1B58A

Oligo-peptide binding protein (oppa) complexed with kyk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b58A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b58A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b58A02
1Y20A 2IA4A 3CSGA 3TUSA 4OEVA 3FZVA 5H8QB 1EZOA 3KG2A 2QJEA 2PX1A 1IXGA 2BJJX 4P0GA 1VFDA 2OZZA 4H8IA 1Q35A 2ESNA 1B3GA 4F18A 1PDAA 1QUJA 1B5HA 3H7MA 4NF4A 3SEWA 1VFEA 1FQBA 1H44A 2PBWA 4Q30B 1QW0A 2HFBA 2ZYNA 4YKIA 2DOJA 4OMBA 3OEMA 3MVXA 3DRGA 4FECA 4Z0IA 2FA7A 2UYEA 1IEJA 3EN3A 1VE4A 2DYXA 3KN8A 1LFHA 1MY1A 1XS5A 2G93A 2I49A 3KN7A 1QUIA 3KJ7A 3PU5A 5I57A 2I6EA 1N3WA 1P1NA 4JBZA 4NWCA 4WEPA 4RYAA 5CRYA 2V3UA 1FQDA 3HV1A 3UA8A 1XC1A 2V84A 4GD5A 3IB1A 2NWJA 5KDTA 3TPAA 4ZEDA 1MXWA 3IOTA 3MC2A 3Q26A 4R6YA 2QS1A 3W15C 5AE4A 1LAFE 3K0VA 1KWHA 2FNCA 4OFJA 2DWAA 3FV2A 3I5OA 1IXCA 1R9LA 2P0SA 3MZ1A 2CZLA 3IB0A 2A5SA 4R75A 4G68A 1FW0A 1B46A 2OK2A 3GXAA 2WOPA 1XVYA 4NF5B 4XXUA 5I2KA 3OEKA 3G3GA 5JEIA 1F9BA 1PEBA 2Q8JA 5AA2B 4ZS9A 4KQPA 4IGRA 3FASA 4FEDA 4KCDA 5BUUA 3MZ9A 5CMKA 3FV1A 1AOVA 4WEDA 4JXIA 2NUVA 3VLVA 1LCTA 4U2RA 2RCAA 1D9YA 4KHZE 4AB5A 4KD5A 3PAMA 2I4CA 1LBCA 4LATA 4NMYA 2REJA 1LFGA 3IK6B 5ELVA 4LA9A 2ONKE 1RKMA 2DXRA 5AA1A 2PVUA 3K6WA 4WXJA 1MXVA 2Z22A 2I3WA 1UQWA 1GV8A 1ZTYA 3BFTA 5H8NB 4QHQA 2Z8DA 2QS2A 3MPKA 5TP9B 1POY1 2QPQA 2O1MA 1CB6A 1NFTA 4ZEKA 3EPEA 4ELPA 4XKQA 1MQIA 3B7DA 4R2FA 4PFYA 2ANJA 2F7CA 1IIWA 2I3VA 2O1LA 2LAOA 1N76A 2XXIA 1FQCA 3H03A 3H06B 4H1XA 1VR5A 3OOAA 1NL5A 3OO9A 1WVJA 4H5FA 1MQHA 3OO6A 4P0IA 1B52A 5CMBA 3KSJA 1GGGA 1UTHB 4F3GA 3S9MC 2R71A 2ALUA 4GVOA 4F3BA 3JZJA 3O2AA 3TTMA 2B3BA 2YJPA 2R9JA 3VDFA 2ABHA 1BKAA 3N5LA 4OFLA 1NNPA 3ZS6A 4EQ7A 4MLQA 1DSNA 3MVYA 4ISUA 1NH7A 1B6HA 3N6UA 3F11A 3GBBA 5H8FA 4OQOA 2XXTA 3MBPA 2I0CA 4POXA 3N94A 4OXVA 3PUYE 3IO6A 4DE8A 4U1OA 3G7WA 2XXWA 1I6QA 1USYE 3KEIA 3CVGA 3C32A 4GXAA 4N13A 3B6WA 3O6IA 4R9FA 4DCXA 4G8NA 4OFOA 2E0SA 2ZNSA 3SKPA 3TYHA 3PMXA 3ILUB 4PFWA 2PMSA 4IY5A 3MVZA 2GHAA 5JTYA 1PB9A 2NVUB 2OJTA 1FQAA 1YAEA 3KN3A 2UVJA 2VHAA 2HAVA 5EHMA 3VVEA 5H8QA 1I69A 1S9TA 3OO7A 3E3KA 2H5YA 3RT8A 4U4XA 2Q88A 3OXNA 4E0WA 1SW1A 3IB2A 3RPWA 5K2YA 5BWJA 3IORA 1P1WA 1A55A 3OENA 4UA8A 4EXLA 4XKPA 1B4HA 3K6VA 4KCCA 2H9BA 3BBRA 4TQUQ 2H4IA 5H8HB 1Y9UA 1LCFA 1ZJLA 3O28A 2YLNA 2XXRA 2OCUA 3RY3A 2D3IA 4Q5TA 3UP9A 3VE1B 3O9PA 4F22A 1A40A 4JSOA 3H6WA 3BKIB 3FJMA 2ZYKA 3FJ7A 4XKRA 4LQ2A 3TKDA 5HM4B 2XX8A 4KYDA 3TAJA 1SVXB 1MDQA 1MXZA 2PYYA 2XXQA 2RCBA 3A3CA 4BDMA 1JVYA 3HO7A 3ODBA 5AA3A 2VOZA 3DELB 1MQJA 4PFTA 2RC8A 2WKYA 1MY4A 4RJZA 2ZYOA 4YAHX 3DRKA 3TQLA 3K6XA 3RN8A 2OWSA 4QFLA 1MQGA 1UIUA 4OETA 2H99A 2ONSA 3SDFA 3LBSA 5CBSA 4H5GA 3U1OA 4QSDA 1LLSA 3UK4A 1JW1A 4O3BA 4POWA 4IGTA 1IZ1A 1SQYA 5M2VA 3T9XB 1B0LA 3UN6A 1RYOA 1SW2A 4I62A 4KPTA 1MG1A 1TFDA 2XX9A 4NF8A 5F7VA 3VLUA 1B51A 1B1XA 2M8CA 1OLAA 1SW4A 3M3FA 4NTLA 4BDRA 1MRPA 3LSWA 1R1NA 1I6AA 1R6ZA 3PUVE 1Y1ZA 2GHBA 3QUJA 4F2OA 3C35A 3LC8A 3PD8A 5I57B 4H8JA 4HCYA 3OD7A 1EH3A 3O97A 4EF1A 4DLDA 1M5DA 1LAHE 4GL8A 1HSJA 4GRKA 2P2AA 4ELRA 3G3JA 1M5BA 2F6GA 3UORA 3FD3A 3R7XA 1SDXA 1I6BA 1BP5A 4NF4B 1US4A 4YU0A 1AIVA 3D4CA 4KI0E 3DRFA 4G4PA 4TLMB 4X48A 3MP1A 3O6HA 1YCJA 1AH5A 4G8MA 1P99A 1SBPA 5JTYB 3RTFB 2DE3A 1A54A 2QS3A 4KYEA 2F6PA 3EHTA 3SEXA 1B1HA 2OLBA 2X7PA 3HHGA 3MP6A 3DRJA 2XD2A 2O6AA 1N04A 2VP1A 3GLBA 4OENA 1ZBMA 4LVQA 3KJTA 4FATA 3M3LA 3TCGA 3U92A 4IO6A 2QL3A 5AA2A 1OQHA 3QAXA 4PFUA 4RPOA 2Y7PA 3LUYA 4WKMA 1OVBA 2V93A 2ZNUA 3E4RA 3K2DA 1H3DA 4GOTA 1TT1A 4JWXA 5CMCA 1YTVA 1US5A 2D21A 1NNTA 3MPLA 2B4LA 4QSCA 3RQTA 3VV5A 5JK4A 3OO8A 1IQ7A 2Y7WA 3FTOA 5AA2D 3B6QA 3DRHA 1B9JA 1OLCA 4JDFA 4R2BA 4YZZA 1DTZA 4JB7A 3ZKKA 1SYHA 2RC7A 3T22A 2W7YA 1B5JA 2VGQA 3T9VA 2CMOA 4E0XA 4GQOA 3EF7A 5HBCA 3VXBA 3HN0A 4DXBA 2OWTA 4LZ5A 3V83A 4QFNA 1Y4TA 3KFMA 3TZAA 3D4GA 1QJMA 4ZZEA 1PB8A 2HAUA 1JVXA 1WDNA 3C34A 4XIGQ 4OEUA 3U72A 3K1PA 3QUFA 4HW8A 3S9EA 4N07A 1EZPA 1QULA 3O29A 3MJNA 3TTKA 1H43A 4YKPA 2DVCA 1IITA 3PPQA 3K6UA 4M4GA 3T9HB 2I48A 1TFAA 2AYSA 5FHNA 2WOKA 3CHGA 1D9VA 4OWDA 3I3VA 4MF3A 2KLFA 3K4UA 5TPAB 4F29A 3KGCA 1NNKA 4C1TA 1H45A 4YB5A 5I56A 5H8HA 3SEUA 5F1QA 1Y4CA 4G2ZA 3I6VA 3JYRA 1QVSA 4LZ7A 1B2HA 2DWJA 4M1VA 3LVUA 2DSFA 1N7XA 1JW5A 4PP0A 5TPAA 5DEXB 4UACA 4QRZA 1N84A 5KCJB 3HSTA 2F34A 3KOTA 1JNFA 3Q27A 4I1DA 1LB8A 1MPCA 3IOUA 4C0RA 1QKAA 4ESWA 1LBBA 2O51A 2XHDA 4F19A 4YMAA 1N3XA 1HSLA 4OTEA 3G3HA 4G68B 3QXMA 3T9UA 2XXHA 1P1OA 2ZXTA 4BDLA 5DTBA 5I58A 4KR5A 5ICTA 4DDDA 5KZTA 5H8FB 1M5FA 4FEBA 3FIRA 2DE4A 4IB2A 1ANFA 1LSTA 3H6VA 1MPBA 1LFIA 1XT8A 3EHUA 4DXCA 5I56B 3K1NA 4NF6A 4ELQA 5DT6A 1BIYA 3V5AA 3IJXB 3IO4A 2AL5A 2B4MA 4GIZA 2F7AA 3AXFA 5L9SA 1OQGA 2Z8FA 4HS7A 4O3AA 3RT6B 3CI8A 3DP6A 3GZGA 1QKBA 2QMWA 1RYXA 1XHYA 3IX1A 1B40A 3MUQA 5H8NA 4I9DA 1B7ZA 2QSXA 3OSRA 1B3EA 1UTHA 3ILTB 4IO3A 1DPPA 3T66A 2R6GE 2REGA 3FVNA 1JEVA 4H65A 4KYSA 1M5EA 2HCAA 2XXPA 2OBGA 4H67A 3TQWA 3FXRA 3DP8A 2XXXA 1URGA 1MXUA 1NKXA 2F5XA 2Y7RA 1LAGE 2Y7KA 5DVFA 4EUOA 4Q8RA 5K2XA 1B3FA 5I58B 1N0TA 1A99A 3RLFE 1SYIA 2THIA 4DIGA 1MM7A 2XX7A 3Q29A 4XKNA 4QFOA 3C36A 3PPNA 4R72A 3TTNA 4RXLA 3RNNA 1B4ZA 4U23A 3SEVA 1SW5A 4QFKA 3DP4A 4OVJA 1WODA 2AL4A 3ZSFA 1MDP1 3S4UA 4ZEBA 1AL3A 3W9WA 1MS7A 4RPNA 3FATA 4DZ1A 3FVKA 3PGFA 2FYIA 3TEPA 2WOLA 2H98A 4F1UA 3V8XB 4FORA 4PE5B 1MXYA 2Q2AA 4KFQA 1ELJA 3KOSA 3SETA 5I59B 1DOTA 1SI1A 2RKMA 3QSLA 4U22A 1ATGA 5ITOA 4QFPA 1B7UA 1XVXA 1UTBA 3K02A 4JWYA 4MBPA 4X1BA 4F2QA 4F1VA 5L9OA 3ECRA 3CIJA 1PBQA 4P11A 4FAJA 5ISUA 1O64A 4N6PA 1S7YA 1URSA 3BFUA 3UIFA 1OVTA 1H76A 1URDA 3ZKLA 1JW4A 2O7UA 4IO2A 4O3CA 1DMBA 3CSBA 2UVIA 3TFLA 1FTKA 3TDJA 2DWHA 3L6HA 3FXQA 3C4MA 2O68A 1B0HA 3CFXA 3HHFA 3PUZE 4IY6A 4U21A 4EXKA 4NF8B 2B3FA 1ZLQA 1IXIA 2GRVA 2ZMBA 4ONYA 3TCFA 4TLLB 1SI0A 2DS9A 5CI5A 2O7IA 4L17A 1Y1MA 2Q89A 3KBRA 3PV0E 3SESA 4IO7A 3U93A 2QRYA 5AA4A 5I2NB 3N26A 3HPIA 3KSXA 3FVGA 2ZNTA 3QYTA 1ZMGA 2IEEA 2X7QA 4I8CA 3ONMA 4G68C 1BTJA 5FTIA 1XOCA 3H3GA 2UXAA 5CM6A 3EHSA 2ONRA 3CFZA 4FJPA 4LP2B 3Q28A 5TU0A 4GF8A 2Z23A 1A7LA 4F3SA 5A5XA 3K01A 2F7BA 4HTGA 1FTOA 1NNFA 5B7DA 1T0KA 4PQJA 3E9XA 4NE4A 3MW0A 1D3KA 2HEUA 3CR9A 4G8HA 4QF9A 1Z7NE 1GVCA 3SEYA 4HCWA 3MWBA 2RF1A 3K00A 3PUWE 2VD3A 4C1UA 4G77A 1Y3PA 1ZIUA 2I58A 4QSEA 4XTCQ 4ESXA 4IO4A 4JSDA 3LSFB 4BLAA 2HQ0A 5ITPA 2Q2CA 3PMVA 3CG3A 5IKBA 3CFLA 3T96B 1AMFA 1IXHA 3S9NC 4AQ4A 3OELA 1EZ9A 4ZE8A 3FGSA 5L8DA 3QK6A 4X1DA 1L5TA 3TTRA 2A5TB 2GFEA 1FTJA 4R6KA 2A5TA 1LGBC 5A5XB 4YICA 3CG1A 3CRBA 1BLFA 4THIA 4H0WA 4RY1A 4YB6A 4DCYA 1MH4A 1UTBB 4Z7EA 2NOOA 3A09A 2V3TA 4DXUA 1HSEA 4ZE9A 1O63A 2DQVA 1P1QA 2P1SA 5DYHA 3G3IA 1O7TA 4MLVA 3B6TA 4Q0CA 4RNSA 5EYFA 4YMBA 2O84X 3FUZA 1TWYA 1B32A 4JWOA 3A3UA 4F1YA 4ZEFA 5CMMA 2DWIA 4R74A 1OIBA 1MQDA 1POTA 4R73A 3QIMA 3O6PA 3IJOB 2PT2A 2F35A 1OMPA 1R9QA 3LSLA 3PUXE 5DVJA 3T93B 4AB6A 1D4NA 5TP9A 3V89B 5CC2A 2NXOA 2QMXA 4MH5A 2XXYA 3E13X 4X9TA 3IOVA 3C31A 3TCHA 3MAMA 2XD3A 5FHMA 2H25A 2I0BA 3USDA 3VFJA 4BDOA 4EQ9A 4ZZAA 5LOMA 3IOWA 4ZEIA 2GH9A 3PPOA 1NH8A 3RYAA 5I84A 4LQ5A 4GL0A 3FJGA 4ZDMA 2DE2A 1DPEA 1M5CA 4GWOA 3RTWB 3MQ9A 1P1UA 4GFRA 5I2KB 3VVFA 3WAEA 4EF2A 3VLWA 1PBPA 4R6HA 2F78A 1FQFA 2V3QA 5L9MA 5H8SA 5KDTB 2X26A 2DP8A 2DVZA 4IO5A 1DTGA 1N7WA 3GBAA 5HPQA 2UYFA 3HCQA 2B65A 3H4ZA 2XXUA 3JV9A 3R6UA 1B3LA 4OESA 2D5WA 1SD3A 4RK9A 1MM6A 3K1MA 1J1NA 3Q25A 4K3FA 4OHNA 3RYBA 1PB7A 2PT1A 1B5IA 1CE2A 1JQFA 3C9HA 1LB9A 4H6DA 4LONB 3TTLA 3FXUA 5J1DA 3VXCA 2V25A 4RA1A 4MFIA 1VSOA 3O66A 4ECFA 2DXYA 2F8DA 2ZYMA 3G3KA 4YB7A 1JEUA 3KZGA 3RUMA 4ZECA 4OERA 1FTMA 3PPRA 3DM0A 2Y7IA 4NWDA 1MY3A 4GLIA 1II5A 3P7IA 4F3PA 4OYVA 3U8QA 3WAFA 5IAIA 2RINA 2XXVA 2Z8EA 5AA4B 3VVDA 5B70A 5I2NA 1FTLA 1EU8A 4NF5A 2QS4A 3G3FA 1MY0A 3M3KA 3R26A 1B05A 1LAXA 4BDQA 4OZ9A 1IUDA 2UVGA 1MH3A 3W9VA 3UGWA 4F31B 2AIXA 3H6TA 3L6GA 2YPNA 4U1ZA 2HZKA 2Q9TA 1GR2A 2HZLA 3FVOA 3EQ1A 4NEDA 1A8FA 5KCJA 1MXXA 2F97A 3PMWA 4TOZA 2VD2A 1Y3NA 4LZ8A 5DVIA 5DEXA 4EQBA 3MZBA 1JETA 4LUBA 3MP8A 3TELA 3SERA 1Y3QA 2F36A 1GTKA 3S9LC 5I59A 4BDNA 4EDPA 5FTHA 2E1SA 5FHOA 5EHSA 1Q1KA 4ELOA 1B3HA 1UIVA 3C33A 3LSXA 2RC9A 1PC3A 2UVHA 4ND9A 3RGYA 3TMGA 3U94A 1NMUA 3IAZA 5CBRA 3IL1B 3N6TA 1YPNA 3DLNA 3OSQA 4FIMA 4RK2A 2Y84A 3S2VA 3THIA 3M8UA 1TXFA 1USYH 4PETA 4R9GA 1FCKA 4F39A 1MY2A 2I4BA 3PPPA 3PD9A 4FE8A 4YKKA 3MVWA 1B7HA 4GXSB 1ZU0A 1ZKBA 3IR1A 1B58A 5ICQA 1Z7ME 1A8EA 2O69A 4NF6B 3H6UA 4YKJA 3TODA 1QUKA 2G29A 3O6GA 4U4SA 2HXWA 1S50A 1MPDA 1FQEA 3LR1A 3OMBA 3DRIA
chains in the Genus database with same CATH superfamily
2BJJX 2OZZA 4H8IA 1Q35A 4F18A 1PDAA 1FQBA 1H44A 4Q30B 2ZYNA 3MVXA 4FECA 4Z0IA 2FA7A 3EN3A 1VE4A 1Q9DA 2I49A 4JBZA 4RYAA 4JVDA 2V84A 3MC2A 3K0VA 3E79A 2DWAA 4P8BA 2CZLA 3IB0A 4G61A 1FW0A 5I2KA 4FBPA 4KQPA 5BUUA 3FV1A 4JXIA 3VLVA 4NMYA 2REJA 1LFGA 4GWSA 3A29A 2I3WA 3BFTA 4QHQA 1POY1 1NFTA 4ZEKA 3B7DA 1FPEA 2ANJA 2XXIA 1IIWA 3H06B 1WVJA 1B52A 4F3GA 3S9MC 3TTMA 2R8TA 4OANA 2R9JA 3VDFA 2ABHA 1BKAA 1DSNA 3MVYA 1NH7A 3F11A 4OVRA 3IO6A 4DE8A 4N13A 3B6WA 4OFOA 3SKPA 3PMXA 4PFWA 5JTYA 2OJTA 1FQAA 3VVEA 5H8QA 1I69A 1S9TA 4PBQA 3RT8A 4U4XA 3OXNA 1INPA 1A55A 1BK4A 3OENA 4UA8A 4XKPA 3O28A 2YLNA 2XXRA 3UP9A 1FTAA 3FJ7A 4LQ2A 3TKDA 4KYDA 3A3CA 1MDQA 1NUZA 2XXQA 5AA3A 3DELB 4YAHX 3K6XA 3RN8A 4QFLA 1MQGA 2H99A 3LBSA 5EQ9A 1LLSA 4OVTA 3UK4A 4O3BA 4POWA 4IGTA 1IZ1A 1B0LA 3UN6A 4NF8A 5F7VA 1B51A 1SW4A 4BDRA 1R6ZA 1FPLA 1Y1ZA 2GHBA 4P1EA 4F2OA 3O97A 4NN3A 4GRKA 2P2AA 4ELRA 3G3JA 2F6GA 3FD3A 3T1BA 1SDXA 1I6BA 1BP5A 1YYZA 4YU0A 1AIVA 3DRFA 4G4PA 4G8MA 1A54A 2F6PA 3HHGA 3DRJA 1N04A 3GLBA 4LVQA 4WKMA 2V93A 5CMCA 3MPLA 4QSCA 3D1RA 1B9JA 4JDFA 4R2BA 2RC7A 3T22A 2W7YA 3EF7A 1IMBA 1Y4TA 1FPKA 3D4GA 1QJMA 1JVXA 4N07A 4O7IA 3MJNA 1H43A 3ROJA 3PPQA 2CZKA 4NHBA 4OWDA 5TPAB 3KGCA 4C1TA 1H45A 1CNQA 4PAFA 2DWJA 1JW5A 4UACA 1LB8A 1LBBA 4PC9A 1P1OA 2ZXTA 4BDLA 5I58A 5ICTA 3H6VA 1K9ZA 1MPBA 5DT6A 1BIYA 3IJXB 2AL5A 2Z8FA 3CI8A 5LTCA 2QMWA 4BLAA 1RYXA 4IO3A 1B3EA 3ILTB 3FVNA 4KYSA 3TQWA 3DP8A 5DVFA 4Q8RA 5LDZA 4HE2A 1A99A 1SYIA 2THIA 3Q29A 3C36A 1DCUA 4RXLA 4QFKA 3W9WA 1MS7A 3FVKA 2FYIA 2Q2AA 1ELJA 5ITOA 4X1BA 5ISUA 4N6PA 1O64A 1URSA 1URDA 1JW4A 1DMBA 3TDJA 2DWHA 3L6HA 3C4MA 4IY6A 1EYKA 4ONYA 3PV0E 5I2NB 3KSXA 4GLIA 2ZNTA 3QYTA 1ZMGA 2ZZXA 4OVPA 3U65A 1XOCA 5CM6A 2ONRA 3K01A 4HTGA 3MW0A 1D3KA 4G8HA 3PUWE 4QSEA 1FBEA 4JSDA 2Q2CA 3PMVA 3T96B 4ZE8A 5L8DA 1L5TA 3TTRA 2A5TB 2A5TA 1LGBC 4RY1A 1NV5A 4Z7EA 4DCYA 2Y5KA 3A09A 5ET6A 2DQVA 1P1QA 1RDYA 3G3IA 2OX3A 4PAKA 4ZEFA 2DWIA 3O6PA 1AWBA 2F35A 2XXYA 3E13X 4X9TA 3C31A 3MAMA 2I0BA 4ZEIA 3RYAA 2DE2A 1DPEA 1M5CA 3MQ9A 5I2KB 4N4UA 2V3QA 4OA4A 2PCRA 5HPQA 2B65A 2D5WA 4RK9A 3K1MA 4K3FA 2PT1A 3C9HA 1CE2A 4LONB 1LB9A 3TTLA 4MAGA 4MFIA 4EF2A 4YB7A 4ZECA 4OERA 1FTMA 3DM0A 1MY3A 4F3PA 2RINA 5B70A 3G3FA 2OWZA 2Y5LA 2AIXA 2Q9TA 2HZLA 4NEDA 5I5PA 5KCJA 3PMWA 5IM2A 4TOZA 1Y3NA 4LZ8A 4EQBA 3SERA 2F36A 4HE1A 1FPBA 1UIVA 1NMUA 3QMFA 3OSQA 3DLNA 4PETA 4PFBA 3PD9A 4FE8A 4GXSB 3TODA 5EYHA 4GWYA 4FORA 2ZYMA 3FXBA 3LR1A 1FQEA 2WBDA 1Y20A 3TUSA 4H46A 1EZOA 3KG2A 1IXGA 4LN5A 1VFDA 2ESNA 1B5HA 2PBWA 3SEWA 1QW0A 2HFBA 3KC0A 3KN8A 1LFHA 2DYXA 1MY1A 1XS5A 3KN7A 1QUIA 3KJ7A 1P1NA 4NWCA 1FQDA 4GD5A 3TPAA 4ZEDA 1MXWA 4R6YA 3FV2A 1IXCA 2P0SA 2A5SA 4R75A 1FPFA 2OK2A 3GXAA 4NF5B 3OEKA 3G3GA 1F9BA 4IGRA 4FEDA 3MZ9A 4WEDA 4AB5A 1LCTA 1NUXA 4KD5A 4PCDA 4LATA 3IK6B 2PVUA 4N8GA 2Z22A 4MNCA 5I3SA 2PFYA 2Z8DA 2QS2A 4N91A 4NQ8A 3MPKA 4NX1A 2O1MA 4O8MA 1CB6A 2I3VA 3H03A 1NV3A 1NL5A 2ALUA 4GVOA 3JZJA 3O2AA 5J16A 2B3BA 3N5LA 1NNPA 3ZS6A 3GBBA 3T0JA 4P3LA 3MBPA 2P3VA 3N94A 3PUYE 3ISPA 1I6QA 1USYE 3CVGA 4MCOA 4IY5A 2PMSA 1PB9A 2NVUB 3KN3A 5EHMA 1NV7A 4E0WA 5BWJA 3K6VA 5H8HB 2H9BA 3BBRA 4Q5TA 4XEQA 3O9PA 1A40A 4I3YA 3H6WA 3FJMA 4GWWA 3TAJA 2PYYA 4BDMA 1JVYA 1MQJA 4PFTA 2RC8A 1MY4A 3DRKA 2OWSA 1UIUA 3SDFA 4I62A 1TFDA 2XX9A 3VLUA 2M8CA 4MNPA 4H45A 3M3FA 3QUJA 3LC8A 5I57B 4HCYA 1LAHE 1KZ8A 2ZZVA 3UORA 3SZPA 4NF4B 4KI0E 3O6HA 5EQAA 4OVQA 3EHTA 1B1HA 2XD2A 2O6AA 3KJTA 1IMEA 1OQHA 2Y7PA 5IZ1A 2D21A 2B4LA 1IQ7A 3FTOA 4GX4A 1OLCA 3ZKKA 3LUZA 4E0XA 2CEYA 5HBCA 3HN0A 4DXBA 4LZ5A 3KFMA 4XIGQ 4HW8A 3K1PA 3QUFA 4XF5A 1IITA 1TFAA 2AYSA 5FHNA 3CHGA 3K4UA 5I56A 4G2ZA 1QVSA 1B2HA 4M1VA 2DSFA 2Q74A 1N84A 5KCJB 3HSTA 4I1DA 4P1LA 1MPCA 3IOUA 1QKAA 4GBWA 2O51A 2XHDA 4F19A 4OTEA 4G68B 2XXHA 4GBVA 1XI6A 3FIRA 4DXCA 1XT8A 1NUYA 4NF6A 3V5AA 2F7AA 1OQGA 4O3AA 1QKBA 3MUQA 4NF8B 2HCAA 2OBGA 2F5XA 1LAGE 2Y7KA 3MYUA 3RLFE 1NI9A 2XX7A 2GQ1A 3RNNA 1FSAA 4U23A 3SEVA 1SW5A 3DP4A 2AL4A 3ZSFA 3FATA 3TEPA 4F1UA 3V8XB 1MXYA 4KFQA 3SETA 3KOSA 2RKMA 3QSLA 4QFPA 1UTBA 4NGUA 4F1VA 5L9OA 3CIJA 1PBQA 1LBWA 1S7YA 3ZKLA 4O3CA 1FTKA 2XA5A 3CFXA 2B3FA 2GRVA 3TCFA 1SI0A 5CI5A 2O7IA 4MNIA 1Y1MA 3SESA 4IO7A 4G68C 1NV6A 3ONMA 3E78A 4LP2B 4FJPA 2Z23A 5A5XA 1NNFA 4NE4A 2HEUA 3SEYA 1Z7NE 1GVCA 4HCWA 3MWBA 4N6DA 4C1UA 1Y3PA 5ET7A 4ESXA 2QVRA 3LSFB 2HQ0A 1AMFA 3S9NC 3OELA 3QK6A 4X1DA 1KA0A 4GWUA 3CG1A 3CRBA 4EXKA 4H0WA 4GX3A 4YB6A 1UTBB 2V3TA 4DXUA 1FBPA 4PTKA 2P1SA 5DYHA 1O7TA 4MLVA 4YMBA 4RNSA 2O84X 2CEXA 3FUZA 4JWOA 4AS4A 4R73A 3QIMA 4JVCA 1R9QA 2XWOA 3LSLA 3KBZA 3PUXE 3T93B 1D4NA 1NV2A 3V89B 2NXOA 3IOVA 5FHMA 3TCHA 2XD3A 3USDA 3PPOA 4LQ5A 3VVFA 3RTWB 2DP8A 2DVZA 3NOHA 4IO5A 4PF8A 4QBAA 3R6UA 4OESA 5H8NA 4OHNA 1MM6A 2VPNA 3GYYA 5J1DA 3VXCA 4RA1A 3O66A 2FBPA 2F8DA 3G3KA 3PPRA 2Y7IA 1II5A 4OYVA 2Z8EA 1FTLA 4NF5A 2V4CA 1LAXA 4OZ9A 1MH3A 3UGWA 3H6TA 2YPNA 3FVOA 3EQ1A 1A8FA 5IGAA 3MZBA 1JETA 4LUBA 5T3JA 3MP8A 3TELA 1GTKA 4BDNA 4EDPA 4ELOA 1PC3A 4N8YA 2PFZA 4FIMA 2Y84A 3THIA 1FCKA 2I4BA 3PPPA 4YKKA 1G0IA 1B58A 1A8EA 5EQ7A 1S50A 1MPDA 5JK4A 3OMBA 1FBGA 2FIXA 2IA4A 3CSGA 2QJEA 2PX1A 5CRYA 5DW8A 4YKIA 4OMBA 3DRGA 4IR8A 2UYEA 2G93A 2I6EA 1N3WA 4PGNA 3UA8A 2NWJA 3IOTA 3Q26A 4X8RA 2QS1A 5AE4A 1LAFE 1KWHA 2FNCA 1NV4A 1R9LA 3MZ1A 4G68A 4X04A 1B46A 4XXUA 4XFEA 1PEBA 5AA2B 2NUVA 1D9YA 4KHZE 3PAMA 2ONKE 5AA1A 3K6WA 4P47A 4WXJA 1MXVA 2XWVA 1GV8A 5TP9B 2QPQA 3EPEA 4XKQA 1MQIA 4PFYA 2F7CA 2LAOA 1N76A 4H1XA 1FQCA 4H5FA 3OOAA 4P0IA 5CMBA 3OO6A 2WYPA 1UTHB 1JP4A 2R71A 4F3BA 2DDKA 1RDXA 4OFLA 4P9KA 4MLQA 5H8FA 4OQOA 2XXTA 2I0CA 4OXVA 4U1OA 2XXWA 5K2XA 3C32A 5FHOA 4DCXA 4G8NA 2ZNSA 4PDHA 2GHAA 2WX9A 2VHAA 3IB2A 3RPWA 5K2YA 1P1WA 4EXLA 1B4HA 4KCCA 4TQUQ 2HPGA 2OCUA 3VE1B 4JSOA 3BKIB 4XKRA 3RPLA 1SVXB 2RCBA 3ODBA 1D9QA 4RJZA 2WKYA 3TQLA 2P3NA 4P56A 1LBXA 4H5GA 1JW1A 1RYOA 1SW2A 4KPTA 1MG1A 1DBZA 1OLAA 1R1NA 3PUVE 4MIJA 3IFCA 2CZIA 1M5DA 1HSJA 1M5BA 3D4CA 4TLMB 4X48A 4PFIA 1YCJA 1P99A 2DE3A 2QS3A 4KYEA 3B50A 3SEXA 4WEPA 2OLBA 2X7PA 3MP6A 2VP1A 1ZBMA 4FATA 3M3LA 3TCGA 1OVBA 4GOTA 1H3DA 4JWXA 1US5A 1NNTA 5IZ3B 1FBDA 3OO8A 5AA2D 3B6QA 4N81A 4JB7A 2L5VA 1B5JA 2CMOA 3V83A 4O7MA 1WDNA 3U72A 4OEUA 3S9EA 2QVUA 1FBHA 1QULA 2CZHA 3TTKA 3K6UA 3T9HB 2I48A 4MF3A 2KLFA 1NNKA 5F1QA 1Y4CA 2KQZA 3I6VA 5TPAA 3LVUA 2WBBA 4QRZA 1JNFA 2HXRA 4ESWA 3G3HA 3QXMA 3T9UA 2WYKA 4NAPA 5DTBA 1DK4A 1LSTA 5I56B 1LFIA 3K1NA 3IO4A 3DP6A 3IX1A 1XHYA 1B40A 4I9DA 1B7ZA 4PAIA 3T66A 2R6GE 1JEVA 1M5EA 5ESYA 1IMFA 1URGA 1NKXA 4NG7A 1N0TA 3PPNA 4R72A 1WODA 1MDP1 4ZEBA 1AL3A 4DZ1A 4RPNA 2WOLA 4PE5B 5I59B 1DOTA 1SI1A 1ATGA 4NF0A 3K02A 4MBPA 4P11A 4FAJA 3BFUA 3RPLB 1IMAA 1OVTA 1H76A 3HFUA 4AS5A 2UVIA 2O68A 1B0HA 3HHFA 3PUZE 4U21A 2ZMBA 3KBRA 3U93A 3FVGA 1AOVA 2IEEA 4I8CA 5FTIA 1BTJA 3H3GA 2UXAA 3RTFB 3CFZA 3Q28A 4GF8A 2F7BA 1FTOA 3IFAA 3E9XA 3CR9A 3K00A 4G77A 1ZIUA 3KC1A 2I58A 4XTCQ 4IO4A 5IKBA 1IXHA 3MSTA 4AQ4A 1EZ9A 3FGSA 2GFEA 1FPGA 1FTJA 4THIA 5I84A 1LEVA 1MH4A 1EYJA 2XXKA 4ZE9A 3B6TA 5EYFA 1TWYA 2XWKA 4F1YA 5CMMA 1OIBA 1POTA 4GX6A 2PT2A 5DVJA 4N17A 5TP9A 2QMXA 4BDOA 2H25A 3VFJA 4EQ9A 4ZZAA 3IOWA 2GH9A 4GL0A 4GWOA 5I59A 4GFRA 1FRPA 2F78A 5KDTB 2X26A 1DTGA 2UYFA 3HCQA 3H4ZA 3Q25A 3RYBA 1FPDA 4ECFA 1VSOA 4NWDA 3P7IA 3U8QA 5I2NA 2XXVA 4DI4B 2QS4A 3M3KA 3R26A 4BDQA 4F31B 3W9VA 3L6GA 4U1ZA 2HZKA 1GR2A 5DVIA 5DEXA 3S9LC 1B3HA 3C33A 2UVHA 4N6KA 3RGYA 3IAZA 3IL1B 3N6TA 1YPNA 3S2VA 3M8UA 1TXFA 1MY2A 3MVWA 4R2FA 3IR1A 5ICQA 4YKJA 3H6UA 1QUKA 2HXWA 2FIEA 1YZ0A 3DRIA 4OEVA 3FZVA 5H8QB 4P0GA 3BIHA 1B3GA 1QUJA 3H7MA 4JVIA 4NF4A 1VFEA 3T9XB 2DOJA 3OEMA 1IEJA 4MEVA 2MKZA 3PU5A 5I57A 2V3UA 3HV1A 1XC1A 3IB1A 5KDTA 3W15C 4OVSA 1LBVA 4OFJA 3I5OA 5IZ3A 5JEIA 2WOPA 1XVYA 2Q8JA 4ZS9A 3FASA 4KCDA 5CMKA 1KA1A 2Q8MA 4U2RA 2RCAA 2JJKA 2I4CA 1LBCA 5ELVA 4LA9A 1RKMA 2DXRA 1G0HA 1UQWA 1ZTYA 3FBPA 5H8NB 4DI3D 5EQ8A 4ELPA 2O1LA 5TU0A 5IZZA 5CBRA 1VR5A 3OO9A 1MQHA 3KSJA 1GGGA 1FJ9A 4PFRA 2YJPA 5A5LA 2KR0A 1IMDA 4EQ7A 4ISUA 1FBFA 1B6HA 3N6UA 4POXA 3G7WA 4I3EA 4R9GA 3KEIA 4F39A 4GXAA 4R9FA 3O6IA 3TYHA 2E0SA 3ILUB 3MVZA 1YAEA 2UVJA 2HAVA 3OO7A 4HE0A 3E3KA 2H5YA 2Q88A 1SW1A 4PBHA 3IORA 1RDZA 5FBPA 2H4IA 1Y9UA 1LCFA 1ZJLA 5F24A 3RY3A 2D3IA 1NV0A 4F22A 4N15A 2ZYKA 5HM4B 2XX8A 1MXZA 3HO7A 2VOZA 3PTYA 2ZYOA 4OETA 2ONSA 5CBSA 3U1OA 4QSDA 1K9YA 5M2VA 1SQYA 1B1XA 4NTLA 1MRPA 3LSWA 1I6AA 3C35A 3PD8A 4H8JA 1NUWA 1EH3A 3OD7A 4EF1A 2QVVA 4DLDA 4MMPA 4GL8A 1EYIA 3R7XA 1US4A 3MP1A 1AH5A 1SBPA 5JTYB 2BJIA 4OENA 3U92A 5AA2A 4IO6A 2QL3A 2FHYA 3QAXA 4PFUA 4RPOA 3LUYA 2ZNUA 3E4RA 3K2DA 1TT1A 1YTVA 5I7IA 3VV5A 3RQTA 2Y7WA 4UABA 3DRHA 4YZZA 1DTZA 1SYHA 3T9VA 2VGQA 4GQOA 3VXBA 2OWTA 4QFNA 3TZAA 4PE3A 4ZZEA 1PB8A 2HAUA 3C34A 1EZPA 1LBZA 3O29A 4GWZA 4YKPA 2DVCA 4M4GA 2WOKA 1FPJA 1D9VA 3I3VA 4F29A 4YB5A 5H8HA 3SEUA 3JYRA 4LZ7A 4PP0A 1N7XA 5ET5A 5DEXB 2F3DA 2VPOA 1VDWA 1SPIA 5EYGA 4MHFA 2F34A 3KOTA 3Q27A 4C0RA 4YMAA 1N3XA 1HSLA 3LV0A 4KR5A 4DDDA 5KZTA 1FJ6A 1M5FA 5H8FB 4FEBA 4PQJA 4GWXA 2DE4A 1ANFA 4IB2A 3EHUA 4ELQA 1FBCA 4GIZA 2B4MA 5L9SA 3AXFA 3RT6B 4HS7A 4MJOA 3GZGA 3U94A 2QFLA 2QSXA 3OSRA 1UTHA 1DPPA 2REGA 4I40A 4H65A 2XXPA 4H67A 3FXRA 2XXXA 1LBYA 1MXUA 2Y7RA 4EUOA 1B3FA 5I58B 4DIGA 1MM7A 4XKNA 4QFOA 1IMCA 3TTNA 1B4ZA 2WEFA 4OVJA 3S4UA 1QGXA 3PGFA 2H98A 4MX6A 4U22A 1B7UA 1XVXA 4JWYA 4F2QA 3ECRA 4PDDA 3UIFA 2O7UA 4IO2A 3CSBA 3TFLA 2ZZWA 3FXQA 1ZLQA 1IXIA 4TLLB 2DS9A 4L17A 2Q89A 2QRYA 5AA4A 3N26A 3HPIA 2X7QA 3EHSA 1A7LA 4F3SA 5B7DA 1T0KA 4QF9A 2RF1A 2VD3A 5ITPA 3CG3A 3CFLA 4R6KA 3EKIA 5A5XB 4YICA 1BLFA 4QXDA 2NOOA 1HSEA 1O63A 4PF6A 4Q0CA 1B32A 3A3UA 4R74A 1MQDA 3IJOB 1OMPA 4AB6A 2XWIA 5CC2A 4MH5A 1FPIA 2HHMA 2F3BA 5LOMA 1NH8A 4HXVA 2VT5A 3FJGA 4ZDMA 1P1UA 3WAEA 3VLWA 1PBPA 4R6HA 1FQFA 5L9MA 5H8SA 4PGPA 1N7WA 3GBAA 2XXUA 3JV9A 1B3LA 4KXPA 1SD3A 1J1NA 1PB7A 4H6DA 1B5IA 1JQFA 3FXUA 2V25A 2DXYA 1JEUA 3RYDA 3KZGA 3RUMA 5IAIA 3WAFA 4O94A 5AA4B 1NV1A 3VVDA 1EU8A 3BIGA 1MY0A 1B05A 1IUDA 2UVGA 1MXXA 2F97A 2VD2A 3B8BA 2FVZA 1Y3QA 5FTHA 2E1SA 5EHSA 1Q1KA 3TMGA 3LSXA 2RC9A 4ND9A 4RK2A 1USYH 5ET8A 1B7HA 1ZU0A 1ZKBA 4NF6B 1Z7ME 2O69A 2G29A 3O6GA 4U4SA 1YXIA
chains in the Genus database with same CATH topology
1Y20A 2IA4A 3CSGA 3TUSA 4OEVA 3FZVA 5H8QB 1EZOA 3KG2A 2QJEA 2PX1A 1IXGA 2BJJX 4P0GA 1VFDA 2OZZA 4H8IA 1Q35A 2ESNA 1B3GA 4F18A 1PDAA 1QUJA 1B5HA 3H7MA 4NF4A 3SEWA 1VFEA 1FQBA 1H44A 2PBWA 4Q30B 1QW0A 2HFBA 2ZYNA 4YKIA 2DOJA 4OMBA 3OEMA 3MVXA 3DRGA 4FECA 4Z0IA 2FA7A 2UYEA 1IEJA 3EN3A 1VE4A 2DYXA 3KN8A 1LFHA 1MY1A 1XS5A 2G93A 2I49A 3KN7A 1QUIA 3KJ7A 3PU5A 5I57A 2I6EA 1N3WA 1P1NA 4JBZA 4NWCA 4WEPA 4RYAA 5CRYA 2V3UA 1FQDA 3HV1A 3UA8A 1XC1A 2V84A 4GD5A 3IB1A 2NWJA 5KDTA 3TPAA 4ZEDA 1MXWA 3IOTA 3MC2A 3Q26A 4R6YA 2QS1A 3W15C 5AE4A 1LAFE 3K0VA 1KWHA 2FNCA 4OFJA 2DWAA 3FV2A 3I5OA 1IXCA 1R9LA 2P0SA 3MZ1A 2CZLA 3IB0A 2A5SA 4R75A 4G68A 1FW0A 1B46A 2OK2A 3GXAA 2WOPA 1XVYA 4NF5B 4XXUA 5I2KA 3OEKA 3G3GA 5JEIA 1F9BA 1PEBA 2Q8JA 5AA2B 4ZS9A 4KQPA 4IGRA 3FASA 4FEDA 4KCDA 5BUUA 3MZ9A 5CMKA 3FV1A 1AOVA 4WEDA 4JXIA 2NUVA 3VLVA 1LCTA 4U2RA 2RCAA 1D9YA 4KHZE 4AB5A 4KD5A 3PAMA 2I4CA 1LBCA 4LATA 4NMYA 2REJA 1LFGA 3IK6B 5ELVA 4LA9A 2ONKE 1RKMA 2DXRA 5AA1A 2PVUA 3K6WA 4WXJA 1MXVA 2Z22A 2I3WA 1UQWA 1GV8A 1ZTYA 3BFTA 5H8NB 4QHQA 2Z8DA 2QS2A 3MPKA 5TP9B 1POY1 2QPQA 2O1MA 1CB6A 1NFTA 4ZEKA 3EPEA 4ELPA 4XKQA 1MQIA 3B7DA 4R2FA 4PFYA 2ANJA 2F7CA 1IIWA 2I3VA 2O1LA 2LAOA 1N76A 2XXIA 1FQCA 3H03A 3H06B 4H1XA 1VR5A 3OOAA 1NL5A 3OO9A 1WVJA 4H5FA 1MQHA 3OO6A 4P0IA 1B52A 5CMBA 3KSJA 1GGGA 1UTHB 4F3GA 3S9MC 2R71A 2ALUA 4GVOA 4F3BA 3JZJA 3O2AA 3TTMA 2B3BA 2YJPA 2R9JA 3VDFA 2ABHA 1BKAA 3N5LA 4OFLA 1NNPA 3ZS6A 4EQ7A 4MLQA 1DSNA 3MVYA 4ISUA 1NH7A 1B6HA 3N6UA 3F11A 3GBBA 5H8FA 4OQOA 2XXTA 3MBPA 2I0CA 4POXA 3N94A 4OXVA 3PUYE 3IO6A 4DE8A 4U1OA 3G7WA 2XXWA 1I6QA 1USYE 3KEIA 3CVGA 3C32A 4GXAA 4N13A 3B6WA 3O6IA 4R9FA 4DCXA 4G8NA 4OFOA 2E0SA 2ZNSA 3SKPA 3TYHA 3PMXA 3ILUB 4PFWA 2PMSA 4IY5A 3MVZA 2GHAA 5JTYA 1PB9A 2NVUB 2OJTA 1FQAA 1YAEA 3KN3A 2UVJA 2VHAA 2HAVA 5EHMA 3VVEA 5H8QA 1I69A 1S9TA 3OO7A 3E3KA 2H5YA 3RT8A 4U4XA 2Q88A 3OXNA 4E0WA 1SW1A 3IB2A 3RPWA 5K2YA 5BWJA 3IORA 1P1WA 1A55A 3OENA 4UA8A 4EXLA 4XKPA 1B4HA 3K6VA 4KCCA 2H9BA 3BBRA 4TQUQ 2H4IA 5H8HB 1Y9UA 1LCFA 1ZJLA 3O28A 2YLNA 2XXRA 2OCUA 3RY3A 2D3IA 4Q5TA 3UP9A 3VE1B 3O9PA 4F22A 1A40A 4JSOA 3H6WA 3BKIB 3FJMA 2ZYKA 3FJ7A 4XKRA 4LQ2A 3TKDA 5HM4B 2XX8A 4KYDA 3TAJA 1SVXB 1MDQA 1MXZA 2PYYA 2XXQA 2RCBA 3A3CA 4BDMA 1JVYA 3HO7A 3ODBA 5AA3A 2VOZA 3DELB 1MQJA 4PFTA 2RC8A 2WKYA 1MY4A 4RJZA 2ZYOA 4YAHX 3DRKA 3TQLA 3K6XA 3RN8A 2OWSA 4QFLA 1MQGA 1UIUA 4OETA 2H99A 2ONSA 3SDFA 3LBSA 5CBSA 4H5GA 3U1OA 4QSDA 1LLSA 3UK4A 1JW1A 4O3BA 4POWA 4IGTA 1IZ1A 1SQYA 5M2VA 3T9XB 1B0LA 3UN6A 1RYOA 1SW2A 4I62A 4KPTA 1MG1A 1TFDA 2XX9A 4NF8A 5F7VA 3VLUA 1B51A 1B1XA 2M8CA 1OLAA 1SW4A 3M3FA 4NTLA 4BDRA 1MRPA 3LSWA 1R1NA 1I6AA 1R6ZA 3PUVE 1Y1ZA 2GHBA 3QUJA 4F2OA 3C35A 3LC8A 3PD8A 5I57B 4H8JA 4HCYA 3OD7A 1EH3A 3O97A 4EF1A 4DLDA 1M5DA 1LAHE 4GL8A 1HSJA 4GRKA 2P2AA 4ELRA 3G3JA 1M5BA 2F6GA 3UORA 3FD3A 3R7XA 1SDXA 1I6BA 1BP5A 4NF4B 1US4A 4YU0A 1AIVA 3D4CA 4KI0E 3DRFA 4G4PA 4TLMB 4X48A 3MP1A 3O6HA 1YCJA 1AH5A 4G8MA 1P99A 1SBPA 5JTYB 3RTFB 2DE3A 1A54A 2QS3A 4KYEA 2F6PA 3EHTA 3SEXA 1B1HA 2OLBA 2X7PA 3HHGA 3MP6A 3DRJA 2XD2A 2O6AA 1N04A 2VP1A 3GLBA 4OENA 1ZBMA 4LVQA 3KJTA 4FATA 3M3LA 3TCGA 3U92A 4IO6A 2QL3A 5AA2A 1OQHA 3QAXA 4PFUA 4RPOA 2Y7PA 3LUYA 4WKMA 1OVBA 2V93A 2ZNUA 3E4RA 3K2DA 1H3DA 4GOTA 1TT1A 4JWXA 5CMCA 1YTVA 1US5A 2D21A 1NNTA 3MPLA 2B4LA 4QSCA 3RQTA 3VV5A 5JK4A 3OO8A 1IQ7A 2Y7WA 3FTOA 5AA2D 3B6QA 3DRHA 1B9JA 1OLCA 4JDFA 4R2BA 4YZZA 1DTZA 4JB7A 3ZKKA 1SYHA 2RC7A 3T22A 2W7YA 1B5JA 2VGQA 3T9VA 2CMOA 4E0XA 4GQOA 3EF7A 5HBCA 3VXBA 3HN0A 4DXBA 2OWTA 4LZ5A 3V83A 4QFNA 1Y4TA 3KFMA 3TZAA 3D4GA 1QJMA 4ZZEA 1PB8A 2HAUA 1JVXA 1WDNA 3C34A 4XIGQ 4OEUA 3U72A 3K1PA 3QUFA 4HW8A 3S9EA 4N07A 1EZPA 1QULA 3O29A 3MJNA 3TTKA 1H43A 4YKPA 2DVCA 1IITA 3PPQA 3K6UA 4M4GA 3T9HB 2I48A 1TFAA 2AYSA 5FHNA 2WOKA 3CHGA 1D9VA 4OWDA 3I3VA 4MF3A 2KLFA 3K4UA 5TPAB 4F29A 3KGCA 1NNKA 4C1TA 1H45A 4YB5A 5I56A 5H8HA 3SEUA 5F1QA 1Y4CA 4G2ZA 3I6VA 3JYRA 1QVSA 4LZ7A 1B2HA 2DWJA 4M1VA 3LVUA 2DSFA 1N7XA 1JW5A 4PP0A 5TPAA 5DEXB 4UACA 4QRZA 1N84A 5KCJB 3HSTA 2F34A 3KOTA 1JNFA 3Q27A 4I1DA 1LB8A 1MPCA 3IOUA 4C0RA 1QKAA 4ESWA 1LBBA 2O51A 2XHDA 4F19A 4YMAA 1N3XA 1HSLA 4OTEA 3G3HA 4G68B 3QXMA 3T9UA 2XXHA 1P1OA 2ZXTA 4BDLA 5DTBA 5I58A 4KR5A 5ICTA 4DDDA 5KZTA 5H8FB 1M5FA 4FEBA 3FIRA 2DE4A 4IB2A 1ANFA 1LSTA 3H6VA 1MPBA 1LFIA 1XT8A 3EHUA 4DXCA 5I56B 3K1NA 4NF6A 4ELQA 5DT6A 1BIYA 3V5AA 3IJXB 3IO4A 2AL5A 2B4MA 4GIZA 2F7AA 3AXFA 5L9SA 1OQGA 2Z8FA 4HS7A 4O3AA 3RT6B 3CI8A 3DP6A 3GZGA 1QKBA 2QMWA 1RYXA 1XHYA 3IX1A 1B40A 3MUQA 5H8NA 4I9DA 1B7ZA 2QSXA 3OSRA 1B3EA 1UTHA 3ILTB 4IO3A 1DPPA 3T66A 2R6GE 2REGA 3FVNA 1JEVA 4H65A 4KYSA 1M5EA 2HCAA 2XXPA 2OBGA 4H67A 3TQWA 3FXRA 3DP8A 2XXXA 1URGA 1MXUA 1NKXA 2F5XA 2Y7RA 1LAGE 2Y7KA 5DVFA 4EUOA 4Q8RA 5K2XA 1B3FA 5I58B 1N0TA 1A99A 3RLFE 1SYIA 2THIA 4DIGA 1MM7A 2XX7A 3Q29A 4XKNA 4QFOA 3C36A 3PPNA 4R72A 3TTNA 4RXLA 3RNNA 1B4ZA 4U23A 3SEVA 1SW5A 4QFKA 3DP4A 4OVJA 1WODA 2AL4A 3ZSFA 1MDP1 3S4UA 4ZEBA 1AL3A 3W9WA 1MS7A 4RPNA 3FATA 4DZ1A 3FVKA 3PGFA 2FYIA 3TEPA 2WOLA 2H98A 4F1UA 3V8XB 4FORA 4PE5B 1MXYA 2Q2AA 4KFQA 1ELJA 3KOSA 3SETA 5I59B 1DOTA 1SI1A 2RKMA 3QSLA 4U22A 1ATGA 5ITOA 4QFPA 1B7UA 1XVXA 1UTBA 3K02A 4JWYA 4MBPA 4X1BA 4F2QA 4F1VA 5L9OA 3ECRA 3CIJA 1PBQA 4P11A 4FAJA 5ISUA 1O64A 4N6PA 1S7YA 1URSA 3BFUA 3UIFA 1OVTA 1H76A 1URDA 3ZKLA 1JW4A 2O7UA 4IO2A 4O3CA 1DMBA 3CSBA 2UVIA 3TFLA 1FTKA 3TDJA 2DWHA 3L6HA 3FXQA 3C4MA 2O68A 1B0HA 3CFXA 3HHFA 3PUZE 4IY6A 4U21A 4EXKA 4NF8B 2B3FA 1ZLQA 1IXIA 2GRVA 2ZMBA 4ONYA 3TCFA 4TLLB 1SI0A 2DS9A 5CI5A 2O7IA 4L17A 1Y1MA 2Q89A 3KBRA 3PV0E 3SESA 4IO7A 3U93A 2QRYA 5AA4A 5I2NB 3N26A 3HPIA 3KSXA 3FVGA 2ZNTA 3QYTA 1ZMGA 2IEEA 2X7QA 4I8CA 3ONMA 4G68C 1BTJA 5FTIA 1XOCA 3H3GA 2UXAA 5CM6A 3EHSA 2ONRA 3CFZA 4FJPA 4LP2B 3Q28A 5TU0A 4GF8A 2Z23A 1A7LA 4F3SA 5A5XA 3K01A 2F7BA 4HTGA 1FTOA 1NNFA 5B7DA 1T0KA 4PQJA 3E9XA 4NE4A 3MW0A 1D3KA 2HEUA 3CR9A 4G8HA 4QF9A 1Z7NE 1GVCA 3SEYA 4HCWA 3MWBA 2RF1A 3K00A 3PUWE 2VD3A 4C1UA 4G77A 1Y3PA 1ZIUA 2I58A 4QSEA 4XTCQ 4ESXA 4IO4A 4JSDA 3LSFB 4BLAA 2HQ0A 5ITPA 2Q2CA 3PMVA 3CG3A 5IKBA 3CFLA 3T96B 1AMFA 1IXHA 3S9NC 4AQ4A 3OELA 1EZ9A 4ZE8A 3FGSA 5L8DA 3QK6A 4X1DA 1L5TA 3TTRA 2A5TB 2GFEA 1FTJA 4R6KA 2A5TA 1LGBC 5A5XB 4YICA 3CG1A 3CRBA 1BLFA 4THIA 4H0WA 4RY1A 4YB6A 4DCYA 1MH4A 1UTBB 4Z7EA 2NOOA 3A09A 2V3TA 4DXUA 1HSEA 4ZE9A 1O63A 2DQVA 1P1QA 2P1SA 5DYHA 3G3IA 1O7TA 4MLVA 3B6TA 4Q0CA 4RNSA 5EYFA 4YMBA 2O84X 3FUZA 1TWYA 1B32A 4JWOA 3A3UA 4F1YA 4ZEFA 5CMMA 2DWIA 4R74A 1OIBA 1MQDA 1POTA 4R73A 3QIMA 3O6PA 3IJOB 2PT2A 2F35A 1OMPA 1R9QA 3LSLA 3PUXE 5DVJA 3T93B 4AB6A 1D4NA 5TP9A 3V89B 5CC2A 2NXOA 2QMXA 4MH5A 2XXYA 3E13X 4X9TA 3IOVA 3C31A 3TCHA 3MAMA 2XD3A 5FHMA 2H25A 2I0BA 3USDA 3VFJA 4BDOA 4EQ9A 4ZZAA 5LOMA 3IOWA 4ZEIA 2GH9A 3PPOA 1NH8A 3RYAA 5I84A 4LQ5A 4GL0A 3FJGA 4ZDMA 2DE2A 1DPEA 1M5CA 4GWOA 3RTWB 3MQ9A 1P1UA 4GFRA 5I2KB 3VVFA 3WAEA 4EF2A 3VLWA 1PBPA 4R6HA 2F78A 1FQFA 2V3QA 5L9MA 5H8SA 5KDTB 2X26A 2DP8A 2DVZA 4IO5A 1DTGA 1N7WA 3GBAA 5HPQA 2UYFA 3HCQA 2B65A 3H4ZA 2XXUA 3JV9A 3R6UA 1B3LA 4OESA 2D5WA 1SD3A 4RK9A 1MM6A 3K1MA 1J1NA 3Q25A 4K3FA 4OHNA 3RYBA 1PB7A 2PT1A 1B5IA 1CE2A 1JQFA 3C9HA 1LB9A 4H6DA 4LONB 3TTLA 3FXUA 5J1DA 3VXCA 2V25A 4RA1A 4MFIA 1VSOA 3O66A 4ECFA 2DXYA 2F8DA 2ZYMA 3G3KA 4YB7A 1JEUA 3KZGA 3RUMA 4ZECA 4OERA 1FTMA 3PPRA 3DM0A 2Y7IA 4NWDA 1MY3A 4GLIA 1II5A 3P7IA 4F3PA 4OYVA 3U8QA 3WAFA 5IAIA 2RINA 2XXVA 2Z8EA 5AA4B 3VVDA 5B70A 5I2NA 1FTLA 1EU8A 4NF5A 2QS4A 3G3FA 1MY0A 3M3KA 3R26A 1B05A 1LAXA 4BDQA 4OZ9A 1IUDA 2UVGA 1MH3A 3W9VA 3UGWA 4F31B 2AIXA 3H6TA 3L6GA 2YPNA 4U1ZA 2HZKA 2Q9TA 1GR2A 2HZLA 3FVOA 3EQ1A 4NEDA 1A8FA 5KCJA 1MXXA 2F97A 3PMWA 4TOZA 2VD2A 1Y3NA 4LZ8A 5DVIA 5DEXA 4EQBA 3MZBA 1JETA 4LUBA 3MP8A 3TELA 3SERA 1Y3QA 2F36A 1GTKA 3S9LC 5I59A 4BDNA 4EDPA 5FTHA 2E1SA 5FHOA 5EHSA 1Q1KA 4ELOA 1B3HA 1UIVA 3C33A 3LSXA 2RC9A 1PC3A 2UVHA 4ND9A 3RGYA 3TMGA 3U94A 1NMUA 3IAZA 5CBRA 3IL1B 3N6TA 1YPNA 3DLNA 3OSQA 4FIMA 4RK2A 2Y84A 3S2VA 3THIA 3M8UA 1TXFA 1USYH 4PETA 4R9GA 1FCKA 4F39A 1MY2A 2I4BA 3PPPA 3PD9A 4FE8A 4YKKA 3MVWA 1B7HA 4GXSB 1ZU0A 1ZKBA 3IR1A 1B58A 5ICQA 1Z7ME 1A8EA 2O69A 4NF6B 3H6UA 4YKJA 3TODA 1QUKA 2G29A 3O6GA 4U4SA 2HXWA 1S50A 1MPDA 1FQEA 3LR1A 3OMBA 3DRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y20 A;  2IA4 A;  3CSG A;  3TUS A;  4OEV A;  3FZV A;  5H8Q B;  1EZO A;  3KG2 A;  2QJE A;  2PX1 A;  1IXG A;  2BJJ X;  4P0G A;  1VFD A;  2OZZ A;  4H8I A;  1Q35 A;  2ESN A;  1B3G A;  4F18 A;  1PDA A;  1QUJ A;  1B5H A;  3H7M A;  4NF4 A;  3SEW A;  1VFE A;  1FQB A;  1H44 A;  2PBW A;  4Q30 B;  1QW0 A;  2HFB A;  2ZYN A;  4YKI A;  2DOJ A;  4OMB A;  3OEM A;  3MVX A;  3DRG A;  4FEC A;  4Z0I A;  2FA7 A;  2UYE A;  1IEJ A;  3EN3 A;  1VE4 A;  2DYX A;  3KN8 A;  1LFH A;  1MY1 A;  1XS5 A;  2G93 A;  2I49 A;  3KN7 A;  1QUI A;  3KJ7 A;  3PU5 A;  5I57 A;  2I6E A;  1N3W A;  1P1N A;  4JBZ A;  4NWC A;  4WEP A;  4RYA A;  5CRY A;  2V3U A;  1FQD A;  3HV1 A;  3UA8 A;  1XC1 A;  2V84 A;  4GD5 A;  3IB1 A;  2NWJ A;  5KDT A;  3TPA A;  4ZED A;  1MXW A;  3IOT A;  3MC2 A;  3Q26 A;  4R6Y A;  2QS1 A;  3W15 C;  5AE4 A;  1LAF E;  3K0V A;  1KWH A;  2FNC A;  4OFJ A;  2DWA A;  3FV2 A;  3I5O A;  1IXC A;  1R9L A;  2P0S A;  3MZ1 A;  2CZL A;  3IB0 A;  2A5S A;  4R75 A;  4G68 A;  1FW0 A;  1B46 A;  2OK2 A;  3GXA A;  2WOP A;  1XVY A;  4NF5 B;  4XXU A;  5I2K A;  3OEK A;  3G3G A;  5JEI A;  1F9B A;  1PEB A;  2Q8J A;  5AA2 B;  4ZS9 A;  4KQP A;  4IGR A;  3FAS A;  4FED A;  4KCD A;  5BUU A;  3MZ9 A;  5CMK A;  3FV1 A;  1AOV A;  4WED A;  4JXI A;  2NUV A;  3VLV A;  1LCT A;  4U2R A;  2RCA A;  1D9Y A;  4KHZ E;  4AB5 A;  4KD5 A;  3PAM A;  2I4C A;  1LBC A;  4LAT A;  4NMY A;  2REJ A;  1LFG A;  3IK6 B;  5ELV A;  4LA9 A;  2ONK E;  1RKM A;  2DXR A;  5AA1 A;  2PVU A;  3K6W A;  4WXJ A;  1MXV A;  2Z22 A;  2I3W A;  1UQW A;  1GV8 A;  1ZTY A;  3BFT A;  5H8N B;  4QHQ A;  2Z8D A;  2QS2 A;  3MPK A;  5TP9 B;  1POY 1;  2QPQ A;  2O1M A;  1CB6 A;  1NFT A;  4ZEK A;  3EPE A;  4ELP A;  4XKQ A;  1MQI A;  3B7D A;  4R2F A;  4PFY A;  2ANJ A;  2F7C A;  1IIW A;  2I3V A;  2O1L A;  2LAO A;  1N76 A;  2XXI A;  1FQC A;  3H03 A;  3H06 B;  4H1X A;  1VR5 A;  3OOA A;  1NL5 A;  3OO9 A;  1WVJ A;  4H5F A;  1MQH A;  3OO6 A;  4P0I A;  1B52 A;  5CMB A;  3KSJ A;  1GGG A;  1UTH B;  4F3G A;  3S9M C;  2R71 A;  2ALU A;  4GVO A;  4F3B A;  3JZJ A;  3O2A A;  3TTM A;  2B3B A;  2YJP A;  2R9J A;  3VDF A;  2ABH A;  1BKA A;  3N5L A;  4OFL A;  1NNP A;  3ZS6 A;  4EQ7 A;  4MLQ A;  1DSN A;  3MVY A;  4ISU A;  1NH7 A;  1B6H A;  3N6U A;  3F11 A;  3GBB A;  5H8F A;  4OQO A;  2XXT A;  3MBP A;  2I0C A;  4POX A;  3N94 A;  4OXV A;  3PUY E;  3IO6 A;  4DE8 A;  4U1O A;  3G7W A;  2XXW A;  1I6Q A;  1USY E;  3KEI A;  3CVG A;  3C32 A;  4GXA A;  4N13 A;  3B6W A;  3O6I A;  4R9F A;  4DCX A;  4G8N A;  4OFO A;  2E0S A;  2ZNS A;  3SKP A;  3TYH A;  3PMX A;  3ILU B;  4PFW A;  2PMS A;  4IY5 A;  3MVZ A;  2GHA A;  5JTY A;  1PB9 A;  2NVU B;  2OJT A;  1FQA A;  1YAE A;  3KN3 A;  2UVJ A;  2VHA A;  2HAV A;  5EHM A;  3VVE A;  5H8Q A;  1I69 A;  1S9T A;  3OO7 A;  3E3K A;  2H5Y A;  3RT8 A;  4U4X A;  2Q88 A;  3OXN A;  4E0W A;  1SW1 A;  3IB2 A;  3RPW A;  5K2Y A;  5BWJ A;  3IOR A;  1P1W A;  1A55 A;  3OEN A;  4UA8 A;  4EXL A;  4XKP A;  1B4H A;  3K6V A;  4KCC A;  2H9B A;  3BBR A;  4TQU Q;  2H4I A;  5H8H B;  1Y9U A;  1LCF A;  1ZJL A;  3O28 A;  2YLN A;  2XXR A;  2OCU A;  3RY3 A;  2D3I A;  4Q5T A;  3UP9 A;  3VE1 B;  3O9P A;  4F22 A;  1A40 A;  4JSO A;  3H6W A;  3BKI B;  3FJM A;  2ZYK A;  3FJ7 A;  4XKR A;  4LQ2 A;  3TKD A;  5HM4 B;  2XX8 A;  4KYD A;  3TAJ A;  1SVX B;  1MDQ A;  1MXZ A;  2PYY A;  2XXQ A;  2RCB A;  3A3C A;  4BDM A;  1JVY A;  3HO7 A;  3ODB A;  5AA3 A;  2VOZ A;  3DEL B;  1MQJ A;  4PFT A;  2RC8 A;  2WKY A;  1MY4 A;  4RJZ A;  2ZYO A;  4YAH X;  3DRK A;  3TQL A;  3K6X A;  3RN8 A;  2OWS A;  4QFL A;  1MQG A;  1UIU A;  4OET A;  2H99 A;  2ONS A;  3SDF A;  3LBS A;  5CBS A;  4H5G A;  3U1O A;  4QSD A;  1LLS A;  3UK4 A;  1JW1 A;  4O3B A;  4POW A;  4IGT A;  1IZ1 A;  1SQY A;  5M2V A;  3T9X B;  1B0L A;  3UN6 A;  1RYO A;  1SW2 A;  4I62 A;  4KPT A;  1MG1 A;  1TFD A;  2XX9 A;  4NF8 A;  5F7V A;  3VLU A;  1B51 A;  1B1X A;  2M8C A;  1OLA A;  1SW4 A;  3M3F A;  4NTL A;  4BDR A;  1MRP A;  3LSW A;  1R1N A;  1I6A A;  1R6Z A;  3PUV E;  1Y1Z A;  2GHB A;  3QUJ A;  4F2O A;  3C35 A;  3LC8 A;  3PD8 A;  5I57 B;  4H8J A;  4HCY A;  3OD7 A;  1EH3 A;  3O97 A;  4EF1 A;  4DLD A;  1M5D A;  1LAH E;  4GL8 A;  1HSJ A;  4GRK A;  2P2A A;  4ELR A;  3G3J A;  1M5B A;  2F6G A;  3UOR A;  3FD3 A;  3R7X A;  1SDX A;  1I6B A;  1BP5 A;  4NF4 B;  1US4 A;  4YU0 A;  1AIV A;  3D4C A;  4KI0 E;  3DRF A;  4G4P A;  4TLM B;  4X48 A;  3MP1 A;  3O6H A;  1YCJ A;  1AH5 A;  4G8M A;  1P99 A;  1SBP A;  5JTY B;  3RTF B;  2DE3 A;  1A54 A;  2QS3 A;  4KYE A;  2F6P A;  3EHT A;  3SEX A;  1B1H A;  2OLB A;  2X7P A;  3HHG A;  3MP6 A;  3DRJ A;  2XD2 A;  2O6A A;  1N04 A;  2VP1 A;  3GLB A;  4OEN A;  1ZBM A;  4LVQ A;  3KJT A;  4FAT A;  3M3L A;  3TCG A;  3U92 A;  4IO6 A;  2QL3 A;  5AA2 A;  1OQH A;  3QAX A;  4PFU A;  4RPO A;  2Y7P A;  3LUY A;  4WKM A;  1OVB A;  2V93 A;  2ZNU A;  3E4R A;  3K2D A;  1H3D A;  4GOT A;  1TT1 A;  4JWX A;  5CMC A;  1YTV A;  1US5 A;  2D21 A;  1NNT A;  3MPL A;  2B4L A;  4QSC A;  3RQT A;  3VV5 A;  5JK4 A;  3OO8 A;  1IQ7 A;  2Y7W A;  3FTO A;  5AA2 D;  3B6Q A;  3DRH A;  1B9J A;  1OLC A;  4JDF A;  4R2B A;  4YZZ A;  1DTZ A;  4JB7 A;  3ZKK A;  1SYH A;  2RC7 A;  3T22 A;  2W7Y A;  1B5J A;  2VGQ A;  3T9V A;  2CMO A;  4E0X A;  4GQO A;  3EF7 A;  5HBC A;  3VXB A;  3HN0 A;  4DXB A;  2OWT A;  4LZ5 A;  3V83 A;  4QFN A;  1Y4T A;  3KFM A;  3TZA A;  3D4G A;  1QJM A;  4ZZE A;  1PB8 A;  2HAU A;  1JVX A;  1WDN A;  3C34 A;  4XIG Q;  4OEU A;  3U72 A;  3K1P A;  3QUF A;  4HW8 A;  3S9E A;  4N07 A;  1EZP A;  1QUL A;  3O29 A;  3MJN A;  3TTK A;  1H43 A;  4YKP A;  2DVC A;  1IIT A;  3PPQ A;  3K6U A;  4M4G A;  3T9H B;  2I48 A;  1TFA A;  2AYS A;  5FHN A;  2WOK A;  3CHG A;  1D9V A;  4OWD A;  3I3V A;  4MF3 A;  2KLF A;  3K4U A;  5TPA B;  4F29 A;  3KGC A;  1NNK A;  4C1T A;  1H45 A;  4YB5 A;  5I56 A;  5H8H A;  3SEU A;  5F1Q A;  1Y4C A;  4G2Z A;  3I6V A;  3JYR A;  1QVS A;  4LZ7 A;  1B2H A;  2DWJ A;  4M1V A;  3LVU A;  2DSF A;  1N7X A;  1JW5 A;  4PP0 A;  5TPA A;  5DEX B;  4UAC A;  4QRZ A;  1N84 A;  5KCJ B;  3HST A;  2F34 A;  3KOT A;  1JNF A;  3Q27 A;  4I1D A;  1LB8 A;  1MPC A;  3IOU A;  4C0R A;  1QKA A;  4ESW A;  1LBB A;  2O51 A;  2XHD A;  4F19 A;  4YMA A;  1N3X A;  1HSL A;  4OTE A;  3G3H A;  4G68 B;  3QXM A;  3T9U A;  2XXH A;  1P1O A;  2ZXT A;  4BDL A;  5DTB A;  5I58 A;  4KR5 A;  5ICT A;  4DDD A;  5KZT A;  5H8F B;  1M5F A;  4FEB A;  3FIR A;  2DE4 A;  4IB2 A;  1ANF A;  1LST A;  3H6V A;  1MPB A;  1LFI A;  1XT8 A;  3EHU A;  4DXC A;  5I56 B;  3K1N A;  4NF6 A;  4ELQ A;  5DT6 A;  1BIY A;  3V5A A;  3IJX B;  3IO4 A;  2AL5 A;  2B4M A;  4GIZ A;  2F7A A;  3AXF A;  5L9S A;  1OQG A;  2Z8F A;  4HS7 A;  4O3A A;  3RT6 B;  3CI8 A;  3DP6 A;  3GZG A;  1QKB A;  2QMW A;  1RYX A;  1XHY A;  3IX1 A;  1B40 A;  3MUQ A;  5H8N A;  4I9D A;  1B7Z A;  2QSX A;  3OSR A;  1B3E A;  1UTH A;  3ILT B;  4IO3 A;  1DPP A;  3T66 A;  2R6G E;  2REG A;  3FVN A;  1JEV A;  4H65 A;  4KYS A;  1M5E A;  2HCA A;  2XXP A;  2OBG A;  4H67 A;  3TQW A;  3FXR A;  3DP8 A;  2XXX A;  1URG A;  1MXU A;  1NKX A;  2F5X A;  2Y7R A;  1LAG E;  2Y7K A;  5DVF A;  4EUO A;  4Q8R A;  5K2X A;  1B3F A;  5I58 B;  1N0T A;  1A99 A;  3RLF E;  1SYI A;  2THI A;  4DIG A;  1MM7 A;  2XX7 A;  3Q29 A;  4XKN A;  4QFO A;  3C36 A;  3PPN A;  4R72 A;  3TTN A;  4RXL A;  3RNN A;  1B4Z A;  4U23 A;  3SEV A;  1SW5 A;  4QFK A;  3DP4 A;  4OVJ A;  1WOD A;  2AL4 A;  3ZSF A;  1MDP 1;  3S4U A;  4ZEB A;  1AL3 A;  3W9W A;  1MS7 A;  4RPN A;  3FAT A;  4DZ1 A;  3FVK A;  3PGF A;  2FYI A;  3TEP A;  2WOL A;  2H98 A;  4F1U A;  3V8X B;  4FOR A;  4PE5 B;  1MXY A;  2Q2A A;  4KFQ A;  1ELJ A;  3KOS A;  3SET A;  5I59 B;  1DOT A;  1SI1 A;  2RKM A;  3QSL A;  4U22 A;  1ATG A;  5ITO A;  4QFP A;  1B7U A;  1XVX A;  1UTB A;  3K02 A;  4JWY A;  4MBP A;  4X1B A;  4F2Q A;  4F1V A;  5L9O A;  3ECR A;  3CIJ A;  1PBQ A;  4P11 A;  4FAJ A;  5ISU A;  1O64 A;  4N6P A;  1S7Y A;  1URS A;  3BFU A;  3UIF A;  1OVT A;  1H76 A;  1URD A;  3ZKL A;  1JW4 A;  2O7U A;  4IO2 A;  4O3C A;  1DMB A;  3CSB A;  2UVI A;  3TFL A;  1FTK A;  3TDJ A;  2DWH A;  3L6H A;  3FXQ A;  3C4M A;  2O68 A;  1B0H A;  3CFX A;  3HHF A;  3PUZ E;  4IY6 A;  4U21 A;  4EXK A;  4NF8 B;  2B3F A;  1ZLQ A;  1IXI A;  2GRV A;  2ZMB A;  4ONY A;  3TCF A;  4TLL B;  1SI0 A;  2DS9 A;  5CI5 A;  2O7I A;  4L17 A;  1Y1M A;  2Q89 A;  3KBR A;  3PV0 E;  3SES A;  4IO7 A;  3U93 A;  2QRY A;  5AA4 A;  5I2N B;  3N26 A;  3HPI A;  3KSX A;  3FVG A;  2ZNT A;  3QYT A;  1ZMG A;  2IEE A;  2X7Q A;  4I8C A;  3ONM A;  4G68 C;  1BTJ A;  5FTI A;  1XOC A;  3H3G A;  2UXA A;  5CM6 A;  3EHS A;  2ONR A;  3CFZ A;  4FJP A;  4LP2 B;  3Q28 A;  5TU0 A;  4GF8 A;  2Z23 A;  1A7L A;  4F3S A;  5A5X A;  3K01 A;  2F7B A;  4HTG A;  1FTO A;  1NNF A;  5B7D A;  1T0K A;  4PQJ A;  3E9X A;  4NE4 A;  3MW0 A;  1D3K A;  2HEU A;  3CR9 A;  4G8H A;  4QF9 A;  1Z7N E;  1GVC A;  3SEY A;  4HCW A;  3MWB A;  2RF1 A;  3K00 A;  3PUW E;  2VD3 A;  4C1U A;  4G77 A;  1Y3P A;  1ZIU A;  2I58 A;  4QSE A;  4XTC Q;  4ESX A;  4IO4 A;  4JSD A;  3LSF B;  4BLA A;  2HQ0 A;  5ITP A;  2Q2C A;  3PMV A;  3CG3 A;  5IKB A;  3CFL A;  3T96 B;  1AMF A;  1IXH A;  3S9N C;  4AQ4 A;  3OEL A;  1EZ9 A;  4ZE8 A;  3FGS A;  5L8D A;  3QK6 A;  4X1D A;  1L5T A;  3TTR A;  2A5T B;  2GFE A;  1FTJ A;  4R6K A;  2A5T A;  1LGB C;  5A5X B;  4YIC A;  3CG1 A;  3CRB A;  1BLF A;  4THI A;  4H0W A;  4RY1 A;  4YB6 A;  4DCY A;  1MH4 A;  1UTB B;  4Z7E A;  2NOO A;  3A09 A;  2V3T A;  4DXU A;  1HSE A;  4ZE9 A;  1O63 A;  2DQV A;  1P1Q A;  2P1S A;  5DYH A;  3G3I A;  1O7T A;  4MLV A;  3B6T A;  4Q0C A;  4RNS A;  5EYF A;  4YMB A;  2O84 X;  3FUZ A;  1TWY A;  1B32 A;  4JWO A;  3A3U A;  4F1Y A;  4ZEF A;  5CMM A;  2DWI A;  4R74 A;  1OIB A;  1MQD A;  1POT A;  4R73 A;  3QIM A;  3O6P A;  3IJO B;  2PT2 A;  2F35 A;  1OMP A;  1R9Q A;  3LSL A;  3PUX E;  5DVJ A;  3T93 B;  4AB6 A;  1D4N A;  5TP9 A;  3V89 B;  5CC2 A;  2NXO A;  2QMX A;  4MH5 A;  2XXY A;  3E13 X;  4X9T A;  3IOV A;  3C31 A;  3TCH A;  3MAM A;  2XD3 A;  5FHM A;  2H25 A;  2I0B A;  3USD A;  3VFJ A;  4BDO A;  4EQ9 A;  4ZZA A;  5LOM A;  3IOW A;  4ZEI A;  2GH9 A;  3PPO A;  1NH8 A;  3RYA A;  5I84 A;  4LQ5 A;  4GL0 A;  3FJG A;  4ZDM A;  2DE2 A;  1DPE A;  1M5C A;  4GWO A;  3RTW B;  3MQ9 A;  1P1U A;  4GFR A;  5I2K B;  3VVF A;  3WAE A;  4EF2 A;  3VLW A;  1PBP A;  4R6H A;  2F78 A;  1FQF A;  2V3Q A;  5L9M A;  5H8S A;  5KDT B;  2X26 A;  2DP8 A;  2DVZ A;  4IO5 A;  1DTG A;  1N7W A;  3GBA A;  5HPQ A;  2UYF A;  3HCQ A;  2B65 A;  3H4Z A;  2XXU A;  3JV9 A;  3R6U A;  1B3L A;  4OES A;  2D5W A;  1SD3 A;  4RK9 A;  1MM6 A;  3K1M A;  1J1N A;  3Q25 A;  4K3F A;  4OHN A;  3RYB A;  1PB7 A;  2PT1 A;  1B5I A;  1CE2 A;  1JQF A;  3C9H A;  1LB9 A;  4H6D A;  4LON B;  3TTL A;  3FXU A;  5J1D A;  3VXC A;  2V25 A;  4RA1 A;  4MFI A;  1VSO A;  3O66 A;  4ECF A;  2DXY A;  2F8D A;  2ZYM A;  3G3K A;  4YB7 A;  1JEU A;  3KZG A;  3RUM A;  4ZEC A;  4OER A;  1FTM A;  3PPR A;  3DM0 A;  2Y7I A;  4NWD A;  1MY3 A;  4GLI A;  1II5 A;  3P7I A;  4F3P A;  4OYV A;  3U8Q A;  3WAF A;  5IAI A;  2RIN A;  2XXV A;  2Z8E A;  5AA4 B;  3VVD A;  5B70 A;  5I2N A;  1FTL A;  1EU8 A;  4NF5 A;  2QS4 A;  3G3F A;  1MY0 A;  3M3K A;  3R26 A;  1B05 A;  1LAX A;  4BDQ A;  4OZ9 A;  1IUD A;  2UVG A;  1MH3 A;  3W9V A;  3UGW A;  4F31 B;  2AIX A;  3H6T A;  3L6G A;  2YPN A;  4U1Z A;  2HZK A;  2Q9T A;  1GR2 A;  2HZL A;  3FVO A;  3EQ1 A;  4NED A;  1A8F A;  5KCJ A;  1MXX A;  2F97 A;  3PMW A;  4TOZ A;  2VD2 A;  1Y3N A;  4LZ8 A;  5DVI A;  5DEX A;  4EQB A;  3MZB A;  1JET A;  4LUB A;  3MP8 A;  3TEL A;  3SER A;  1Y3Q A;  2F36 A;  1GTK A;  3S9L C;  5I59 A;  4BDN A;  4EDP A;  5FTH A;  2E1S A;  5FHO A;  5EHS A;  1Q1K A;  4ELO A;  1B3H A;  1UIV A;  3C33 A;  3LSX A;  2RC9 A;  1PC3 A;  2UVH A;  4ND9 A;  3RGY A;  3TMG A;  3U94 A;  1NMU A;  3IAZ A;  5CBR A;  3IL1 B;  3N6T A;  1YPN A;  3DLN A;  3OSQ A;  4FIM A;  4RK2 A;  2Y84 A;  3S2V A;  3THI A;  3M8U A;  1TXF A;  1USY H;  4PET A;  4R9G A;  1FCK A;  4F39 A;  1MY2 A;  2I4B A;  3PPP A;  3PD9 A;  4FE8 A;  4YKK A;  3MVW A;  1B7H A;  4GXS B;  1ZU0 A;  1ZKB A;  3IR1 A;  1B58 A;  5ICQ A;  1Z7M E;  1A8E A;  2O69 A;  4NF6 B;  3H6U A;  4YKJ A;  3TOD A;  1QUK A;  2G29 A;  3O6G A;  4U4S A;  2HXW A;  1S50 A;  1MPD A;  1FQE A;  3LR1 A;  3OMB A;  3DRI A; 
#chains in the Genus database with same CATH topology
 2BJJ X;  2OZZ A;  4H8I A;  1Q35 A;  4F18 A;  1PDA A;  1FQB A;  1H44 A;  4Q30 B;  2ZYN A;  3MVX A;  4FEC A;  4Z0I A;  2FA7 A;  3EN3 A;  1VE4 A;  1Q9D A;  2I49 A;  4JBZ A;  4RYA A;  4JVD A;  2V84 A;  3MC2 A;  3K0V A;  3E79 A;  2DWA A;  4P8B A;  2CZL A;  3IB0 A;  4G61 A;  1FW0 A;  5I2K A;  4FBP A;  4KQP A;  5BUU A;  3FV1 A;  4JXI A;  3VLV A;  4NMY A;  2REJ A;  1LFG A;  4GWS A;  3A29 A;  2I3W A;  3BFT A;  4QHQ A;  1POY 1;  1NFT A;  4ZEK A;  3B7D A;  1FPE A;  2ANJ A;  2XXI A;  1IIW A;  3H06 B;  1WVJ A;  1B52 A;  4F3G A;  3S9M C;  3TTM A;  2R8T A;  4OAN A;  2R9J A;  3VDF A;  2ABH A;  1BKA A;  1DSN A;  3MVY A;  1NH7 A;  3F11 A;  4OVR A;  3IO6 A;  4DE8 A;  4N13 A;  3B6W A;  4OFO A;  3SKP A;  3PMX A;  4PFW A;  5JTY A;  2OJT A;  1FQA A;  3VVE A;  5H8Q A;  1I69 A;  1S9T A;  4PBQ A;  3RT8 A;  4U4X A;  3OXN A;  1INP A;  1A55 A;  1BK4 A;  3OEN A;  4UA8 A;  4XKP A;  3O28 A;  2YLN A;  2XXR A;  3UP9 A;  1FTA A;  3FJ7 A;  4LQ2 A;  3TKD A;  4KYD A;  3A3C A;  1MDQ A;  1NUZ A;  2XXQ A;  5AA3 A;  3DEL B;  4YAH X;  3K6X A;  3RN8 A;  4QFL A;  1MQG A;  2H99 A;  3LBS A;  5EQ9 A;  1LLS A;  4OVT A;  3UK4 A;  4O3B A;  4POW A;  4IGT A;  1IZ1 A;  1B0L A;  3UN6 A;  4NF8 A;  5F7V A;  1B51 A;  1SW4 A;  4BDR A;  1R6Z A;  1FPL A;  1Y1Z A;  2GHB A;  4P1E A;  4F2O A;  3O97 A;  4NN3 A;  4GRK A;  2P2A A;  4ELR A;  3G3J A;  2F6G A;  3FD3 A;  3T1B A;  1SDX A;  1I6B A;  1BP5 A;  1YYZ A;  4YU0 A;  1AIV A;  3DRF A;  4G4P A;  4G8M A;  1A54 A;  2F6P A;  3HHG A;  3DRJ A;  1N04 A;  3GLB A;  4LVQ A;  4WKM A;  2V93 A;  5CMC A;  3MPL A;  4QSC A;  3D1R A;  1B9J A;  4JDF A;  4R2B A;  2RC7 A;  3T22 A;  2W7Y A;  3EF7 A;  1IMB A;  1Y4T A;  1FPK A;  3D4G A;  1QJM A;  1JVX A;  4N07 A;  4O7I A;  3MJN A;  1H43 A;  3ROJ A;  3PPQ A;  2CZK A;  4NHB A;  4OWD A;  5TPA B;  3KGC A;  4C1T A;  1H45 A;  1CNQ A;  4PAF A;  2DWJ A;  1JW5 A;  4UAC A;  1LB8 A;  1LBB A;  4PC9 A;  1P1O A;  2ZXT A;  4BDL A;  5I58 A;  5ICT A;  3H6V A;  1K9Z A;  1MPB A;  5DT6 A;  1BIY A;  3IJX B;  2AL5 A;  2Z8F A;  3CI8 A;  5LTC A;  2QMW A;  4BLA A;  1RYX A;  4IO3 A;  1B3E A;  3ILT B;  3FVN A;  4KYS A;  3TQW A;  3DP8 A;  5DVF A;  4Q8R A;  5LDZ A;  4HE2 A;  1A99 A;  1SYI A;  2THI A;  3Q29 A;  3C36 A;  1DCU A;  4RXL A;  4QFK A;  3W9W A;  1MS7 A;  3FVK A;  2FYI A;  2Q2A A;  1ELJ A;  5ITO A;  4X1B A;  5ISU A;  4N6P A;  1O64 A;  1URS A;  1URD A;  1JW4 A;  1DMB A;  3TDJ A;  2DWH A;  3L6H A;  3C4M A;  4IY6 A;  1EYK A;  4ONY A;  3PV0 E;  5I2N B;  3KSX A;  4GLI A;  2ZNT A;  3QYT A;  1ZMG A;  2ZZX A;  4OVP A;  3U65 A;  1XOC A;  5CM6 A;  2ONR A;  3K01 A;  4HTG A;  3MW0 A;  1D3K A;  4G8H A;  3PUW E;  4QSE A;  1FBE A;  4JSD A;  2Q2C A;  3PMV A;  3T96 B;  4ZE8 A;  5L8D A;  1L5T A;  3TTR A;  2A5T B;  2A5T A;  1LGB C;  4RY1 A;  1NV5 A;  4Z7E A;  4DCY A;  2Y5K A;  3A09 A;  5ET6 A;  2DQV A;  1P1Q A;  1RDY A;  3G3I A;  2OX3 A;  4PAK A;  4ZEF A;  2DWI A;  3O6P A;  1AWB A;  2F35 A;  2XXY A;  3E13 X;  4X9T A;  3C31 A;  3MAM A;  2I0B A;  4ZEI A;  3RYA A;  2DE2 A;  1DPE A;  1M5C A;  3MQ9 A;  5I2K B;  4N4U A;  2V3Q A;  4OA4 A;  2PCR A;  5HPQ A;  2B65 A;  2D5W A;  4RK9 A;  3K1M A;  4K3F A;  2PT1 A;  3C9H A;  1CE2 A;  4LON B;  1LB9 A;  3TTL A;  4MAG A;  4MFI A;  4EF2 A;  4YB7 A;  4ZEC A;  4OER A;  1FTM A;  3DM0 A;  1MY3 A;  4F3P A;  2RIN A;  5B70 A;  3G3F A;  2OWZ A;  2Y5L A;  2AIX A;  2Q9T A;  2HZL A;  4NED A;  5I5P A;  5KCJ A;  3PMW A;  5IM2 A;  4TOZ A;  1Y3N A;  4LZ8 A;  4EQB A;  3SER A;  2F36 A;  4HE1 A;  1FPB A;  1UIV A;  1NMU A;  3QMF A;  3OSQ A;  3DLN A;  4PET A;  4PFB A;  3PD9 A;  4FE8 A;  4GXS B;  3TOD A;  5EYH A;  4GWY A;  4FOR A;  2ZYM A;  3FXB A;  3LR1 A;  1FQE A;  2WBD A;  1Y20 A;  3TUS A;  4H46 A;  1EZO A;  3KG2 A;  1IXG A;  4LN5 A;  1VFD A;  2ESN A;  1B5H A;  2PBW A;  3SEW A;  1QW0 A;  2HFB A;  3KC0 A;  3KN8 A;  1LFH A;  2DYX A;  1MY1 A;  1XS5 A;  3KN7 A;  1QUI A;  3KJ7 A;  1P1N A;  4NWC A;  1FQD A;  4GD5 A;  3TPA A;  4ZED A;  1MXW A;  4R6Y A;  3FV2 A;  1IXC A;  2P0S A;  2A5S A;  4R75 A;  1FPF A;  2OK2 A;  3GXA A;  4NF5 B;  3OEK A;  3G3G A;  1F9B A;  4IGR A;  4FED A;  3MZ9 A;  4WED A;  4AB5 A;  1LCT A;  1NUX A;  4KD5 A;  4PCD A;  4LAT A;  3IK6 B;  2PVU A;  4N8G A;  2Z22 A;  4MNC A;  5I3S A;  2PFY A;  2Z8D A;  2QS2 A;  4N91 A;  4NQ8 A;  3MPK A;  4NX1 A;  2O1M A;  4O8M A;  1CB6 A;  2I3V A;  3H03 A;  1NV3 A;  1NL5 A;  2ALU A;  4GVO A;  3JZJ A;  3O2A A;  5J16 A;  2B3B A;  3N5L A;  1NNP A;  3ZS6 A;  3GBB A;  3T0J A;  4P3L A;  3MBP A;  2P3V A;  3N94 A;  3PUY E;  3ISP A;  1I6Q A;  1USY E;  3CVG A;  4MCO A;  4IY5 A;  2PMS A;  1PB9 A;  2NVU B;  3KN3 A;  5EHM A;  1NV7 A;  4E0W A;  5BWJ A;  3K6V A;  5H8H B;  2H9B A;  3BBR A;  4Q5T A;  4XEQ A;  3O9P A;  1A40 A;  4I3Y A;  3H6W A;  3FJM A;  4GWW A;  3TAJ A;  2PYY A;  4BDM A;  1JVY A;  1MQJ A;  4PFT A;  2RC8 A;  1MY4 A;  3DRK A;  2OWS A;  1UIU A;  3SDF A;  4I62 A;  1TFD A;  2XX9 A;  3VLU A;  2M8C A;  4MNP A;  4H45 A;  3M3F A;  3QUJ A;  3LC8 A;  5I57 B;  4HCY A;  1LAH E;  1KZ8 A;  2ZZV A;  3UOR A;  3SZP A;  4NF4 B;  4KI0 E;  3O6H A;  5EQA A;  4OVQ A;  3EHT A;  1B1H A;  2XD2 A;  2O6A A;  3KJT A;  1IME A;  1OQH A;  2Y7P A;  5IZ1 A;  2D21 A;  2B4L A;  1IQ7 A;  3FTO A;  4GX4 A;  1OLC A;  3ZKK A;  3LUZ A;  4E0X A;  2CEY A;  5HBC A;  3HN0 A;  4DXB A;  4LZ5 A;  3KFM A;  4XIG Q;  4HW8 A;  3K1P A;  3QUF A;  4XF5 A;  1IIT A;  1TFA A;  2AYS A;  5FHN A;  3CHG A;  3K4U A;  5I56 A;  4G2Z A;  1QVS A;  1B2H A;  4M1V A;  2DSF A;  2Q74 A;  1N84 A;  5KCJ B;  3HST A;  4I1D A;  4P1L A;  1MPC A;  3IOU A;  1QKA A;  4GBW A;  2O51 A;  2XHD A;  4F19 A;  4OTE A;  4G68 B;  2XXH A;  4GBV A;  1XI6 A;  3FIR A;  4DXC A;  1XT8 A;  1NUY A;  4NF6 A;  3V5A A;  2F7A A;  1OQG A;  4O3A A;  1QKB A;  3MUQ A;  4NF8 B;  2HCA A;  2OBG A;  2F5X A;  1LAG E;  2Y7K A;  3MYU A;  3RLF E;  1NI9 A;  2XX7 A;  2GQ1 A;  3RNN A;  1FSA A;  4U23 A;  3SEV A;  1SW5 A;  3DP4 A;  2AL4 A;  3ZSF A;  3FAT A;  3TEP A;  4F1U A;  3V8X B;  1MXY A;  4KFQ A;  3SET A;  3KOS A;  2RKM A;  3QSL A;  4QFP A;  1UTB A;  4NGU A;  4F1V A;  5L9O A;  3CIJ A;  1PBQ A;  1LBW A;  1S7Y A;  3ZKL A;  4O3C A;  1FTK A;  2XA5 A;  3CFX A;  2B3F A;  2GRV A;  3TCF A;  1SI0 A;  5CI5 A;  2O7I A;  4MNI A;  1Y1M A;  3SES A;  4IO7 A;  4G68 C;  1NV6 A;  3ONM A;  3E78 A;  4LP2 B;  4FJP A;  2Z23 A;  5A5X A;  1NNF A;  4NE4 A;  2HEU A;  3SEY A;  1Z7N E;  1GVC A;  4HCW A;  3MWB A;  4N6D A;  4C1U A;  1Y3P A;  5ET7 A;  4ESX A;  2QVR A;  3LSF B;  2HQ0 A;  1AMF A;  3S9N C;  3OEL A;  3QK6 A;  4X1D A;  1KA0 A;  4GWU A;  3CG1 A;  3CRB A;  4EXK A;  4H0W A;  4GX3 A;  4YB6 A;  1UTB B;  2V3T A;  4DXU A;  1FBP A;  4PTK A;  2P1S A;  5DYH A;  1O7T A;  4MLV A;  4YMB A;  4RNS A;  2O84 X;  2CEX A;  3FUZ A;  4JWO A;  4AS4 A;  4R73 A;  3QIM A;  4JVC A;  1R9Q A;  2XWO A;  3LSL A;  3KBZ A;  3PUX E;  3T93 B;  1D4N A;  1NV2 A;  3V89 B;  2NXO A;  3IOV A;  5FHM A;  3TCH A;  2XD3 A;  3USD A;  3PPO A;  4LQ5 A;  3VVF A;  3RTW B;  2DP8 A;  2DVZ A;  3NOH A;  4IO5 A;  4PF8 A;  4QBA A;  3R6U A;  4OES A;  5H8N A;  4OHN A;  1MM6 A;  2VPN A;  3GYY A;  5J1D A;  3VXC A;  4RA1 A;  3O66 A;  2FBP A;  2F8D A;  3G3K A;  3PPR A;  2Y7I A;  1II5 A;  4OYV A;  2Z8E A;  1FTL A;  4NF5 A;  2V4C A;  1LAX A;  4OZ9 A;  1MH3 A;  3UGW A;  3H6T A;  2YPN A;  3FVO A;  3EQ1 A;  1A8F A;  5IGA A;  3MZB A;  1JET A;  4LUB A;  5T3J A;  3MP8 A;  3TEL A;  1GTK A;  4BDN A;  4EDP A;  4ELO A;  1PC3 A;  4N8Y A;  2PFZ A;  4FIM A;  2Y84 A;  3THI A;  1FCK A;  2I4B A;  3PPP A;  4YKK A;  1G0I A;  1B58 A;  1A8E A;  5EQ7 A;  1S50 A;  1MPD A;  5JK4 A;  3OMB A;  1FBG A;  2FIX A;  2IA4 A;  3CSG A;  2QJE A;  2PX1 A;  5CRY A;  5DW8 A;  4YKI A;  4OMB A;  3DRG A;  4IR8 A;  2UYE A;  2G93 A;  2I6E A;  1N3W A;  4PGN A;  3UA8 A;  2NWJ A;  3IOT A;  3Q26 A;  4X8R A;  2QS1 A;  5AE4 A;  1LAF E;  1KWH A;  2FNC A;  1NV4 A;  1R9L A;  3MZ1 A;  4G68 A;  4X04 A;  1B46 A;  4XXU A;  4XFE A;  1PEB A;  5AA2 B;  2NUV A;  1D9Y A;  4KHZ E;  3PAM A;  2ONK E;  5AA1 A;  3K6W A;  4P47 A;  4WXJ A;  1MXV A;  2XWV A;  1GV8 A;  5TP9 B;  2QPQ A;  3EPE A;  4XKQ A;  1MQI A;  4PFY A;  2F7C A;  2LAO A;  1N76 A;  4H1X A;  1FQC A;  4H5F A;  3OOA A;  4P0I A;  5CMB A;  3OO6 A;  2WYP A;  1UTH B;  1JP4 A;  2R71 A;  4F3B A;  2DDK A;  1RDX A;  4OFL A;  4P9K A;  4MLQ A;  5H8F A;  4OQO A;  2XXT A;  2I0C A;  4OXV A;  4U1O A;  2XXW A;  5K2X A;  3C32 A;  5FHO A;  4DCX A;  4G8N A;  2ZNS A;  4PDH A;  2GHA A;  2WX9 A;  2VHA A;  3IB2 A;  3RPW A;  5K2Y A;  1P1W A;  4EXL A;  1B4H A;  4KCC A;  4TQU Q;  2HPG A;  2OCU A;  3VE1 B;  4JSO A;  3BKI B;  4XKR A;  3RPL A;  1SVX B;  2RCB A;  3ODB A;  1D9Q A;  4RJZ A;  2WKY A;  3TQL A;  2P3N A;  4P56 A;  1LBX A;  4H5G A;  1JW1 A;  1RYO A;  1SW2 A;  4KPT A;  1MG1 A;  1DBZ A;  1OLA A;  1R1N A;  3PUV E;  4MIJ A;  3IFC A;  2CZI A;  1M5D A;  1HSJ A;  1M5B A;  3D4C A;  4TLM B;  4X48 A;  4PFI A;  1YCJ A;  1P99 A;  2DE3 A;  2QS3 A;  4KYE A;  3B50 A;  3SEX A;  4WEP A;  2OLB A;  2X7P A;  3MP6 A;  2VP1 A;  1ZBM A;  4FAT A;  3M3L A;  3TCG A;  1OVB A;  4GOT A;  1H3D A;  4JWX A;  1US5 A;  1NNT A;  5IZ3 B;  1FBD A;  3OO8 A;  5AA2 D;  3B6Q A;  4N81 A;  4JB7 A;  2L5V A;  1B5J A;  2CMO A;  3V83 A;  4O7M A;  1WDN A;  3U72 A;  4OEU A;  3S9E A;  2QVU A;  1FBH A;  1QUL A;  2CZH A;  3TTK A;  3K6U A;  3T9H B;  2I48 A;  4MF3 A;  2KLF A;  1NNK A;  5F1Q A;  1Y4C A;  2KQZ A;  3I6V A;  5TPA A;  3LVU A;  2WBB A;  4QRZ A;  1JNF A;  2HXR A;  4ESW A;  3G3H A;  3QXM A;  3T9U A;  2WYK A;  4NAP A;  5DTB A;  1DK4 A;  1LST A;  5I56 B;  1LFI A;  3K1N A;  3IO4 A;  3DP6 A;  3IX1 A;  1XHY A;  1B40 A;  4I9D A;  1B7Z A;  4PAI A;  3T66 A;  2R6G E;  1JEV A;  1M5E A;  5ESY A;  1IMF A;  1URG A;  1NKX A;  4NG7 A;  1N0T A;  3PPN A;  4R72 A;  1WOD A;  1MDP 1;  4ZEB A;  1AL3 A;  4DZ1 A;  4RPN A;  2WOL A;  4PE5 B;  5I59 B;  1DOT A;  1SI1 A;  1ATG A;  4NF0 A;  3K02 A;  4MBP A;  4P11 A;  4FAJ A;  3BFU A;  3RPL B;  1IMA A;  1OVT A;  1H76 A;  3HFU A;  4AS5 A;  2UVI A;  2O68 A;  1B0H A;  3HHF A;  3PUZ E;  4U21 A;  2ZMB A;  3KBR A;  3U93 A;  3FVG A;  1AOV A;  2IEE A;  4I8C A;  5FTI A;  1BTJ A;  3H3G A;  2UXA A;  3RTF B;  3CFZ A;  3Q28 A;  4GF8 A;  2F7B A;  1FTO A;  3IFA A;  3E9X A;  3CR9 A;  3K00 A;  4G77 A;  1ZIU A;  3KC1 A;  2I58 A;  4XTC Q;  4IO4 A;  5IKB A;  1IXH A;  3MST A;  4AQ4 A;  1EZ9 A;  3FGS A;  2GFE A;  1FPG A;  1FTJ A;  4THI A;  5I84 A;  1LEV A;  1MH4 A;  1EYJ A;  2XXK A;  4ZE9 A;  3B6T A;  5EYF A;  1TWY A;  2XWK A;  4F1Y A;  5CMM A;  1OIB A;  1POT A;  4GX6 A;  2PT2 A;  5DVJ A;  4N17 A;  5TP9 A;  2QMX A;  4BDO A;  2H25 A;  3VFJ A;  4EQ9 A;  4ZZA A;  3IOW A;  2GH9 A;  4GL0 A;  4GWO A;  5I59 A;  4GFR A;  1FRP A;  2F78 A;  5KDT B;  2X26 A;  1DTG A;  2UYF A;  3HCQ A;  3H4Z A;  3Q25 A;  3RYB A;  1FPD A;  4ECF A;  1VSO A;  4NWD A;  3P7I A;  3U8Q A;  5I2N A;  2XXV A;  4DI4 B;  2QS4 A;  3M3K A;  3R26 A;  4BDQ A;  4F31 B;  3W9V A;  3L6G A;  4U1Z A;  2HZK A;  1GR2 A;  5DVI A;  5DEX A;  3S9L C;  1B3H A;  3C33 A;  2UVH A;  4N6K A;  3RGY A;  3IAZ A;  3IL1 B;  3N6T A;  1YPN A;  3S2V A;  3M8U A;  1TXF A;  1MY2 A;  3MVW A;  4R2F A;  3IR1 A;  5ICQ A;  4YKJ A;  3H6U A;  1QUK A;  2HXW A;  2FIE A;  1YZ0 A;  3DRI A;  4OEV A;  3FZV A;  5H8Q B;  4P0G A;  3BIH A;  1B3G A;  1QUJ A;  3H7M A;  4JVI A;  4NF4 A;  1VFE A;  3T9X B;  2DOJ A;  3OEM A;  1IEJ A;  4MEV A;  2MKZ A;  3PU5 A;  5I57 A;  2V3U A;  3HV1 A;  1XC1 A;  3IB1 A;  5KDT A;  3W15 C;  4OVS A;  1LBV A;  4OFJ A;  3I5O A;  5IZ3 A;  5JEI A;  2WOP A;  1XVY A;  2Q8J A;  4ZS9 A;  3FAS A;  4KCD A;  5CMK A;  1KA1 A;  2Q8M A;  4U2R A;  2RCA A;  2JJK A;  2I4C A;  1LBC A;  5ELV A;  4LA9 A;  1RKM A;  2DXR A;  1G0H A;  1UQW A;  1ZTY A;  3FBP A;  5H8N B;  4DI3 D;  5EQ8 A;  4ELP A;  2O1L A;  5TU0 A;  5IZZ A;  5CBR A;  1VR5 A;  3OO9 A;  1MQH A;  3KSJ A;  1GGG A;  1FJ9 A;  4PFR A;  2YJP A;  5A5L A;  2KR0 A;  1IMD A;  4EQ7 A;  4ISU A;  1FBF A;  1B6H A;  3N6U A;  4POX A;  3G7W A;  4I3E A;  4R9G A;  3KEI A;  4F39 A;  4GXA A;  4R9F A;  3O6I A;  3TYH A;  2E0S A;  3ILU B;  3MVZ A;  1YAE A;  2UVJ A;  2HAV A;  3OO7 A;  4HE0 A;  3E3K A;  2H5Y A;  2Q88 A;  1SW1 A;  4PBH A;  3IOR A;  1RDZ A;  5FBP A;  2H4I A;  1Y9U A;  1LCF A;  1ZJL A;  5F24 A;  3RY3 A;  2D3I A;  1NV0 A;  4F22 A;  4N15 A;  2ZYK A;  5HM4 B;  2XX8 A;  1MXZ A;  3HO7 A;  2VOZ A;  3PTY A;  2ZYO A;  4OET A;  2ONS A;  5CBS A;  3U1O A;  4QSD A;  1K9Y A;  5M2V A;  1SQY A;  1B1X A;  4NTL A;  1MRP A;  3LSW A;  1I6A A;  3C35 A;  3PD8 A;  4H8J A;  1NUW A;  1EH3 A;  3OD7 A;  4EF1 A;  2QVV A;  4DLD A;  4MMP A;  4GL8 A;  1EYI A;  3R7X A;  1US4 A;  3MP1 A;  1AH5 A;  1SBP A;  5JTY B;  2BJI A;  4OEN A;  3U92 A;  5AA2 A;  4IO6 A;  2QL3 A;  2FHY A;  3QAX A;  4PFU A;  4RPO A;  3LUY A;  2ZNU A;  3E4R A;  3K2D A;  1TT1 A;  1YTV A;  5I7I A;  3VV5 A;  3RQT A;  2Y7W A;  4UAB A;  3DRH A;  4YZZ A;  1DTZ A;  1SYH A;  3T9V A;  2VGQ A;  4GQO A;  3VXB A;  2OWT A;  4QFN A;  3TZA A;  4PE3 A;  4ZZE A;  1PB8 A;  2HAU A;  3C34 A;  1EZP A;  1LBZ A;  3O29 A;  4GWZ A;  4YKP A;  2DVC A;  4M4G A;  2WOK A;  1FPJ A;  1D9V A;  3I3V A;  4F29 A;  4YB5 A;  5H8H A;  3SEU A;  3JYR A;  4LZ7 A;  4PP0 A;  1N7X A;  5ET5 A;  5DEX B;  2F3D A;  2VPO A;  1VDW A;  1SPI A;  5EYG A;  4MHF A;  2F34 A;  3KOT A;  3Q27 A;  4C0R A;  4YMA A;  1N3X A;  1HSL A;  3LV0 A;  4KR5 A;  4DDD A;  5KZT A;  1FJ6 A;  1M5F A;  5H8F B;  4FEB A;  4PQJ A;  4GWX A;  2DE4 A;  1ANF A;  4IB2 A;  3EHU A;  4ELQ A;  1FBC A;  4GIZ A;  2B4M A;  5L9S A;  3AXF A;  3RT6 B;  4HS7 A;  4MJO A;  3GZG A;  3U94 A;  2QFL A;  2QSX A;  3OSR A;  1UTH A;  1DPP A;  2REG A;  4I40 A;  4H65 A;  2XXP A;  4H67 A;  3FXR A;  2XXX A;  1LBY A;  1MXU A;  2Y7R A;  4EUO A;  1B3F A;  5I58 B;  4DIG A;  1MM7 A;  4XKN A;  4QFO A;  1IMC A;  3TTN A;  1B4Z A;  2WEF A;  4OVJ A;  3S4U A;  1QGX A;  3PGF A;  2H98 A;  4MX6 A;  4U22 A;  1B7U A;  1XVX A;  4JWY A;  4F2Q A;  3ECR A;  4PDD A;  3UIF A;  2O7U A;  4IO2 A;  3CSB A;  3TFL A;  2ZZW A;  3FXQ A;  1ZLQ A;  1IXI A;  4TLL B;  2DS9 A;  4L17 A;  2Q89 A;  2QRY A;  5AA4 A;  3N26 A;  3HPI A;  2X7Q A;  3EHS A;  1A7L A;  4F3S A;  5B7D A;  1T0K A;  4QF9 A;  2RF1 A;  2VD3 A;  5ITP A;  3CG3 A;  3CFL A;  4R6K A;  3EKI A;  5A5X B;  4YIC A;  1BLF A;  4QXD A;  2NOO A;  1HSE A;  1O63 A;  4PF6 A;  4Q0C A;  1B32 A;  3A3U A;  4R74 A;  1MQD A;  3IJO B;  1OMP A;  4AB6 A;  2XWI A;  5CC2 A;  4MH5 A;  1FPI A;  2HHM A;  2F3B A;  5LOM A;  1NH8 A;  4HXV A;  2VT5 A;  3FJG A;  4ZDM A;  1P1U A;  3WAE A;  3VLW A;  1PBP A;  4R6H A;  1FQF A;  5L9M A;  5H8S A;  4PGP A;  1N7W A;  3GBA A;  2XXU A;  3JV9 A;  1B3L A;  4KXP A;  1SD3 A;  1J1N A;  1PB7 A;  4H6D A;  1B5I A;  1JQF A;  3FXU A;  2V25 A;  2DXY A;  1JEU A;  3RYD A;  3KZG A;  3RUM A;  5IAI A;  3WAF A;  4O94 A;  5AA4 B;  1NV1 A;  3VVD A;  1EU8 A;  3BIG A;  1MY0 A;  1B05 A;  1IUD A;  2UVG A;  1MXX A;  2F97 A;  2VD2 A;  3B8B A;  2FVZ A;  1Y3Q A;  5FTH A;  2E1S A;  5EHS A;  1Q1K A;  3TMG A;  3LSX A;  2RC9 A;  4ND9 A;  4RK2 A;  1USY H;  5ET8 A;  1B7H A;  1ZU0 A;  1ZKB A;  4NF6 B;  1Z7M E;  2O69 A;  2G29 A;  3O6G A;  4U4S A;  1YXI A; 
#chains in the Genus database with same CATH homology
 1Y20 A;  2IA4 A;  3CSG A;  3TUS A;  4OEV A;  3FZV A;  5H8Q B;  1EZO A;  3KG2 A;  2QJE A;  2PX1 A;  1IXG A;  2BJJ X;  4P0G A;  1VFD A;  2OZZ A;  4H8I A;  1Q35 A;  2ESN A;  1B3G A;  4F18 A;  1PDA A;  1QUJ A;  1B5H A;  3H7M A;  4NF4 A;  3SEW A;  1VFE A;  1FQB A;  1H44 A;  2PBW A;  4Q30 B;  1QW0 A;  2HFB A;  2ZYN A;  4YKI A;  2DOJ A;  4OMB A;  3OEM A;  3MVX A;  3DRG A;  4FEC A;  4Z0I A;  2FA7 A;  2UYE A;  1IEJ A;  3EN3 A;  1VE4 A;  2DYX A;  3KN8 A;  1LFH A;  1MY1 A;  1XS5 A;  2G93 A;  2I49 A;  3KN7 A;  1QUI A;  3KJ7 A;  3PU5 A;  5I57 A;  2I6E A;  1N3W A;  1P1N A;  4JBZ A;  4NWC A;  4WEP A;  4RYA A;  5CRY A;  2V3U A;  1FQD A;  3HV1 A;  3UA8 A;  1XC1 A;  2V84 A;  4GD5 A;  3IB1 A;  2NWJ A;  5KDT A;  3TPA A;  4ZED A;  1MXW A;  3IOT A;  3MC2 A;  3Q26 A;  4R6Y A;  2QS1 A;  3W15 C;  5AE4 A;  1LAF E;  3K0V A;  1KWH A;  2FNC A;  4OFJ A;  2DWA A;  3FV2 A;  3I5O A;  1IXC A;  1R9L A;  2P0S A;  3MZ1 A;  2CZL A;  3IB0 A;  2A5S A;  4R75 A;  4G68 A;  1FW0 A;  1B46 A;  2OK2 A;  3GXA A;  2WOP A;  1XVY A;  4NF5 B;  4XXU A;  5I2K A;  3OEK A;  3G3G A;  5JEI A;  1F9B A;  1PEB A;  2Q8J A;  5AA2 B;  4ZS9 A;  4KQP A;  4IGR A;  3FAS A;  4FED A;  4KCD A;  5BUU A;  3MZ9 A;  5CMK A;  3FV1 A;  1AOV A;  4WED A;  4JXI A;  2NUV A;  3VLV A;  1LCT A;  4U2R A;  2RCA A;  1D9Y A;  4KHZ E;  4AB5 A;  4KD5 A;  3PAM A;  2I4C A;  1LBC A;  4LAT A;  4NMY A;  2REJ A;  1LFG A;  3IK6 B;  5ELV A;  4LA9 A;  2ONK E;  1RKM A;  2DXR A;  5AA1 A;  2PVU A;  3K6W A;  4WXJ A;  1MXV A;  2Z22 A;  2I3W A;  1UQW A;  1GV8 A;  1ZTY A;  3BFT A;  5H8N B;  4QHQ A;  2Z8D A;  2QS2 A;  3MPK A;  5TP9 B;  1POY 1;  2QPQ A;  2O1M A;  1CB6 A;  1NFT A;  4ZEK A;  3EPE A;  4ELP A;  4XKQ A;  1MQI A;  3B7D A;  4R2F A;  4PFY A;  2ANJ A;  2F7C A;  1IIW A;  2I3V A;  2O1L A;  2LAO A;  1N76 A;  2XXI A;  1FQC A;  3H03 A;  3H06 B;  4H1X A;  1VR5 A;  3OOA A;  1NL5 A;  3OO9 A;  1WVJ A;  4H5F A;  1MQH A;  3OO6 A;  4P0I A;  1B52 A;  5CMB A;  3KSJ A;  1GGG A;  1UTH B;  4F3G A;  3S9M C;  2R71 A;  2ALU A;  4GVO A;  4F3B A;  3JZJ A;  3O2A A;  3TTM A;  2B3B A;  2YJP A;  2R9J A;  3VDF A;  2ABH A;  1BKA A;  3N5L A;  4OFL A;  1NNP A;  3ZS6 A;  4EQ7 A;  4MLQ A;  1DSN A;  3MVY A;  4ISU A;  1NH7 A;  1B6H A;  3N6U A;  3F11 A;  3GBB A;  5H8F A;  4OQO A;  2XXT A;  3MBP A;  2I0C A;  4POX A;  3N94 A;  4OXV A;  3PUY E;  3IO6 A;  4DE8 A;  4U1O A;  3G7W A;  2XXW A;  1I6Q A;  1USY E;  3KEI A;  3CVG A;  3C32 A;  4GXA A;  4N13 A;  3B6W A;  3O6I A;  4R9F A;  4DCX A;  4G8N A;  4OFO A;  2E0S A;  2ZNS A;  3SKP A;  3TYH A;  3PMX A;  3ILU B;  4PFW A;  2PMS A;  4IY5 A;  3MVZ A;  2GHA A;  5JTY A;  1PB9 A;  2NVU B;  2OJT A;  1FQA A;  1YAE A;  3KN3 A;  2UVJ A;  2VHA A;  2HAV A;  5EHM A;  3VVE A;  5H8Q A;  1I69 A;  1S9T A;  3OO7 A;  3E3K A;  2H5Y A;  3RT8 A;  4U4X A;  2Q88 A;  3OXN A;  4E0W A;  1SW1 A;  3IB2 A;  3RPW A;  5K2Y A;  5BWJ A;  3IOR A;  1P1W A;  1A55 A;  3OEN A;  4UA8 A;  4EXL A;  4XKP A;  1B4H A;  3K6V A;  4KCC A;  2H9B A;  3BBR A;  4TQU Q;  2H4I A;  5H8H B;  1Y9U A;  1LCF A;  1ZJL A;  3O28 A;  2YLN A;  2XXR A;  2OCU A;  3RY3 A;  2D3I A;  4Q5T A;  3UP9 A;  3VE1 B;  3O9P A;  4F22 A;  1A40 A;  4JSO A;  3H6W A;  3BKI B;  3FJM A;  2ZYK A;  3FJ7 A;  4XKR A;  4LQ2 A;  3TKD A;  5HM4 B;  2XX8 A;  4KYD A;  3TAJ A;  1SVX B;  1MDQ A;  1MXZ A;  2PYY A;  2XXQ A;  2RCB A;  3A3C A;  4BDM A;  1JVY A;  3HO7 A;  3ODB A;  5AA3 A;  2VOZ A;  3DEL B;  1MQJ A;  4PFT A;  2RC8 A;  2WKY A;  1MY4 A;  4RJZ A;  2ZYO A;  4YAH X;  3DRK A;  3TQL A;  3K6X A;  3RN8 A;  2OWS A;  4QFL A;  1MQG A;  1UIU A;  4OET A;  2H99 A;  2ONS A;  3SDF A;  3LBS A;  5CBS A;  4H5G A;  3U1O A;  4QSD A;  1LLS A;  3UK4 A;  1JW1 A;  4O3B A;  4POW A;  4IGT A;  1IZ1 A;  1SQY A;  5M2V A;  3T9X B;  1B0L A;  3UN6 A;  1RYO A;  1SW2 A;  4I62 A;  4KPT A;  1MG1 A;  1TFD A;  2XX9 A;  4NF8 A;  5F7V A;  3VLU A;  1B51 A;  1B1X A;  2M8C A;  1OLA A;  1SW4 A;  3M3F A;  4NTL A;  4BDR A;  1MRP A;  3LSW A;  1R1N A;  1I6A A;  1R6Z A;  3PUV E;  1Y1Z A;  2GHB A;  3QUJ A;  4F2O A;  3C35 A;  3LC8 A;  3PD8 A;  5I57 B;  4H8J A;  4HCY A;  3OD7 A;  1EH3 A;  3O97 A;  4EF1 A;  4DLD A;  1M5D A;  1LAH E;  4GL8 A;  1HSJ A;  4GRK A;  2P2A A;  4ELR A;  3G3J A;  1M5B A;  2F6G A;  3UOR A;  3FD3 A;  3R7X A;  1SDX A;  1I6B A;  1BP5 A;  4NF4 B;  1US4 A;  4YU0 A;  1AIV A;  3D4C A;  4KI0 E;  3DRF A;  4G4P A;  4TLM B;  4X48 A;  3MP1 A;  3O6H A;  1YCJ A;  1AH5 A;  4G8M A;  1P99 A;  1SBP A;  5JTY B;  3RTF B;  2DE3 A;  1A54 A;  2QS3 A;  4KYE A;  2F6P A;  3EHT A;  3SEX A;  1B1H A;  2OLB A;  2X7P A;  3HHG A;  3MP6 A;  3DRJ A;  2XD2 A;  2O6A A;  1N04 A;  2VP1 A;  3GLB A;  4OEN A;  1ZBM A;  4LVQ A;  3KJT A;  4FAT A;  3M3L A;  3TCG A;  3U92 A;  4IO6 A;  2QL3 A;  5AA2 A;  1OQH A;  3QAX A;  4PFU A;  4RPO A;  2Y7P A;  3LUY A;  4WKM A;  1OVB A;  2V93 A;  2ZNU A;  3E4R A;  3K2D A;  1H3D A;  4GOT A;  1TT1 A;  4JWX A;  5CMC A;  1YTV A;  1US5 A;  2D21 A;  1NNT A;  3MPL A;  2B4L A;  4QSC A;  3RQT A;  3VV5 A;  5JK4 A;  3OO8 A;  1IQ7 A;  2Y7W A;  3FTO A;  5AA2 D;  3B6Q A;  3DRH A;  1B9J A;  1OLC A;  4JDF A;  4R2B A;  4YZZ A;  1DTZ A;  4JB7 A;  3ZKK A;  1SYH A;  2RC7 A;  3T22 A;  2W7Y A;  1B5J A;  2VGQ A;  3T9V A;  2CMO A;  4E0X A;  4GQO A;  3EF7 A;  5HBC A;  3VXB A;  3HN0 A;  4DXB A;  2OWT A;  4LZ5 A;  3V83 A;  4QFN A;  1Y4T A;  3KFM A;  3TZA A;  3D4G A;  1QJM A;  4ZZE A;  1PB8 A;  2HAU A;  1JVX A;  1WDN A;  3C34 A;  4XIG Q;  4OEU A;  3U72 A;  3K1P A;  3QUF A;  4HW8 A;  3S9E A;  4N07 A;  1EZP A;  1QUL A;  3O29 A;  3MJN A;  3TTK A;  1H43 A;  4YKP A;  2DVC A;  1IIT A;  3PPQ A;  3K6U A;  4M4G A;  3T9H B;  2I48 A;  1TFA A;  2AYS A;  5FHN A;  2WOK A;  3CHG A;  1D9V A;  4OWD A;  3I3V A;  4MF3 A;  2KLF A;  3K4U A;  5TPA B;  4F29 A;  3KGC A;  1NNK A;  4C1T A;  1H45 A;  4YB5 A;  5I56 A;  5H8H A;  3SEU A;  5F1Q A;  1Y4C A;  4G2Z A;  3I6V A;  3JYR A;  1QVS A;  4LZ7 A;  1B2H A;  2DWJ A;  4M1V A;  3LVU A;  2DSF A;  1N7X A;  1JW5 A;  4PP0 A;  5TPA A;  5DEX B;  4UAC A;  4QRZ A;  1N84 A;  5KCJ B;  3HST A;  2F34 A;  3KOT A;  1JNF A;  3Q27 A;  4I1D A;  1LB8 A;  1MPC A;  3IOU A;  4C0R A;  1QKA A;  4ESW A;  1LBB A;  2O51 A;  2XHD A;  4F19 A;  4YMA A;  1N3X A;  1HSL A;  4OTE A;  3G3H A;  4G68 B;  3QXM A;  3T9U A;  2XXH A;  1P1O A;  2ZXT A;  4BDL A;  5DTB A;  5I58 A;  4KR5 A;  5ICT A;  4DDD A;  5KZT A;  5H8F B;  1M5F A;  4FEB A;  3FIR A;  2DE4 A;  4IB2 A;  1ANF A;  1LST A;  3H6V A;  1MPB A;  1LFI A;  1XT8 A;  3EHU A;  4DXC A;  5I56 B;  3K1N A;  4NF6 A;  4ELQ A;  5DT6 A;  1BIY A;  3V5A A;  3IJX B;  3IO4 A;  2AL5 A;  2B4M A;  4GIZ A;  2F7A A;  3AXF A;  5L9S A;  1OQG A;  2Z8F A;  4HS7 A;  4O3A A;  3RT6 B;  3CI8 A;  3DP6 A;  3GZG A;  1QKB A;  2QMW A;  1RYX A;  1XHY A;  3IX1 A;  1B40 A;  3MUQ A;  5H8N A;  4I9D A;  1B7Z A;  2QSX A;  3OSR A;  1B3E A;  1UTH A;  3ILT B;  4IO3 A;  1DPP A;  3T66 A;  2R6G E;  2REG A;  3FVN A;  1JEV A;  4H65 A;  4KYS A;  1M5E A;  2HCA A;  2XXP A;  2OBG A;  4H67 A;  3TQW A;  3FXR A;  3DP8 A;  2XXX A;  1URG A;  1MXU A;  1NKX A;  2F5X A;  2Y7R A;  1LAG E;  2Y7K A;  5DVF A;  4EUO A;  4Q8R A;  5K2X A;  1B3F A;  5I58 B;  1N0T A;  1A99 A;  3RLF E;  1SYI A;  2THI A;  4DIG A;  1MM7 A;  2XX7 A;  3Q29 A;  4XKN A;  4QFO A;  3C36 A;  3PPN A;  4R72 A;  3TTN A;  4RXL A;  3RNN A;  1B4Z A;  4U23 A;  3SEV A;  1SW5 A;  4QFK A;  3DP4 A;  4OVJ A;  1WOD A;  2AL4 A;  3ZSF A;  1MDP 1;  3S4U A;  4ZEB A;  1AL3 A;  3W9W A;  1MS7 A;  4RPN A;  3FAT A;  4DZ1 A;  3FVK A;  3PGF A;  2FYI A;  3TEP A;  2WOL A;  2H98 A;  4F1U A;  3V8X B;  4FOR A;  4PE5 B;  1MXY A;  2Q2A A;  4KFQ A;  1ELJ A;  3KOS A;  3SET A;  5I59 B;  1DOT A;  1SI1 A;  2RKM A;  3QSL A;  4U22 A;  1ATG A;  5ITO A;  4QFP A;  1B7U A;  1XVX A;  1UTB A;  3K02 A;  4JWY A;  4MBP A;  4X1B A;  4F2Q A;  4F1V A;  5L9O A;  3ECR A;  3CIJ A;  1PBQ A;  4P11 A;  4FAJ A;  5ISU A;  1O64 A;  4N6P A;  1S7Y A;  1URS A;  3BFU A;  3UIF A;  1OVT A;  1H76 A;  1URD A;  3ZKL A;  1JW4 A;  2O7U A;  4IO2 A;  4O3C A;  1DMB A;  3CSB A;  2UVI A;  3TFL A;  1FTK A;  3TDJ A;  2DWH A;  3L6H A;  3FXQ A;  3C4M A;  2O68 A;  1B0H A;  3CFX A;  3HHF A;  3PUZ E;  4IY6 A;  4U21 A;  4EXK A;  4NF8 B;  2B3F A;  1ZLQ A;  1IXI A;  2GRV A;  2ZMB A;  4ONY A;  3TCF A;  4TLL B;  1SI0 A;  2DS9 A;  5CI5 A;  2O7I A;  4L17 A;  1Y1M A;  2Q89 A;  3KBR A;  3PV0 E;  3SES A;  4IO7 A;  3U93 A;  2QRY A;  5AA4 A;  5I2N B;  3N26 A;  3HPI A;  3KSX A;  3FVG A;  2ZNT A;  3QYT A;  1ZMG A;  2IEE A;  2X7Q A;  4I8C A;  3ONM A;  4G68 C;  1BTJ A;  5FTI A;  1XOC A;  3H3G A;  2UXA A;  5CM6 A;  3EHS A;  2ONR A;  3CFZ A;  4FJP A;  4LP2 B;  3Q28 A;  5TU0 A;  4GF8 A;  2Z23 A;  1A7L A;  4F3S A;  5A5X A;  3K01 A;  2F7B A;  4HTG A;  1FTO A;  1NNF A;  5B7D A;  1T0K A;  4PQJ A;  3E9X A;  4NE4 A;  3MW0 A;  1D3K A;  2HEU A;  3CR9 A;  4G8H A;  4QF9 A;  1Z7N E;  1GVC A;  3SEY A;  4HCW A;  3MWB A;  2RF1 A;  3K00 A;  3PUW E;  2VD3 A;  4C1U A;  4G77 A;  1Y3P A;  1ZIU A;  2I58 A;  4QSE A;  4XTC Q;  4ESX A;  4IO4 A;  4JSD A;  3LSF B;  4BLA A;  2HQ0 A;  5ITP A;  2Q2C A;  3PMV A;  3CG3 A;  5IKB A;  3CFL A;  3T96 B;  1AMF A;  1IXH A;  3S9N C;  4AQ4 A;  3OEL A;  1EZ9 A;  4ZE8 A;  3FGS A;  5L8D A;  3QK6 A;  4X1D A;  1L5T A;  3TTR A;  2A5T B;  2GFE A;  1FTJ A;  4R6K A;  2A5T A;  1LGB C;  5A5X B;  4YIC A;  3CG1 A;  3CRB A;  1BLF A;  4THI A;  4H0W A;  4RY1 A;  4YB6 A;  4DCY A;  1MH4 A;  1UTB B;  4Z7E A;  2NOO A;  3A09 A;  2V3T A;  4DXU A;  1HSE A;  4ZE9 A;  1O63 A;  2DQV A;  1P1Q A;  2P1S A;  5DYH A;  3G3I A;  1O7T A;  4MLV A;  3B6T A;  4Q0C A;  4RNS A;  5EYF A;  4YMB A;  2O84 X;  3FUZ A;  1TWY A;  1B32 A;  4JWO A;  3A3U A;  4F1Y A;  4ZEF A;  5CMM A;  2DWI A;  4R74 A;  1OIB A;  1MQD A;  1POT A;  4R73 A;  3QIM A;  3O6P A;  3IJO B;  2PT2 A;  2F35 A;  1OMP A;  1R9Q A;  3LSL A;  3PUX E;  5DVJ A;  3T93 B;  4AB6 A;  1D4N A;  5TP9 A;  3V89 B;  5CC2 A;  2NXO A;  2QMX A;  4MH5 A;  2XXY A;  3E13 X;  4X9T A;  3IOV A;  3C31 A;  3TCH A;  3MAM A;  2XD3 A;  5FHM A;  2H25 A;  2I0B A;  3USD A;  3VFJ A;  4BDO A;  4EQ9 A;  4ZZA A;  5LOM A;  3IOW A;  4ZEI A;  2GH9 A;  3PPO A;  1NH8 A;  3RYA A;  5I84 A;  4LQ5 A;  4GL0 A;  3FJG A;  4ZDM A;  2DE2 A;  1DPE A;  1M5C A;  4GWO A;  3RTW B;  3MQ9 A;  1P1U A;  4GFR A;  5I2K B;  3VVF A;  3WAE A;  4EF2 A;  3VLW A;  1PBP A;  4R6H A;  2F78 A;  1FQF A;  2V3Q A;  5L9M A;  5H8S A;  5KDT B;  2X26 A;  2DP8 A;  2DVZ A;  4IO5 A;  1DTG A;  1N7W A;  3GBA A;  5HPQ A;  2UYF A;  3HCQ A;  2B65 A;  3H4Z A;  2XXU A;  3JV9 A;  3R6U A;  1B3L A;  4OES A;  2D5W A;  1SD3 A;  4RK9 A;  1MM6 A;  3K1M A;  1J1N A;  3Q25 A;  4K3F A;  4OHN A;  3RYB A;  1PB7 A;  2PT1 A;  1B5I A;  1CE2 A;  1JQF A;  3C9H A;  1LB9 A;  4H6D A;  4LON B;  3TTL A;  3FXU A;  5J1D A;  3VXC A;  2V25 A;  4RA1 A;  4MFI A;  1VSO A;  3O66 A;  4ECF A;  2DXY A;  2F8D A;  2ZYM A;  3G3K A;  4YB7 A;  1JEU A;  3KZG A;  3RUM A;  4ZEC A;  4OER A;  1FTM A;  3PPR A;  3DM0 A;  2Y7I A;  4NWD A;  1MY3 A;  4GLI A;  1II5 A;  3P7I A;  4F3P A;  4OYV A;  3U8Q A;  3WAF A;  5IAI A;  2RIN A;  2XXV A;  2Z8E A;  5AA4 B;  3VVD A;  5B70 A;  5I2N A;  1FTL A;  1EU8 A;  4NF5 A;  2QS4 A;  3G3F A;  1MY0 A;  3M3K A;  3R26 A;  1B05 A;  1LAX A;  4BDQ A;  4OZ9 A;  1IUD A;  2UVG A;  1MH3 A;  3W9V A;  3UGW A;  4F31 B;  2AIX A;  3H6T A;  3L6G A;  2YPN A;  4U1Z A;  2HZK A;  2Q9T A;  1GR2 A;  2HZL A;  3FVO A;  3EQ1 A;  4NED A;  1A8F A;  5KCJ A;  1MXX A;  2F97 A;  3PMW A;  4TOZ A;  2VD2 A;  1Y3N A;  4LZ8 A;  5DVI A;  5DEX A;  4EQB A;  3MZB A;  1JET A;  4LUB A;  3MP8 A;  3TEL A;  3SER A;  1Y3Q A;  2F36 A;  1GTK A;  3S9L C;  5I59 A;  4BDN A;  4EDP A;  5FTH A;  2E1S A;  5FHO A;  5EHS A;  1Q1K A;  4ELO A;  1B3H A;  1UIV A;  3C33 A;  3LSX A;  2RC9 A;  1PC3 A;  2UVH A;  4ND9 A;  3RGY A;  3TMG A;  3U94 A;  1NMU A;  3IAZ A;  5CBR A;  3IL1 B;  3N6T A;  1YPN A;  3DLN A;  3OSQ A;  4FIM A;  4RK2 A;  2Y84 A;  3S2V A;  3THI A;  3M8U A;  1TXF A;  1USY H;  4PET A;  4R9G A;  1FCK A;  4F39 A;  1MY2 A;  2I4B A;  3PPP A;  3PD9 A;  4FE8 A;  4YKK A;  3MVW A;  1B7H A;  4GXS B;  1ZU0 A;  1ZKB A;  3IR1 A;  1B58 A;  5ICQ A;  1Z7M E;  1A8E A;  2O69 A;  4NF6 B;  3H6U A;  4YKJ A;  3TOD A;  1QUK A;  2G29 A;  3O6G A;  4U4S A;  2HXW A;  1S50 A;  1MPD A;  1FQE A;  3LR1 A;  3OMB A;  3DRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...