1B3HA

Oligo-peptide binding protein complexed with lysyl-cyclohexylalanyl-lysine
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
total genus 192
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b3hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b3hA02
1GR2A 3B6TA 5I56A 2Y7PA 4EQ7A 2F7AA 1MY2A 1N7WA 2O7IA 4X1BA 4OEVA 1A99A 2WOLA 4WEPA 3R7XA 1AL3A 4PP0A 3B6QA 3TTNA 1B7HA 5KCJB 1NH7A 4H0WA 1CE2A 2NVUB 3PPPA 2O51A 5AE4A 1OLAA 4FAJA 4P0IA 1P1QA 3G3IA 4KD5A 5DEXB 5JTYA 1B4HA 3M3KA 5IKBA 3GBAA 1EZPA 3H4ZA 3N26A 4WKMA 2DWAA 5I57B 2ZNSA 2H9BA 4OZ9A 5DEXA 2V84A 3USDA 1D9YA 4YKKA 3G7WA 3ECRA 4IY6A 4ELPA 2HAUA 1R1NA 4ZEFA 4JB7A 1H76A 4U21A 2PT1A 5EYFA 4F3PA 1PB8A 1SBPA 1MRPA 2RCAA 2Y84A 4OQOA 1XC1A 2DYXA 3VVEA 3SEXA 4RPOA 5FHOA 5CMMA 5H8FB 1Y4TA 4PFTA 1P1UA 4H8JA 5B7DA 1I6BA 4EXKA 2XXTA 3JZJA 5L8DA 2NXOA 3SESA 2R9JA 4GLIA 2O6AA 5H8FA 2I48A 1N0TA 4DCYA 2O84X 3PD9A 3C4MA 4R9FA 5I58A 1UTBB 1MY3A 3TZAA 3Q25A 3K02A 2B4MA 3BKIB 2DS9A 4IO3A 2XXRA 2ZMBA 4BDMA 1LFGA 2XX9A 3MC2A 2UVHA 2ONKE 4OENA 2V25A 4OESA 1JW4A 4FEBA 1B3EA 3EHSA 4EF1A 3RY3A 3KEIA 1TFDA 4NF6A 4R72A 4NE4A 3MVXA 1O63A 4OEUA 2Y7RA 4F2QA 1GTKA 4DCXA 4C0RA 3M8UA 3IO4A 2AL4A 2ZYNA 2E1SA 3U8QA 2OCUA 5K2YA 3WAEA 2I0BA 4XKNA 2WOKA 2DSFA 1FTJA 1JW1A 2ZYMA 1FQFA 1JQFA 1O7TA 2Q2AA 4AB6A 4EQBA 1IXHA 4O3AA 1MM7A 4ESXA 1URGA 3OSQA 5H8QA 3OMBA 3TTMA 4XKQA 1S50A 3K00A 1SDXA 3D4GA 3MBPA 4JSOA 4WXJA 3H7MA 5I2KB 1XT8A 3DP6A 2DE4A 1Y3NA 4F3GA 4ZE9A 4THIA 3E13X 2QS2A 1P99A 5I2KA 3UP9A 1USYE 3RT6B 1MQIA 2QJEA 3KOSA 1XHYA 5FHMA 4TLLB 3U94A 4ISUA 4PETA 4HW8A 1N04A 3FJ7A 4BDOA 2R6GE 3T96B 4R6YA 1O64A 1MG1A 2NOOA 1P1WA 4UA8A 4XTCQ 1GGGA 1A8FA 3UA8A 2QL3A 4HTGA 1D9VA 4R2FA 2XD2A 4ZZAA 3CSGA 2O7UA 2CZLA 4Q30B 4EXLA 1R6ZA 1FQCA 5J1DA 2DVCA 4QFLA 1UIVA 4ZDMA 1PB7A 2I4BA 2XXHA 4N07A 2PX1A 4NF4B 3U92A 4POXA 1LAXA 1LSTA 2A5TB 4G8HA 1KWHA 3C36A 4ZEBA 5CBRA 4U4XA 3HV1A 1A8EA 3FIRA 4EQ9A 4U22A 5H8HB 2ZYKA 3PUWE 4XKPA 1MY1A 2QPQA 4F3BA 5H8HA 3W9WA 2XXXA 3OOAA 2PVUA 2Z23A 1SD3A 3DP8A 3LSWA 2XXVA 4G68A 5DTBA 2KLFA 4F29A 1B7UA 1PC3A 1GVCA 5AA1A 3OD7A 5AA3A 1A7LA 2CMOA 4P0GA 4H67A 1VE4A 3MUQA 3MPKA 3PUYE 2B65A 3ODBA 1PEBA 1B51A 4GRKA 1JETA 1LFIA 2AIXA 5DVIA 4OERA 2F6PA 1BP5A 4M4GA 4O3BA 1QKBA 2BJJX 4OETA 2HEUA 3FJMA 3IB1A 2ONRA 4DXCA 2PT2A 4FIMA 1VSOA 5EHMA 3PUXE 3FASA 1Y3PA 3THIA 4MFIA 1AIVA 1B3FA 2W7YA 3K01A 4YB7A 3TQWA 2WOPA 3W15C 3SDFA 3CRBA 5AA2A 5CC2A 3SETA 1L5TA 4FATA 1FQBA 4QSDA 3MVYA 4KYSA 1IITA 2PMSA 1PDAA 5ITPA 4C1TA 1Y3QA 2XD3A 4TQUQ 1UTHB 2QMWA 1DTGA 3EF7A 4BLAA 2QS3A 1SI0A 4Z0IA 4IO4A 3G3HA 2PBWA 3EQ1A 3MJNA 3DRFA 4TOZA 3IK6B 3IR1A 1FQDA 1FTKA 4F1YA 1EZ9A 1QW0A 5CM6A 3ZKKA 4IB2A 3N5LA 3KN7A 3C35A 3LBSA 5DT6A 3S9MC 4ZS9A 1OLCA 5DVJA 3WAFA 3RYAA 3KOTA 3ONMA 3GXAA 4GVOA 4QFOA 4R74A 4BDNA 2DE2A 5BWJA 3VFJA 3SEUA 2B4LA 1UQWA 1B05A 3FXUA 4IO6A 3VLVA 3RYBA 1OVBA 4N6PA 3PMXA 1A54A 2I4CA 3IOTA 1OMPA 3TMGA 1B5HA 1NKXA 1POY1 4XIGQ 3MQ9A 1LAGE 2D21A 2I3WA 1SW4A 4LZ7A 3H3GA 5L9SA 4DXBA 1ZBMA 1B0LA 3HO7A 3Q27A 4LVQA 1ZMGA 3CFLA 1H43A 3KSJA 4UACA 2XXPA 2GHBA 4LZ8A 4LQ5A 4LQ2A 2HAVA 1H45A 3MZ9A 1MXXA 1MPDA 3QYTA 3QAXA 2V3QA 1DPEA 3TCGA 1ZKBA 3FATA 5JTYB 3TKDA 4F39A 1WVJA 4X48A 3LR1A 3VLWA 1NNFA 1MXUA 2QRYA 4POWA 3MVWA 3N94A 4NWCA 2WKYA 4LA9A 4KHZE 4JSDA 3IOWA 4GOTA 3KJTA 3A09A 4KPTA 1Y9UA 3PMVA 4XKRA 4F1UA 3PUVE 5FTHA 1YAEA 4ESWA 1ZU0A 3K1PA 3O28A 3RN8A 4FECA 2H98A 3T9VA 4P11A 2OBGA 2OZZA 5B70A 3I5OA 3V8XB 2VP1A 3DRHA 3VLUA 1MPBA 2Y7WA 1NNPA 2GH9A 4JBZA 1DTZA 1LBBA 5I58B 5KDTA 2I49A 1QJMA 4LUBA 3MP1A 5TU0A 4LZ5A 4F18A 1HSJA 4I8CA 4C1UA 1YTVA 5TPAA 2F35A 1ELJA 2DOJA 5CMKA 4ZZEA 4YMAA 4BDRA 3SEVA 2ALUA 4NF6B 2THIA 4RXLA 3HHGA 3S9EA 2DE3A 4GXSB 1B7ZA 1Y4CA 4AB5A 4OFOA 3LVUA 3HSTA 5TP9A 4YICA 3H6TA 3O6IA 1A55A 4G8MA 2NUVA 3LSLA 1B40A 3K1MA 1N84A 1IUDA 1UIUA 3U1OA 3IORA 2M8CA 1H44A 5DYHA 3TFLA 5H8QB 2E0SA 3SEWA 2VOZA 1DSNA 3KFMA 2Z22A 1SYHA 1NL5A 3T9UA 3RQTA 2F7BA 3UN6A 1NMUA 3RT8A 1IXCA 1OIBA 2F36A 3QXMA 3PPRA 3O29A 4ND9A 3IOVA 1MH3A 1PBQA 3S9NC 5FHNA 4ECFA 2PYYA 4QFKA 3JV9A 4MLVA 4K3FA 3QIMA 2ZYOA 3G3GA 1HSLA 4IGRA 5KZTA 1P1OA 3EPEA 1MY0A 3K6WA 3EN3A 2Z8FA 1QUKA 2Y7IA 3DP4A 3W9VA 3LSXA 4U1ZA 1N3WA 4RK2A 5F1QA 3OO8A 3C9HA 3S9LC 2ONSA 4JWXA 3AXFA 3PPQA 3P7IA 1NNKA 1AMFA 3FVNA 1FTLA 3ZKLA 3QK6A 4GQOA 4AQ4A 2DQVA 2RC9A 3CIJA 3IB2A 2RINA 1LCTA 1SYIA 4OHNA 4IO5A 1ATGA 4U23A 3V5AA 2ANJA 1DPPA 3TPAA 3PV0E 4PFWA 2HXWA 3FUZA 3R26A 3RTWB 1JNFA 3TCHA 1FCKA 2ESNA 2B3BA 2QMXA 1ZLQA 1LAFE 3UIFA 2P0SA 4G68B 1ZTYA 1MXYA 3I6VA 3O6PA 1JVXA 1S9TA 2V3TA 4GL0A 4RPNA 1B9JA 1USYH 4G4PA 3N6TA 4F1VA 3OSRA 1OVTA 1B5JA 3H06B 3IJOB 1AOVA 3TEPA 3MPLA 3Q29A 2F8DA 5ICTA 4IO2A 3IX1A 1M5BA 3CR9A 3TDJA 1VR5A 2FNCA 3LC8A 1M5FA 3KBRA 4MF3A 1FTMA 4E0WA 5I59A 4G77A 3EHTA 4F3SA 4KI0E 1BKAA 4IGTA 2F7CA 2P2AA 4H65A 4IO7A 5ITOA 1IQ7A 3TTLA 4G8NA 2HQ0A 3K6UA 5F7VA 4U2RA 4NF8A 1QVSA 3FVGA 4KYDA 5AA2B 5CMCA 5CRYA 3KZGA 1Z7NE 5L9MA 4HCYA 3H6UA 2UYFA 4QFNA 3CG1A 3FVOA 3FZVA 3O6GA 1QKAA 3Q26A 1B3LA 2Q2CA 4JWYA 4OFJA 1D3KA 2AL5A 3KG2A 3O9PA 5CMBA 2O68A 3O97A 4KR5A 5LOMA 3OENA 2OLBA 3FXRA 3PD8A 2HZKA 1RYOA 2VD3A 4RYAA 1MS7A 4PQJA 3PAMA 3EHUA 2X26A 3DRJA 4R73A 3CVGA 3UGWA 1FW0A 1M5EA 3TAJA 4ZEKA 1ZJLA 2FA7A 3F11A 2H25A 5HM4B 3PU5A 4QSCA 3MWBA 1JEUA 3GBBA 3HHFA 3HCQA 1ZIUA 3H6VA 2QS4A 3K6XA 3K1NA 4FEDA 1EZOA 3FV2A 1MQDA 1Y1MA 3Q28A 1BTJA 4F22A 1MQJA 2H99A 3B7DA 1WODA 3MVZA 4YZZA 1LAHE 4ZEDA 4R9GA 2OWSA 2XXUA 3RGYA 1LB9A 3TUSA 1GV8A 4PFYA 4YKJA 5M2VA 2DWHA 3IOUA 1B3GA 3FD3A 3E3KA 1M5CA 2OK2A 3FXQA 1SW5A 3IL1B 3VVFA 5I2NA 1B1XA 1XVYA 5ISUA 1IXIA 5A5XA 2UVGA 3G3KA 2XXWA 4GD5A 4GWOA 1XS5A 5AA4A 4FORA 4MBPA 2VHAA 2REGA 2V93A 2X7PA 1VFDA 5H8NA 2D5WA 3L6GA 3G3JA 2XXIA 3M3LA 3K2DA 4KYEA 4F31B 3CFZA 3QUFA 4I9DA 1AH5A 1EU8A 3IB0A 4G2ZA 3UORA 4OWDA 2OWTA 1LBCA 3LSFB 3T9HB 1QUJA 3S2VA 3RUMA 1YCJA 1J1NA 4Q0CA 4OXVA 2I58A 5HBCA 3PPNA 4ZE8A 1RYXA 5KCJA 2B3FA 3O66A 5HPQA 3RTFB 2F5XA 1JEVA 4H6DA 1MDQA 4TLMB 3O6HA 2LAOA 4WEDA 4NWDA 3MP6A 4U4SA 1OQGA 5I57A 2FYIA 3A3CA 1MXVA 3DRGA 3JYRA 4F19A 1R9LA 3I3VA 2NWJA 4QRZA 2GHAA 2G29A 5KDTB 2GRVA 1ANFA 2QSXA 3VXBA 4DDDA 2HFBA 3KN8A 3MZ1A 3SERA 4DXUA 5H8SA 1LB8A 4NTLA 1Q35A 1US4A 4YKPA 3FJGA 1I6AA 2AYSA 1VFEA 1OQHA 4JXIA 3U93A 1B6HA 3TYHA 3C32A 4OVJA 5TPAB 3ZS6A 5EHSA 3O2AA 1CB6A 3CSBA 2YLNA 3ILUB 1LFHA 4PE5B 4YKIA 1MQHA 4EDPA 1MXZA 4MLQA 4R6KA 3D4CA 1DMBA 5TP9B 3SKPA 3R6UA 3HN0A 2Z8EA 2XHDA 4YU0A 4YB5A 1SI1A 1UTBA 4GL8A 2X7QA 3TTKA 2RKMA 2O69A 1FTOA 1XOCA 4KCCA 1MM6A 4DE8A 2Z8DA 4PFUA 3BBRA 2O1MA 2F97A 3KJ7A 3H03A 4DLDA 1PBPA 1B4ZA 3U72A 3CHGA 2DXRA 3FV1A 3KSXA 1H3DA 2UYEA 1Z7ME 1URSA 4N13A 3OXNA 3A3UA 3RNNA 1B46A 3K0VA 4MH5A 2G93A 4R2BA 1B5IA 1IIWA 3MW0A 1US5A 2F34A 1S7YA 1BLFA 1NFTA 3DLNA 4LONB 2O1LA 5ELVA 5AA2D 5JK4A 5JEIA 1B0HA 4ONYA 1RKMA 2DXYA 2ZNTA 1MH4A 5CI5A 2RC8A 3V89B 1B2HA 3MAMA 3C31A 4JDFA 2I3VA 2VD2A 2Y7KA 3GLBA 3VDFA 2H4IA 5BUUA 4GF8A 2R71A 3FVKA 2DWJA 1TT1A 4YAHX 3S4UA 3DELB 1R9QA 3ILTB 4ELRA 3LUYA 2I6EA 1POTA 2A5SA 1TWYA 3T9XB 1TXFA 1LGBC 3IJXB 2XXQA 3OO7A 1QULA 4M1VA 3PMWA 1LLSA 5DVFA 1JVYA 3BFTA 1Q1KA 3KN3A 2Q9TA 2XXYA 4X9TA 3UK4A 4Q5TA 4Z7EA 3OO6A 3T66A 3IAZA 2RF1A 3E9XA 1I69A 3OELA 2IA4A 1JW5A 4ZECA 3MP8A 4NF4A 4RJZA 3IO6A 4H8IA 3TELA 1SQYA 1B52A 3PUZE 3ZSFA 2YPNA 1N3XA 3TTRA 2A5TA 4IY5A 3RLFE 1I6QA 5L9OA 1FQAA 2UVJA 1SW2A 4RA1A 4OFLA 1DOTA 5ICQA 1LCFA 2REJA 4H5GA 3G3FA 5CBSA 1IZ1A 2F78A 1P1NA 4U1OA 2ZXTA 2DP8A 1WDNA 3RPWA 3CI8A 1QUIA 3DM0A 1B1HA 4YMBA 3TQLA 1B3HA 1M5DA 1Y20A 3QUJA 3OEMA 5I59B 1N7XA 3CFXA 4ZEIA 1SW1A 4E0XA 3BFUA 1NH8A 4R75A 3V83A 4OTEA 4DIGA 4ELOA 2XX7A 2Q8JA 2V3UA 3M3FA 2Q89A 2HCAA 3C34A 4FE8A 4NF8B 1XVXA 3QSLA 2I0CA 3N6UA 2ZNUA 4H1XA 4KCDA 4OYVA 5FTIA 4QF9A 1D4NA 4RNSA 1F9BA 1IEJA 4O3CA 1FQEA 4HS7A 1A40A 3K6VA 4I62A 2OJTA 2XX8A 3K4UA 4DZ1A 2YJPA 1N76A 3C33A 3H6WA 4KQPA 4JWOA 2ABHA 4QSEA 3TCFA 3B6WA 2F6GA 1YPNA 2QS1A 4FJPA 4RK9A 3CG3A 4F2OA 2D3IA 4QFPA 4L17A 2GFEA 3VV5A 1T0KA 4NMYA 5K2XA 1URDA 4R6HA 4G68C 1PB9A 3SEYA 3DRKA 4GIZA 3T93B 4BDQA 4OMBA 4QHQA 1UTHA 2P1SA 4ELQA 2IEEA 4BDLA 1B32A 2DWIA 1EH3A 1MPCA 3GZGA 1B58A 1SVXB 3VXCA 1II5A 3FTOA 4NEDA 1HSEA 3DRIA 2HZLA 2UVIA 3VVDA 3E4RA 4NF5B 5I84A 2DVZA 2VGQA 1TFAA 4EUOA 4EF2A 4LP2B 1MQGA 1MXWA 4I1DA 3PGFA 4NF5A 4Q8RA 4GXAA 4KFQA 4XXUA 3L6HA 4YB6A 4LATA 3PPOA 4RY1A 5I2NB 2RC7A 3T22A 1IXGA 5A5XB 3OEKA 3MZBA 2UXAA 1Y1ZA 5AA4B 4X1DA 1MY4A 2H5YA 4HCWA 4GFRA 1BIYA 5H8NB 3FGSA 2RCBA 3VE1B 1NNTA 5I56B 3HPIA 1MDP1 4H5FA 2Q88A 3KGCA 3OO9A 3TODA 5IAIA
chains in the Genus database with same CATH superfamily
1GR2A 3B6TA 5I56A 2Y7PA 4EQ7A 2F7AA 1MY2A 1N7WA 5FBPA 2O7IA 1LEVA 4JVCA 1Q9DA 4X1BA 4OEVA 4MIJA 1A99A 2WOLA 4WEPA 3R7XA 1AL3A 4PP0A 3B6QA 3TTNA 1B7HA 1G0HA 5KCJB 4GBVA 1NH7A 4H0WA 1CE2A 2NVUB 3PPPA 2O51A 1LBVA 5AE4A 2CZIA 1OLAA 4FAJA 4P0IA 5LDZA 1P1QA 3G3IA 4KD5A 5DEXB 3MYUA 5JTYA 1B4HA 3M3KA 1DK4A 5IKBA 3GBAA 1EZPA 3H4ZA 3N26A 4WKMA 2DWAA 5I57B 2ZNSA 2H9BA 4OZ9A 5DEXA 4UABA 2V84A 3USDA 1D9YA 4NAPA 4YKKA 3G7WA 3ECRA 4IY6A 4ELPA 4MNPA 2HAUA 1G0IA 1R1NA 4ZEFA 2FVZA 4JB7A 1H76A 1RDYA 4U21A 5EQ7A 2PT1A 4MCOA 5EYFA 4F3PA 1PB8A 1SBPA 1MRPA 1VDWA 2RCAA 2Y84A 4OQOA 1XC1A 2DYXA 3VVEA 3SEXA 4RPOA 5FHOA 5CMMA 5H8FB 1Y4TA 3IFAA 4PFTA 1P1UA 4H8JA 5B7DA 1I6BA 4EXKA 2XXTA 4PAFA 3JZJA 5L8DA 2NXOA 3SESA 2R9JA 4GLIA 2O6AA 5H8FA 2I48A 4NX1A 1INPA 1N0TA 4DCYA 2O84X 3PD9A 3C4MA 4R9FA 5I58A 1UTBB 1MY3A 1FBDA 3TZAA 3Q25A 3K02A 2B4MA 1NV7A 3BKIB 2DS9A 4IO3A 2XXRA 4NGUA 2XWOA 2ZMBA 4BDMA 1LFGA 2XX9A 3MC2A 2UVHA 2ONKE 4OENA 2V25A 4OESA 1JW4A 4FEBA 1B3EA 3EHSA 4EF1A 3RY3A 3KEIA 1TFDA 4NF6A 4R72A 4NE4A 3MVXA 1O63A 4OEUA 2Y7RA 4F2QA 1GTKA 4DCXA 1NUZA 3A29A 4C0RA 3M8UA 2WBBA 3IO4A 2AL4A 2ZYNA 2E1SA 3U8QA 2OCUA 5K2YA 3WAEA 2I0BA 4XKNA 2WOKA 2DSFA 1FTJA 1JW1A 2ZYMA 4P1EA 1FQFA 1JQFA 1O7TA 2Q2AA 4AB6A 4EQBA 1IXHA 4O3AA 1MM7A 4ESXA 1URGA 3OSQA 5H8QA 3OMBA 3TTMA 4XKQA 2OWZA 1S50A 3K00A 1SDXA 3D4GA 1FPIA 3MBPA 4JSOA 4WXJA 3H7MA 4P1LA 5I2KB 4PGPA 1XT8A 3DP6A 2DE4A 4PFBA 1Y3NA 2ZZVA 4DI4B 4F3GA 1NUXA 4ZE9A 4THIA 3E13X 2QS2A 1P99A 5I2KA 2HXRA 3UP9A 1USYE 3RT6B 1MQIA 2QJEA 3KOSA 1XHYA 5FHMA 2R8TA 4TLLB 3U94A 4ISUA 4PETA 4HW8A 1N04A 3FJ7A 4BDOA 2R6GE 3T96B 1FBFA 4R6YA 1O64A 1MG1A 2NOOA 1P1WA 4UA8A 4XTCQ 1GGGA 4IR8A 1A8FA 3UA8A 2QL3A 4HTGA 1D9VA 4R2FA 3SZPA 1LBYA 2XD2A 4ZZAA 3CSGA 1NV3A 2O7UA 2CZLA 4Q30B 4EXLA 1R6ZA 1FQCA 3D1RA 5J1DA 2DVCA 4QFLA 1UIVA 4ZDMA 1PB7A 2I4BA 2XXHA 4N07A 2PX1A 4NF4B 4POXA 3U92A 1LAXA 1LSTA 3FBPA 2A5TB 4G8HA 1KWHA 4GWSA 3C36A 3T0JA 4ZEBA 5CBRA 4U4XA 3HV1A 4X8RA 1A8EA 3FIRA 4EQ9A 4U22A 5ET6A 5H8HB 5IM2A 2ZYKA 3PUWE 4XKPA 1MY1A 2QPQA 4F3BA 5H8HA 3W9WA 2XXXA 2WX9A 3OOAA 2PVUA 2Z23A 1SD3A 4PF6A 1RDXA 3DP8A 3LSWA 1LBZA 2XXVA 4G68A 5DTBA 2KLFA 4F29A 1B7UA 1PC3A 1GVCA 5AA1A 3OD7A 1YYZA 5AA3A 1FRPA 1A7LA 2CMOA 4P0GA 2MKZA 4H67A 1VE4A 3MUQA 3MPKA 1NUWA 3PUYE 2B65A 3ODBA 1PEBA 1B51A 4GRKA 1JETA 1LFIA 1NV2A 2AIXA 5DVIA 4OERA 2F6PA 4PFIA 1BP5A 4M4GA 4O3BA 1QKBA 2BJJX 4OETA 2HEUA 3FJMA 2WYPA 3IB1A 2ONRA 4DXCA 2PT2A 4FIMA 1VSOA 5EHMA 3PUXE 3FASA 4PFRA 4MX6A 1Y3PA 3THIA 4MFIA 4JVIA 1LBWA 4AS4A 4GWYA 1AIVA 1B3FA 1DBZA 1JP4A 4O7MA 2W7YA 1AWBA 3K01A 4YB7A 3TQWA 4I3EA 2WOPA 3W15C 3EKIA 3SDFA 3RYDA 3CRBA 5AA2A 5CC2A 4N6DA 3SETA 1L5TA 4FATA 1IMFA 1FQBA 4QSDA 3MVYA 4KYSA 3IFCA 1FBEA 1NV1A 1IITA 2PMSA 1PDAA 4XF5A 5ITPA 4C1TA 1Y3QA 2XD3A 4TQUQ 1UTHB 2QMWA 1DTGA 3EF7A 4BLAA 2QS3A 1SI0A 4Z0IA 4IO4A 3G3HA 2PBWA 3EQ1A 3MJNA 3DRFA 4TOZA 3IK6B 2CEXA 3IR1A 1FQDA 1FTKA 4F1YA 1EZ9A 1QW0A 5CM6A 3ZKKA 4IB2A 3N5LA 3KN7A 3C35A 3LBSA 4GWZA 5DT6A 3S9MC 4PCDA 4ZS9A 1OLCA 5DVJA 1SPIA 3WAFA 3B50A 3RYAA 3KOTA 3ONMA 3GXAA 4GVOA 4QFOA 4R74A 4BDNA 2DE2A 4PDHA 5BWJA 2WYKA 3VFJA 3SEUA 2B4LA 1UQWA 1B05A 3BIGA 3FXUA 4IO6A 3VLVA 3RYBA 1OVBA 4N6PA 3PMXA 1A54A 2I4CA 4HE0A 2FBPA 4GX3A 3IOTA 3B8BA 1OMPA 3TMGA 1B5HA 3KC1A 1NKXA 1POY1 4XIGQ 3MQ9A 1LAGE 2D21A 4MHFA 2I3WA 1SW4A 4NN3A 4LZ7A 3H3GA 5L9SA 4DXBA 1ZBMA 1B0LA 3HO7A 3Q27A 4LVQA 4N15A 1ZMGA 3CFLA 1FPFA 4PGNA 1H43A 3KSJA 4UACA 2XXPA 2GHBA 4LZ8A 4LQ5A 4LQ2A 2HAVA 1H45A 3MZ9A 1MXXA 1MPDA 3QYTA 3QAXA 2V3QA 1DPEA 3TCGA 2ZZXA 1ZKBA 3FATA 5JTYB 3TKDA 4F39A 1FPKA 1WVJA 4X48A 3LR1A 3VLWA 1NNFA 1MXUA 2QRYA 4POWA 2ZZWA 3MVWA 1LBXA 3N94A 4NWCA 2WKYA 4LA9A 4KHZE 4JSDA 3IOWA 1K9ZA 4GOTA 3KJTA 3A09A 4KPTA 1Y9UA 3PMVA 4XKRA 4F1UA 3PUVE 5FTHA 4O94A 4OVSA 1YAEA 4ESWA 4MEVA 1ZU0A 3K1PA 3O28A 3RN8A 4OA4A 4FECA 4GX4A 2H98A 2CZHA 1IMDA 3T9VA 4P11A 2OBGA 2OZZA 5B70A 4LN5A 3I5OA 3V8XB 2VP1A 2KQZA 3DRHA 1NUYA 3VLUA 1MPBA 2Y7WA 1NNPA 2GH9A 4JBZA 1DTZA 1LBBA 5I58B 5KDTA 2I49A 5IZ1A 1QJMA 3MSTA 4LUBA 3MP1A 2FIEA 5TU0A 4KXPA 4LZ5A 4F18A 1HSJA 4I8CA 4C1UA 1YTVA 4O8MA 5TPAA 2F35A 1ELJA 2DOJA 5CMKA 4ZZEA 4YMAA 4BDRA 3SEVA 2ALUA 4NF6B 2THIA 4RXLA 3HHGA 3S9EA 2DE3A 2VPOA 4GXSB 4PBQA 1B7ZA 1Y4CA 4AB5A 4OFOA 3LVUA 3HSTA 5TP9A 4YICA 4NHBA 3H6TA 2PFZA 3O6IA 1A55A 1EYIA 4G8MA 2NUVA 3LSLA 1B40A 2JJKA 3K1MA 4MNIA 1N84A 1IUDA 4N81A 1NV5A 1UIUA 1NI9A 2WEFA 1YZ0A 5IZ3A 3U1OA 3IORA 2M8CA 1H44A 5DYHA 3TFLA 5H8QB 2E0SA 3SEWA 4N91A 2VOZA 1DSNA 3KFMA 2Z22A 2XWIA 1SYHA 1NL5A 4MMPA 3T9UA 3RQTA 2F7BA 3UN6A 1NMUA 5ET5A 3RT8A 1IXCA 5I3SA 1OIBA 3KC0A 2F36A 3ROJA 3QXMA 3PPRA 3O29A 4ND9A 4HE2A 3IOVA 1MH3A 3E79A 1PBQA 2F3BA 3S9NC 5FHNA 2PYYA 4ECFA 4QFKA 3JV9A 4MLVA 4K3FA 3QIMA 4OVPA 2ZYOA 1FBGA 2F3DA 3G3GA 1HSLA 4IGRA 5KZTA 1P1OA 3EPEA 1MY0A 1NV0A 3EN3A 3K6WA 2Z8FA 1QUKA 2Y7IA 3DP4A 3W9VA 3LSXA 4U1ZA 1NV6A 1N3WA 4RK2A 5F1QA 3OO8A 3C9HA 3S9LC 2ONSA 4JWXA 3AXFA 2QVRA 3PPQA 4P9KA 3P7IA 1NNKA 1AMFA 3FVNA 1FTLA 3ZKLA 3QK6A 4GQOA 4AQ4A 2DQVA 2RC9A 3CIJA 2QFLA 3IB2A 2RINA 1LCTA 1SYIA 4OHNA 4IO5A 1ATGA 4U23A 3V5AA 2ANJA 1DPPA 3TPAA 3PV0E 4PFWA 2HXWA 3FUZA 3R26A 3RTWB 1JNFA 3TCHA 1FCKA 2ESNA 2B3BA 2QMXA 1ZLQA 1LAFE 3UIFA 2P0SA 4G68B 1ZTYA 1MXYA 4QBAA 3I6VA 3O6PA 1JVXA 1FBCA 1S9TA 4N17A 2V3TA 4GL0A 4RPNA 1B9JA 1USYH 4G4PA 3N6TA 4F1VA 3OSRA 1OVTA 1B5JA 3H06B 3IJOB 1AOVA 3TEPA 3MPLA 4NF0A 3Q29A 2F8DA 5ICTA 4IO2A 3IX1A 1M5BA 3CR9A 3TDJA 1VR5A 2FNCA 4PBHA 3LC8A 1M5FA 3KBRA 4MF3A 1FTMA 4E0WA 5I59A 4N8YA 4G77A 3EHTA 4F3SA 1FPLA 4KI0E 1BKAA 4GWWA 4IGTA 5J16A 2F7CA 2P2AA 4H65A 4IO7A 5ESYA 5ITOA 1IQ7A 3TTLA 4G8NA 2HQ0A 3K6UA 5F7VA 4U2RA 4NF8A 1QVSA 1IMAA 3FVGA 4KYDA 1FPDA 5AA2B 5CMCA 5CRYA 3KZGA 4PAKA 1Z7NE 2FIXA 1KZ8A 1IMEA 5L9MA 4HCYA 3H6UA 2UYFA 5ET7A 2CZKA 4QFNA 3CG1A 3FVOA 3FZVA 3O6GA 3NOHA 1QKAA 3Q26A 1B3LA 2Q2CA 4JWYA 5EQ9A 3T1BA 4OFJA 1D3KA 2AL5A 3KG2A 3O9PA 1IMCA 5CMBA 2O68A 3O97A 4KR5A 5LOMA 3OENA 2OLBA 3FXRA 3PD8A 2HZKA 1RYOA 2VD3A 4RYAA 1MS7A 4PQJA 3PAMA 3EHUA 2X26A 3DRJA 4R73A 3CVGA 3UGWA 1FW0A 1M5EA 3TAJA 4OVRA 4ZEKA 3FXBA 1ZJLA 4MAGA 4GX6A 2FA7A 3F11A 2H25A 5HM4B 3PU5A 5ET8A 4QSCA 4XEQA 3MWBA 1JEUA 3GBBA 3HHFA 4P3LA 3HCQA 1EYJA 1ZIUA 3H6VA 1FSAA 2QS4A 3K6XA 4MNCA 3K1NA 4FEDA 1EZOA 3FV2A 1MQDA 1Y1MA 1FPJA 3Q28A 1BTJA 4F22A 1MQJA 2H99A 3B7DA 1QGXA 1WODA 3MVZA 4YZZA 4NG7A 1LAHE 4ZEDA 4R9GA 2OWSA 2XXUA 3RGYA 1LB9A 2VT5A 1EYKA 4P47A 3TUSA 1KA0A 1GV8A 4PFYA 4YKJA 5M2VA 4HXVA 2DWHA 3IOUA 1B3GA 3FD3A 3E3KA 1M5CA 2OK2A 4DI3D 3FXQA 1SW5A 3IL1B 3VVFA 5I2NA 1B1XA 1XVYA 2VPNA 5ISUA 3E78A 1IXIA 5A5XA 2UVGA 3G3KA 2XXWA 4GD5A 4GWOA 1XS5A 5AA4A 4FORA 4MBPA 2VHAA 2REGA 2V93A 2X7PA 1VFDA 5H8NA 2DDKA 2D5WA 3L6GA 3G3JA 4NQ8A 2XXIA 3M3LA 3K2DA 4KYEA 4F31B 3CFZA 3QUFA 4I9DA 2XXKA 1AH5A 1EU8A 3IB0A 4G2ZA 3UORA 2P3NA 4OWDA 2OWTA 1LBCA 3LSFB 3T9HB 1QUJA 4G61A 3S2VA 3RUMA 1YCJA 1J1NA 4Q0CA 4OXVA 2I58A 5HBCA 3PPNA 4ZE8A 2HHMA 1RYXA 5KCJA 2CEYA 2B3FA 3O66A 5HPQA 3RTFB 4JVDA 4OVTA 2HPGA 2F5XA 1JEVA 4H6DA 1MDQA 5EQAA 3O6HA 4TLMB 2KR0A 4WEDA 2LAOA 4NWDA 3MP6A 4U4SA 1OQGA 5I57A 2FYIA 3A3CA 1MXVA 2BJIA 3DRGA 3JYRA 4F19A 1R9LA 3I3VA 2NWJA 4QRZA 2GHAA 1CNQA 2G29A 5KDTB 2GRVA 1ANFA 2QSXA 3VXBA 4DDDA 2HFBA 2Q8MA 3KN8A 3MZ1A 3SERA 4DXUA 5H8SA 1LB8A 4NTLA 1FBPA 4P8BA 1Q35A 1US4A 4PC9A 4YKPA 3FJGA 1I6AA 2AYSA 1VFEA 1OQHA 4JXIA 3U93A 1B6HA 1FPEA 3TYHA 3C32A 4OVJA 5TPAB 3ZS6A 5EHSA 3O2AA 1CB6A 3CSBA 2YLNA 3ILUB 1LFHA 4MJOA 4PE5B 4YKIA 3U65A 1MQHA 4EDPA 1MXZA 4MLQA 4R6KA 4GBWA 3D4CA 1DMBA 5TP9B 3SKPA 3R6UA 3HN0A 2Z8EA 2XHDA 4YU0A 3HFUA 4YB5A 1SI1A 1UTBA 1FPBA 1RDZA 4GL8A 2X7QA 3TTKA 2RKMA 4QXDA 2O69A 4XFEA 1FTOA 2Q74A 3PTYA 1XOCA 5IZ3B 4KCCA 1MM6A 4DE8A 2Z8DA 4PFUA 3BBRA 2O1MA 2F97A 1KA1A 3KJ7A 3H03A 4DLDA 1PBPA 4N6KA 1B4ZA 3BIHA 3U72A 3CHGA 2L5VA 2Y5LA 2DXRA 3FV1A 3ISPA 2OX3A 3KSXA 1H3DA 2UYEA 1Z7ME 1URSA 3LUZA 4N13A 3OXNA 3A3UA 3RNNA 1B46A 3K0VA 4MH5A 5IZZA 2G93A 4R2BA 1B5IA 1IIWA 3MW0A 1US5A 2F34A 4HE1A 1S7YA 1BLFA 1FTAA 2PCRA 1NFTA 3DLNA 4LONB 5EQ8A 2O1LA 5A5LA 5ELVA 5AA2D 1FJ9A 5JK4A 5JEIA 1B0HA 4ONYA 2Y5KA 1RKMA 2DXYA 2ZNTA 1MH4A 5CI5A 2RC8A 2XWVA 3V89B 1B2HA 3MAMA 3QMFA 3C31A 4JDFA 1DCUA 2I3VA 2VD2A 2Y7KA 3GLBA 3VDFA 2V4CA 2H4IA 1YXIA 5BUUA 4GF8A 2R71A 3FVKA 3LV0A 2DWJA 1TT1A 4YAHX 3S4UA 3DELB 1R9QA 3ILTB 5EYGA 4ELRA 4H46A 3LUYA 2I6EA 1POTA 2A5SA 1TWYA 3T9XB 2QVUA 1TXFA 1LGBC 3IJXB 2XXQA 3OO7A 1QULA 4M1VA 3PMWA 1LLSA 5DVFA 1JVYA 1FJ6A 4PDDA 3BFTA 1Q1KA 3KN3A 2P3VA 2Q9TA 2XXYA 4X9TA 3UK4A 4Q5TA 4Z7EA 4OVQA 3OO6A 3T66A 3IAZA 2RF1A 3E9XA 1I69A 3OELA 2IA4A 1JW5A 4ZECA 3MP8A 4NF4A 4RJZA 3IO6A 4H8IA 3TELA 1SQYA 2WBDA 1B52A 3PUZE 3ZSFA 2YPNA 1N3XA 3TTRA 2A5TA 4IY5A 3RLFE 1I6QA 5L9OA 1FQAA 2UVJA 1SW2A 4RA1A 4OFLA 1DOTA 5ICQA 1LCFA 2REJA 5F24A 4H5GA 4GWXA 3RPLB 3G3FA 5CBSA 2FHYA 1IZ1A 2F78A 1P1NA 5I7IA 4U1OA 2ZXTA 2DP8A 2XA5A 1WDNA 3RPLA 3RPWA 3CI8A 1QUIA 3DM0A 1B1HA 4YMBA 3TQLA 1B3HA 4PE3A 1FBHA 1M5DA 1Y20A 1NV4A 3QUJA 3OEMA 5I59B 1N7XA 3CFXA 2QVVA 4OANA 4ZEIA 1SW1A 4E0XA 3BFUA 1NH8A 4R75A 3V83A 4OTEA 4DIGA 1IMBA 5EYHA 4ELOA 2XX7A 2Q8JA 2V3UA 3M3FA 4PAIA 5I5PA 2Q89A 2HCAA 3C34A 4FE8A 4NF8B 1XVXA 3QSLA 2I0CA 3N6UA 2ZNUA 4H1XA 4PF8A 4KCDA 1FPGA 3KBZA 4OYVA 5FTIA 4QF9A 1D4NA 4RNSA 3GYYA 1F9BA 5T3JA 5LTCA 5IGAA 1IEJA 4O3CA 1FQEA 4HS7A 1A40A 3K6VA 4I62A 2OJTA 2XX8A 3K4UA 4DZ1A 2YJPA 1N76A 4N4UA 1K9YA 3C33A 3H6WA 4KQPA 4JWOA 2ABHA 4QSEA 3TCFA 3B6WA 2F6GA 1YPNA 2QS1A 4FJPA 4RK9A 3CG3A 4F2OA 2D3IA 4QFPA 4L17A 2GFEA 3VV5A 4I3YA 1T0KA 4FBPA 4NMYA 5K2XA 1URDA 4R6HA 4G68C 1PB9A 3SEYA 3DRKA 4GIZA 3T93B 4BDQA 4OMBA 4PTKA 4QHQA 1UTHA 2P1SA 4ELQA 2IEEA 4BDLA 1B32A 2DWIA 1XI6A 1EH3A 1MPCA 3GZGA 1B58A 1SVXB 2XWKA 3VXCA 1II5A 3FTOA 4NEDA 2GQ1A 1HSEA 4H45A 3DRIA 2HZLA 2UVIA 3VVDA 3E4RA 4NF5B 5I84A 4O7IA 2DVZA 2VGQA 1TFAA 4EUOA 4I40A 4EF2A 4LP2B 1MQGA 1MXWA 4I1DA 3PGFA 4NF5A 4Q8RA 4GXAA 1D9QA 4KFQA 4GWUA 4XXUA 3L6HA 4YB6A 4LATA 3PPOA 4RY1A 5I2NB 4X04A 2RC7A 3T22A 1IXGA 5A5XB 3OEKA 1BK4A 3MZBA 2UXAA 1Y1ZA 5AA4B 4X1DA 1MY4A 2H5YA 4HCWA 4GFRA 4N8GA 1BIYA 5H8NB 3FGSA 2RCBA 3VE1B 1NNTA 4P56A 5I56B 3HPIA 1MDP1 4H5FA 2Q88A 4AS5A 3KGCA 3OO9A 2PFYA 5DW8A 3TODA 5IAIA
chains in the Genus database with same CATH topology
1GR2A 3B6TA 5I56A 2Y7PA 4EQ7A 2F7AA 1MY2A 1N7WA 2O7IA 4X1BA 4OEVA 1A99A 2WOLA 4WEPA 3R7XA 1AL3A 4PP0A 3B6QA 3TTNA 1B7HA 5KCJB 1NH7A 4H0WA 1CE2A 2NVUB 3PPPA 2O51A 5AE4A 1OLAA 4FAJA 4P0IA 1P1QA 3G3IA 4KD5A 5DEXB 5JTYA 1B4HA 3M3KA 5IKBA 3GBAA 1EZPA 3H4ZA 3N26A 4WKMA 2DWAA 5I57B 2ZNSA 2H9BA 4OZ9A 5DEXA 2V84A 3USDA 1D9YA 4YKKA 3G7WA 3ECRA 4IY6A 4ELPA 2HAUA 1R1NA 4ZEFA 4JB7A 1H76A 4U21A 2PT1A 5EYFA 4F3PA 1PB8A 1SBPA 1MRPA 2RCAA 2Y84A 4OQOA 1XC1A 2DYXA 3VVEA 3SEXA 4RPOA 5FHOA 5CMMA 5H8FB 1Y4TA 4PFTA 1P1UA 4H8JA 5B7DA 1I6BA 4EXKA 2XXTA 3JZJA 5L8DA 2NXOA 3SESA 2R9JA 4GLIA 2O6AA 5H8FA 2I48A 1N0TA 4DCYA 2O84X 3PD9A 3C4MA 4R9FA 5I58A 1UTBB 1MY3A 3TZAA 3Q25A 3K02A 2B4MA 3BKIB 2DS9A 4IO3A 2XXRA 2ZMBA 4BDMA 1LFGA 2XX9A 3MC2A 2UVHA 2ONKE 4OENA 2V25A 4OESA 1JW4A 4FEBA 1B3EA 3EHSA 4EF1A 3RY3A 3KEIA 1TFDA 4NF6A 4R72A 4NE4A 3MVXA 1O63A 4OEUA 2Y7RA 4F2QA 1GTKA 4DCXA 4C0RA 3M8UA 3IO4A 2AL4A 2ZYNA 2E1SA 3U8QA 2OCUA 5K2YA 3WAEA 2I0BA 4XKNA 2WOKA 2DSFA 1FTJA 1JW1A 2ZYMA 1FQFA 1JQFA 1O7TA 2Q2AA 4AB6A 4EQBA 1IXHA 4O3AA 1MM7A 4ESXA 1URGA 3OSQA 5H8QA 3OMBA 3TTMA 4XKQA 1S50A 3K00A 1SDXA 3D4GA 3MBPA 4JSOA 4WXJA 3H7MA 5I2KB 1XT8A 3DP6A 2DE4A 1Y3NA 4F3GA 4ZE9A 4THIA 3E13X 2QS2A 1P99A 5I2KA 3UP9A 1USYE 3RT6B 1MQIA 2QJEA 3KOSA 1XHYA 5FHMA 4TLLB 3U94A 4ISUA 4PETA 4HW8A 1N04A 3FJ7A 4BDOA 2R6GE 3T96B 4R6YA 1O64A 1MG1A 2NOOA 1P1WA 4UA8A 4XTCQ 1GGGA 1A8FA 3UA8A 2QL3A 4HTGA 1D9VA 4R2FA 2XD2A 4ZZAA 3CSGA 2O7UA 2CZLA 4Q30B 4EXLA 1R6ZA 1FQCA 5J1DA 2DVCA 4QFLA 1UIVA 4ZDMA 1PB7A 2I4BA 2XXHA 4N07A 2PX1A 4NF4B 3U92A 4POXA 1LAXA 1LSTA 2A5TB 4G8HA 1KWHA 3C36A 4ZEBA 5CBRA 4U4XA 3HV1A 1A8EA 3FIRA 4EQ9A 4U22A 5H8HB 2ZYKA 3PUWE 4XKPA 1MY1A 2QPQA 4F3BA 5H8HA 3W9WA 2XXXA 3OOAA 2PVUA 2Z23A 1SD3A 3DP8A 3LSWA 2XXVA 4G68A 5DTBA 2KLFA 4F29A 1B7UA 1PC3A 1GVCA 5AA1A 3OD7A 5AA3A 1A7LA 2CMOA 4P0GA 4H67A 1VE4A 3MUQA 3MPKA 3PUYE 2B65A 3ODBA 1PEBA 1B51A 4GRKA 1JETA 1LFIA 2AIXA 5DVIA 4OERA 2F6PA 1BP5A 4M4GA 4O3BA 1QKBA 2BJJX 4OETA 2HEUA 3FJMA 3IB1A 2ONRA 4DXCA 2PT2A 4FIMA 1VSOA 5EHMA 3PUXE 3FASA 1Y3PA 3THIA 4MFIA 1AIVA 1B3FA 2W7YA 3K01A 4YB7A 3TQWA 2WOPA 3W15C 3SDFA 3CRBA 5AA2A 5CC2A 3SETA 1L5TA 4FATA 1FQBA 4QSDA 3MVYA 4KYSA 1IITA 2PMSA 1PDAA 5ITPA 4C1TA 1Y3QA 2XD3A 4TQUQ 1UTHB 2QMWA 1DTGA 3EF7A 4BLAA 2QS3A 1SI0A 4Z0IA 4IO4A 3G3HA 2PBWA 3EQ1A 3MJNA 3DRFA 4TOZA 3IK6B 3IR1A 1FQDA 1FTKA 4F1YA 1EZ9A 1QW0A 5CM6A 3ZKKA 4IB2A 3N5LA 3KN7A 3C35A 3LBSA 5DT6A 3S9MC 4ZS9A 1OLCA 5DVJA 3WAFA 3RYAA 3KOTA 3ONMA 3GXAA 4GVOA 4QFOA 4R74A 4BDNA 2DE2A 5BWJA 3VFJA 3SEUA 2B4LA 1UQWA 1B05A 3FXUA 4IO6A 3VLVA 3RYBA 1OVBA 4N6PA 3PMXA 1A54A 2I4CA 3IOTA 1OMPA 3TMGA 1B5HA 1NKXA 1POY1 4XIGQ 3MQ9A 1LAGE 2D21A 2I3WA 1SW4A 4LZ7A 3H3GA 5L9SA 4DXBA 1ZBMA 1B0LA 3HO7A 3Q27A 4LVQA 1ZMGA 3CFLA 1H43A 3KSJA 4UACA 2XXPA 2GHBA 4LZ8A 4LQ5A 4LQ2A 2HAVA 1H45A 3MZ9A 1MXXA 1MPDA 3QYTA 3QAXA 2V3QA 1DPEA 3TCGA 1ZKBA 3FATA 5JTYB 3TKDA 4F39A 1WVJA 4X48A 3LR1A 3VLWA 1NNFA 1MXUA 2QRYA 4POWA 3MVWA 3N94A 4NWCA 2WKYA 4LA9A 4KHZE 4JSDA 3IOWA 4GOTA 3KJTA 3A09A 4KPTA 1Y9UA 3PMVA 4XKRA 4F1UA 3PUVE 5FTHA 1YAEA 4ESWA 1ZU0A 3K1PA 3O28A 3RN8A 4FECA 2H98A 3T9VA 4P11A 2OBGA 2OZZA 5B70A 3I5OA 3V8XB 2VP1A 3DRHA 3VLUA 1MPBA 2Y7WA 1NNPA 2GH9A 4JBZA 1DTZA 1LBBA 5I58B 5KDTA 2I49A 1QJMA 4LUBA 3MP1A 5TU0A 4LZ5A 4F18A 1HSJA 4I8CA 4C1UA 1YTVA 5TPAA 2F35A 1ELJA 2DOJA 5CMKA 4ZZEA 4YMAA 4BDRA 3SEVA 2ALUA 4NF6B 2THIA 4RXLA 3HHGA 3S9EA 2DE3A 4GXSB 1B7ZA 1Y4CA 4AB5A 4OFOA 3LVUA 3HSTA 5TP9A 4YICA 3H6TA 3O6IA 1A55A 4G8MA 2NUVA 3LSLA 1B40A 3K1MA 1N84A 1IUDA 1UIUA 3U1OA 3IORA 2M8CA 1H44A 5DYHA 3TFLA 5H8QB 2E0SA 3SEWA 2VOZA 1DSNA 3KFMA 2Z22A 1SYHA 1NL5A 3T9UA 3RQTA 2F7BA 3UN6A 1NMUA 3RT8A 1IXCA 1OIBA 2F36A 3QXMA 3PPRA 3O29A 4ND9A 3IOVA 1MH3A 1PBQA 3S9NC 5FHNA 4ECFA 2PYYA 4QFKA 3JV9A 4MLVA 4K3FA 3QIMA 2ZYOA 3G3GA 1HSLA 4IGRA 5KZTA 1P1OA 3EPEA 1MY0A 3K6WA 3EN3A 2Z8FA 1QUKA 2Y7IA 3DP4A 3W9VA 3LSXA 4U1ZA 1N3WA 4RK2A 5F1QA 3OO8A 3C9HA 3S9LC 2ONSA 4JWXA 3AXFA 3PPQA 3P7IA 1NNKA 1AMFA 3FVNA 1FTLA 3ZKLA 3QK6A 4GQOA 4AQ4A 2DQVA 2RC9A 3CIJA 3IB2A 2RINA 1LCTA 1SYIA 4OHNA 4IO5A 1ATGA 4U23A 3V5AA 2ANJA 1DPPA 3TPAA 3PV0E 4PFWA 2HXWA 3FUZA 3R26A 3RTWB 1JNFA 3TCHA 1FCKA 2ESNA 2B3BA 2QMXA 1ZLQA 1LAFE 3UIFA 2P0SA 4G68B 1ZTYA 1MXYA 3I6VA 3O6PA 1JVXA 1S9TA 2V3TA 4GL0A 4RPNA 1B9JA 1USYH 4G4PA 3N6TA 4F1VA 3OSRA 1OVTA 1B5JA 3H06B 3IJOB 1AOVA 3TEPA 3MPLA 3Q29A 2F8DA 5ICTA 4IO2A 3IX1A 1M5BA 3CR9A 3TDJA 1VR5A 2FNCA 3LC8A 1M5FA 3KBRA 4MF3A 1FTMA 4E0WA 5I59A 4G77A 3EHTA 4F3SA 4KI0E 1BKAA 4IGTA 2F7CA 2P2AA 4H65A 4IO7A 5ITOA 1IQ7A 3TTLA 4G8NA 2HQ0A 3K6UA 5F7VA 4U2RA 4NF8A 1QVSA 3FVGA 4KYDA 5AA2B 5CMCA 5CRYA 3KZGA 1Z7NE 5L9MA 4HCYA 3H6UA 2UYFA 4QFNA 3CG1A 3FVOA 3FZVA 3O6GA 1QKAA 3Q26A 1B3LA 2Q2CA 4JWYA 4OFJA 1D3KA 2AL5A 3KG2A 3O9PA 5CMBA 2O68A 3O97A 4KR5A 5LOMA 3OENA 2OLBA 3FXRA 3PD8A 2HZKA 1RYOA 2VD3A 4RYAA 1MS7A 4PQJA 3PAMA 3EHUA 2X26A 3DRJA 4R73A 3CVGA 3UGWA 1FW0A 1M5EA 3TAJA 4ZEKA 1ZJLA 2FA7A 3F11A 2H25A 5HM4B 3PU5A 4QSCA 3MWBA 1JEUA 3GBBA 3HHFA 3HCQA 1ZIUA 3H6VA 2QS4A 3K6XA 3K1NA 4FEDA 1EZOA 3FV2A 1MQDA 1Y1MA 3Q28A 1BTJA 4F22A 1MQJA 2H99A 3B7DA 1WODA 3MVZA 4YZZA 1LAHE 4ZEDA 4R9GA 2OWSA 2XXUA 3RGYA 1LB9A 3TUSA 1GV8A 4PFYA 4YKJA 5M2VA 2DWHA 3IOUA 1B3GA 3FD3A 3E3KA 1M5CA 2OK2A 3FXQA 1SW5A 3IL1B 3VVFA 5I2NA 1B1XA 1XVYA 5ISUA 1IXIA 5A5XA 2UVGA 3G3KA 2XXWA 4GD5A 4GWOA 1XS5A 5AA4A 4FORA 4MBPA 2VHAA 2REGA 2V93A 2X7PA 1VFDA 5H8NA 2D5WA 3L6GA 3G3JA 2XXIA 3M3LA 3K2DA 4KYEA 4F31B 3CFZA 3QUFA 4I9DA 1AH5A 1EU8A 3IB0A 4G2ZA 3UORA 4OWDA 2OWTA 1LBCA 3LSFB 3T9HB 1QUJA 3S2VA 3RUMA 1YCJA 1J1NA 4Q0CA 4OXVA 2I58A 5HBCA 3PPNA 4ZE8A 1RYXA 5KCJA 2B3FA 3O66A 5HPQA 3RTFB 2F5XA 1JEVA 4H6DA 1MDQA 4TLMB 3O6HA 2LAOA 4WEDA 4NWDA 3MP6A 4U4SA 1OQGA 5I57A 2FYIA 3A3CA 1MXVA 3DRGA 3JYRA 4F19A 1R9LA 3I3VA 2NWJA 4QRZA 2GHAA 2G29A 5KDTB 2GRVA 1ANFA 2QSXA 3VXBA 4DDDA 2HFBA 3KN8A 3MZ1A 3SERA 4DXUA 5H8SA 1LB8A 4NTLA 1Q35A 1US4A 4YKPA 3FJGA 1I6AA 2AYSA 1VFEA 1OQHA 4JXIA 3U93A 1B6HA 3TYHA 3C32A 4OVJA 5TPAB 3ZS6A 5EHSA 3O2AA 1CB6A 3CSBA 2YLNA 3ILUB 1LFHA 4PE5B 4YKIA 1MQHA 4EDPA 1MXZA 4MLQA 4R6KA 3D4CA 1DMBA 5TP9B 3SKPA 3R6UA 3HN0A 2Z8EA 2XHDA 4YU0A 4YB5A 1SI1A 1UTBA 4GL8A 2X7QA 3TTKA 2RKMA 2O69A 1FTOA 1XOCA 4KCCA 1MM6A 4DE8A 2Z8DA 4PFUA 3BBRA 2O1MA 2F97A 3KJ7A 3H03A 4DLDA 1PBPA 1B4ZA 3U72A 3CHGA 2DXRA 3FV1A 3KSXA 1H3DA 2UYEA 1Z7ME 1URSA 4N13A 3OXNA 3A3UA 3RNNA 1B46A 3K0VA 4MH5A 2G93A 4R2BA 1B5IA 1IIWA 3MW0A 1US5A 2F34A 1S7YA 1BLFA 1NFTA 3DLNA 4LONB 2O1LA 5ELVA 5AA2D 5JK4A 5JEIA 1B0HA 4ONYA 1RKMA 2DXYA 2ZNTA 1MH4A 5CI5A 2RC8A 3V89B 1B2HA 3MAMA 3C31A 4JDFA 2I3VA 2VD2A 2Y7KA 3GLBA 3VDFA 2H4IA 5BUUA 4GF8A 2R71A 3FVKA 2DWJA 1TT1A 4YAHX 3S4UA 3DELB 1R9QA 3ILTB 4ELRA 3LUYA 2I6EA 1POTA 2A5SA 1TWYA 3T9XB 1TXFA 1LGBC 3IJXB 2XXQA 3OO7A 1QULA 4M1VA 3PMWA 1LLSA 5DVFA 1JVYA 3BFTA 1Q1KA 3KN3A 2Q9TA 2XXYA 4X9TA 3UK4A 4Q5TA 4Z7EA 3OO6A 3T66A 3IAZA 2RF1A 3E9XA 1I69A 3OELA 2IA4A 1JW5A 4ZECA 3MP8A 4NF4A 4RJZA 3IO6A 4H8IA 3TELA 1SQYA 1B52A 3PUZE 3ZSFA 2YPNA 1N3XA 3TTRA 2A5TA 4IY5A 3RLFE 1I6QA 5L9OA 1FQAA 2UVJA 1SW2A 4RA1A 4OFLA 1DOTA 5ICQA 1LCFA 2REJA 4H5GA 3G3FA 5CBSA 1IZ1A 2F78A 1P1NA 4U1OA 2ZXTA 2DP8A 1WDNA 3RPWA 3CI8A 1QUIA 3DM0A 1B1HA 4YMBA 3TQLA 1B3HA 1M5DA 1Y20A 3QUJA 3OEMA 5I59B 1N7XA 3CFXA 4ZEIA 1SW1A 4E0XA 3BFUA 1NH8A 4R75A 3V83A 4OTEA 4DIGA 4ELOA 2XX7A 2Q8JA 2V3UA 3M3FA 2Q89A 2HCAA 3C34A 4FE8A 4NF8B 1XVXA 3QSLA 2I0CA 3N6UA 2ZNUA 4H1XA 4KCDA 4OYVA 5FTIA 4QF9A 1D4NA 4RNSA 1F9BA 1IEJA 4O3CA 1FQEA 4HS7A 1A40A 3K6VA 4I62A 2OJTA 2XX8A 3K4UA 4DZ1A 2YJPA 1N76A 3C33A 3H6WA 4KQPA 4JWOA 2ABHA 4QSEA 3TCFA 3B6WA 2F6GA 1YPNA 2QS1A 4FJPA 4RK9A 3CG3A 4F2OA 2D3IA 4QFPA 4L17A 2GFEA 3VV5A 1T0KA 4NMYA 5K2XA 1URDA 4R6HA 4G68C 1PB9A 3SEYA 3DRKA 4GIZA 3T93B 4BDQA 4OMBA 4QHQA 1UTHA 2P1SA 4ELQA 2IEEA 4BDLA 1B32A 2DWIA 1EH3A 1MPCA 3GZGA 1B58A 1SVXB 3VXCA 1II5A 3FTOA 4NEDA 1HSEA 3DRIA 2HZLA 2UVIA 3VVDA 3E4RA 4NF5B 5I84A 2DVZA 2VGQA 1TFAA 4EUOA 4EF2A 4LP2B 1MQGA 1MXWA 4I1DA 3PGFA 4NF5A 4Q8RA 4GXAA 4KFQA 4XXUA 3L6HA 4YB6A 4LATA 3PPOA 4RY1A 5I2NB 2RC7A 3T22A 1IXGA 5A5XB 3OEKA 3MZBA 2UXAA 1Y1ZA 5AA4B 4X1DA 1MY4A 2H5YA 4HCWA 4GFRA 1BIYA 5H8NB 3FGSA 2RCBA 3VE1B 1NNTA 5I56B 3HPIA 1MDP1 4H5FA 2Q88A 3KGCA 3OO9A 3TODA 5IAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GR2 A;  3B6T A;  5I56 A;  2Y7P A;  4EQ7 A;  2F7A A;  1MY2 A;  1N7W A;  2O7I A;  4X1B A;  4OEV A;  1A99 A;  2WOL A;  4WEP A;  3R7X A;  1AL3 A;  4PP0 A;  3B6Q A;  3TTN A;  1B7H A;  5KCJ B;  1NH7 A;  4H0W A;  1CE2 A;  2NVU B;  3PPP A;  2O51 A;  5AE4 A;  1OLA A;  4FAJ A;  4P0I A;  1P1Q A;  3G3I A;  4KD5 A;  5DEX B;  5JTY A;  1B4H A;  3M3K A;  5IKB A;  3GBA A;  1EZP A;  3H4Z A;  3N26 A;  4WKM A;  2DWA A;  5I57 B;  2ZNS A;  2H9B A;  4OZ9 A;  5DEX A;  2V84 A;  3USD A;  1D9Y A;  4YKK A;  3G7W A;  3ECR A;  4IY6 A;  4ELP A;  2HAU A;  1R1N A;  4ZEF A;  4JB7 A;  1H76 A;  4U21 A;  2PT1 A;  5EYF A;  4F3P A;  1PB8 A;  1SBP A;  1MRP A;  2RCA A;  2Y84 A;  4OQO A;  1XC1 A;  2DYX A;  3VVE A;  3SEX A;  4RPO A;  5FHO A;  5CMM A;  5H8F B;  1Y4T A;  4PFT A;  1P1U A;  4H8J A;  5B7D A;  1I6B A;  4EXK A;  2XXT A;  3JZJ A;  5L8D A;  2NXO A;  3SES A;  2R9J A;  4GLI A;  2O6A A;  5H8F A;  2I48 A;  1N0T A;  4DCY A;  2O84 X;  3PD9 A;  3C4M A;  4R9F A;  5I58 A;  1UTB B;  1MY3 A;  3TZA A;  3Q25 A;  3K02 A;  2B4M A;  3BKI B;  2DS9 A;  4IO3 A;  2XXR A;  2ZMB A;  4BDM A;  1LFG A;  2XX9 A;  3MC2 A;  2UVH A;  2ONK E;  4OEN A;  2V25 A;  4OES A;  1JW4 A;  4FEB A;  1B3E A;  3EHS A;  4EF1 A;  3RY3 A;  3KEI A;  1TFD A;  4NF6 A;  4R72 A;  4NE4 A;  3MVX A;  1O63 A;  4OEU A;  2Y7R A;  4F2Q A;  1GTK A;  4DCX A;  4C0R A;  3M8U A;  3IO4 A;  2AL4 A;  2ZYN A;  2E1S A;  3U8Q A;  2OCU A;  5K2Y A;  3WAE A;  2I0B A;  4XKN A;  2WOK A;  2DSF A;  1FTJ A;  1JW1 A;  2ZYM A;  1FQF A;  1JQF A;  1O7T A;  2Q2A A;  4AB6 A;  4EQB A;  1IXH A;  4O3A A;  1MM7 A;  4ESX A;  1URG A;  3OSQ A;  5H8Q A;  3OMB A;  3TTM A;  4XKQ A;  1S50 A;  3K00 A;  1SDX A;  3D4G A;  3MBP A;  4JSO A;  4WXJ A;  3H7M A;  5I2K B;  1XT8 A;  3DP6 A;  2DE4 A;  1Y3N A;  4F3G A;  4ZE9 A;  4THI A;  3E13 X;  2QS2 A;  1P99 A;  5I2K A;  3UP9 A;  1USY E;  3RT6 B;  1MQI A;  2QJE A;  3KOS A;  1XHY A;  5FHM A;  4TLL B;  3U94 A;  4ISU A;  4PET A;  4HW8 A;  1N04 A;  3FJ7 A;  4BDO A;  2R6G E;  3T96 B;  4R6Y A;  1O64 A;  1MG1 A;  2NOO A;  1P1W A;  4UA8 A;  4XTC Q;  1GGG A;  1A8F A;  3UA8 A;  2QL3 A;  4HTG A;  1D9V A;  4R2F A;  2XD2 A;  4ZZA A;  3CSG A;  2O7U A;  2CZL A;  4Q30 B;  4EXL A;  1R6Z A;  1FQC A;  5J1D A;  2DVC A;  4QFL A;  1UIV A;  4ZDM A;  1PB7 A;  2I4B A;  2XXH A;  4N07 A;  2PX1 A;  4NF4 B;  3U92 A;  4POX A;  1LAX A;  1LST A;  2A5T B;  4G8H A;  1KWH A;  3C36 A;  4ZEB A;  5CBR A;  4U4X A;  3HV1 A;  1A8E A;  3FIR A;  4EQ9 A;  4U22 A;  5H8H B;  2ZYK A;  3PUW E;  4XKP A;  1MY1 A;  2QPQ A;  4F3B A;  5H8H A;  3W9W A;  2XXX A;  3OOA A;  2PVU A;  2Z23 A;  1SD3 A;  3DP8 A;  3LSW A;  2XXV A;  4G68 A;  5DTB A;  2KLF A;  4F29 A;  1B7U A;  1PC3 A;  1GVC A;  5AA1 A;  3OD7 A;  5AA3 A;  1A7L A;  2CMO A;  4P0G A;  4H67 A;  1VE4 A;  3MUQ A;  3MPK A;  3PUY E;  2B65 A;  3ODB A;  1PEB A;  1B51 A;  4GRK A;  1JET A;  1LFI A;  2AIX A;  5DVI A;  4OER A;  2F6P A;  1BP5 A;  4M4G A;  4O3B A;  1QKB A;  2BJJ X;  4OET A;  2HEU A;  3FJM A;  3IB1 A;  2ONR A;  4DXC A;  2PT2 A;  4FIM A;  1VSO A;  5EHM A;  3PUX E;  3FAS A;  1Y3P A;  3THI A;  4MFI A;  1AIV A;  1B3F A;  2W7Y A;  3K01 A;  4YB7 A;  3TQW A;  2WOP A;  3W15 C;  3SDF A;  3CRB A;  5AA2 A;  5CC2 A;  3SET A;  1L5T A;  4FAT A;  1FQB A;  4QSD A;  3MVY A;  4KYS A;  1IIT A;  2PMS A;  1PDA A;  5ITP A;  4C1T A;  1Y3Q A;  2XD3 A;  4TQU Q;  1UTH B;  2QMW A;  1DTG A;  3EF7 A;  4BLA A;  2QS3 A;  1SI0 A;  4Z0I A;  4IO4 A;  3G3H A;  2PBW A;  3EQ1 A;  3MJN A;  3DRF A;  4TOZ A;  3IK6 B;  3IR1 A;  1FQD A;  1FTK A;  4F1Y A;  1EZ9 A;  1QW0 A;  5CM6 A;  3ZKK A;  4IB2 A;  3N5L A;  3KN7 A;  3C35 A;  3LBS A;  5DT6 A;  3S9M C;  4ZS9 A;  1OLC A;  5DVJ A;  3WAF A;  3RYA A;  3KOT A;  3ONM A;  3GXA A;  4GVO A;  4QFO A;  4R74 A;  4BDN A;  2DE2 A;  5BWJ A;  3VFJ A;  3SEU A;  2B4L A;  1UQW A;  1B05 A;  3FXU A;  4IO6 A;  3VLV A;  3RYB A;  1OVB A;  4N6P A;  3PMX A;  1A54 A;  2I4C A;  3IOT A;  1OMP A;  3TMG A;  1B5H A;  1NKX A;  1POY 1;  4XIG Q;  3MQ9 A;  1LAG E;  2D21 A;  2I3W A;  1SW4 A;  4LZ7 A;  3H3G A;  5L9S A;  4DXB A;  1ZBM A;  1B0L A;  3HO7 A;  3Q27 A;  4LVQ A;  1ZMG A;  3CFL A;  1H43 A;  3KSJ A;  4UAC A;  2XXP A;  2GHB A;  4LZ8 A;  4LQ5 A;  4LQ2 A;  2HAV A;  1H45 A;  3MZ9 A;  1MXX A;  1MPD A;  3QYT A;  3QAX A;  2V3Q A;  1DPE A;  3TCG A;  1ZKB A;  3FAT A;  5JTY B;  3TKD A;  4F39 A;  1WVJ A;  4X48 A;  3LR1 A;  3VLW A;  1NNF A;  1MXU A;  2QRY A;  4POW A;  3MVW A;  3N94 A;  4NWC A;  2WKY A;  4LA9 A;  4KHZ E;  4JSD A;  3IOW A;  4GOT A;  3KJT A;  3A09 A;  4KPT A;  1Y9U A;  3PMV A;  4XKR A;  4F1U A;  3PUV E;  5FTH A;  1YAE A;  4ESW A;  1ZU0 A;  3K1P A;  3O28 A;  3RN8 A;  4FEC A;  2H98 A;  3T9V A;  4P11 A;  2OBG A;  2OZZ A;  5B70 A;  3I5O A;  3V8X B;  2VP1 A;  3DRH A;  3VLU A;  1MPB A;  2Y7W A;  1NNP A;  2GH9 A;  4JBZ A;  1DTZ A;  1LBB A;  5I58 B;  5KDT A;  2I49 A;  1QJM A;  4LUB A;  3MP1 A;  5TU0 A;  4LZ5 A;  4F18 A;  1HSJ A;  4I8C A;  4C1U A;  1YTV A;  5TPA A;  2F35 A;  1ELJ A;  2DOJ A;  5CMK A;  4ZZE A;  4YMA A;  4BDR A;  3SEV A;  2ALU A;  4NF6 B;  2THI A;  4RXL A;  3HHG A;  3S9E A;  2DE3 A;  4GXS B;  1B7Z A;  1Y4C A;  4AB5 A;  4OFO A;  3LVU A;  3HST A;  5TP9 A;  4YIC A;  3H6T A;  3O6I A;  1A55 A;  4G8M A;  2NUV A;  3LSL A;  1B40 A;  3K1M A;  1N84 A;  1IUD A;  1UIU A;  3U1O A;  3IOR A;  2M8C A;  1H44 A;  5DYH A;  3TFL A;  5H8Q B;  2E0S A;  3SEW A;  2VOZ A;  1DSN A;  3KFM A;  2Z22 A;  1SYH A;  1NL5 A;  3T9U A;  3RQT A;  2F7B A;  3UN6 A;  1NMU A;  3RT8 A;  1IXC A;  1OIB A;  2F36 A;  3QXM A;  3PPR A;  3O29 A;  4ND9 A;  3IOV A;  1MH3 A;  1PBQ A;  3S9N C;  5FHN A;  4ECF A;  2PYY A;  4QFK A;  3JV9 A;  4MLV A;  4K3F A;  3QIM A;  2ZYO A;  3G3G A;  1HSL A;  4IGR A;  5KZT A;  1P1O A;  3EPE A;  1MY0 A;  3K6W A;  3EN3 A;  2Z8F A;  1QUK A;  2Y7I A;  3DP4 A;  3W9V A;  3LSX A;  4U1Z A;  1N3W A;  4RK2 A;  5F1Q A;  3OO8 A;  3C9H A;  3S9L C;  2ONS A;  4JWX A;  3AXF A;  3PPQ A;  3P7I A;  1NNK A;  1AMF A;  3FVN A;  1FTL A;  3ZKL A;  3QK6 A;  4GQO A;  4AQ4 A;  2DQV A;  2RC9 A;  3CIJ A;  3IB2 A;  2RIN A;  1LCT A;  1SYI A;  4OHN A;  4IO5 A;  1ATG A;  4U23 A;  3V5A A;  2ANJ A;  1DPP A;  3TPA A;  3PV0 E;  4PFW A;  2HXW A;  3FUZ A;  3R26 A;  3RTW B;  1JNF A;  3TCH A;  1FCK A;  2ESN A;  2B3B A;  2QMX A;  1ZLQ A;  1LAF E;  3UIF A;  2P0S A;  4G68 B;  1ZTY A;  1MXY A;  3I6V A;  3O6P A;  1JVX A;  1S9T A;  2V3T A;  4GL0 A;  4RPN A;  1B9J A;  1USY H;  4G4P A;  3N6T A;  4F1V A;  3OSR A;  1OVT A;  1B5J A;  3H06 B;  3IJO B;  1AOV A;  3TEP A;  3MPL A;  3Q29 A;  2F8D A;  5ICT A;  4IO2 A;  3IX1 A;  1M5B A;  3CR9 A;  3TDJ A;  1VR5 A;  2FNC A;  3LC8 A;  1M5F A;  3KBR A;  4MF3 A;  1FTM A;  4E0W A;  5I59 A;  4G77 A;  3EHT A;  4F3S A;  4KI0 E;  1BKA A;  4IGT A;  2F7C A;  2P2A A;  4H65 A;  4IO7 A;  5ITO A;  1IQ7 A;  3TTL A;  4G8N A;  2HQ0 A;  3K6U A;  5F7V A;  4U2R A;  4NF8 A;  1QVS A;  3FVG A;  4KYD A;  5AA2 B;  5CMC A;  5CRY A;  3KZG A;  1Z7N E;  5L9M A;  4HCY A;  3H6U A;  2UYF A;  4QFN A;  3CG1 A;  3FVO A;  3FZV A;  3O6G A;  1QKA A;  3Q26 A;  1B3L A;  2Q2C A;  4JWY A;  4OFJ A;  1D3K A;  2AL5 A;  3KG2 A;  3O9P A;  5CMB A;  2O68 A;  3O97 A;  4KR5 A;  5LOM A;  3OEN A;  2OLB A;  3FXR A;  3PD8 A;  2HZK A;  1RYO A;  2VD3 A;  4RYA A;  1MS7 A;  4PQJ A;  3PAM A;  3EHU A;  2X26 A;  3DRJ A;  4R73 A;  3CVG A;  3UGW A;  1FW0 A;  1M5E A;  3TAJ A;  4ZEK A;  1ZJL A;  2FA7 A;  3F11 A;  2H25 A;  5HM4 B;  3PU5 A;  4QSC A;  3MWB A;  1JEU A;  3GBB A;  3HHF A;  3HCQ A;  1ZIU A;  3H6V A;  2QS4 A;  3K6X A;  3K1N A;  4FED A;  1EZO A;  3FV2 A;  1MQD A;  1Y1M A;  3Q28 A;  1BTJ A;  4F22 A;  1MQJ A;  2H99 A;  3B7D A;  1WOD A;  3MVZ A;  4YZZ A;  1LAH E;  4ZED A;  4R9G A;  2OWS A;  2XXU A;  3RGY A;  1LB9 A;  3TUS A;  1GV8 A;  4PFY A;  4YKJ A;  5M2V A;  2DWH A;  3IOU A;  1B3G A;  3FD3 A;  3E3K A;  1M5C A;  2OK2 A;  3FXQ A;  1SW5 A;  3IL1 B;  3VVF A;  5I2N A;  1B1X A;  1XVY A;  5ISU A;  1IXI A;  5A5X A;  2UVG A;  3G3K A;  2XXW A;  4GD5 A;  4GWO A;  1XS5 A;  5AA4 A;  4FOR A;  4MBP A;  2VHA A;  2REG A;  2V93 A;  2X7P A;  1VFD A;  5H8N A;  2D5W A;  3L6G A;  3G3J A;  2XXI A;  3M3L A;  3K2D A;  4KYE A;  4F31 B;  3CFZ A;  3QUF A;  4I9D A;  1AH5 A;  1EU8 A;  3IB0 A;  4G2Z A;  3UOR A;  4OWD A;  2OWT A;  1LBC A;  3LSF B;  3T9H B;  1QUJ A;  3S2V A;  3RUM A;  1YCJ A;  1J1N A;  4Q0C A;  4OXV A;  2I58 A;  5HBC A;  3PPN A;  4ZE8 A;  1RYX A;  5KCJ A;  2B3F A;  3O66 A;  5HPQ A;  3RTF B;  2F5X A;  1JEV A;  4H6D A;  1MDQ A;  4TLM B;  3O6H A;  2LAO A;  4WED A;  4NWD A;  3MP6 A;  4U4S A;  1OQG A;  5I57 A;  2FYI A;  3A3C A;  1MXV A;  3DRG A;  3JYR A;  4F19 A;  1R9L A;  3I3V A;  2NWJ A;  4QRZ A;  2GHA A;  2G29 A;  5KDT B;  2GRV A;  1ANF A;  2QSX A;  3VXB A;  4DDD A;  2HFB A;  3KN8 A;  3MZ1 A;  3SER A;  4DXU A;  5H8S A;  1LB8 A;  4NTL A;  1Q35 A;  1US4 A;  4YKP A;  3FJG A;  1I6A A;  2AYS A;  1VFE A;  1OQH A;  4JXI A;  3U93 A;  1B6H A;  3TYH A;  3C32 A;  4OVJ A;  5TPA B;  3ZS6 A;  5EHS A;  3O2A A;  1CB6 A;  3CSB A;  2YLN A;  3ILU B;  1LFH A;  4PE5 B;  4YKI A;  1MQH A;  4EDP A;  1MXZ A;  4MLQ A;  4R6K A;  3D4C A;  1DMB A;  5TP9 B;  3SKP A;  3R6U A;  3HN0 A;  2Z8E A;  2XHD A;  4YU0 A;  4YB5 A;  1SI1 A;  1UTB A;  4GL8 A;  2X7Q A;  3TTK A;  2RKM A;  2O69 A;  1FTO A;  1XOC A;  4KCC A;  1MM6 A;  4DE8 A;  2Z8D A;  4PFU A;  3BBR A;  2O1M A;  2F97 A;  3KJ7 A;  3H03 A;  4DLD A;  1PBP A;  1B4Z A;  3U72 A;  3CHG A;  2DXR A;  3FV1 A;  3KSX A;  1H3D A;  2UYE A;  1Z7M E;  1URS A;  4N13 A;  3OXN A;  3A3U A;  3RNN A;  1B46 A;  3K0V A;  4MH5 A;  2G93 A;  4R2B A;  1B5I A;  1IIW A;  3MW0 A;  1US5 A;  2F34 A;  1S7Y A;  1BLF A;  1NFT A;  3DLN A;  4LON B;  2O1L A;  5ELV A;  5AA2 D;  5JK4 A;  5JEI A;  1B0H A;  4ONY A;  1RKM A;  2DXY A;  2ZNT A;  1MH4 A;  5CI5 A;  2RC8 A;  3V89 B;  1B2H A;  3MAM A;  3C31 A;  4JDF A;  2I3V A;  2VD2 A;  2Y7K A;  3GLB A;  3VDF A;  2H4I A;  5BUU A;  4GF8 A;  2R71 A;  3FVK A;  2DWJ A;  1TT1 A;  4YAH X;  3S4U A;  3DEL B;  1R9Q A;  3ILT B;  4ELR A;  3LUY A;  2I6E A;  1POT A;  2A5S A;  1TWY A;  3T9X B;  1TXF A;  1LGB C;  3IJX B;  2XXQ A;  3OO7 A;  1QUL A;  4M1V A;  3PMW A;  1LLS A;  5DVF A;  1JVY A;  3BFT A;  1Q1K A;  3KN3 A;  2Q9T A;  2XXY A;  4X9T A;  3UK4 A;  4Q5T A;  4Z7E A;  3OO6 A;  3T66 A;  3IAZ A;  2RF1 A;  3E9X A;  1I69 A;  3OEL A;  2IA4 A;  1JW5 A;  4ZEC A;  3MP8 A;  4NF4 A;  4RJZ A;  3IO6 A;  4H8I A;  3TEL A;  1SQY A;  1B52 A;  3PUZ E;  3ZSF A;  2YPN A;  1N3X A;  3TTR A;  2A5T A;  4IY5 A;  3RLF E;  1I6Q A;  5L9O A;  1FQA A;  2UVJ A;  1SW2 A;  4RA1 A;  4OFL A;  1DOT A;  5ICQ A;  1LCF A;  2REJ A;  4H5G A;  3G3F A;  5CBS A;  1IZ1 A;  2F78 A;  1P1N A;  4U1O A;  2ZXT A;  2DP8 A;  1WDN A;  3RPW A;  3CI8 A;  1QUI A;  3DM0 A;  1B1H A;  4YMB A;  3TQL A;  1B3H A;  1M5D A;  1Y20 A;  3QUJ A;  3OEM A;  5I59 B;  1N7X A;  3CFX A;  4ZEI A;  1SW1 A;  4E0X A;  3BFU A;  1NH8 A;  4R75 A;  3V83 A;  4OTE A;  4DIG A;  4ELO A;  2XX7 A;  2Q8J A;  2V3U A;  3M3F A;  2Q89 A;  2HCA A;  3C34 A;  4FE8 A;  4NF8 B;  1XVX A;  3QSL A;  2I0C A;  3N6U A;  2ZNU A;  4H1X A;  4KCD A;  4OYV A;  5FTI A;  4QF9 A;  1D4N A;  4RNS A;  1F9B A;  1IEJ A;  4O3C A;  1FQE A;  4HS7 A;  1A40 A;  3K6V A;  4I62 A;  2OJT A;  2XX8 A;  3K4U A;  4DZ1 A;  2YJP A;  1N76 A;  3C33 A;  3H6W A;  4KQP A;  4JWO A;  2ABH A;  4QSE A;  3TCF A;  3B6W A;  2F6G A;  1YPN A;  2QS1 A;  4FJP A;  4RK9 A;  3CG3 A;  4F2O A;  2D3I A;  4QFP A;  4L17 A;  2GFE A;  3VV5 A;  1T0K A;  4NMY A;  5K2X A;  1URD A;  4R6H A;  4G68 C;  1PB9 A;  3SEY A;  3DRK A;  4GIZ A;  3T93 B;  4BDQ A;  4OMB A;  4QHQ A;  1UTH A;  2P1S A;  4ELQ A;  2IEE A;  4BDL A;  1B32 A;  2DWI A;  1EH3 A;  1MPC A;  3GZG A;  1B58 A;  1SVX B;  3VXC A;  1II5 A;  3FTO A;  4NED A;  1HSE A;  3DRI A;  2HZL A;  2UVI A;  3VVD A;  3E4R A;  4NF5 B;  5I84 A;  2DVZ A;  2VGQ A;  1TFA A;  4EUO A;  4EF2 A;  4LP2 B;  1MQG A;  1MXW A;  4I1D A;  3PGF A;  4NF5 A;  4Q8R A;  4GXA A;  4KFQ A;  4XXU A;  3L6H A;  4YB6 A;  4LAT A;  3PPO A;  4RY1 A;  5I2N B;  2RC7 A;  3T22 A;  1IXG A;  5A5X B;  3OEK A;  3MZB A;  2UXA A;  1Y1Z A;  5AA4 B;  4X1D A;  1MY4 A;  2H5Y A;  4HCW A;  4GFR A;  1BIY A;  5H8N B;  3FGS A;  2RCB A;  3VE1 B;  1NNT A;  5I56 B;  3HPI A;  1MDP 1;  4H5F A;  2Q88 A;  3KGC A;  3OO9 A;  3TOD A;  5IAI A; 
#chains in the Genus database with same CATH topology
 1GR2 A;  3B6T A;  5I56 A;  2Y7P A;  4EQ7 A;  2F7A A;  1MY2 A;  1N7W A;  5FBP A;  2O7I A;  1LEV A;  4JVC A;  1Q9D A;  4X1B A;  4OEV A;  4MIJ A;  1A99 A;  2WOL A;  4WEP A;  3R7X A;  1AL3 A;  4PP0 A;  3B6Q A;  3TTN A;  1B7H A;  1G0H A;  5KCJ B;  4GBV A;  1NH7 A;  4H0W A;  1CE2 A;  2NVU B;  3PPP A;  2O51 A;  1LBV A;  5AE4 A;  2CZI A;  1OLA A;  4FAJ A;  4P0I A;  5LDZ A;  1P1Q A;  3G3I A;  4KD5 A;  5DEX B;  3MYU A;  5JTY A;  1B4H A;  3M3K A;  1DK4 A;  5IKB A;  3GBA A;  1EZP A;  3H4Z A;  3N26 A;  4WKM A;  2DWA A;  5I57 B;  2ZNS A;  2H9B A;  4OZ9 A;  5DEX A;  4UAB A;  2V84 A;  3USD A;  1D9Y A;  4NAP A;  4YKK A;  3G7W A;  3ECR A;  4IY6 A;  4ELP A;  4MNP A;  2HAU A;  1G0I A;  1R1N A;  4ZEF A;  2FVZ A;  4JB7 A;  1H76 A;  1RDY A;  4U21 A;  5EQ7 A;  2PT1 A;  4MCO A;  5EYF A;  4F3P A;  1PB8 A;  1SBP A;  1MRP A;  1VDW A;  2RCA A;  2Y84 A;  4OQO A;  1XC1 A;  2DYX A;  3VVE A;  3SEX A;  4RPO A;  5FHO A;  5CMM A;  5H8F B;  1Y4T A;  3IFA A;  4PFT A;  1P1U A;  4H8J A;  5B7D A;  1I6B A;  4EXK A;  2XXT A;  4PAF A;  3JZJ A;  5L8D A;  2NXO A;  3SES A;  2R9J A;  4GLI A;  2O6A A;  5H8F A;  2I48 A;  4NX1 A;  1INP A;  1N0T A;  4DCY A;  2O84 X;  3PD9 A;  3C4M A;  4R9F A;  5I58 A;  1UTB B;  1MY3 A;  1FBD A;  3TZA A;  3Q25 A;  3K02 A;  2B4M A;  1NV7 A;  3BKI B;  2DS9 A;  4IO3 A;  2XXR A;  4NGU A;  2XWO A;  2ZMB A;  4BDM A;  1LFG A;  2XX9 A;  3MC2 A;  2UVH A;  2ONK E;  4OEN A;  2V25 A;  4OES A;  1JW4 A;  4FEB A;  1B3E A;  3EHS A;  4EF1 A;  3RY3 A;  3KEI A;  1TFD A;  4NF6 A;  4R72 A;  4NE4 A;  3MVX A;  1O63 A;  4OEU A;  2Y7R A;  4F2Q A;  1GTK A;  4DCX A;  1NUZ A;  3A29 A;  4C0R A;  3M8U A;  2WBB A;  3IO4 A;  2AL4 A;  2ZYN A;  2E1S A;  3U8Q A;  2OCU A;  5K2Y A;  3WAE A;  2I0B A;  4XKN A;  2WOK A;  2DSF A;  1FTJ A;  1JW1 A;  2ZYM A;  4P1E A;  1FQF A;  1JQF A;  1O7T A;  2Q2A A;  4AB6 A;  4EQB A;  1IXH A;  4O3A A;  1MM7 A;  4ESX A;  1URG A;  3OSQ A;  5H8Q A;  3OMB A;  3TTM A;  4XKQ A;  2OWZ A;  1S50 A;  3K00 A;  1SDX A;  3D4G A;  1FPI A;  3MBP A;  4JSO A;  4WXJ A;  3H7M A;  4P1L A;  5I2K B;  4PGP A;  1XT8 A;  3DP6 A;  2DE4 A;  4PFB A;  1Y3N A;  2ZZV A;  4DI4 B;  4F3G A;  1NUX A;  4ZE9 A;  4THI A;  3E13 X;  2QS2 A;  1P99 A;  5I2K A;  2HXR A;  3UP9 A;  1USY E;  3RT6 B;  1MQI A;  2QJE A;  3KOS A;  1XHY A;  5FHM A;  2R8T A;  4TLL B;  3U94 A;  4ISU A;  4PET A;  4HW8 A;  1N04 A;  3FJ7 A;  4BDO A;  2R6G E;  3T96 B;  1FBF A;  4R6Y A;  1O64 A;  1MG1 A;  2NOO A;  1P1W A;  4UA8 A;  4XTC Q;  1GGG A;  4IR8 A;  1A8F A;  3UA8 A;  2QL3 A;  4HTG A;  1D9V A;  4R2F A;  3SZP A;  1LBY A;  2XD2 A;  4ZZA A;  3CSG A;  1NV3 A;  2O7U A;  2CZL A;  4Q30 B;  4EXL A;  1R6Z A;  1FQC A;  3D1R A;  5J1D A;  2DVC A;  4QFL A;  1UIV A;  4ZDM A;  1PB7 A;  2I4B A;  2XXH A;  4N07 A;  2PX1 A;  4NF4 B;  4POX A;  3U92 A;  1LAX A;  1LST A;  3FBP A;  2A5T B;  4G8H A;  1KWH A;  4GWS A;  3C36 A;  3T0J A;  4ZEB A;  5CBR A;  4U4X A;  3HV1 A;  4X8R A;  1A8E A;  3FIR A;  4EQ9 A;  4U22 A;  5ET6 A;  5H8H B;  5IM2 A;  2ZYK A;  3PUW E;  4XKP A;  1MY1 A;  2QPQ A;  4F3B A;  5H8H A;  3W9W A;  2XXX A;  2WX9 A;  3OOA A;  2PVU A;  2Z23 A;  1SD3 A;  4PF6 A;  1RDX A;  3DP8 A;  3LSW A;  1LBZ A;  2XXV A;  4G68 A;  5DTB A;  2KLF A;  4F29 A;  1B7U A;  1PC3 A;  1GVC A;  5AA1 A;  3OD7 A;  1YYZ A;  5AA3 A;  1FRP A;  1A7L A;  2CMO A;  4P0G A;  2MKZ A;  4H67 A;  1VE4 A;  3MUQ A;  3MPK A;  1NUW A;  3PUY E;  2B65 A;  3ODB A;  1PEB A;  1B51 A;  4GRK A;  1JET A;  1LFI A;  1NV2 A;  2AIX A;  5DVI A;  4OER A;  2F6P A;  4PFI A;  1BP5 A;  4M4G A;  4O3B A;  1QKB A;  2BJJ X;  4OET A;  2HEU A;  3FJM A;  2WYP A;  3IB1 A;  2ONR A;  4DXC A;  2PT2 A;  4FIM A;  1VSO A;  5EHM A;  3PUX E;  3FAS A;  4PFR A;  4MX6 A;  1Y3P A;  3THI A;  4MFI A;  4JVI A;  1LBW A;  4AS4 A;  4GWY A;  1AIV A;  1B3F A;  1DBZ A;  1JP4 A;  4O7M A;  2W7Y A;  1AWB A;  3K01 A;  4YB7 A;  3TQW A;  4I3E A;  2WOP A;  3W15 C;  3EKI A;  3SDF A;  3RYD A;  3CRB A;  5AA2 A;  5CC2 A;  4N6D A;  3SET A;  1L5T A;  4FAT A;  1IMF A;  1FQB A;  4QSD A;  3MVY A;  4KYS A;  3IFC A;  1FBE A;  1NV1 A;  1IIT A;  2PMS A;  1PDA A;  4XF5 A;  5ITP A;  4C1T A;  1Y3Q A;  2XD3 A;  4TQU Q;  1UTH B;  2QMW A;  1DTG A;  3EF7 A;  4BLA A;  2QS3 A;  1SI0 A;  4Z0I A;  4IO4 A;  3G3H A;  2PBW A;  3EQ1 A;  3MJN A;  3DRF A;  4TOZ A;  3IK6 B;  2CEX A;  3IR1 A;  1FQD A;  1FTK A;  4F1Y A;  1EZ9 A;  1QW0 A;  5CM6 A;  3ZKK A;  4IB2 A;  3N5L A;  3KN7 A;  3C35 A;  3LBS A;  4GWZ A;  5DT6 A;  3S9M C;  4PCD A;  4ZS9 A;  1OLC A;  5DVJ A;  1SPI A;  3WAF A;  3B50 A;  3RYA A;  3KOT A;  3ONM A;  3GXA A;  4GVO A;  4QFO A;  4R74 A;  4BDN A;  2DE2 A;  4PDH A;  5BWJ A;  2WYK A;  3VFJ A;  3SEU A;  2B4L A;  1UQW A;  1B05 A;  3BIG A;  3FXU A;  4IO6 A;  3VLV A;  3RYB A;  1OVB A;  4N6P A;  3PMX A;  1A54 A;  2I4C A;  4HE0 A;  2FBP A;  4GX3 A;  3IOT A;  3B8B A;  1OMP A;  3TMG A;  1B5H A;  3KC1 A;  1NKX A;  1POY 1;  4XIG Q;  3MQ9 A;  1LAG E;  2D21 A;  4MHF A;  2I3W A;  1SW4 A;  4NN3 A;  4LZ7 A;  3H3G A;  5L9S A;  4DXB A;  1ZBM A;  1B0L A;  3HO7 A;  3Q27 A;  4LVQ A;  4N15 A;  1ZMG A;  3CFL A;  1FPF A;  4PGN A;  1H43 A;  3KSJ A;  4UAC A;  2XXP A;  2GHB A;  4LZ8 A;  4LQ5 A;  4LQ2 A;  2HAV A;  1H45 A;  3MZ9 A;  1MXX A;  1MPD A;  3QYT A;  3QAX A;  2V3Q A;  1DPE A;  3TCG A;  2ZZX A;  1ZKB A;  3FAT A;  5JTY B;  3TKD A;  4F39 A;  1FPK A;  1WVJ A;  4X48 A;  3LR1 A;  3VLW A;  1NNF A;  1MXU A;  2QRY A;  4POW A;  2ZZW A;  3MVW A;  1LBX A;  3N94 A;  4NWC A;  2WKY A;  4LA9 A;  4KHZ E;  4JSD A;  3IOW A;  1K9Z A;  4GOT A;  3KJT A;  3A09 A;  4KPT A;  1Y9U A;  3PMV A;  4XKR A;  4F1U A;  3PUV E;  5FTH A;  4O94 A;  4OVS A;  1YAE A;  4ESW A;  4MEV A;  1ZU0 A;  3K1P A;  3O28 A;  3RN8 A;  4OA4 A;  4FEC A;  4GX4 A;  2H98 A;  2CZH A;  1IMD A;  3T9V A;  4P11 A;  2OBG A;  2OZZ A;  5B70 A;  4LN5 A;  3I5O A;  3V8X B;  2VP1 A;  2KQZ A;  3DRH A;  1NUY A;  3VLU A;  1MPB A;  2Y7W A;  1NNP A;  2GH9 A;  4JBZ A;  1DTZ A;  1LBB A;  5I58 B;  5KDT A;  2I49 A;  5IZ1 A;  1QJM A;  3MST A;  4LUB A;  3MP1 A;  2FIE A;  5TU0 A;  4KXP A;  4LZ5 A;  4F18 A;  1HSJ A;  4I8C A;  4C1U A;  1YTV A;  4O8M A;  5TPA A;  2F35 A;  1ELJ A;  2DOJ A;  5CMK A;  4ZZE A;  4YMA A;  4BDR A;  3SEV A;  2ALU A;  4NF6 B;  2THI A;  4RXL A;  3HHG A;  3S9E A;  2DE3 A;  2VPO A;  4GXS B;  4PBQ A;  1B7Z A;  1Y4C A;  4AB5 A;  4OFO A;  3LVU A;  3HST A;  5TP9 A;  4YIC A;  4NHB A;  3H6T A;  2PFZ A;  3O6I A;  1A55 A;  1EYI A;  4G8M A;  2NUV A;  3LSL A;  1B40 A;  2JJK A;  3K1M A;  4MNI A;  1N84 A;  1IUD A;  4N81 A;  1NV5 A;  1UIU A;  1NI9 A;  2WEF A;  1YZ0 A;  5IZ3 A;  3U1O A;  3IOR A;  2M8C A;  1H44 A;  5DYH A;  3TFL A;  5H8Q B;  2E0S A;  3SEW A;  4N91 A;  2VOZ A;  1DSN A;  3KFM A;  2Z22 A;  2XWI A;  1SYH A;  1NL5 A;  4MMP A;  3T9U A;  3RQT A;  2F7B A;  3UN6 A;  1NMU A;  5ET5 A;  3RT8 A;  1IXC A;  5I3S A;  1OIB A;  3KC0 A;  2F36 A;  3ROJ A;  3QXM A;  3PPR A;  3O29 A;  4ND9 A;  4HE2 A;  3IOV A;  1MH3 A;  3E79 A;  1PBQ A;  2F3B A;  3S9N C;  5FHN A;  2PYY A;  4ECF A;  4QFK A;  3JV9 A;  4MLV A;  4K3F A;  3QIM A;  4OVP A;  2ZYO A;  1FBG A;  2F3D A;  3G3G A;  1HSL A;  4IGR A;  5KZT A;  1P1O A;  3EPE A;  1MY0 A;  1NV0 A;  3EN3 A;  3K6W A;  2Z8F A;  1QUK A;  2Y7I A;  3DP4 A;  3W9V A;  3LSX A;  4U1Z A;  1NV6 A;  1N3W A;  4RK2 A;  5F1Q A;  3OO8 A;  3C9H A;  3S9L C;  2ONS A;  4JWX A;  3AXF A;  2QVR A;  3PPQ A;  4P9K A;  3P7I A;  1NNK A;  1AMF A;  3FVN A;  1FTL A;  3ZKL A;  3QK6 A;  4GQO A;  4AQ4 A;  2DQV A;  2RC9 A;  3CIJ A;  2QFL A;  3IB2 A;  2RIN A;  1LCT A;  1SYI A;  4OHN A;  4IO5 A;  1ATG A;  4U23 A;  3V5A A;  2ANJ A;  1DPP A;  3TPA A;  3PV0 E;  4PFW A;  2HXW A;  3FUZ A;  3R26 A;  3RTW B;  1JNF A;  3TCH A;  1FCK A;  2ESN A;  2B3B A;  2QMX A;  1ZLQ A;  1LAF E;  3UIF A;  2P0S A;  4G68 B;  1ZTY A;  1MXY A;  4QBA A;  3I6V A;  3O6P A;  1JVX A;  1FBC A;  1S9T A;  4N17 A;  2V3T A;  4GL0 A;  4RPN A;  1B9J A;  1USY H;  4G4P A;  3N6T A;  4F1V A;  3OSR A;  1OVT A;  1B5J A;  3H06 B;  3IJO B;  1AOV A;  3TEP A;  3MPL A;  4NF0 A;  3Q29 A;  2F8D A;  5ICT A;  4IO2 A;  3IX1 A;  1M5B A;  3CR9 A;  3TDJ A;  1VR5 A;  2FNC A;  4PBH A;  3LC8 A;  1M5F A;  3KBR A;  4MF3 A;  1FTM A;  4E0W A;  5I59 A;  4N8Y A;  4G77 A;  3EHT A;  4F3S A;  1FPL A;  4KI0 E;  1BKA A;  4GWW A;  4IGT A;  5J16 A;  2F7C A;  2P2A A;  4H65 A;  4IO7 A;  5ESY A;  5ITO A;  1IQ7 A;  3TTL A;  4G8N A;  2HQ0 A;  3K6U A;  5F7V A;  4U2R A;  4NF8 A;  1QVS A;  1IMA A;  3FVG A;  4KYD A;  1FPD A;  5AA2 B;  5CMC A;  5CRY A;  3KZG A;  4PAK A;  1Z7N E;  2FIX A;  1KZ8 A;  1IME A;  5L9M A;  4HCY A;  3H6U A;  2UYF A;  5ET7 A;  2CZK A;  4QFN A;  3CG1 A;  3FVO A;  3FZV A;  3O6G A;  3NOH A;  1QKA A;  3Q26 A;  1B3L A;  2Q2C A;  4JWY A;  5EQ9 A;  3T1B A;  4OFJ A;  1D3K A;  2AL5 A;  3KG2 A;  3O9P A;  1IMC A;  5CMB A;  2O68 A;  3O97 A;  4KR5 A;  5LOM A;  3OEN A;  2OLB A;  3FXR A;  3PD8 A;  2HZK A;  1RYO A;  2VD3 A;  4RYA A;  1MS7 A;  4PQJ A;  3PAM A;  3EHU A;  2X26 A;  3DRJ A;  4R73 A;  3CVG A;  3UGW A;  1FW0 A;  1M5E A;  3TAJ A;  4OVR A;  4ZEK A;  3FXB A;  1ZJL A;  4MAG A;  4GX6 A;  2FA7 A;  3F11 A;  2H25 A;  5HM4 B;  3PU5 A;  5ET8 A;  4QSC A;  4XEQ A;  3MWB A;  1JEU A;  3GBB A;  3HHF A;  4P3L A;  3HCQ A;  1EYJ A;  1ZIU A;  3H6V A;  1FSA A;  2QS4 A;  3K6X A;  4MNC A;  3K1N A;  4FED A;  1EZO A;  3FV2 A;  1MQD A;  1Y1M A;  1FPJ A;  3Q28 A;  1BTJ A;  4F22 A;  1MQJ A;  2H99 A;  3B7D A;  1QGX A;  1WOD A;  3MVZ A;  4YZZ A;  4NG7 A;  1LAH E;  4ZED A;  4R9G A;  2OWS A;  2XXU A;  3RGY A;  1LB9 A;  2VT5 A;  1EYK A;  4P47 A;  3TUS A;  1KA0 A;  1GV8 A;  4PFY A;  4YKJ A;  5M2V A;  4HXV A;  2DWH A;  3IOU A;  1B3G A;  3FD3 A;  3E3K A;  1M5C A;  2OK2 A;  4DI3 D;  3FXQ A;  1SW5 A;  3IL1 B;  3VVF A;  5I2N A;  1B1X A;  1XVY A;  2VPN A;  5ISU A;  3E78 A;  1IXI A;  5A5X A;  2UVG A;  3G3K A;  2XXW A;  4GD5 A;  4GWO A;  1XS5 A;  5AA4 A;  4FOR A;  4MBP A;  2VHA A;  2REG A;  2V93 A;  2X7P A;  1VFD A;  5H8N A;  2DDK A;  2D5W A;  3L6G A;  3G3J A;  4NQ8 A;  2XXI A;  3M3L A;  3K2D A;  4KYE A;  4F31 B;  3CFZ A;  3QUF A;  4I9D A;  2XXK A;  1AH5 A;  1EU8 A;  3IB0 A;  4G2Z A;  3UOR A;  2P3N A;  4OWD A;  2OWT A;  1LBC A;  3LSF B;  3T9H B;  1QUJ A;  4G61 A;  3S2V A;  3RUM A;  1YCJ A;  1J1N A;  4Q0C A;  4OXV A;  2I58 A;  5HBC A;  3PPN A;  4ZE8 A;  2HHM A;  1RYX A;  5KCJ A;  2CEY A;  2B3F A;  3O66 A;  5HPQ A;  3RTF B;  4JVD A;  4OVT A;  2HPG A;  2F5X A;  1JEV A;  4H6D A;  1MDQ A;  5EQA A;  3O6H A;  4TLM B;  2KR0 A;  4WED A;  2LAO A;  4NWD A;  3MP6 A;  4U4S A;  1OQG A;  5I57 A;  2FYI A;  3A3C A;  1MXV A;  2BJI A;  3DRG A;  3JYR A;  4F19 A;  1R9L A;  3I3V A;  2NWJ A;  4QRZ A;  2GHA A;  1CNQ A;  2G29 A;  5KDT B;  2GRV A;  1ANF A;  2QSX A;  3VXB A;  4DDD A;  2HFB A;  2Q8M A;  3KN8 A;  3MZ1 A;  3SER A;  4DXU A;  5H8S A;  1LB8 A;  4NTL A;  1FBP A;  4P8B A;  1Q35 A;  1US4 A;  4PC9 A;  4YKP A;  3FJG A;  1I6A A;  2AYS A;  1VFE A;  1OQH A;  4JXI A;  3U93 A;  1B6H A;  1FPE A;  3TYH A;  3C32 A;  4OVJ A;  5TPA B;  3ZS6 A;  5EHS A;  3O2A A;  1CB6 A;  3CSB A;  2YLN A;  3ILU B;  1LFH A;  4MJO A;  4PE5 B;  4YKI A;  3U65 A;  1MQH A;  4EDP A;  1MXZ A;  4MLQ A;  4R6K A;  4GBW A;  3D4C A;  1DMB A;  5TP9 B;  3SKP A;  3R6U A;  3HN0 A;  2Z8E A;  2XHD A;  4YU0 A;  3HFU A;  4YB5 A;  1SI1 A;  1UTB A;  1FPB A;  1RDZ A;  4GL8 A;  2X7Q A;  3TTK A;  2RKM A;  4QXD A;  2O69 A;  4XFE A;  1FTO A;  2Q74 A;  3PTY A;  1XOC A;  5IZ3 B;  4KCC A;  1MM6 A;  4DE8 A;  2Z8D A;  4PFU A;  3BBR A;  2O1M A;  2F97 A;  1KA1 A;  3KJ7 A;  3H03 A;  4DLD A;  1PBP A;  4N6K A;  1B4Z A;  3BIH A;  3U72 A;  3CHG A;  2L5V A;  2Y5L A;  2DXR A;  3FV1 A;  3ISP A;  2OX3 A;  3KSX A;  1H3D A;  2UYE A;  1Z7M E;  1URS A;  3LUZ A;  4N13 A;  3OXN A;  3A3U A;  3RNN A;  1B46 A;  3K0V A;  4MH5 A;  5IZZ A;  2G93 A;  4R2B A;  1B5I A;  1IIW A;  3MW0 A;  1US5 A;  2F34 A;  4HE1 A;  1S7Y A;  1BLF A;  1FTA A;  2PCR A;  1NFT A;  3DLN A;  4LON B;  5EQ8 A;  2O1L A;  5A5L A;  5ELV A;  5AA2 D;  1FJ9 A;  5JK4 A;  5JEI A;  1B0H A;  4ONY A;  2Y5K A;  1RKM A;  2DXY A;  2ZNT A;  1MH4 A;  5CI5 A;  2RC8 A;  2XWV A;  3V89 B;  1B2H A;  3MAM A;  3QMF A;  3C31 A;  4JDF A;  1DCU A;  2I3V A;  2VD2 A;  2Y7K A;  3GLB A;  3VDF A;  2V4C A;  2H4I A;  1YXI A;  5BUU A;  4GF8 A;  2R71 A;  3FVK A;  3LV0 A;  2DWJ A;  1TT1 A;  4YAH X;  3S4U A;  3DEL B;  1R9Q A;  3ILT B;  5EYG A;  4ELR A;  4H46 A;  3LUY A;  2I6E A;  1POT A;  2A5S A;  1TWY A;  3T9X B;  2QVU A;  1TXF A;  1LGB C;  3IJX B;  2XXQ A;  3OO7 A;  1QUL A;  4M1V A;  3PMW A;  1LLS A;  5DVF A;  1JVY A;  1FJ6 A;  4PDD A;  3BFT A;  1Q1K A;  3KN3 A;  2P3V A;  2Q9T A;  2XXY A;  4X9T A;  3UK4 A;  4Q5T A;  4Z7E A;  4OVQ A;  3OO6 A;  3T66 A;  3IAZ A;  2RF1 A;  3E9X A;  1I69 A;  3OEL A;  2IA4 A;  1JW5 A;  4ZEC A;  3MP8 A;  4NF4 A;  4RJZ A;  3IO6 A;  4H8I A;  3TEL A;  1SQY A;  2WBD A;  1B52 A;  3PUZ E;  3ZSF A;  2YPN A;  1N3X A;  3TTR A;  2A5T A;  4IY5 A;  3RLF E;  1I6Q A;  5L9O A;  1FQA A;  2UVJ A;  1SW2 A;  4RA1 A;  4OFL A;  1DOT A;  5ICQ A;  1LCF A;  2REJ A;  5F24 A;  4H5G A;  4GWX A;  3RPL B;  3G3F A;  5CBS A;  2FHY A;  1IZ1 A;  2F78 A;  1P1N A;  5I7I A;  4U1O A;  2ZXT A;  2DP8 A;  2XA5 A;  1WDN A;  3RPL A;  3RPW A;  3CI8 A;  1QUI A;  3DM0 A;  1B1H A;  4YMB A;  3TQL A;  1B3H A;  4PE3 A;  1FBH A;  1M5D A;  1Y20 A;  1NV4 A;  3QUJ A;  3OEM A;  5I59 B;  1N7X A;  3CFX A;  2QVV A;  4OAN A;  4ZEI A;  1SW1 A;  4E0X A;  3BFU A;  1NH8 A;  4R75 A;  3V83 A;  4OTE A;  4DIG A;  1IMB A;  5EYH A;  4ELO A;  2XX7 A;  2Q8J A;  2V3U A;  3M3F A;  4PAI A;  5I5P A;  2Q89 A;  2HCA A;  3C34 A;  4FE8 A;  4NF8 B;  1XVX A;  3QSL A;  2I0C A;  3N6U A;  2ZNU A;  4H1X A;  4PF8 A;  4KCD A;  1FPG A;  3KBZ A;  4OYV A;  5FTI A;  4QF9 A;  1D4N A;  4RNS A;  3GYY A;  1F9B A;  5T3J A;  5LTC A;  5IGA A;  1IEJ A;  4O3C A;  1FQE A;  4HS7 A;  1A40 A;  3K6V A;  4I62 A;  2OJT A;  2XX8 A;  3K4U A;  4DZ1 A;  2YJP A;  1N76 A;  4N4U A;  1K9Y A;  3C33 A;  3H6W A;  4KQP A;  4JWO A;  2ABH A;  4QSE A;  3TCF A;  3B6W A;  2F6G A;  1YPN A;  2QS1 A;  4FJP A;  4RK9 A;  3CG3 A;  4F2O A;  2D3I A;  4QFP A;  4L17 A;  2GFE A;  3VV5 A;  4I3Y A;  1T0K A;  4FBP A;  4NMY A;  5K2X A;  1URD A;  4R6H A;  4G68 C;  1PB9 A;  3SEY A;  3DRK A;  4GIZ A;  3T93 B;  4BDQ A;  4OMB A;  4PTK A;  4QHQ A;  1UTH A;  2P1S A;  4ELQ A;  2IEE A;  4BDL A;  1B32 A;  2DWI A;  1XI6 A;  1EH3 A;  1MPC A;  3GZG A;  1B58 A;  1SVX B;  2XWK A;  3VXC A;  1II5 A;  3FTO A;  4NED A;  2GQ1 A;  1HSE A;  4H45 A;  3DRI A;  2HZL A;  2UVI A;  3VVD A;  3E4R A;  4NF5 B;  5I84 A;  4O7I A;  2DVZ A;  2VGQ A;  1TFA A;  4EUO A;  4I40 A;  4EF2 A;  4LP2 B;  1MQG A;  1MXW A;  4I1D A;  3PGF A;  4NF5 A;  4Q8R A;  4GXA A;  1D9Q A;  4KFQ A;  4GWU A;  4XXU A;  3L6H A;  4YB6 A;  4LAT A;  3PPO A;  4RY1 A;  5I2N B;  4X04 A;  2RC7 A;  3T22 A;  1IXG A;  5A5X B;  3OEK A;  1BK4 A;  3MZB A;  2UXA A;  1Y1Z A;  5AA4 B;  4X1D A;  1MY4 A;  2H5Y A;  4HCW A;  4GFR A;  4N8G A;  1BIY A;  5H8N B;  3FGS A;  2RCB A;  3VE1 B;  1NNT A;  4P56 A;  5I56 B;  3HPI A;  1MDP 1;  4H5F A;  2Q88 A;  4AS5 A;  3KGC A;  3OO9 A;  2PFY A;  5DW8 A;  3TOD A;  5IAI A; 
#chains in the Genus database with same CATH homology
 1GR2 A;  3B6T A;  5I56 A;  2Y7P A;  4EQ7 A;  2F7A A;  1MY2 A;  1N7W A;  2O7I A;  4X1B A;  4OEV A;  1A99 A;  2WOL A;  4WEP A;  3R7X A;  1AL3 A;  4PP0 A;  3B6Q A;  3TTN A;  1B7H A;  5KCJ B;  1NH7 A;  4H0W A;  1CE2 A;  2NVU B;  3PPP A;  2O51 A;  5AE4 A;  1OLA A;  4FAJ A;  4P0I A;  1P1Q A;  3G3I A;  4KD5 A;  5DEX B;  5JTY A;  1B4H A;  3M3K A;  5IKB A;  3GBA A;  1EZP A;  3H4Z A;  3N26 A;  4WKM A;  2DWA A;  5I57 B;  2ZNS A;  2H9B A;  4OZ9 A;  5DEX A;  2V84 A;  3USD A;  1D9Y A;  4YKK A;  3G7W A;  3ECR A;  4IY6 A;  4ELP A;  2HAU A;  1R1N A;  4ZEF A;  4JB7 A;  1H76 A;  4U21 A;  2PT1 A;  5EYF A;  4F3P A;  1PB8 A;  1SBP A;  1MRP A;  2RCA A;  2Y84 A;  4OQO A;  1XC1 A;  2DYX A;  3VVE A;  3SEX A;  4RPO A;  5FHO A;  5CMM A;  5H8F B;  1Y4T A;  4PFT A;  1P1U A;  4H8J A;  5B7D A;  1I6B A;  4EXK A;  2XXT A;  3JZJ A;  5L8D A;  2NXO A;  3SES A;  2R9J A;  4GLI A;  2O6A A;  5H8F A;  2I48 A;  1N0T A;  4DCY A;  2O84 X;  3PD9 A;  3C4M A;  4R9F A;  5I58 A;  1UTB B;  1MY3 A;  3TZA A;  3Q25 A;  3K02 A;  2B4M A;  3BKI B;  2DS9 A;  4IO3 A;  2XXR A;  2ZMB A;  4BDM A;  1LFG A;  2XX9 A;  3MC2 A;  2UVH A;  2ONK E;  4OEN A;  2V25 A;  4OES A;  1JW4 A;  4FEB A;  1B3E A;  3EHS A;  4EF1 A;  3RY3 A;  3KEI A;  1TFD A;  4NF6 A;  4R72 A;  4NE4 A;  3MVX A;  1O63 A;  4OEU A;  2Y7R A;  4F2Q A;  1GTK A;  4DCX A;  4C0R A;  3M8U A;  3IO4 A;  2AL4 A;  2ZYN A;  2E1S A;  3U8Q A;  2OCU A;  5K2Y A;  3WAE A;  2I0B A;  4XKN A;  2WOK A;  2DSF A;  1FTJ A;  1JW1 A;  2ZYM A;  1FQF A;  1JQF A;  1O7T A;  2Q2A A;  4AB6 A;  4EQB A;  1IXH A;  4O3A A;  1MM7 A;  4ESX A;  1URG A;  3OSQ A;  5H8Q A;  3OMB A;  3TTM A;  4XKQ A;  1S50 A;  3K00 A;  1SDX A;  3D4G A;  3MBP A;  4JSO A;  4WXJ A;  3H7M A;  5I2K B;  1XT8 A;  3DP6 A;  2DE4 A;  1Y3N A;  4F3G A;  4ZE9 A;  4THI A;  3E13 X;  2QS2 A;  1P99 A;  5I2K A;  3UP9 A;  1USY E;  3RT6 B;  1MQI A;  2QJE A;  3KOS A;  1XHY A;  5FHM A;  4TLL B;  3U94 A;  4ISU A;  4PET A;  4HW8 A;  1N04 A;  3FJ7 A;  4BDO A;  2R6G E;  3T96 B;  4R6Y A;  1O64 A;  1MG1 A;  2NOO A;  1P1W A;  4UA8 A;  4XTC Q;  1GGG A;  1A8F A;  3UA8 A;  2QL3 A;  4HTG A;  1D9V A;  4R2F A;  2XD2 A;  4ZZA A;  3CSG A;  2O7U A;  2CZL A;  4Q30 B;  4EXL A;  1R6Z A;  1FQC A;  5J1D A;  2DVC A;  4QFL A;  1UIV A;  4ZDM A;  1PB7 A;  2I4B A;  2XXH A;  4N07 A;  2PX1 A;  4NF4 B;  3U92 A;  4POX A;  1LAX A;  1LST A;  2A5T B;  4G8H A;  1KWH A;  3C36 A;  4ZEB A;  5CBR A;  4U4X A;  3HV1 A;  1A8E A;  3FIR A;  4EQ9 A;  4U22 A;  5H8H B;  2ZYK A;  3PUW E;  4XKP A;  1MY1 A;  2QPQ A;  4F3B A;  5H8H A;  3W9W A;  2XXX A;  3OOA A;  2PVU A;  2Z23 A;  1SD3 A;  3DP8 A;  3LSW A;  2XXV A;  4G68 A;  5DTB A;  2KLF A;  4F29 A;  1B7U A;  1PC3 A;  1GVC A;  5AA1 A;  3OD7 A;  5AA3 A;  1A7L A;  2CMO A;  4P0G A;  4H67 A;  1VE4 A;  3MUQ A;  3MPK A;  3PUY E;  2B65 A;  3ODB A;  1PEB A;  1B51 A;  4GRK A;  1JET A;  1LFI A;  2AIX A;  5DVI A;  4OER A;  2F6P A;  1BP5 A;  4M4G A;  4O3B A;  1QKB A;  2BJJ X;  4OET A;  2HEU A;  3FJM A;  3IB1 A;  2ONR A;  4DXC A;  2PT2 A;  4FIM A;  1VSO A;  5EHM A;  3PUX E;  3FAS A;  1Y3P A;  3THI A;  4MFI A;  1AIV A;  1B3F A;  2W7Y A;  3K01 A;  4YB7 A;  3TQW A;  2WOP A;  3W15 C;  3SDF A;  3CRB A;  5AA2 A;  5CC2 A;  3SET A;  1L5T A;  4FAT A;  1FQB A;  4QSD A;  3MVY A;  4KYS A;  1IIT A;  2PMS A;  1PDA A;  5ITP A;  4C1T A;  1Y3Q A;  2XD3 A;  4TQU Q;  1UTH B;  2QMW A;  1DTG A;  3EF7 A;  4BLA A;  2QS3 A;  1SI0 A;  4Z0I A;  4IO4 A;  3G3H A;  2PBW A;  3EQ1 A;  3MJN A;  3DRF A;  4TOZ A;  3IK6 B;  3IR1 A;  1FQD A;  1FTK A;  4F1Y A;  1EZ9 A;  1QW0 A;  5CM6 A;  3ZKK A;  4IB2 A;  3N5L A;  3KN7 A;  3C35 A;  3LBS A;  5DT6 A;  3S9M C;  4ZS9 A;  1OLC A;  5DVJ A;  3WAF A;  3RYA A;  3KOT A;  3ONM A;  3GXA A;  4GVO A;  4QFO A;  4R74 A;  4BDN A;  2DE2 A;  5BWJ A;  3VFJ A;  3SEU A;  2B4L A;  1UQW A;  1B05 A;  3FXU A;  4IO6 A;  3VLV A;  3RYB A;  1OVB A;  4N6P A;  3PMX A;  1A54 A;  2I4C A;  3IOT A;  1OMP A;  3TMG A;  1B5H A;  1NKX A;  1POY 1;  4XIG Q;  3MQ9 A;  1LAG E;  2D21 A;  2I3W A;  1SW4 A;  4LZ7 A;  3H3G A;  5L9S A;  4DXB A;  1ZBM A;  1B0L A;  3HO7 A;  3Q27 A;  4LVQ A;  1ZMG A;  3CFL A;  1H43 A;  3KSJ A;  4UAC A;  2XXP A;  2GHB A;  4LZ8 A;  4LQ5 A;  4LQ2 A;  2HAV A;  1H45 A;  3MZ9 A;  1MXX A;  1MPD A;  3QYT A;  3QAX A;  2V3Q A;  1DPE A;  3TCG A;  1ZKB A;  3FAT A;  5JTY B;  3TKD A;  4F39 A;  1WVJ A;  4X48 A;  3LR1 A;  3VLW A;  1NNF A;  1MXU A;  2QRY A;  4POW A;  3MVW A;  3N94 A;  4NWC A;  2WKY A;  4LA9 A;  4KHZ E;  4JSD A;  3IOW A;  4GOT A;  3KJT A;  3A09 A;  4KPT A;  1Y9U A;  3PMV A;  4XKR A;  4F1U A;  3PUV E;  5FTH A;  1YAE A;  4ESW A;  1ZU0 A;  3K1P A;  3O28 A;  3RN8 A;  4FEC A;  2H98 A;  3T9V A;  4P11 A;  2OBG A;  2OZZ A;  5B70 A;  3I5O A;  3V8X B;  2VP1 A;  3DRH A;  3VLU A;  1MPB A;  2Y7W A;  1NNP A;  2GH9 A;  4JBZ A;  1DTZ A;  1LBB A;  5I58 B;  5KDT A;  2I49 A;  1QJM A;  4LUB A;  3MP1 A;  5TU0 A;  4LZ5 A;  4F18 A;  1HSJ A;  4I8C A;  4C1U A;  1YTV A;  5TPA A;  2F35 A;  1ELJ A;  2DOJ A;  5CMK A;  4ZZE A;  4YMA A;  4BDR A;  3SEV A;  2ALU A;  4NF6 B;  2THI A;  4RXL A;  3HHG A;  3S9E A;  2DE3 A;  4GXS B;  1B7Z A;  1Y4C A;  4AB5 A;  4OFO A;  3LVU A;  3HST A;  5TP9 A;  4YIC A;  3H6T A;  3O6I A;  1A55 A;  4G8M A;  2NUV A;  3LSL A;  1B40 A;  3K1M A;  1N84 A;  1IUD A;  1UIU A;  3U1O A;  3IOR A;  2M8C A;  1H44 A;  5DYH A;  3TFL A;  5H8Q B;  2E0S A;  3SEW A;  2VOZ A;  1DSN A;  3KFM A;  2Z22 A;  1SYH A;  1NL5 A;  3T9U A;  3RQT A;  2F7B A;  3UN6 A;  1NMU A;  3RT8 A;  1IXC A;  1OIB A;  2F36 A;  3QXM A;  3PPR A;  3O29 A;  4ND9 A;  3IOV A;  1MH3 A;  1PBQ A;  3S9N C;  5FHN A;  4ECF A;  2PYY A;  4QFK A;  3JV9 A;  4MLV A;  4K3F A;  3QIM A;  2ZYO A;  3G3G A;  1HSL A;  4IGR A;  5KZT A;  1P1O A;  3EPE A;  1MY0 A;  3K6W A;  3EN3 A;  2Z8F A;  1QUK A;  2Y7I A;  3DP4 A;  3W9V A;  3LSX A;  4U1Z A;  1N3W A;  4RK2 A;  5F1Q A;  3OO8 A;  3C9H A;  3S9L C;  2ONS A;  4JWX A;  3AXF A;  3PPQ A;  3P7I A;  1NNK A;  1AMF A;  3FVN A;  1FTL A;  3ZKL A;  3QK6 A;  4GQO A;  4AQ4 A;  2DQV A;  2RC9 A;  3CIJ A;  3IB2 A;  2RIN A;  1LCT A;  1SYI A;  4OHN A;  4IO5 A;  1ATG A;  4U23 A;  3V5A A;  2ANJ A;  1DPP A;  3TPA A;  3PV0 E;  4PFW A;  2HXW A;  3FUZ A;  3R26 A;  3RTW B;  1JNF A;  3TCH A;  1FCK A;  2ESN A;  2B3B A;  2QMX A;  1ZLQ A;  1LAF E;  3UIF A;  2P0S A;  4G68 B;  1ZTY A;  1MXY A;  3I6V A;  3O6P A;  1JVX A;  1S9T A;  2V3T A;  4GL0 A;  4RPN A;  1B9J A;  1USY H;  4G4P A;  3N6T A;  4F1V A;  3OSR A;  1OVT A;  1B5J A;  3H06 B;  3IJO B;  1AOV A;  3TEP A;  3MPL A;  3Q29 A;  2F8D A;  5ICT A;  4IO2 A;  3IX1 A;  1M5B A;  3CR9 A;  3TDJ A;  1VR5 A;  2FNC A;  3LC8 A;  1M5F A;  3KBR A;  4MF3 A;  1FTM A;  4E0W A;  5I59 A;  4G77 A;  3EHT A;  4F3S A;  4KI0 E;  1BKA A;  4IGT A;  2F7C A;  2P2A A;  4H65 A;  4IO7 A;  5ITO A;  1IQ7 A;  3TTL A;  4G8N A;  2HQ0 A;  3K6U A;  5F7V A;  4U2R A;  4NF8 A;  1QVS A;  3FVG A;  4KYD A;  5AA2 B;  5CMC A;  5CRY A;  3KZG A;  1Z7N E;  5L9M A;  4HCY A;  3H6U A;  2UYF A;  4QFN A;  3CG1 A;  3FVO A;  3FZV A;  3O6G A;  1QKA A;  3Q26 A;  1B3L A;  2Q2C A;  4JWY A;  4OFJ A;  1D3K A;  2AL5 A;  3KG2 A;  3O9P A;  5CMB A;  2O68 A;  3O97 A;  4KR5 A;  5LOM A;  3OEN A;  2OLB A;  3FXR A;  3PD8 A;  2HZK A;  1RYO A;  2VD3 A;  4RYA A;  1MS7 A;  4PQJ A;  3PAM A;  3EHU A;  2X26 A;  3DRJ A;  4R73 A;  3CVG A;  3UGW A;  1FW0 A;  1M5E A;  3TAJ A;  4ZEK A;  1ZJL A;  2FA7 A;  3F11 A;  2H25 A;  5HM4 B;  3PU5 A;  4QSC A;  3MWB A;  1JEU A;  3GBB A;  3HHF A;  3HCQ A;  1ZIU A;  3H6V A;  2QS4 A;  3K6X A;  3K1N A;  4FED A;  1EZO A;  3FV2 A;  1MQD A;  1Y1M A;  3Q28 A;  1BTJ A;  4F22 A;  1MQJ A;  2H99 A;  3B7D A;  1WOD A;  3MVZ A;  4YZZ A;  1LAH E;  4ZED A;  4R9G A;  2OWS A;  2XXU A;  3RGY A;  1LB9 A;  3TUS A;  1GV8 A;  4PFY A;  4YKJ A;  5M2V A;  2DWH A;  3IOU A;  1B3G A;  3FD3 A;  3E3K A;  1M5C A;  2OK2 A;  3FXQ A;  1SW5 A;  3IL1 B;  3VVF A;  5I2N A;  1B1X A;  1XVY A;  5ISU A;  1IXI A;  5A5X A;  2UVG A;  3G3K A;  2XXW A;  4GD5 A;  4GWO A;  1XS5 A;  5AA4 A;  4FOR A;  4MBP A;  2VHA A;  2REG A;  2V93 A;  2X7P A;  1VFD A;  5H8N A;  2D5W A;  3L6G A;  3G3J A;  2XXI A;  3M3L A;  3K2D A;  4KYE A;  4F31 B;  3CFZ A;  3QUF A;  4I9D A;  1AH5 A;  1EU8 A;  3IB0 A;  4G2Z A;  3UOR A;  4OWD A;  2OWT A;  1LBC A;  3LSF B;  3T9H B;  1QUJ A;  3S2V A;  3RUM A;  1YCJ A;  1J1N A;  4Q0C A;  4OXV A;  2I58 A;  5HBC A;  3PPN A;  4ZE8 A;  1RYX A;  5KCJ A;  2B3F A;  3O66 A;  5HPQ A;  3RTF B;  2F5X A;  1JEV A;  4H6D A;  1MDQ A;  4TLM B;  3O6H A;  2LAO A;  4WED A;  4NWD A;  3MP6 A;  4U4S A;  1OQG A;  5I57 A;  2FYI A;  3A3C A;  1MXV A;  3DRG A;  3JYR A;  4F19 A;  1R9L A;  3I3V A;  2NWJ A;  4QRZ A;  2GHA A;  2G29 A;  5KDT B;  2GRV A;  1ANF A;  2QSX A;  3VXB A;  4DDD A;  2HFB A;  3KN8 A;  3MZ1 A;  3SER A;  4DXU A;  5H8S A;  1LB8 A;  4NTL A;  1Q35 A;  1US4 A;  4YKP A;  3FJG A;  1I6A A;  2AYS A;  1VFE A;  1OQH A;  4JXI A;  3U93 A;  1B6H A;  3TYH A;  3C32 A;  4OVJ A;  5TPA B;  3ZS6 A;  5EHS A;  3O2A A;  1CB6 A;  3CSB A;  2YLN A;  3ILU B;  1LFH A;  4PE5 B;  4YKI A;  1MQH A;  4EDP A;  1MXZ A;  4MLQ A;  4R6K A;  3D4C A;  1DMB A;  5TP9 B;  3SKP A;  3R6U A;  3HN0 A;  2Z8E A;  2XHD A;  4YU0 A;  4YB5 A;  1SI1 A;  1UTB A;  4GL8 A;  2X7Q A;  3TTK A;  2RKM A;  2O69 A;  1FTO A;  1XOC A;  4KCC A;  1MM6 A;  4DE8 A;  2Z8D A;  4PFU A;  3BBR A;  2O1M A;  2F97 A;  3KJ7 A;  3H03 A;  4DLD A;  1PBP A;  1B4Z A;  3U72 A;  3CHG A;  2DXR A;  3FV1 A;  3KSX A;  1H3D A;  2UYE A;  1Z7M E;  1URS A;  4N13 A;  3OXN A;  3A3U A;  3RNN A;  1B46 A;  3K0V A;  4MH5 A;  2G93 A;  4R2B A;  1B5I A;  1IIW A;  3MW0 A;  1US5 A;  2F34 A;  1S7Y A;  1BLF A;  1NFT A;  3DLN A;  4LON B;  2O1L A;  5ELV A;  5AA2 D;  5JK4 A;  5JEI A;  1B0H A;  4ONY A;  1RKM A;  2DXY A;  2ZNT A;  1MH4 A;  5CI5 A;  2RC8 A;  3V89 B;  1B2H A;  3MAM A;  3C31 A;  4JDF A;  2I3V A;  2VD2 A;  2Y7K A;  3GLB A;  3VDF A;  2H4I A;  5BUU A;  4GF8 A;  2R71 A;  3FVK A;  2DWJ A;  1TT1 A;  4YAH X;  3S4U A;  3DEL B;  1R9Q A;  3ILT B;  4ELR A;  3LUY A;  2I6E A;  1POT A;  2A5S A;  1TWY A;  3T9X B;  1TXF A;  1LGB C;  3IJX B;  2XXQ A;  3OO7 A;  1QUL A;  4M1V A;  3PMW A;  1LLS A;  5DVF A;  1JVY A;  3BFT A;  1Q1K A;  3KN3 A;  2Q9T A;  2XXY A;  4X9T A;  3UK4 A;  4Q5T A;  4Z7E A;  3OO6 A;  3T66 A;  3IAZ A;  2RF1 A;  3E9X A;  1I69 A;  3OEL A;  2IA4 A;  1JW5 A;  4ZEC A;  3MP8 A;  4NF4 A;  4RJZ A;  3IO6 A;  4H8I A;  3TEL A;  1SQY A;  1B52 A;  3PUZ E;  3ZSF A;  2YPN A;  1N3X A;  3TTR A;  2A5T A;  4IY5 A;  3RLF E;  1I6Q A;  5L9O A;  1FQA A;  2UVJ A;  1SW2 A;  4RA1 A;  4OFL A;  1DOT A;  5ICQ A;  1LCF A;  2REJ A;  4H5G A;  3G3F A;  5CBS A;  1IZ1 A;  2F78 A;  1P1N A;  4U1O A;  2ZXT A;  2DP8 A;  1WDN A;  3RPW A;  3CI8 A;  1QUI A;  3DM0 A;  1B1H A;  4YMB A;  3TQL A;  1B3H A;  1M5D A;  1Y20 A;  3QUJ A;  3OEM A;  5I59 B;  1N7X A;  3CFX A;  4ZEI A;  1SW1 A;  4E0X A;  3BFU A;  1NH8 A;  4R75 A;  3V83 A;  4OTE A;  4DIG A;  4ELO A;  2XX7 A;  2Q8J A;  2V3U A;  3M3F A;  2Q89 A;  2HCA A;  3C34 A;  4FE8 A;  4NF8 B;  1XVX A;  3QSL A;  2I0C A;  3N6U A;  2ZNU A;  4H1X A;  4KCD A;  4OYV A;  5FTI A;  4QF9 A;  1D4N A;  4RNS A;  1F9B A;  1IEJ A;  4O3C A;  1FQE A;  4HS7 A;  1A40 A;  3K6V A;  4I62 A;  2OJT A;  2XX8 A;  3K4U A;  4DZ1 A;  2YJP A;  1N76 A;  3C33 A;  3H6W A;  4KQP A;  4JWO A;  2ABH A;  4QSE A;  3TCF A;  3B6W A;  2F6G A;  1YPN A;  2QS1 A;  4FJP A;  4RK9 A;  3CG3 A;  4F2O A;  2D3I A;  4QFP A;  4L17 A;  2GFE A;  3VV5 A;  1T0K A;  4NMY A;  5K2X A;  1URD A;  4R6H A;  4G68 C;  1PB9 A;  3SEY A;  3DRK A;  4GIZ A;  3T93 B;  4BDQ A;  4OMB A;  4QHQ A;  1UTH A;  2P1S A;  4ELQ A;  2IEE A;  4BDL A;  1B32 A;  2DWI A;  1EH3 A;  1MPC A;  3GZG A;  1B58 A;  1SVX B;  3VXC A;  1II5 A;  3FTO A;  4NED A;  1HSE A;  3DRI A;  2HZL A;  2UVI A;  3VVD A;  3E4R A;  4NF5 B;  5I84 A;  2DVZ A;  2VGQ A;  1TFA A;  4EUO A;  4EF2 A;  4LP2 B;  1MQG A;  1MXW A;  4I1D A;  3PGF A;  4NF5 A;  4Q8R A;  4GXA A;  4KFQ A;  4XXU A;  3L6H A;  4YB6 A;  4LAT A;  3PPO A;  4RY1 A;  5I2N B;  2RC7 A;  3T22 A;  1IXG A;  5A5X B;  3OEK A;  3MZB A;  2UXA A;  1Y1Z A;  5AA4 B;  4X1D A;  1MY4 A;  2H5Y A;  4HCW A;  4GFR A;  1BIY A;  5H8N B;  3FGS A;  2RCB A;  3VE1 B;  1NNT A;  5I56 B;  3HPI A;  1MDP 1;  4H5F A;  2Q88 A;  3KGC A;  3OO9 A;  3TOD A;  5IAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...