA 2H99A 4LZ5A 5ITPA 3L6HA 3EN3A 1JNFA 2VOZA 4RK9A 1NMUA 2IA4A 2R6GE 2RC8A 1JVYA 3PU5A 1QULA 3IB0A 2RINA 3IX1A 1CB6A 2V84A 3Q29A 3IL1B 3S9NC 3BFTA 3KOSA 3DLNA 2QRYA 5AE4A 1FW0A 2DVCA 2O68A 2I3WA 4LUBA 1DTGA 2AIXA 1IUDA 1I6QA 4H0WA 4JB7A 2ALUA 1I6BA 1H3DA 1OMPA 2XXRA 3V89B 4XXUA 3KSJA 1M5DA 2Z8DA 3FD3A 4YKJA 3BFUA 1KWHA 4F2QA 4R74A 5H8FA 1LCTA 4OESA 1T0KA 1Y20A 1XHYA 1SI1A 1PC3A 3K1NA 5TPAA 2Y84A 4F39A 5KCJB 3O29A 2RC9A 1HSLA 2O7UA 4OYVA 4N6PA 2H98A 4G77A 2XX7A 1Y4TA 3FATA 1D9YA 3O2AA 4DXBA 1MY1A 2DSFA 1LFGA 1ELJA 4X9TA 2XD3A 3O9PA 3FVGA 1MXXA 1Y3NA 4YMAA 2FYIA 4IO2A 2QS3A 3U94A 3OO9A 1XOCA 4G2ZA 3D4CA 4QFLA 4JSDA 4U23A 1OQGA 2REJA 4PFTA 2DE4A 4GIZA 3IR1A 2XXWA 1A7LA 3CVGA 3IO4A 4H67A 2XXYA 4GVOA 5I59B 3IOVA 1USYH 4GFRA 3C34A 1B2HA 3RQTA 4OQOA 4WXJA 4EXLA 4OHNA 1F9BA 4PP0A 2NWJA 3LVUA 3RLFE 1FQCA 4U1OA 1JW1A 4MLQA 2Q2AA 5EHSA 1ZMGA 4LATA 2B3FA 4BDOA 4RY1A 3IAZA 2QPQA 4GXAA 4DE8A 1P1WA 2CZLA 1B0HA 2I58A 3THIA 3MZ9A 3RY3A 2DXRA 3RYBA 1A8FA 2YJPA 1O63A 3OMBA 2GHAA 1AOVA 3LSXA 1LFIA 2Z23A 4JDFA 3MUQA 3HSTA 5L9OA 4MF3A 2HZLA 5I2NA 4KR5A 5KDTB 3PMWA 1B51A 2O1LA 1SDXA 3EHTA 5L9MA 4IO6A 2ABHA 1PDAA 3GBBA 5TP9B 2ZYMA 1LAXA 2NOOA 1B5JA 2W7YA 2CMOA 1SQYA 3G3KA 4LONB 3PUWE 5AA4A 2HZKA 2V3UA 1CE2A 1D3KA 5I57A 2Z8EA 3K6WA 3MZ1A 3K4UA 3KFMA 1B40A 2UVGA 4U2RA 4DLDA 4F31B 1BLFA 3FGSA 3LSFB 4POWA 1RYXA 1QUKA 4E0WA 3B6TA 3OO7A 3SETA 4GWOA 4AQ4A 1P1NA 1US4A 5ELVA 1N3WA 2Y7PA 5I58A 1AMFA 5J1DA 1S9TA 2Q2CA 3T9HB 3PPNA 1FTMA 3DRGA 3LUYA 5FHMA 2HXWA 3TTLA 4YAHX 4YICA 3K00A 1P99A 1AL3A 1EH3A 2QSXA 3CRBA 4G68B 1Y4CA 3DELB 4WKMA 3A09A 5EYFA 2B4MA 2F7AA 3QXMA 3GBAA 3KGCA 4ECFA 3E4RA 3I3VA 1IEJA 1VFEA 1M5BA 2DOJA 4U22A 2WKYA 3RPWA 1GTKA 4UACA 1B52A 4DCXA 4PETA 4JWXA 1QUJA 2XD2A 3MAMA 1Z7NE 5KCJA 3CIJA 3IK6B 1PBQA 3MW0A 3UIFA 3MBPA 5JEIA 4RK2A 1N0TA 2UVIA 4RYAA 3M3LA 2I6EA 3PGFA 2OBGA 5CBRA 3FTOA 3FVNA 5ISUA 4OZ9A 1EZOA 4LP2B 3R26A 3MWBA 1I6AA 1J1NA 1ZTYA 1URSA 4GQOA 1R1NA 4R73A 4OFJA 3VXCA 4IY6A 3JYRA 1PEBA 4KYDA 5H8SA 5CMMA 2OWSA 2YLNA 4ZE8A 1B4ZA 1DOTA 4FORA 3H6WA 3LR1A 1B58A 5H8NB 4TLLB 3UORA 3TCHA 4YU0A 1B05A 4QRZA 4OFLA 1FQAA 1XVYA 4NEDA 5I59A 1MQDA 4LVQA 2R9JA 3TUSA 5CMKA 3PUVE 5AA4B 3L6GA 4UA8A 4K3FA 2V93A 1FTOA 4KCCA 4ZE9A 1QW0A 2PT1A 3DRKA 1Y1ZA 2DWHA 1PBPA 3O6PA 3TMGA 1B3FA 2I4BA 5JTYB 5L9SA 3KSXA 3SDFA 3C4MA 4C1UA 5IAIA 2XXQA 3C31A 2ZYOA 4YB7A 1LSTA 3SEXA 4M1VA 3RGYA 3TQLA 4KI0E 1Q35A 3EQ1A 4WEDA 2VP1A 3IORA 4IO3A 5I56B 2D21A 4N13A 3DP4A 3RNNA 1WVJA 4QFKA 4ONYA 4TQUQ 1B32A 3DM0A 1B1XA 4ELQA 4IGRA 4NWCA 3VFJA 2UVHA 4X48A 4RXLA 5K2XA 1LB8A 2Z8FA 3PD9A 3I6VA 2H25A 2PT2A 3EHSA 1AH5A 1Y3QA 1IXGA 1MDQA 4QHQA 3TPAA 4E0XA 1Y1MA 1MY2A 1ZKBA 3E3KA 1LAFE 4H65A 3Q27A 5CC2A 5AA2D 2F7CA 4KCDA 1IIWA 3N6TA 1EZ9A 2OZZA 4ZEDA 1H45A 4KPTA 2I48A 1SYHA 1S50A 1ZIUA 1AIVA 4ZEIA 4OXVA 1XVXA 3MP8A 3FV1A 3OXNA 4YKKA 4JXIA 1POY1 1MY3A 2UXAA 1SVXB 4ELPA 1QKBA 1XS5A 5B7DA 4G4PA 3IB1A 3RN8A 1QJMA 3G3JA 3MC2A 3IJXB 1RKMA 2NVUB 5F7VA 1BP5A 3AXFA 2HCAA 3FVKA 4OTEA 4G68A 1O64A 4JWYA 2B3BA 3DRHA 1B5HA 4AB5A 5H8HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDF A;  1YPN A;  4LZ8 A;  3UGW A;  3N5L A;  1M5F A;  1B7H A;  2RKM A;  2F35 A;  5TU0 A;  4OWD A;  2X26 A;  1OVT A;  2A5S A;  2H4I A;  1N3X A;  2OWT A;  1SYI A;  3TTR A;  2DVZ A;  3M3F A;  4Z0I A;  1XC1 A;  4FEC A;  1MY0 A;  3UA8 A;  5KZT A;  3WAF A;  3OO6 A;  1B6H A;  1JW5 A;  3RT6 B;  2VD3 A;  4LA9 A;  4NWD A;  3H4Z A;  2ZNT A;  1N7X A;  4RJZ A;  4KYE A;  3S2V A;  1LCF A;  3HHF A;  3TCG A;  1IZ1 A;  4WEP A;  2VD2 A;  4ELO A;  2F34 A;  2NXO A;  2H9B A;  3TOD A;  3SEU A;  5AA1 A;  4EQ7 A;  5EHM A;  4EQB A;  3PPR A;  4YZZ A;  1PB9 A;  4C0R A;  1LFH A;  3TEP A;  3QIM A;  3EHU A;  4U1Z A;  1B3L A;  4F1V A;  4THI A;  4RNS A;  4GL0 A;  3RUM A;  4IB2 A;  3QK6 A;  3M3K A;  4YB6 A;  2RC7 A;  1B9J A;  3TAJ A;  2F6G A;  3VLW A;  1MQH A;  1II5 A;  3CSG A;  4H5F A;  2Y7W A;  2XXX A;  2OCU A;  3G3G A;  4DZ1 A;  1USY E;  3IOW A;  4JSO A;  5HM4 B;  1BIY A;  2UVJ A;  2WOL A;  2ONS A;  3MZB A;  2DE3 A;  1JVX A;  4R6Y A;  4R75 A;  3S4U A;  3B7D A;  3MVW A;  1MM6 A;  2LAO A;  3CI8 A;  1NKX A;  5H8N A;  3K01 A;  3C36 A;  3JV9 A;  1VE4 A;  2QJE A;  1MPC A;  4G8M A;  1FCK A;  1S7Y A;  1IXI A;  4BLA A;  2ZYK A;  3T9U A;  2HAV A;  2O1M A;  1FQD A;  4EQ9 A;  1FQE A;  2PMS A;  4U4S A;  1H43 A;  1URG A;  4F22 A;  3G3H A;  4AB6 A;  4FAJ A;  1NL5 A;  2FA7 A;  2D5W A;  1A99 A;  4JBZ A;  1YTV A;  4KD5 A;  3IB2 A;  5FHN A;  1UIV A;  1IXH A;  5CMC A;  2DWA A;  2G29 A;  3G7W A;  3PUZ E;  4POX A;  5JTY A;  1B3H A;  3O6I A;  1OVB A;  3CG3 A;  3DP8 A;  2DE2 A;  4GF8 A;  3JZJ A;  4OMB A;  1VSO A;  1TFD A;  5CBS A;  4JWO A;  2OK2 A;  5I56 A;  3H6T A;  2ZNU A;  4LQ5 A;  4FIM A;  2GH9 A;  1B3G A;  4YB5 A;  2ZYN A;  3TKD A;  1L5T A;  2I0B A;  3SES A;  3MP6 A;  3FJ7 A;  1MPD A;  3N6U A;  3GZG A;  1SW2 A;  4KHZ E;  5FTH A;  3PPO A;  5FTI A;  4NF8 A;  4ZEC A;  1Y3P A;  2V25 A;  2XXI A;  5CRY A;  4NF5 A;  1R9L A;  3PUX E;  4G68 C;  4GRK A;  4OEN A;  1MPB A;  4R9G A;  3TQW A;  1LB9 A;  2M8C A;  4HS7 A;  4BDN A;  3OSR A;  2RF1 A;  1FTL A;  3U1O A;  4I9D A;  4R2F A;  3SKP A;  1ZU0 A;  4GXS B;  2WOK A;  2F7B A;  1MH4 A;  1MG1 A;  2KLF A;  2VHA A;  4OFO A;  2QMW A;  1UQW A;  1Y9U A;  3RTF B;  4LQ2 A;  3W9V A;  2ONR A;  4KQP A;  4H1X A;  5H8Q B;  1GGG A;  5IKB A;  3VV5 A;  5AA3 A;  3KN7 A;  1SI0 A;  4H8I A;  2X7P A;  1Z7M E;  4NF4 B;  4I1D A;  4DIG A;  4EXK A;  5I84 A;  2DYX A;  3A3U A;  4MFI A;  3U93 A;  4IGT A;  2O7I A;  3PUY E;  1ANF A;  3H06 B;  4YKP A;  2AYS A;  1NFT A;  3WAE A;  3LSW A;  4R72 A;  2XHD A;  2UYF A;  3ZKK A;  1JW4 A;  5A5X A;  3K2D A;  2ANJ A;  1B46 A;  5H8H A;  2DP8 A;  3CR9 A;  4QFN A;  3FZV A;  2G93 A;  1MQJ A;  4O3C A;  2AL4 A;  3T66 A;  3KG2 A;  3TFL A;  1D4N A;  3TTN A;  1MXW A;  3N94 A;  1GR2 A;  2HEU A;  2V3Q A;  3E13 X;  2PX1 A;  2DS9 A;  3C35 A;  2ZXT A;  1OIB A;  4G8N A;  2E0S A;  4G8H A;  4PFY A;  1DSN A;  3CHG A;  2RCB A;  4YMB A;  3F11 A;  2DWI A;  4EF1 A;  4U4X A;  5DVJ A;  3T9V A;  2YPN A;  4PFU A;  2IEE A;  5B70 A;  1VFD A;  3UK4 A;  4F29 A;  1B3E A;  4R9F A;  5CMB A;  3OEM A;  5ICQ A;  1WDN A;  3ZS6 A;  2A5T A;  1A40 A;  2DWJ A;  3R6U A;  3W9W A;  2F6P A;  1DMB A;  4MBP A;  3S9M C;  4NF6 B;  3R7X A;  4XIG Q;  4I62 A;  3N26 A;  1VR5 A;  3HPI A;  1YAE A;  3K1M A;  2HFB A;  1TWY A;  3GXA A;  3OD7 A;  1LLS A;  1JEV A;  2DXY A;  3KZG A;  1QVS A;  3KJT A;  3CFL A;  3TDJ A;  3EF7 A;  1N84 A;  1TXF A;  2THI A;  1HSE A;  4XKQ A;  5DVI A;  4KFQ A;  4KYS A;  3VVD A;  1DPP A;  4ZZA A;  3FXQ A;  1N76 A;  4QSC A;  4Q8R A;  4NF8 B;  4R6H A;  3ECR A;  4FJP A;  3FXU A;  3OEK A;  3HV1 A;  3H3G A;  1UTH A;  3B6Q A;  1I69 A;  4NF5 B;  4Q0C A;  2O51 A;  3RT8 A;  1ZBM A;  1DPE A;  3MVY A;  2I3V A;  2QS1 A;  3V5A A;  3SEY A;  2FNC A;  3PPP A;  2QL3 A;  2X7Q A;  3O6H A;  3Q25 A;  4P11 A;  1MXZ A;  1A54 A;  4TOZ A;  3I5O A;  5ICT A;  3U8Q A;  4QF9 A;  3LSL A;  2QS4 A;  2Y7I A;  1M5E A;  3MVZ A;  3VE1 B;  4P0I A;  3BBR A;  4I8C A;  1POT A;  3UN6 A;  3PD8 A;  2BJJ X;  3VLV A;  3KN3 A;  1MS7 A;  5BUU A;  2P1S A;  4HW8 A;  4ZEB A;  1FTK A;  1NH8 A;  3UP9 A;  1MQI A;  3USD A;  2Q8J A;  4HTG A;  2Y7K A;  5A5X B;  4GLI A;  4FEB A;  4OVJ A;  1MM7 A;  4O3A A;  2XX8 A;  4XKP A;  5AA2 B;  1US5 A;  2OLB A;  1MQG A;  2DQV A;  2HAU A;  2B65 A;  4OET A;  2XXV A;  3T9X B;  4P0G A;  3HHG A;  4ZS9 A;  5I2K B;  1IXC A;  1FQB A;  3O6G A;  4ISU A;  3ILT B;  2PVU A;  4ESW A;  2REG A;  5CM6 A;  2NUV A;  2XXP A;  1RYO A;  3TZA A;  3E9X A;  5H8Q A;  3IOT A;  4EF2 A;  3G3I A;  4RA1 A;  4DXU A;  1B1H A;  5LOM A;  1LAH E;  1HSJ A;  4X1B A;  3HN0 A;  5CI5 A;  4BDL A;  4NF4 A;  3MQ9 A;  1N7W A;  3PAM A;  4Q30 B;  2ZNS A;  3KBR A;  3RYA A;  4DCY A;  4C1T A;  1NNK A;  4U21 A;  3CSB A;  2A5T B;  1PB8 A;  1JEU A;  4XTC Q;  1M5C A;  1GVC A;  2VGQ A;  4BDR A;  2F97 A;  4YKI A;  4IY5 A;  3TEL A;  4XKN A;  3LC8 A;  2I4C A;  4R6K A;  3DRI A;  3MPL A;  5L8D A;  2I49 A;  4X1D A;  3FJG A;  1LBB A;  3ONM A;  2F36 A;  1UTB A;  1FTJ A;  2WOP A;  2O6A A;  3K6U A;  1B7Z A;  2O69 A;  1R6Z A;  2UYE A;  3FV2 A;  1IIT A;  3CG1 A;  4M4G A;  3MVX A;  4ZEK A;  3SER A;  3QUJ A;  4FE8 A;  4LZ7 A;  4ELR A;  1BKA A;  4BDQ A;  2ONK E;  4ESX A;  2F8D A;  2XXT A;  1SW4 A;  4ND9 A;  1EZP A;  3FUZ A;  3H6V A;  3DRF A;  3K0V A;  1UTH B;  3C33 A;  1Q1K A;  4IO4 A;  4PQJ A;  3ODB A;  3KOT A;  4H8J A;  5DYH A;  1TFA A;  1B4H A;  4MLV A;  3FIR A;  4NF6 A;  2PBW A;  2XXH A;  3D4G A;  1MH3 A;  3ZKL A;  4RPO A;  2D3I A;  3TCF A;  4O3B A;  2P2A A;  1MXU A;  3VVF A;  3KEI A;  4H6D A;  3HO7 A;  3TTM A;  4QSE A;  2Q9T A;  1JQF A;  3LBS A;  4DDD A;  1PB7 A;  4F1Y A;  1LAG E;  4QFO A;  3G3F A;  5JK4 A;  5DEX A;  2GRV A;  5F1Q A;  3PMV A;  3C9H A;  5H8F B;  1SBP A;  4XKR A;  1WOD A;  2O84 X;  3H7M A;  4GOT A;  4GD5 A;  5TPA B;  4IO5 A;  4OER A;  4BDM A;  1YCJ A;  1MXV A;  5FHO A;  3PV0 E;  4F3G A;  3V83 A;  4F19 A;  1XT8 A;  3EPE A;  5K2Y A;  3K02 A;  3P7I A;  3H03 A;  3BKI B;  1P1U A;  2XXU A;  1SW5 A;  3O28 A;  4Q5T A;  3OEL A;  2ESN A;  4NE4 A;  1SW1 A;  2GHB A;  4FED A;  2F5X A;  3DP6 A;  1NNT A;  4F1U A;  1N04 A;  3CFX A;  1OQH A;  4OEV A;  4HCW A;  3S9L C;  4FAT A;  2Q89 A;  3K1P A;  3U72 A;  2XX9 A;  3OEN A;  3V8X B;  4Z7E A;  4RPN A;  1DTZ A;  1A8E A;  3SEW A;  1P1O A;  1JET A;  3OSQ A;  2P0S A;  4NTL A;  3PPQ A;  3OO8 A;  3IO6 A;  1NH7 A;  2I0C A;  1OLC A;  1B0L A;  4F18 A;  1H76 A;  3U92 A;  3QUF A;  4EUO A;  1GV8 A;  5DTB A;  3HCQ A;  1QUI A;  5AA2 A;  3KJ7 A;  4ZDM A;  3S9E A;  1O7T A;  3VLU A;  1TT1 A;  3MP1 A;  4N07 A;  1QKA A;  1MRP A;  3O97 A;  1URD A;  5DVF A;  3VVE A;  1MDP 1;  1SD3 A;  3TTK A;  1UTB B;  3GLB A;  5I2K A;  1FQF A;  3B6W A;  2OJT A;  5M2V A;  1B7U A;  1D9V A;  1BTJ A;  4ZZE A;  3H6U A;  3FAS A;  1P1Q A;  4F2O A;  5I2N B;  3A3C A;  3SEV A;  4PFW A;  3T22 A;  1NNF A;  2Q88 A;  3KN8 A;  2GFE A;  3RTW B;  2HQ0 A;  2QMX A;  2B4L A;  3ZSF A;  2RCA A;  4L17 A;  3DRJ A;  2Y7R A;  3FJM A;  2AL5 A;  2QS2 A;  4IO7 A;  4H5G A;  3T93 B;  3ILU B;  1LBC A;  2V3T A;  3FXR A;  3FVO A;  4EDP A;  3W15 C;  3CFZ A;  4MH5 A;  5I57 B;  1MXY A;  3M8U A;  1LGB C;  4QFP A;  2E1S A;  5ITO A;  3QYT A;  4F3P A;  1OLA A;  3PMX A;  3T96 B;  3K6X A;  4F3S A;  5DT6 A;  5HBC A;  2R71 A;  3MJN A;  1H44 A;  1NNP A;  3IJO B;  1IQ7 A;  3QAX A;  4HCY A;  3OOA A;  1A55 A;  2F78 A;  3QSL A;  1UIU A;  1MY4 A;  2H5Y A;  4TLM B;  5KDT A;  1R9Q A;  4PE5 B;  1B5I A;  2Z22 A;  4R2B A;  5I58 B;  4ZEF A;  3IOU A;  1EU8 A;  5DEX B;  2PYY A;  3VXB A;  5BWJ A;  1ZJL A;  4GL8 A;  3TYH A;  4NMY A;  4QSD A;  5HPQ A;  3Q28 A;  4OEU A;  4F3B A;  2ZMB A;  3C32 A;  1ZLQ A;  3MPK A;  3K6V A;  5TP9 A;  3Q26 A;  3O66 A;  4DXC A;  1ATG A;  2H99 A;  4LZ5 A;  5ITP A;  3L6H A;  3EN3 A;  1JNF A;  2VOZ A;  4RK9 A;  1NMU A;  2IA4 A;  2R6G E;  2RC8 A;  1JVY A;  3PU5 A;  1QUL A;  3IB0 A;  2RIN A;  3IX1 A;  1CB6 A;  2V84 A;  3Q29 A;  3IL1 B;  3S9N C;  3BFT A;  3KOS A;  3DLN A;  2QRY A;  5AE4 A;  1FW0 A;  2DVC A;  2O68 A;  2I3W A;  4LUB A;  1DTG A;  2AIX A;  1IUD A;  1I6Q A;  4H0W A;  4JB7 A;  2ALU A;  1I6B A;  1H3D A;  1OMP A;  2XXR A;  3V89 B;  4XXU A;  3KSJ A;  1M5D A;  2Z8D A;  3FD3 A;  4YKJ A;  3BFU A;  1KWH A;  4F2Q A;  4R74 A;  5H8F A;  1LCT A;  4OES A;  1T0K A;  1Y20 A;  1XHY A;  1SI1 A;  1PC3 A;  3K1N A;  5TPA A;  2Y84 A;  4F39 A;  5KCJ B;  3O29 A;  2RC9 A;  1HSL A;  2O7U A;  4OYV A;  4N6P A;  2H98 A;  4G77 A;  2XX7 A;  1Y4T A;  3FAT A;  1D9Y A;  3O2A A;  4DXB A;  1MY1 A;  2DSF A;  1LFG A;  1ELJ A;  4X9T A;  2XD3 A;  3O9P A;  3FVG A;  1MXX A;  1Y3N A;  4YMA A;  2FYI A;  4IO2 A;  2QS3 A;  3U94 A;  3OO9 A;  1XOC A;  4G2Z A;  3D4C A;  4QFL A;  4JSD A;  4U23 A;  1OQG A;  2REJ A;  4PFT A;  2DE4 A;  4GIZ A;  3IR1 A;  2XXW A;  1A7L A;  3CVG A;  3IO4 A;  4H67 A;  2XXY A;  4GVO A;  5I59 B;  3IOV A;  1USY H;  4GFR A;  3C34 A;  1B2H A;  3RQT A;  4OQO A;  4WXJ A;  4EXL A;  4OHN A;  1F9B A;  4PP0 A;  2NWJ A;  3LVU A;  3RLF E;  1FQC A;  4U1O A;  1JW1 A;  4MLQ A;  2Q2A A;  5EHS A;  1ZMG A;  4LAT A;  2B3F A;  4BDO A;  4RY1 A;  3IAZ A;  2QPQ A;  4GXA A;  4DE8 A;  1P1W A;  2CZL A;  1B0H A;  2I58 A;  3THI A;  3MZ9 A;  3RY3 A;  2DXR A;  3RYB A;  1A8F A;  2YJP A;  1O63 A;  3OMB A;  2GHA A;  1AOV A;  3LSX A;  1LFI A;  2Z23 A;  4JDF A;  3MUQ A;  3HST A;  5L9O A;  4MF3 A;  2HZL A;  5I2N A;  4KR5 A;  5KDT B;  3PMW A;  1B51 A;  2O1L A;  1SDX A;  3EHT A;  5L9M A;  4IO6 A;  2ABH A;  1PDA A;  3GBB A;  5TP9 B;  2ZYM A;  1LAX A;  2NOO A;  1B5J A;  2W7Y A;  2CMO A;  1SQY A;  3G3K A;  4LON B;  3PUW E;  5AA4 A;  2HZK A;  2V3U A;  1CE2 A;  1D3K A;  5I57 A;  2Z8E A;  3K6W A;  3MZ1 A;  3K4U A;  3KFM A;  1B40 A;  2UVG A;  4U2R A;  4DLD A;  4F31 B;  1BLF A;  3FGS A;  3LSF B;  4POW A;  1RYX A;  1QUK A;  4E0W A;  3B6T A;  3OO7 A;  3SET A;  4GWO A;  4AQ4 A;  1P1N A;  1US4 A;  5ELV A;  1N3W A;  2Y7P A;  5I58 A;  1AMF A;  5J1D A;  1S9T A;  2Q2C A;  3T9H B;  3PPN A;  1FTM A;  3DRG A;  3LUY A;  5FHM A;  2HXW A;  3TTL A;  4YAH X;  4YIC A;  3K00 A;  1P99 A;  1AL3 A;  1EH3 A;  2QSX A;  3CRB A;  4G68 B;  1Y4C A;  3DEL B;  4WKM A;  3A09 A;  5EYF A;  2B4M A;  2F7A A;  3QXM A;  3GBA A;  3KGC A;  4ECF A;  3E4R A;  3I3V A;  1IEJ A;  1VFE A;  1M5B A;  2DOJ A;  4U22 A;  2WKY A;  3RPW A;  1GTK A;  4UAC A;  1B52 A;  4DCX A;  4PET A;  4JWX A;  1QUJ A;  2XD2 A;  3MAM A;  1Z7N E;  5KCJ A;  3CIJ A;  3IK6 B;  1PBQ A;  3MW0 A;  3UIF A;  3MBP A;  5JEI A;  4RK2 A;  1N0T A;  2UVI A;  4RYA A;  3M3L A;  2I6E A;  3PGF A;  2OBG A;  5CBR A;  3FTO A;  3FVN A;  5ISU A;  4OZ9 A;  1EZO A;  4LP2 B;  3R26 A;  3MWB A;  1I6A A;  1J1N A;  1ZTY A;  1URS A;  4GQO A;  1R1N A;  4R73 A;  4OFJ A;  3VXC A;  4IY6 A;  3JYR A;  1PEB A;  4KYD A;  5H8S A;  5CMM A;  2OWS A;  2YLN A;  4ZE8 A;  1B4Z A;  1DOT A;  4FOR A;  3H6W A;  3LR1 A;  1B58 A;  5H8N B;  4TLL B;  3UOR A;  3TCH A;  4YU0 A;  1B05 A;  4QRZ A;  4OFL A;  1FQA A;  1XVY A;  4NED A;  5I59 A;  1MQD A;  4LVQ A;  2R9J A;  3TUS A;  5CMK A;  3PUV E;  5AA4 B;  3L6G A;  4UA8 A;  4K3F A;  2V93 A;  1FTO A;  4KCC A;  4ZE9 A;  1QW0 A;  2PT1 A;  3DRK A;  1Y1Z A;  2DWH A;  1PBP A;  3O6P A;  3TMG A;  1B3F A;  2I4B A;  5JTY B;  5L9S A;  3KSX A;  3SDF A;  3C4M A;  4C1U A;  5IAI A;  2XXQ A;  3C31 A;  2ZYO A;  4YB7 A;  1LST A;  3SEX A;  4M1V A;  3RGY A;  3TQL A;  4KI0 E;  1Q35 A;  3EQ1 A;  4WED A;  2VP1 A;  3IOR A;  4IO3 A;  5I56 B;  2D21 A;  4N13 A;  3DP4 A;  3RNN A;  1WVJ A;  4QFK A;  4ONY A;  4TQU Q;  1B32 A;  3DM0 A;  1B1X A;  4ELQ A;  4IGR A;  4NWC A;  3VFJ A;  2UVH A;  4X48 A;  4RXL A;  5K2X A;  1LB8 A;  2Z8F A;  3PD9 A;  3I6V A;  2H25 A;  2PT2 A;  3EHS A;  1AH5 A;  1Y3Q A;  1IXG A;  1MDQ A;  4QHQ A;  3TPA A;  4E0X A;  1Y1M A;  1MY2 A;  1ZKB A;  3E3K A;  1LAF E;  4H65 A;  3Q27 A;  5CC2 A;  5AA2 D;  2F7C A;  4KCD A;  1IIW A;  3N6T A;  1EZ9 A;  2OZZ A;  4ZED A;  1H45 A;  4KPT A;  2I48 A;  1SYH A;  1S50 A;  1ZIU A;  1AIV A;  4ZEI A;  4OXV A;  1XVX A;  3MP8 A;  3FV1 A;  3OXN A;  4YKK A;  4JXI A;  1POY 1;  1MY3 A;  2UXA A;  1SVX B;  4ELP A;  1QKB A;  1XS5 A;  5B7D A;  4G4P A;  3IB1 A;  3RN8 A;  1QJM A;  3G3J A;  3MC2 A;  3IJX B;  1RKM A;  2NVU B;  5F7V A;  1BP5 A;  3AXF A;  2HCA A;  3FVK A;  4OTE A;  4G68 A;  1O64 A;  4JWY A;  2B3B A;  3DRH A;  1B5H A;  4AB5 A;  5H8H B; 
#chains in the Genus database with same CATH topology
 3VDF A;  1YPN A;  4LZ8 A;  3UGW A;  3N5L A;  1M5F A;  1B7H A;  2RKM A;  2F35 A;  2KR0 A;  5TU0 A;  4OWD A;  2X26 A;  1OVT A;  2A5S A;  2H4I A;  1N3X A;  2OWT A;  1SYI A;  2DDK A;  3TTR A;  2DVZ A;  3M3F A;  4Z0I A;  1XC1 A;  4FEC A;  1MY0 A;  3UA8 A;  5KZT A;  3WAF A;  3OO6 A;  1B6H A;  1JW5 A;  3RT6 B;  4NHB A;  2VD3 A;  4LA9 A;  4NWD A;  2HXR A;  3H4Z A;  2ZNT A;  1N7X A;  4RJZ A;  4KYE A;  3S2V A;  1LCF A;  5T3J A;  4PFI A;  3HHF A;  3TCG A;  1IZ1 A;  4WEP A;  2VD2 A;  4ELO A;  2F34 A;  2NXO A;  2H9B A;  3TOD A;  3SEU A;  5AA1 A;  4EQ7 A;  5EHM A;  4EQB A;  3PPR A;  4YZZ A;  1PB9 A;  4C0R A;  1LFH A;  3TEP A;  3QIM A;  4P1L A;  3EHU A;  4U1Z A;  1B3L A;  4F1V A;  4THI A;  4RNS A;  4GL0 A;  3RUM A;  4JVC A;  4IB2 A;  3QK6 A;  3M3K A;  4YB6 A;  2RC7 A;  1B9J A;  3TAJ A;  2F6G A;  3VLW A;  4PF6 A;  1MQH A;  1II5 A;  3CSG A;  4O7M A;  1Q9D A;  4H5F A;  2Y7W A;  2XXX A;  2OCU A;  3G3G A;  2OX3 A;  4DZ1 A;  1USY E;  3IOW A;  3BIG A;  5IZ3 A;  4JSO A;  1NUX A;  5HM4 B;  4PGP A;  1BIY A;  2UVJ A;  2WOL A;  2ONS A;  3KC1 A;  3MZB A;  2DE3 A;  1JVX A;  4R6Y A;  4R75 A;  3S4U A;  3B7D A;  3MVW A;  2XWV A;  1MM6 A;  2LAO A;  1FBP A;  3CI8 A;  4I3E A;  1NKX A;  5H8N A;  3K01 A;  3C36 A;  3JV9 A;  1VE4 A;  2WX9 A;  2QJE A;  1DCU A;  1MPC A;  4G8M A;  5ET5 A;  1FCK A;  1S7Y A;  1NV1 A;  1IXI A;  4BLA A;  2ZYK A;  3T9U A;  2HAV A;  2O1M A;  1FQD A;  4EQ9 A;  1FQE A;  2PMS A;  4GX4 A;  4U4S A;  1NV2 A;  1H43 A;  1URG A;  4F22 A;  3G3H A;  4QBA A;  4AB6 A;  4GBV A;  4FAJ A;  1NL5 A;  2FA7 A;  2D5W A;  4XF5 A;  1A99 A;  4JBZ A;  1YTV A;  4KD5 A;  3IB2 A;  3FBP A;  4NF0 A;  5FHN A;  4PAI A;  1UIV A;  1IXH A;  5CMC A;  2DWA A;  2G29 A;  3G7W A;  3PUZ E;  4POX A;  5JTY A;  1B3H A;  3O6I A;  1OVB A;  3CG3 A;  2ZZW A;  3DP8 A;  2DE2 A;  4DI4 B;  4GF8 A;  3JZJ A;  4DI3 D;  4OMB A;  1VSO A;  1TFD A;  5CBS A;  4JWO A;  2OK2 A;  5I56 A;  3H6T A;  2ZNU A;  4LQ5 A;  4FIM A;  2GH9 A;  1B3G A;  4O8M A;  4YB5 A;  2ZYN A;  3TKD A;  1L5T A;  2I0B A;  3SES A;  3MP6 A;  4GWS A;  4XFE A;  4KXP A;  3FJ7 A;  1MPD A;  3N6U A;  3GZG A;  1SW2 A;  5EQ7 A;  4KHZ E;  5FTH A;  2FBP A;  3PPO A;  5FTI A;  1NV7 A;  4NF8 A;  1LBY A;  4ZEC A;  1Y3P A;  2V25 A;  4MNP A;  2XXI A;  4NF5 A;  5CRY A;  1R9L A;  3PUX E;  4G68 C;  4GRK A;  4OEN A;  1KZ8 A;  1MPB A;  4R9G A;  3TQW A;  1LB9 A;  2M8C A;  4HS7 A;  5F24 A;  4BDN A;  3OSR A;  2RF1 A;  1FTL A;  5LTC A;  3U1O A;  1FPG A;  4I9D A;  4R2F A;  3SKP A;  1FBF A;  1ZU0 A;  3MST A;  4GXS B;  2WOK A;  2F7B A;  1MH4 A;  1MG1 A;  2KLF A;  2VHA A;  4OFO A;  4MAG A;  2QMW A;  3E79 A;  1UQW A;  1Y9U A;  3RTF B;  4LQ2 A;  3W9V A;  2ONR A;  4KQP A;  1CNQ A;  4H1X A;  2XXK A;  5H8Q B;  1GGG A;  4GWX A;  5IKB A;  3VV5 A;  5AA3 A;  3KN7 A;  1SI0 A;  4H8I A;  2X7P A;  3T0J A;  1Z7M E;  4NF4 B;  4I1D A;  4DIG A;  4EXK A;  5I84 A;  2DYX A;  3A3U A;  4MFI A;  3U93 A;  4IGT A;  2O7I A;  3PUY E;  1ANF A;  3H06 B;  4YKP A;  2AYS A;  1NFT A;  3WAE A;  1IMF A;  3LSW A;  4R72 A;  2XHD A;  2UYF A;  3ZKK A;  1JW4 A;  5A5X A;  3K2D A;  2ANJ A;  1B46 A;  5H8H A;  2DP8 A;  3CR9 A;  4QFN A;  3FZV A;  1RDX A;  2G93 A;  1MQJ A;  4O3C A;  2AL4 A;  3T66 A;  3KG2 A;  3TFL A;  1D9Q A;  1D4N A;  3TTN A;  1MXW A;  1NUY A;  3N94 A;  1GR2 A;  2HEU A;  2V3Q A;  3E13 X;  2WBD A;  2PX1 A;  2ZZV A;  2DS9 A;  2P3N A;  3FXB A;  3C35 A;  2ZXT A;  1OIB A;  1QGX A;  4G8N A;  2E0S A;  4G8H A;  4PFY A;  1DSN A;  3CHG A;  2RCB A;  4YMB A;  3F11 A;  2DWI A;  2HPG A;  4EF1 A;  4U4X A;  5DVJ A;  3T9V A;  2YPN A;  1FBE A;  4PFU A;  2QVU A;  4X8R A;  2IEE A;  5B70 A;  1VFD A;  3UK4 A;  4F29 A;  1B3E A;  4R9F A;  1FPI A;  5CMB A;  1DK4 A;  2V4C A;  3OEM A;  5ICQ A;  1WDN A;  3ZS6 A;  2A5T A;  1A40 A;  2DWJ A;  3R6U A;  3W9W A;  2F6P A;  1DMB A;  4MBP A;  3S9M C;  4NF6 B;  3R7X A;  4JVD A;  3RYD A;  4PF8 A;  4XIG Q;  4I62 A;  4NAP A;  3N26 A;  1VR5 A;  1FPB A;  3HPI A;  1YAE A;  3K1M A;  2HFB A;  1YZ0 A;  4UAB A;  1TWY A;  3GXA A;  3OD7 A;  2FHY A;  4NX1 A;  1FTA A;  1LLS A;  1JEV A;  2DXY A;  3KZG A;  1QVS A;  3KJT A;  2CZI A;  3CFL A;  3TDJ A;  3EF7 A;  1FBD A;  1N84 A;  1TXF A;  2THI A;  4O94 A;  1HSE A;  4N81 A;  4XKQ A;  5DVI A;  4KFQ A;  4KYS A;  3VVD A;  1DPP A;  4ZZA A;  2XA5 A;  3FXQ A;  4G61 A;  1N76 A;  4QSC A;  4Q8R A;  4NF8 B;  4R6H A;  3ECR A;  4FJP A;  3FXU A;  3OEK A;  3HV1 A;  3H3G A;  1UTH A;  4NQ8 A;  3B6Q A;  1I69 A;  4JVI A;  4NF5 B;  1FBG A;  4Q0C A;  2O51 A;  3RT8 A;  1ZBM A;  1DPE A;  3MVY A;  2I3V A;  1IMC A;  2QS1 A;  3V5A A;  3SEY A;  3E78 A;  2FNC A;  3PPP A;  2QL3 A;  2X7Q A;  4MEV A;  3O6H A;  3Q25 A;  4P11 A;  1MXZ A;  1A54 A;  4TOZ A;  3BIH A;  3I5O A;  5ICT A;  3U8Q A;  4QF9 A;  4PBH A;  3LSL A;  2QS4 A;  2Y7I A;  1M5E A;  3MVZ A;  3VE1 B;  4P0I A;  3BBR A;  4I8C A;  1POT A;  3UN6 A;  5FBP A;  1FPE A;  3PD8 A;  2BJJ X;  1DBZ A;  3VLV A;  3KN3 A;  3NOH A;  1MS7 A;  5BUU A;  2P1S A;  5A5L A;  4HW8 A;  4ZEB A;  1FTK A;  1NH8 A;  3UP9 A;  1MQI A;  4MX6 A;  3USD A;  2Q8J A;  2WYP A;  4HTG A;  2Y7K A;  5A5X B;  4PDH A;  4GLI A;  4FEB A;  4OVJ A;  1MM7 A;  4O3A A;  2XX8 A;  4XKP A;  5AA2 B;  1US5 A;  2OLB A;  1MQG A;  2DQV A;  2HAU A;  2B65 A;  4OET A;  2XXV A;  4OVP A;  3T9X B;  4P0G A;  4FBP A;  3HHG A;  4ZS9 A;  5I2K B;  4GBW A;  1IXC A;  1FQB A;  3O6G A;  4ISU A;  3ILT B;  2PVU A;  2QVV A;  2REG A;  4ESW A;  5CM6 A;  2KQZ A;  2NUV A;  2XXP A;  1RYO A;  3TZA A;  1FBC A;  3E9X A;  5H8Q A;  3IOT A;  4H46 A;  4EF2 A;  1FPK A;  4RA1 A;  3G3I A;  3RPL A;  4DXU A;  1B1H A;  5LOM A;  1LAH E;  1HSJ A;  4X1B A;  3HN0 A;  5CI5 A;  1IMB A;  4BDL A;  4NF4 A;  3MQ9 A;  1N7W A;  3PAM A;  4Q30 B;  2ZNS A;  3KBR A;  3RYA A;  4HE1 A;  4DCY A;  4C1T A;  1LBZ A;  1NNK A;  4U21 A;  3CSB A;  5ET8 A;  2A5T B;  1PB8 A;  1JEU A;  4XTC Q;  1M5C A;  1GVC A;  2VGQ A;  2Q8M A;  4BDR A;  2F97 A;  4YKI A;  4N15 A;  4IY5 A;  3TEL A;  4XKN A;  3LC8 A;  4OVS A;  2I4C A;  4R6K A;  3DRI A;  3MPL A;  5L8D A;  2I49 A;  4I3Y A;  4X1D A;  2CEY A;  3FJG A;  1LBB A;  3ONM A;  2F36 A;  5I7I A;  1UTB A;  1FTJ A;  2WEF A;  2WOP A;  2O6A A;  3K6U A;  2Y5K A;  1B7Z A;  2O69 A;  1R6Z A;  2UYE A;  3FV2 A;  4OAN A;  1IIT A;  3CG1 A;  4M4G A;  2QFL A;  3ISP A;  3MVX A;  4ZEK A;  3SER A;  3QUJ A;  4FE8 A;  4LZ7 A;  4ELR A;  2P3V A;  1BKA A;  4BDQ A;  2ONK E;  4ESX A;  4GWU A;  2F8D A;  2XXT A;  1SW4 A;  4ND9 A;  1EZP A;  3FUZ A;  3H6V A;  3DRF A;  3K0V A;  2MKZ A;  1UTH B;  3C33 A;  1Q1K A;  4IO4 A;  4PQJ A;  3ODB A;  2WBB A;  3KOT A;  4H8J A;  5DYH A;  2CZK A;  1NUZ A;  1TFA A;  4PDD A;  2HHM A;  1B4H A;  4MLV A;  3FIR A;  4O7I A;  4NF6 A;  2PBW A;  2XXH A;  3D4G A;  1MH3 A;  3ZKL A;  5EQ8 A;  4RPO A;  2D3I A;  4PE3 A;  5I3S A;  3TCF A;  4OA4 A;  4PCD A;  4O3B A;  2P2A A;  1MXU A;  3VVF A;  3KEI A;  4H6D A;  4IR8 A;  3HO7 A;  3TTM A;  4QSE A;  2Q9T A;  1JQF A;  3LBS A;  4DDD A;  1PB7 A;  5IGA A;  4F1Y A;  1LAG E;  4QFO A;  3G3F A;  5JK4 A;  5DEX A;  2GRV A;  5F1Q A;  3PMV A;  3C9H A;  5H8F B;  1SBP A;  4XKR A;  1WOD A;  2O84 X;  3H7M A;  4GOT A;  4GD5 A;  5TPA B;  4IO5 A;  4OER A;  4BDM A;  1YCJ A;  1MXV A;  5FHO A;  3PV0 E;  4F3G A;  3V83 A;  5EYG A;  4F19 A;  1XT8 A;  3EPE A;  5K2Y A;  3K02 A;  3P7I A;  3H03 A;  3BKI B;  1P1U A;  2XXU A;  1SW5 A;  3O28 A;  4Q5T A;  3OEL A;  2ESN A;  4NE4 A;  1K9Y A;  1SW1 A;  2GHB A;  1FJ6 A;  4FED A;  2F5X A;  3DP6 A;  1NNT A;  4F1U A;  3A29 A;  1N04 A;  3CFX A;  1OQH A;  4OEV A;  4HCW A;  4PBQ A;  3S9L C;  4FAT A;  2Q89 A;  3K1P A;  4MIJ A;  3U72 A;  2XX9 A;  3OEN A;  3V8X B;  3RPL B;  4Z7E A;  4RPN A;  1DTZ A;  1A8E A;  3SEW A;  1P1O A;  3MYU A;  3D1R A;  1JET A;  4PFB A;  3OSQ A;  4LN5 A;  2P0S A;  4GX3 A;  4NTL A;  3PPQ A;  3OO8 A;  3IO6 A;  4P3L A;  4PAK A;  1NH7 A;  2I0C A;  1OLC A;  1B0L A;  4F18 A;  1H76 A;  3U92 A;  3QUF A;  1LBW A;  4EUO A;  1GV8 A;  5DTB A;  1FPL A;  3HCQ A;  1QUI A;  5AA2 A;  3KJ7 A;  4ZDM A;  3S9E A;  1O7T A;  3VLU A;  1TT1 A;  4P8B A;  3MP1 A;  2ZZX A;  4N07 A;  1QKA A;  1MRP A;  1NV3 A;  1G0I A;  3O97 A;  1URD A;  4PAF A;  1VDW A;  5DVF A;  3VVE A;  1MDP 1;  1SD3 A;  3TTK A;  2BJI A;  1UTB B;  3GLB A;  5EQA A;  5I2K A;  1FQF A;  4P9K A;  3B6W A;  2OJT A;  5M2V A;  1B7U A;  1D9V A;  1BTJ A;  4ZZE A;  2PFZ A;  3H6U A;  3PTY A;  3FAS A;  1P1Q A;  5IZ1 A;  4F2O A;  5I2N B;  3A3C A;  3SEV A;  4PFW A;  1EYJ A;  3T22 A;  1NNF A;  2Q88 A;  3KN8 A;  1IMD A;  2GFE A;  3RTW B;  2OWZ A;  2HQ0 A;  2QMX A;  2B4L A;  3ZSF A;  2RCA A;  2L5V A;  4L17 A;  5IZZ A;  4N8Y A;  3DRJ A;  2Y7R A;  3FJM A;  2AL5 A;  2QS2 A;  4IO7 A;  5ET7 A;  4H5G A;  3T93 B;  3ILU B;  1LBC A;  2V3T A;  3FXR A;  3FVO A;  4EDP A;  3W15 C;  3CFZ A;  4MH5 A;  5I57 B;  1MXY A;  3M8U A;  1LGB C;  4QFP A;  2E1S A;  5ITO A;  3QYT A;  4F3P A;  1OLA A;  3PMX A;  3T96 B;  3K6X A;  4F3S A;  5DT6 A;  1LEV A;  5HBC A;  2R71 A;  3MJN A;  1H44 A;  1NNP A;  3IJO B;  1IQ7 A;  3QAX A;  4HCY A;  4NN3 A;  3OOA A;  1A55 A;  3QSL A;  2F78 A;  2XWO A;  1UIU A;  1MY4 A;  1AWB A;  3T1B A;  2H5Y A;  4TLM B;  2XWI A;  5KDT A;  1R9Q A;  4PE5 B;  1B5I A;  2Z22 A;  4R2B A;  1NV0 A;  4ZEF A;  2VPN A;  3IOU A;  5I58 B;  1INP A;  1EU8 A;  5DEX B;  2PYY A;  3VXB A;  5BWJ A;  1ZJL A;  4GL8 A;  2WYK A;  3TYH A;  4NMY A;  4QSD A;  4AS5 A;  5HPQ A;  3Q28 A;  4OEU A;  1KA0 A;  4F3B A;  2ZMB A;  3C32 A;  1ZLQ A;  3MPK A;  3K6V A;  5TP9 A;  3Q26 A;  3O66 A;  4DXC A;  1ATG A;  2H99 A;  4LZ5 A;  5ITP A;  3L6H A;  3EN3 A;  1JNF A;  2VOZ A;  4RK9 A;  1NMU A;  2IA4 A;  2R6G E;  2RC8 A;  1JVY A;  3PU5 A;  1QUL A;  3IB0 A;  3IFA A;  2RIN A;  3IX1 A;  1CB6 A;  2V84 A;  3Q29 A;  4GWY A;  3IL1 B;  3S9N C;  3BFT A;  3KOS A;  3DLN A;  2QRY A;  5AE4 A;  1FW0 A;  2DVC A;  2O68 A;  2I3W A;  4LUB A;  1DTG A;  2FIE A;  1RDY A;  2AIX A;  2JJK A;  1IUD A;  1EYK A;  1I6Q A;  1BK4 A;  4H0W A;  4JB7 A;  2ALU A;  1I6B A;  1H3D A;  1OMP A;  2XXR A;  3V89 B;  4XXU A;  3KSJ A;  1M5D A;  2Z8D A;  3FD3 A;  4YKJ A;  1YXI A;  1RDZ A;  3BFU A;  1KWH A;  4F2Q A;  4R74 A;  2VT5 A;  5H8F A;  1LCT A;  4OES A;  1T0K A;  1Y20 A;  1XHY A;  1SI1 A;  2PFY A;  1PC3 A;  2FIX A;  3U65 A;  3K1N A;  5TPA A;  2GQ1 A;  2Y84 A;  4F39 A;  5KCJ B;  3O29 A;  2RC9 A;  1HSL A;  2O7U A;  4OYV A;  4N6P A;  2H98 A;  4G77 A;  2XX7 A;  1Y4T A;  3FAT A;  4N4U A;  4X04 A;  1D9Y A;  3O2A A;  4DXB A;  1MY1 A;  2DSF A;  4OVT A;  1LFG A;  1ELJ A;  4X9T A;  2XD3 A;  3O9P A;  1NV4 A;  3FVG A;  1MXX A;  1Y3N A;  4YMA A;  2FYI A;  4IO2 A;  2QS3 A;  3U94 A;  2VPO A;  3OO9 A;  1XOC A;  4G2Z A;  3D4C A;  4QFL A;  4JSD A;  4QXD A;  4U23 A;  1OQG A;  2REJ A;  4PFT A;  2DE4 A;  4GIZ A;  2R8T A;  3IR1 A;  2XXW A;  1A7L A;  3CVG A;  3IO4 A;  4H67 A;  1K9Z A;  2XXY A;  4GVO A;  5I59 B;  3IOV A;  1USY H;  4GFR A;  3C34 A;  1B2H A;  3RQT A;  4OQO A;  4WXJ A;  4EXL A;  4OHN A;  4PFR A;  1F9B A;  4PP0 A;  2NWJ A;  3LVU A;  3RLF E;  1FQC A;  4U1O A;  1JW1 A;  4MLQ A;  2Q2A A;  2QVR A;  5EHS A;  1ZMG A;  1NUW A;  4LAT A;  2B3F A;  3B50 A;  4PTK A;  4BDO A;  4RY1 A;  3IAZ A;  2QPQ A;  5DW8 A;  4GXA A;  4DE8 A;  1P1W A;  2CZL A;  1B0H A;  2I58 A;  3THI A;  3MZ9 A;  3RY3 A;  2DXR A;  3RYB A;  1A8F A;  2YJP A;  1O63 A;  2F3B A;  3OMB A;  2GHA A;  4MHF A;  1AOV A;  3LSX A;  1LFI A;  2Z23 A;  4JDF A;  3MUQ A;  3HST A;  5L9O A;  4N91 A;  4MF3 A;  4P47 A;  2HZL A;  5I2N A;  4KR5 A;  5KDT B;  5EQ9 A;  3PMW A;  1B51 A;  2O1L A;  1SDX A;  3EHT A;  5L9M A;  4IO6 A;  4NG7 A;  3EKI A;  5ESY A;  1NV6 A;  2ABH A;  1PDA A;  4PGN A;  3GBB A;  4OVR A;  5TP9 B;  2ZYM A;  1LAX A;  2NOO A;  2Q74 A;  1B5J A;  2W7Y A;  2CMO A;  1SQY A;  3G3K A;  4LON B;  3PUW E;  5AA4 A;  2HZK A;  5LDZ A;  2V3U A;  1CE2 A;  1D3K A;  5I57 A;  2Z8E A;  3K6W A;  3MZ1 A;  3K4U A;  3KFM A;  1B40 A;  2UVG A;  4U2R A;  4HE0 A;  4DLD A;  4F31 B;  4HE2 A;  1BLF A;  3FGS A;  3LSF B;  4POW A;  5EYH A;  1RYX A;  1QUK A;  4E0W A;  3B6T A;  3OO7 A;  2CZH A;  3SET A;  3ROJ A;  4GWO A;  4AQ4 A;  1P1N A;  4N6D A;  1US4 A;  4PC9 A;  5ELV A;  1LBV A;  1N3W A;  2Y7P A;  3GYY A;  5I58 A;  1AMF A;  1FSA A;  2FVZ A;  5IM2 A;  5J1D A;  1S9T A;  2Q2C A;  3QMF A;  3T9H B;  3PPN A;  1FTM A;  3DRG A;  3LUY A;  5FHM A;  2HXW A;  3TTL A;  4NGU A;  4YAH X;  4YIC A;  4GWZ A;  3K00 A;  1P99 A;  1AL3 A;  3B8B A;  1EH3 A;  2QSX A;  2PCR A;  3CRB A;  4G68 B;  1Y4C A;  3DEL B;  4MMP A;  4WKM A;  3A09 A;  5EYF A;  2B4M A;  2F7A A;  3SZP A;  3QXM A;  3GBA A;  1JP4 A;  3KGC A;  3LV0 A;  4ECF A;  3E4R A;  3I3V A;  1IEJ A;  1VFE A;  1M5B A;  1EYI A;  2DOJ A;  4U22 A;  2WKY A;  3RPW A;  1GTK A;  4UAC A;  1B52 A;  4DCX A;  4PET A;  1FPJ A;  4JWX A;  1QUJ A;  2XD2 A;  4I40 A;  3MAM A;  1IMA A;  1Z7N E;  5KCJ A;  4N17 A;  3CIJ A;  3IK6 B;  1PBQ A;  3MW0 A;  3UIF A;  2CEX A;  3MBP A;  5JEI A;  4RK2 A;  1N0T A;  2UVI A;  4RYA A;  3M3L A;  2I6E A;  4HXV A;  3PGF A;  2OBG A;  5CBR A;  3FTO A;  3FVN A;  5ISU A;  3HFU A;  4OZ9 A;  1EZO A;  4LP2 B;  3R26 A;  3MWB A;  1I6A A;  3IFC A;  1J1N A;  1ZTY A;  1URS A;  4GQO A;  1R1N A;  4R73 A;  5J16 A;  4OFJ A;  3VXC A;  4IY6 A;  3JYR A;  1PEB A;  5IZ3 B;  1NI9 A;  4MJO A;  4KYD A;  5H8S A;  5CMM A;  2OWS A;  2YLN A;  4ZE8 A;  1B4Z A;  1DOT A;  4FOR A;  3H6W A;  3LR1 A;  1B58 A;  5H8N B;  4TLL B;  3UOR A;  3TCH A;  4YU0 A;  1B05 A;  4QRZ A;  4OFL A;  4NED A;  1FQA A;  1G0H A;  1XVY A;  5I59 A;  1MQD A;  1SPI A;  4LVQ A;  2R9J A;  3TUS A;  1FPD A;  1NV5 A;  5CMK A;  3PUV E;  5AA4 B;  4P56 A;  3L6G A;  4UA8 A;  4K3F A;  2V93 A;  1FTO A;  1FRP A;  4MNI A;  4KCC A;  4ZE9 A;  1QW0 A;  4H45 A;  1YYZ A;  5I5P A;  2PT1 A;  3DRK A;  1Y1Z A;  1LBX A;  2DWH A;  1PBP A;  3O6P A;  4N8G A;  3TMG A;  1B3F A;  2I4B A;  5JTY B;  5L9S A;  3KSX A;  1FBH A;  5ET6 A;  3SDF A;  3C4M A;  4C1U A;  5IAI A;  2XXQ A;  3C31 A;  2ZYO A;  1IME A;  4YB7 A;  1LST A;  3SEX A;  1FPF A;  4M1V A;  4XEQ A;  3RGY A;  3TQL A;  4KI0 E;  1Q35 A;  3EQ1 A;  2F3D A;  4WED A;  2VP1 A;  3IOR A;  4IO3 A;  3KBZ A;  5I56 B;  2D21 A;  4N13 A;  3DP4 A;  3RNN A;  1WVJ A;  4QFK A;  4MCO A;  4ONY A;  4TQU Q;  1B32 A;  3DM0 A;  1B1X A;  4ELQ A;  4P1E A;  4IGR A;  4NWC A;  3VFJ A;  2UVH A;  4X48 A;  4RXL A;  5K2X A;  1LB8 A;  2Z8F A;  3PD9 A;  3I6V A;  2H25 A;  2PT2 A;  1XI6 A;  3EHS A;  1AH5 A;  1Y3Q A;  1IXG A;  2Y5L A;  1MDQ A;  4QHQ A;  3TPA A;  4E0X A;  2XWK A;  1Y1M A;  1MY2 A;  1ZKB A;  3E3K A;  1LAF E;  4H65 A;  4MNC A;  3Q27 A;  5CC2 A;  5AA2 D;  2F7C A;  4KCD A;  1IIW A;  3N6T A;  1EZ9 A;  4OVQ A;  2OZZ A;  3KC0 A;  4ZED A;  1H45 A;  4KPT A;  2I48 A;  1SYH A;  1S50 A;  1ZIU A;  1AIV A;  4ZEI A;  3LUZ A;  4OXV A;  1XVX A;  3MP8 A;  3FV1 A;  1KA1 A;  3OXN A;  4GX6 A;  4YKK A;  4JXI A;  1POY 1;  1MY3 A;  2UXA A;  1SVX B;  4ELP A;  1QKB A;  1XS5 A;  4N6K A;  5B7D A;  4G4P A;  3IB1 A;  3RN8 A;  1QJM A;  3G3J A;  3MC2 A;  3IJX B;  1RKM A;  2NVU B;  5F7V A;  1BP5 A;  3AXF A;  4GWW A;  1FJ9 A;  2HCA A;  3FVK A;  4OTE A;  4G68 A;  1O64 A;  4JWY A;  4AS4 A;  2B3B A;  3DRH A;  1B5H A;  4AB5 A;  5H8H B; 
#chains in the Genus database with same CATH homology
 3VDF A;  1YPN A;  4LZ8 A;  3UGW A;  3N5L A;  1M5F A;  1B7H A;  2RKM A;  2F35 A;  5TU0 A;  4OWD A;  2X26 A;  1OVT A;  2A5S A;  2H4I A;  1N3X A;  2OWT A;  1SYI A;  3TTR A;  2DVZ A;  3M3F A;  4Z0I A;  1XC1 A;  4FEC A;  1MY0 A;  3UA8 A;  5KZT A;  3WAF A;  3OO6 A;  1B6H A;  1JW5 A;  3RT6 B;  2VD3 A;  4LA9 A;  4NWD A;  3H4Z A;  2ZNT A;  1N7X A;  4RJZ A;  4KYE A;  3S2V A;  1LCF A;  3HHF A;  3TCG A;  1IZ1 A;  4WEP A;  2VD2 A;  4ELO A;  2F34 A;  2NXO A;  2H9B A;  3TOD A;  3SEU A;  5AA1 A;  4EQ7 A;  5EHM A;  4EQB A;  3PPR A;  4YZZ A;  1PB9 A;  4C0R A;  1LFH A;  3TEP A;  3QIM A;  3EHU A;  4U1Z A;  1B3L A;  4F1V A;  4THI A;  4RNS A;  4GL0 A;  3RUM A;  4IB2 A;  3QK6 A;  3M3K A;  4YB6 A;  2RC7 A;  1B9J A;  3TAJ A;  2F6G A;  3VLW A;  1MQH A;  1II5 A;  3CSG A;  4H5F A;  2Y7W A;  2XXX A;  2OCU A;  3G3G A;  4DZ1 A;  1USY E;  3IOW A;  4JSO A;  5HM4 B;  1BIY A;  2UVJ A;  2WOL A;  2ONS A;  3MZB A;  2DE3 A;  1JVX A;  4R6Y A;  4R75 A;  3S4U A;  3B7D A;  3MVW A;  1MM6 A;  2LAO A;  3CI8 A;  1NKX A;  5H8N A;  3K01 A;  3C36 A;  3JV9 A;  1VE4 A;  2QJE A;  1MPC A;  4G8M A;  1FCK A;  1S7Y A;  1IXI A;  4BLA A;  2ZYK A;  3T9U A;  2HAV A;  2O1M A;  1FQD A;  4EQ9 A;  1FQE A;  2PMS A;  4U4S A;  1H43 A;  1URG A;  4F22 A;  3G3H A;  4AB6 A;  4FAJ A;  1NL5 A;  2FA7 A;  2D5W A;  1A99 A;  4JBZ A;  1YTV A;  4KD5 A;  3IB2 A;  5FHN A;  1UIV A;  1IXH A;  5CMC A;  2DWA A;  2G29 A;  3G7W A;  3PUZ E;  4POX A;  5JTY A;  1B3H A;  3O6I A;  1OVB A;  3CG3 A;  3DP8 A;  2DE2 A;  4GF8 A;  3JZJ A;  4OMB A;  1VSO A;  1TFD A;  5CBS A;  4JWO A;  2OK2 A;  5I56 A;  3H6T A;  2ZNU A;  4LQ5 A;  4FIM A;  2GH9 A;  1B3G A;  4YB5 A;  2ZYN A;  3TKD A;  1L5T A;  2I0B A;  3SES A;  3MP6 A;  3FJ7 A;  1MPD A;  3N6U A;  3GZG A;  1SW2 A;  4KHZ E;  5FTH A;  3PPO A;  5FTI A;  4NF8 A;  4ZEC A;  1Y3P A;  2V25 A;  2XXI A;  5CRY A;  4NF5 A;  1R9L A;  3PUX E;  4G68 C;  4GRK A;  4OEN A;  1MPB A;  4R9G A;  3TQW A;  1LB9 A;  2M8C A;  4HS7 A;  4BDN A;  3OSR A;  2RF1 A;  1FTL A;  3U1O A;  4I9D A;  4R2F A;  3SKP A;  1ZU0 A;  4GXS B;  2WOK A;  2F7B A;  1MH4 A;  1MG1 A;  2KLF A;  2VHA A;  4OFO A;  2QMW A;  1UQW A;  1Y9U A;  3RTF B;  4LQ2 A;  3W9V A;  2ONR A;  4KQP A;  4H1X A;  5H8Q B;  1GGG A;  5IKB A;  3VV5 A;  5AA3 A;  3KN7 A;  1SI0 A;  4H8I A;  2X7P A;  1Z7M E;  4NF4 B;  4I1D A;  4DIG A;  4EXK A;  5I84 A;  2DYX A;  3A3U A;  4MFI A;  3U93 A;  4IGT A;  2O7I A;  3PUY E;  1ANF A;  3H06 B;  4YKP A;  2AYS A;  1NFT A;  3WAE A;  3LSW A;  4R72 A;  2XHD A;  2UYF A;  3ZKK A;  1JW4 A;  5A5X A;  3K2D A;  2ANJ A;  1B46 A;  5H8H A;  2DP8 A;  3CR9 A;  4QFN A;  3FZV A;  2G93 A;  1MQJ A;  4O3C A;  2AL4 A;  3T66 A;  3KG2 A;  3TFL A;  1D4N A;  3TTN A;  1MXW A;  3N94 A;  1GR2 A;  2HEU A;  2V3Q A;  3E13 X;  2PX1 A;  2DS9 A;  3C35 A;  2ZXT A;  1OIB A;  4G8N A;  2E0S A;  4G8H A;  4PFY A;  1DSN A;  3CHG A;  2RCB A;  4YMB A;  3F11 A;  2DWI A;  4EF1 A;  4U4X A;  5DVJ A;  3T9V A;  2YPN A;  4PFU A;  2IEE A;  5B70 A;  1VFD A;  3UK4 A;  4F29 A;  1B3E A;  4R9F A;  5CMB A;  3OEM A;  5ICQ A;  1WDN A;  3ZS6 A;  2A5T A;  1A40 A;  2DWJ A;  3R6U A;  3W9W A;  2F6P A;  1DMB A;  4MBP A;  3S9M C;  4NF6 B;  3R7X A;  4XIG Q;  4I62 A;  3N26 A;  1VR5 A;  3HPI A;  1YAE A;  3K1M A;  2HFB A;  1TWY A;  3GXA A;  3OD7 A;  1LLS A;  1JEV A;  2DXY A;  3KZG A;  1QVS A;  3KJT A;  3CFL A;  3TDJ A;  3EF7 A;  1N84 A;  1TXF A;  2THI A;  1HSE A;  4XKQ A;  5DVI A;  4KFQ A;  4KYS A;  3VVD A;  1DPP A;  4ZZA A;  3FXQ A;  1N76 A;  4QSC A;  4Q8R A;  4NF8 B;  4R6H A;  3ECR A;  4FJP A;  3FXU A;  3OEK A;  3HV1 A;  3H3G A;  1UTH A;  3B6Q A;  1I69 A;  4NF5 B;  4Q0C A;  2O51 A;  3RT8 A;  1ZBM A;  1DPE A;  3MVY A;  2I3V A;  2QS1 A;  3V5A A;  3SEY A;  2FNC A;  3PPP A;  2QL3 A;  2X7Q A;  3O6H A;  3Q25 A;  4P11 A;  1MXZ A;  1A54 A;  4TOZ A;  3I5O A;  5ICT A;  3U8Q A;  4QF9 A;  3LSL A;  2QS4 A;  2Y7I A;  1M5E A;  3MVZ A;  3VE1 B;  4P0I A;  3BBR A;  4I8C A;  1POT A;  3UN6 A;  3PD8 A;  2BJJ X;  3VLV A;  3KN3 A;  1MS7 A;  5BUU A;  2P1S A;  4HW8 A;  4ZEB A;  1FTK A;  1NH8 A;  3UP9 A;  1MQI A;  3USD A;  2Q8J A;  4HTG A;  2Y7K A;  5A5X B;  4GLI A;  4FEB A;  4OVJ A;  1MM7 A;  4O3A A;  2XX8 A;  4XKP A;  5AA2 B;  1US5 A;  2OLB A;  1MQG A;  2DQV A;  2HAU A;  2B65 A;  4OET A;  2XXV A;  3T9X B;  4P0G A;  3HHG A;  4ZS9 A;  5I2K B;  1IXC A;  1FQB A;  3O6G A;  4ISU A;  3ILT B;  2PVU A;  4ESW A;  2REG A;  5CM6 A;  2NUV A;  2XXP A;  1RYO A;  3TZA A;  3E9X A;  5H8Q A;  3IOT A;  4EF2 A;  3G3I A;  4RA1 A;  4DXU A;  1B1H A;  5LOM A;  1LAH E;  1HSJ A;  4X1B A;  3HN0 A;  5CI5 A;  4BDL A;  4NF4 A;  3MQ9 A;  1N7W A;  3PAM A;  4Q30 B;  2ZNS A;  3KBR A;  3RYA A;  4DCY A;  4C1T A;  1NNK A;  4U21 A;  3CSB A;  2A5T B;  1PB8 A;  1JEU A;  4XTC Q;  1M5C A;  1GVC A;  2VGQ A;  4BDR A;  2F97 A;  4YKI A;  4IY5 A;  3TEL A;  4XKN A;  3LC8 A;  2I4C A;  4R6K A;  3DRI A;  3MPL A;  5L8D A;  2I49 A;  4X1D A;  3FJG A;  1LBB A;  3ONM A;  2F36 A;  1UTB A;  1FTJ A;  2WOP A;  2O6A A;  3K6U A;  1B7Z A;  2O69 A;  1R6Z A;  2UYE A;  3FV2 A;  1IIT A;  3CG1 A;  4M4G A;  3MVX A;  4ZEK A;  3SER A;  3QUJ A;  4FE8 A;  4LZ7 A;  4ELR A;  1BKA A;  4BDQ A;  2ONK E;  4ESX A;  2F8D A;  2XXT A;  1SW4 A;  4ND9 A;  1EZP A;  3FUZ A;  3H6V A;  3DRF A;  3K0V A;  1UTH B;  3C33 A;  1Q1K A;  4IO4 A;  4PQJ A;  3ODB A;  3KOT A;  4H8J A;  5DYH A;  1TFA A;  1B4H A;  4MLV A;  3FIR A;  4NF6 A;  2PBW A;  2XXH A;  3D4G A;  1MH3 A;  3ZKL A;  4RPO A;  2D3I A;  3TCF A;  4O3B A;  2P2A A;  1MXU A;  3VVF A;  3KEI A;  4H6D A;  3HO7 A;  3TTM A;  4QSE A;  2Q9T A;  1JQF A;  3LBS A;  4DDD A;  1PB7 A;  4F1Y A;  1LAG E;  4QFO A;  3G3F A;  5JK4 A;  5DEX A;  2GRV A;  5F1Q A;  3PMV A;  3C9H A;  5H8F B;  1SBP A;  4XKR A;  1WOD A;  2O84 X;  3H7M A;  4GOT A;  4GD5 A;  5TPA B;  4IO5 A;  4OER A;  4BDM A;  1YCJ A;  1MXV A;  5FHO A;  3PV0 E;  4F3G A;  3V83 A;  4F19 A;  1XT8 A;  3EPE A;  5K2Y A;  3K02 A;  3P7I A;  3H03 A;  3BKI B;  1P1U A;  2XXU A;  1SW5 A;  3O28 A;  4Q5T A;  3OEL A;  2ESN A;  4NE4 A;  1SW1 A;  2GHB A;  4FED A;  2F5X A;  3DP6 A;  1NNT A;  4F1U A;  1N04 A;  3CFX A;  1OQH A;  4OEV A;  4HCW A;  3S9L C;  4FAT A;  2Q89 A;  3K1P A;  3U72 A;  2XX9 A;  3OEN A;  3V8X B;  4Z7E A;  4RPN A;  1DTZ A;  1A8E A;  3SEW A;  1P1O A;  1JET A;  3OSQ A;  2P0S A;  4NTL A;  3PPQ A;  3OO8 A;  3IO6 A;  1NH7 A;  2I0C A;  1OLC A;  1B0L A;  4F18 A;  1H76 A;  3U92 A;  3QUF A;  4EUO A;  1GV8 A;  5DTB A;  3HCQ A;  1QUI A;  5AA2 A;  3KJ7 A;  4ZDM A;  3S9E A;  1O7T A;  3VLU A;  1TT1 A;  3MP1 A;  4N07 A;  1QKA A;  1MRP A;  3O97 A;  1URD A;  5DVF A;  3VVE A;  1MDP 1;  1SD3 A;  3TTK A;  1UTB B;  3GLB A;  5I2K A;  1FQF A;  3B6W A;  2OJT A;  5M2V A;  1B7U A;  1D9V A;  1BTJ A;  4ZZE A;  3H6U A;  3FAS A;  1P1Q A;  4F2O A;  5I2N B;  3A3C A;  3SEV A;  4PFW A;  3T22 A;  1NNF A;  2Q88 A;  3KN8 A;  2GFE A;  3RTW B;  2HQ0 A;  2QMX A;  2B4L A;  3ZSF A;  2RCA A;  4L17 A;  3DRJ A;  2Y7R A;  3FJM A;  2AL5 A;  2QS2 A;  4IO7 A;  4H5G A;  3T93 B;  3ILU B;  1LBC A;  2V3T A;  3FXR A;  3FVO A;  4EDP A;  3W15 C;  3CFZ A;  4MH5 A;  5I57 B;  1MXY A;  3M8U A;  1LGB C;  4QFP A;  2E1S A;  5ITO A;  3QYT A;  4F3P A;  1OLA A;  3PMX A;  3T96 B;  3K6X A;  4F3S A;  5DT6 A;  5HBC A;  2R71 A;  3MJN A;  1H44 A;  1NNP A;  3IJO B;  1IQ7 A;  3QAX A;  4HCY A;  3OOA A;  1A55 A;  2F78 A;  3QSL A;  1UIU A;  1MY4 A;  2H5Y A;  4TLM B;  5KDT A;  1R9Q A;  4PE5 B;  1B5I A;  2Z22 A;  4R2B A;  5I58 B;  4ZEF A;  3IOU A;  1EU8 A;  5DEX B;  2PYY A;  3VXB A;  5BWJ A;  1ZJL A;  4GL8 A;  3TYH A;  4NMY A;  4QSD A;  5HPQ A;  3Q28 A;  4OEU A;  4F3B A;  2ZMB A;  3C32 A;  1ZLQ A;  3MPK A;  3K6V A;  5TP9 A;  3Q26 A;  3O66 A;  4DXC A;  1ATG A;  2H99 A;  4LZ5 A;  5ITP A;  3L6H A;  3EN3 A;  1JNF A;  2VOZ A;  4RK9 A;  1NMU A;  2IA4 A;  2R6G E;  2RC8 A;  1JVY A;  3PU5 A;  1QUL A;  3IB0 A;  2RIN A;  3IX1 A;  1CB6 A;  2V84 A;  3Q29 A;  3IL1 B;  3S9N C;  3BFT A;  3KOS A;  3DLN A;  2QRY A;  5AE4 A;  1FW0 A;  2DVC A;  2O68 A;  2I3W A;  4LUB A;  1DTG A;  2AIX A;  1IUD A;  1I6Q A;  4H0W A;  4JB7 A;  2ALU A;  1I6B A;  1H3D A;  1OMP A;  2XXR A;  3V89 B;  4XXU A;  3KSJ A;  1M5D A;  2Z8D A;  3FD3 A;  4YKJ A;  3BFU A;  1KWH A;  4F2Q A;  4R74 A;  5H8F A;  1LCT A;  4OES A;  1T0K A;  1Y20 A;  1XHY A;  1SI1 A;  1PC3 A;  3K1N A;  5TPA A;  2Y84 A;  4F39 A;  5KCJ B;  3O29 A;  2RC9 A;  1HSL A;  2O7U A;  4OYV A;  4N6P A;  2H98 A;  4G77 A;  2XX7 A;  1Y4T A;  3FAT A;  1D9Y A;  3O2A A;  4DXB A;  1MY1 A;  2DSF A;  1LFG A;  1ELJ A;  4X9T A;  2XD3 A;  3O9P A;  3FVG A;  1MXX A;  1Y3N A;  4YMA A;  2FYI A;  4IO2 A;  2QS3 A;  3U94 A;  3OO9 A;  1XOC A;  4G2Z A;  3D4C A;  4QFL A;  4JSD A;  4U23 A;  1OQG A;  2REJ A;  4PFT A;  2DE4 A;  4GIZ A;  3IR1 A;  2XXW A;  1A7L A;  3CVG A;  3IO4 A;  4H67 A;  2XXY A;  4GVO A;  5I59 B;  3IOV A;  1USY H;  4GFR A;  3C34 A;  1B2H A;  3RQT A;  4OQO A;  4WXJ A;  4EXL A;  4OHN A;  1F9B A;  4PP0 A;  2NWJ A;  3LVU A;  3RLF E;  1FQC A;  4U1O A;  1JW1 A;  4MLQ A;  2Q2A A;  5EHS A;  1ZMG A;  4LAT A;  2B3F A;  4BDO A;  4RY1 A;  3IAZ A;  2QPQ A;  4GXA A;  4DE8 A;  1P1W A;  2CZL A;  1B0H A;  2I58 A;  3THI A;  3MZ9 A;  3RY3 A;  2DXR A;  3RYB A;  1A8F A;  2YJP A;  1O63 A;  3OMB A;  2GHA A;  1AOV A;  3LSX A;  1LFI A;  2Z23 A;  4JDF A;  3MUQ A;  3HST A;  5L9O A;  4MF3 A;  2HZL A;  5I2N A;  4KR5 A;  5KDT B;  3PMW A;  1B51 A;  2O1L A;  1SDX A;  3EHT A;  5L9M A;  4IO6 A;  2ABH A;  1PDA A;  3GBB A;  5TP9 B;  2ZYM A;  1LAX A;  2NOO A;  1B5J A;  2W7Y A;  2CMO A;  1SQY A;  3G3K A;  4LON B;  3PUW E;  5AA4 A;  2HZK A;  2V3U A;  1CE2 A;  1D3K A;  5I57 A;  2Z8E A;  3K6W A;  3MZ1 A;  3K4U A;  3KFM A;  1B40 A;  2UVG A;  4U2R A;  4DLD A;  4F31 B;  1BLF A;  3FGS A;  3LSF B;  4POW A;  1RYX A;  1QUK A;  4E0W A;  3B6T A;  3OO7 A;  3SET A;  4GWO A;  4AQ4 A;  1P1N A;  1US4 A;  5ELV A;  1N3W A;  2Y7P A;  5I58 A;  1AMF A;  5J1D A;  1S9T A;  2Q2C A;  3T9H B;  3PPN A;  1FTM A;  3DRG A;  3LUY A;  5FHM A;  2HXW A;  3TTL A;  4YAH X;  4YIC A;  3K00 A;  1P99 A;  1AL3 A;  1EH3 A;  2QSX A;  3CRB A;  4G68 B;  1Y4C A;  3DEL B;  4WKM A;  3A09 A;  5EYF A;  2B4M A;  2F7A A;  3QXM A;  3GBA A;  3KGC A;  4ECF A;  3E4R A;  3I3V A;  1IEJ A;  1VFE A;  1M5B A;  2DOJ A;  4U22 A;  2WKY A;  3RPW A;  1GTK A;  4UAC A;  1B52 A;  4DCX A;  4PET A;  4JWX A;  1QUJ A;  2XD2 A;  3MAM A;  1Z7N E;  5KCJ A;  3CIJ A;  3IK6 B;  1PBQ A;  3MW0 A;  3UIF A;  3MBP A;  5JEI A;  4RK2 A;  1N0T A;  2UVI A;  4RYA A;  3M3L A;  2I6E A;  3PGF A;  2OBG A;  5CBR A;  3FTO A;  3FVN A;  5ISU A;  4OZ9 A;  1EZO A;  4LP2 B;  3R26 A;  3MWB A;  1I6A A;  1J1N A;  1ZTY A;  1URS A;  4GQO A;  1R1N A;  4R73 A;  4OFJ A;  3VXC A;  4IY6 A;  3JYR A;  1PEB A;  4KYD A;  5H8S A;  5CMM A;  2OWS A;  2YLN A;  4ZE8 A;  1B4Z A;  1DOT A;  4FOR A;  3H6W A;  3LR1 A;  1B58 A;  5H8N B;  4TLL B;  3UOR A;  3TCH A;  4YU0 A;  1B05 A;  4QRZ A;  4OFL A;  1FQA A;  1XVY A;  4NED A;  5I59 A;  1MQD A;  4LVQ A;  2R9J A;  3TUS A;  5CMK A;  3PUV E;  5AA4 B;  3L6G A;  4UA8 A;  4K3F A;  2V93 A;  1FTO A;  4KCC A;  4ZE9 A;  1QW0 A;  2PT1 A;  3DRK A;  1Y1Z A;  2DWH A;  1PBP A;  3O6P A;  3TMG A;  1B3F A;  2I4B A;  5JTY B;  5L9S A;  3KSX A;  3SDF A;  3C4M A;  4C1U A;  5IAI A;  2XXQ A;  3C31 A;  2ZYO A;  4YB7 A;  1LST A;  3SEX A;  4M1V A;  3RGY A;  3TQL A;  4KI0 E;  1Q35 A;  3EQ1 A;  4WED A;  2VP1 A;  3IOR A;  4IO3 A;  5I56 B;  2D21 A;  4N13 A;  3DP4 A;  3RNN A;  1WVJ A;  4QFK A;  4ONY A;  4TQU Q;  1B32 A;  3DM0 A;  1B1X A;  4ELQ A;  4IGR A;  4NWC A;  3VFJ A;  2UVH A;  4X48 A;  4RXL A;  5K2X A;  1LB8 A;  2Z8F A;  3PD9 A;  3I6V A;  2H25 A;  2PT2 A;  3EHS A;  1AH5 A;  1Y3Q A;  1IXG A;  1MDQ A;  4QHQ A;  3TPA A;  4E0X A;  1Y1M A;  1MY2 A;  1ZKB A;  3E3K A;  1LAF E;  4H65 A;  3Q27 A;  5CC2 A;  5AA2 D;  2F7C A;  4KCD A;  1IIW A;  3N6T A;  1EZ9 A;  2OZZ A;  4ZED A;  1H45 A;  4KPT A;  2I48 A;  1SYH A;  1S50 A;  1ZIU A;  1AIV A;  4ZEI A;  4OXV A;  1XVX A;  3MP8 A;  3FV1 A;  3OXN A;  4YKK A;  4JXI A;  1POY 1;  1MY3 A;  2UXA A;  1SVX B;  4ELP A;  1QKB A;  1XS5 A;  5B7D A;  4G4P A;  3IB1 A;  3RN8 A;  1QJM A;  3G3J A;  3MC2 A;  3IJX B;  1RKM A;  2NVU B;  5F7V A;  1BP5 A;  3AXF A;  2HCA A;  3FVK A;  4OTE A;  4G68 A;  1O64 A;  4JWY A;  2B3B A;  3DRH A;  1B5H A;  4AB5 A;  5H8H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...