1B58A

Oligo-peptide binding protein (oppa) complexed with kyk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b58A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b58A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b58A02
3DP4A 3E9XA 3EPEA 2UVHA 4QFOA 2A5TA 4ELPA 1SW1A 4NE4A 3KN7A 1B1XA 1MM7A 2ZYMA 3T9VA 4WKMA 3OD7A 3TQWA 5I2KA 3FVKA 3FASA 1GVCA 1XVXA 4ONYA 2UYEA 4JWXA 4NF6A 1SD3A 3KGCA 1FCKA 4KHZE 5KDTA 2DP8A 3H3GA 1DSNA 4KCDA 5I58B 1FTKA 3T9XB 3IORA 2Q9TA 3RUMA 2Y7PA 2R6GE 5L9SA 1B2HA 3MWBA 4Q8RA 1Y4TA 1O63A 1UIUA 3IJXB 3VLWA 4ELQA 5LOMA 1NH8A 1D9VA 2XXQA 3HSTA 3VXCA 3LSFB 2X7PA 5AE4A 3PPPA 1Y1MA 4EUOA 1DMBA 2V25A 2GHAA 1AL3A 3VXBA 4QHQA 3H06B 1Z7NE 3FXUA 3Q27A 3TTRA 5A5XB 5F7VA 3A3UA 3C33A 4O3BA 4MFIA 3DRKA 3B7DA 3KN8A 5J1DA 5B7DA 1II5A 2I48A 2H98A 5ITOA 1SVXB 1B5JA 5DVJA 4PE5B 3DRFA 1USYE 3PPNA 4XKQA 2VHAA 2VOZA 5KCJA 1B0HA 3RYAA 3FD3A 4RPNA 4EF2A 1CE2A 4FIMA 4IO6A 1MY1A 5TPAA 3PMVA 3VV5A 1MDQA 1DPPA 2YPNA 4ZDMA 2F6GA 3DRGA 1VFDA 3ZKKA 4TOZA 1SW5A 1Z7ME 4R9FA 4G4PA 4RNSA 4R2FA 4QRZA 1B58A 3BFUA 5H8FA 3M8UA 3S4UA 1PBQA 3C36A 1QKBA 4ZS9A 1M5FA 2H4IA 4JWYA 4NEDA 2HXWA 1Y3QA 4NF8A 3MVZA 3RYBA 4N13A 3T93B 4XKRA 2RF1A 2F5XA 1H45A 3U94A 4XIGQ 3SDFA 2IA4A 4PETA 4TQUQ 1B3LA 2AL5A 4YKPA 1P1OA 4GL8A 1OMPA 2B3FA 4K3FA 3TKDA 2E0SA 1M5DA 1F9BA 2X7QA 3K02A 2QMXA 4GVOA 1BKAA 1S50A 2Y7IA 4YU0A 1OLCA 1EZOA 1I6AA 1P1NA 5I57B 2IEEA 2YJPA 1M5BA 3LUYA 3MBPA 2ZXTA 3K1PA 3OO9A 5CMCA 1KWHA 2DQVA 4OVJA 2Z22A 2CMOA 2A5SA 1OVBA 4YB5A 1I69A 4Q30B 2RC8A 3G3KA 3MP1A 1DPEA 4XXUA 1H43A 3TZAA 4EQ9A 1VSOA 3IL1B 4RK2A 4QFPA 4GXSB 3W15C 2I4CA 1MH3A 1YCJA 3DRHA 3CFLA 4DIGA 4Z7EA 3N6TA 1OLAA 2H99A 3TCGA 3T22A 1ANFA 1I6QA 4YAHX 3H6WA 1B0LA 3IOVA 1AOVA 1Y9UA 3IOUA 1BP5A 4X1DA 4N6PA 1T0KA 4P0GA 1XT8A 3GLBA 4I1DA 1ZTYA 4IO7A 3BBRA 5DVIA 3MQ9A 3R26A 3B6WA 1ZMGA 4PQJA 5EHSA 1S7YA 4NTLA 5FHOA 3G3GA 2DE2A 2DOJA 3HV1A 1NNPA 4GD5A 1LSTA 4G68A 4FATA 1SI1A 1XHYA 3KZGA 4G8NA 4FE8A 3OO7A 3Q25A 1FTLA 3MJNA 1WVJA 4WXJA 2G29A 3ZSFA 2ZYNA 3H6UA 4G68C 4GIZA 3QIMA 2THIA 3G3FA 1MQIA 3MW0A 1N3WA 3T9UA 3PV0E 3A09A 1Q35A 3N26A 3U8QA 4OETA 2UXAA 1MPCA 1NNTA 5HBCA 3O6HA 1A8EA 2V3TA 2P0SA 2Y84A 2B4MA 2PX1A 3LSWA 2OLBA 2V84A 3OENA 1OIBA 2W7YA 1SQYA 4F19A 5H8NB 3IB0A 3EQ1A 3QK6A 3MC2A 3UK4A 2G93A 1EZ9A 2VD2A 4NF4B 1MXXA 3K1MA 4FECA 2XX8A 2ZNSA 2Z8EA 2A5TB 3TYHA 3V5AA 4QSDA 3S9LC 4JB7A 2I3VA 3CVGA 3TTKA 3PPQA 3TAJA 3IJOB 5I2KB 1XVYA 1IQ7A 4OZ9A 2O7IA 1JW4A 2AL4A 3G3IA 1ZU0A 2DXRA 5H8QA 4GLIA 1B4ZA 4MBPA 5TP9B 4OWDA 4QFNA 4F1YA 1ZJLA 4M1VA 2REGA 1P99A 1GGGA 1XOCA 4X1BA 5DEXB 4R2BA 4R74A 2O7UA 4ISUA 3UP9A 2WOPA 3B6QA 5HM4B 1MQHA 1B46A 4OESA 1FTJA 5CMKA 2PBWA 1A54A 4NWCA 2Q8JA 1MM6A 3PPOA 3P7IA 5I2NA 3H6TA 2H9BA 3A3CA 3PUXE 3D4CA 2XXHA 3MVXA 4GF8A 4BDMA 1IXHA 3D4GA 2XD3A 4EXKA 1IXIA 2Q2CA 3F11A 3TTMA 3O6IA 3UGWA 1UTBA 3FIRA 3EF7A 1H3DA 3FVOA 2VGQA 3TEPA 4F1VA 1Y20A 2D5WA 3C34A 4DXBA 5FTIA 5JEIA 1A7LA 2XX9A 1NKXA 3KSXA 3LC8A 2QRYA 2XXTA 4JBZA 3K6UA 3PAMA 4OFLA 4C1TA 4OQOA 3CG1A 1NFTA 5TPAB 2UVGA 2ONKE 3R7XA 2I49A 3TQLA 2DE4A 4H5FA 2O1MA 5AA2B 4ZEKA 3MP8A 3EHUA 5H8FB 1QUIA 2I58A 3RTWB 4KR5A 1UIVA 3THIA 4DCYA 3DELB 1QUJA 2NOOA 4IY6A 3IR1A 4HS7A 4DLDA 4KQPA 4BDRA 2XXXA 1QUKA 1SW4A 5KZTA 1PB9A 5DT6A 4XKPA 1Y3NA 2RC9A 2I3WA 2H25A 2YLNA 1N7XA 4KYSA 2DYXA 3MP6A 1JVXA 4IO5A 3ONMA 5CRYA 3MVYA 1URDA 4ZE8A 4OFOA 4YKIA 1B05A 1P1WA 3RT8A 3EHTA 4BLAA 4BDQA 5I56A 1R9LA 3S9MC 4E0WA 5ICQA 2PVUA 4DCXA 3I5OA 2DSFA 2F7BA 2ZNTA 1SW2A 1MDP1 2KLFA 5AA4A 1PB8A 1PEBA 3V89B 3DP6A 4PFTA 3M3KA 2RCBA 3OOAA 4OEVA 1TFAA 4O3AA 3CFZA 1HSJA 1JQFA 3RNNA 5ICTA 1YAEA 4N07A 3EHSA 4NF5A 1B1HA 3W9WA 3FUZA 3TTNA 3TODA 5AA3A 1NNKA 3RQTA 2WOKA 4HCYA 3S9EA 3H6VA 1FTOA 4OTEA 3FV2A 3RY3A 1B6HA 4IO4A 3CI8A 1NMUA 1MY3A 4THIA 3QUFA 2OWTA 3EN3A 4JWOA 4H6DA 3SEYA 2ZNUA 1B40A 2B3BA 1RYOA 4X9TA 4U4XA 3VE1B 2QJEA 2DWAA 5I58A 2O51A 1WODA 1POY1 4X48A 2GHBA 2UVJA 1IEJA 3FATA 3JZJA 4F3PA 3H4ZA 4H5GA 1LAXA 3MVWA 2ABHA 3JV9A 4U1ZA 1USYH 4IO2A 1MPDA 1FQCA 1WDNA 4ZECA 3K1NA 3SESA 4DZ1A 5I84A 2HAVA 5FHMA 1LFGA 4OERA 2ESNA 4LA9A 1TT1A 1TFDA 2V3QA 1N7WA 3IOWA 1J1NA 3G7WA 3G3HA 4GWOA 5CI5A 3RLFE 1QULA 2F36A 3QAXA 4U21A 3MAMA 1B3EA 2ANJA 4TLMB 3K6WA 1URSA 1VFEA 1QVSA 4R6HA 3Q29A 3VVFA 3ILUB 2XX7A 1B5IA 1FQAA 3PMWA 1JNFA 4MF3A 5L9MA 1L5TA 2R71A 3K6VA 3GZGA 4LQ2A 2FYIA 3K0VA 3CG3A 2I0CA 3KBRA 4LZ5A 4XKNA 4ESWA 3RT6B 2F7AA 1MY4A 4U23A 4ELOA 4U2RA 1MXZA 3BFTA 3PU5A 1B7UA 3KOTA 1UTHB 2QS2A 4U22A 2DS9A 2DXYA 1B52A 2O68A 1EU8A 3PPRA 3O28A 2D21A 2QS3A 4DDDA 3DP8A 3LVUA 4EXLA 2HZLA 3N5LA 1FTMA 2NXOA 1MQDA 1N3XA 2VP1A 4RJZA 3T9HB 2GFEA 5EYFA 5H8QB 3OEKA 5AA1A 1GTKA 4DXUA 4Q0CA 1B3FA 4OEUA 3T66A 4DXCA 3C4MA 1SI0A 2OBGA 4F39A 2Q2AA 1POTA 3VVEA 2Z23A 4GOTA 4GRKA 4U4SA 5L9OA 5DYHA 3R6UA 4F3GA 2O1LA 3G3JA 2DWIA 1LBBA 3M3LA 2HEUA 5H8HA 3DM0A 4F22A 4H8IA 3UA8A 3L6HA 2H5YA 1ZLQA 2Y7KA 2D3IA 4ND9A 1LB9A 3ZS6A 1B3HA 1MQJA 3IAZA 2PYYA 1JVYA 4MLVA 3AXFA 3U92A 1LFIA 4OXVA 4YKJA 2QSXA 3LR1A 4WEPA 3IK6B 1ZBMA 3E13X 4XTCQ 2OJTA 1JW5A 1R1NA 2QPQA 1S9TA 4ESXA 4ZEBA 3U93A 1US5A 2XXRA 3QXMA 3SKPA 4YMAA 4DE8A 1MXVA 2Y7WA 3V8XB 4ZZEA 3LSXA 1N76A 4NF6B 2DWJA 3Q28A 1RKMA 5KDTB 2FNCA 4EQ7A 4AQ4A 3ODBA 5H8SA 4GFRA 4HCWA 2OK2A 3C9HA 3Q26A 3K01A 4BDOA 3O97A 4RXLA 4PFUA 3CIJA 4L17A 2VD3A 4HTGA 4BDLA 2XD2A 1LAGE 4IGTA 4QF9A 4JDFA 1QW0A 4OENA 4YMBA 4Z0IA 4U1OA 3FV1A 2QL3A 2F34A 4PFYA 3I6VA 3WAFA 5ISUA 1MH4A 1BTJA 3TELA 3PUYE 3PMXA 1LCFA 4AB6A 4H8JA 1OQHA 3USDA 4QFLA 2WOLA 4EQBA 3N6UA 5BUUA 4ZEDA 1US4A 3FGSA 3GXAA 3I3VA 2NVUB 3KEIA 3GBAA 1OVTA 4PFWA 3RN8A 2XXWA 4G8HA 3TUSA 1H76A 3KN3A 1LCTA 1LFHA 1Y1ZA 1NH7A 4EF1A 2O69A 1HSEA 2HAUA 3PD8A 4F31B 5H8NA 1MY2A 2OZZA 5I59A 4R6YA 2XXUA 1B5HA 4KFQA 3TCFA 4NF4A 5KCJB 1A55A 2XXYA 2P2AA 1B9JA 4ZZAA 5JK4A 4ELRA 1QJMA 3MPLA 4FEDA 2AYSA 2PMSA 1P1QA 3JYRA 3O29A 3PUZE 4KPTA 3K6XA 1GR2A 3O2AA 1I6BA 1N84A 5AA2D 2PT1A 1B32A 3FJ7A 2B65A 3V83A 1DTZA 2V93A 1D4NA 1CB6A 1OQGA 1ELJA 4NF8B 2X26A 3OMBA 2F8DA 5TP9A 3TMGA 4KI0E 4FAJA 1BLFA 5M2VA 4POXA 5L8DA 4LONB 3IO4A 1B7ZA 4QSEA 3CSBA 5IKBA 4ZE9A 2NUVA 5ELVA 3PD9A 4C1UA 1TXFA 3TCHA 4R6KA 3KJ7A 4I9DA 3SEVA 2ZMBA 3SEUA 3DRJA 1YPNA 5DEXA 4RYAA 5HPQA 5JTYA 4LP2B 4MLQA 4R72A 4P0IA 1A99A 4M4GA 2XHDA 1LLSA 1VE4A 4MH5A 3FVGA 1IUDA 1DOTA 1PC3A 2Z8DA 3N94A 2PT2A 3O9PA 1XS5A 2GH9A 4HW8A 1YTVA 2I4BA 4H65A 1SDXA 3LBSA 5EHMA 3K4UA 1Q1KA 4JSDA 3MZ1A 2HZKA 4LQ5A 4YB7A 3W9VA 2REJA 1IXGA 1A40A 1SYIA 1MPBA 2OWSA 3DRIA 2QS4A 2RCAA 2F35A 3TDJA 3OSRA 4FJPA 3FTOA 4F1UA 2CZLA 3C35A 3FJGA 3KJTA 2O6AA 3RGYA 4I62A 3O6GA 2NWJA 3VLVA 5AA2A 3HHGA 3CHGA 3FZVA 1IITA 3QUJA 3SEXA 2XXVA 1LBCA 1LB8A 3PUWE 2ONSA 1PDAA 4H1XA 1O7TA 2Q88A 1ZKBA 3CR9A 3KSJA 4G68B 3WAEA 2RINA 3IB2A 4OYVA 1JEVA 3HPIA 1URGA 4G2ZA 1AIVA 4OHNA 2Q89A 4F3SA 2ZYOA 3SERA 3HHFA 3IO6A 1N0TA 1N04A 2F78A 2F97A 4ECFA 1NNFA 2HCAA 3CRBA 3RTFB 2Y7RA 2DWHA 5A5XA 3ILTB 3OXNA 3OO6A 4IB2A 3M3FA 3RPWA 1ZIUA 1JEUA 1FQBA 5H8HB 3FJMA 2QS1A 2DE3A 1MS7A 1TWYA 3VLUA 3H03A 4LZ8A 1HSLA 2HFBA 4LUBA 1FQEA 1XC1A 3HCQA 3GBBA 4PP0A 4F18A 3VVDA 4ZEFA 3FXQA 2OCUA 2O84X 2Z8FA 2RC7A 3C31A 4O3CA 1GV8A 4KCCA 4OMBA 3DLNA 4LVQA 2XXPA 1JETA 1IZ1A 3HO7A 4EDPA 2I0BA 2R9JA 5B70A 1PB7A 1LGBC 3L6GA 4F2QA 1B4HA 3KFMA 3C32A 2HQ0A 4FEBA 3UORA 1VR5A 3FVNA 1EH3A 4FORA 3UN6A 1MY0A 3PUVE 3OEMA 4Q5TA 3B6TA 4G8MA 1D3KA 5CBRA 4P11A 3H7MA 4YZZA 4OFJA 4NWDA 1BIYA 4RA1A 5K2XA 5DTBA 3UIFA 3SEWA 2AIXA 2ONRA 4NMYA 1A8FA 4GL0A 1B3GA 1B7HA 3HN0A 4JXIA 3OO8A 1Y4CA 4G77A 5CC2A 4UACA 5FHNA 1EZPA 5I57A 2QMWA 1R9QA 4QSCA 4IO3A 4IY5A 2P1SA 1IXCA 5BWJA 1FQDA 2UVIA 3MZBA 3KG2A 3OSQA 1AH5A 4GXAA 5I2NB 4LZ7A 1SYHA 4GQOA 1M5CA 3QYTA 1IIWA 2DVCA 1AMFA 1MXYA 4F3BA 3K2DA 2FA7A 2I6EA 3PGFA 5CMMA 1UTBB 5ITPA 4E0XA 5FTHA 5I59B 3IB1A 5TU0A 1UQWA 1Y3PA 3IOTA 2E1SA 3SETA 5F1QA 3MZ9A 3MUQA 4YB6A 3O66A 5CM6A 1UTHA 2WKYA 4LATA 3TPAA 3KOSA 4TLLB 1LAHE 1M5EA 4I8CA 1MXUA 3LSLA 2LAOA 4QFKA 1DTGA 4YKKA 2XXIA 3U1OA 4KYDA 4BDNA 3TFLA 5IAIA 4ZEIA 3FXRA 4KD5A 1LAFE 4JSOA 1FQFA 3CSGA 4WEDA 1O64A 3QSLA 1R6ZA 4H0WA 1RYXA 3BKIB 2RKMA 1MXWA 4F2OA 2ZYKA 3T96B 2DVZA 4POWA 4KYEA 5DVFA 1H44A 1D9YA 1MRPA 4AB5A 3MPKA 2UYFA 3VDFA 5CMBA 1QKAA 2ALUA 1NL5A 3U72A 1PBPA 5JTYB 1JW1A 4YICA 5CBSA 3O6PA 4RPOA 4R9GA 1FW0A 4H67A 5I56B 2B4LA 1ATGA 1MQGA 1P1UA 3K00A 2GRVA 3S2VA 2BJJX 2F6PA 3E4RA 4F29A 1B51A 4C0RA 3ECRA 3CFXA 1SBPA 3ZKLA 4UA8A 4IGRA 5AA4B 4R75A 3IX1A 2M8CA 3S9NC 3VFJA 4RK9A 4NF5B 1MG1A 5K2YA 2F7CA 3E3KA 2V3UA 3OELA 4R73A 3TTLA 4RY1A
chains in the Genus database with same CATH superfamily
3DP4A 3E9XA 3EPEA 2UVHA 4QFOA 2A5TA 4ELPA 1SW1A 4NE4A 3KN7A 1B1XA 4P1LA 1MM7A 2ZYMA 3T9VA 4WKMA 3OD7A 3TQWA 5I2KA 3FVKA 3FASA 1GVCA 1XVXA 5EYGA 4ONYA 2UYEA 4JWXA 4NF6A 1SD3A 3KGCA 1FCKA 4JVCA 4KHZE 5KDTA 2DP8A 3H3GA 1DSNA 4KCDA 5I58B 1FTKA 3T9XB 3IORA 2Q9TA 3RUMA 2Y7PA 2R6GE 5L9SA 1B2HA 5DW8A 3MWBA 4Q8RA 1Y4TA 1O63A 1UIUA 1FPGA 3IJXB 3VLWA 3FBPA 2HPGA 4ELQA 5LOMA 1NH8A 2Q8MA 1D9VA 5IZ3B 2XXQA 3HSTA 3VXCA 3LSFB 4LN5A 2X7PA 5AE4A 3PPPA 1RDYA 1Y1MA 4EUOA 1DMBA 2V25A 4GX6A 2GHAA 1AL3A 3VXBA 4QHQA 3H06B 1Z7NE 3FXUA 2P3VA 3Q27A 3TTRA 4OVTA 1NV1A 5A5XB 5F7VA 3A3UA 3C33A 4O3BA 4KXPA 4MFIA 3DRKA 3B7DA 3KN8A 5J1DA 5B7DA 1II5A 4HE1A 1NV5A 2I48A 4H46A 2H98A 5IZ1A 5ITOA 1SVXB 1B5JA 5DVJA 4PE5B 3DRFA 1USYE 3PPNA 4PAFA 4XKQA 4P8BA 2VHAA 2VOZA 5KCJA 1B0HA 3RYAA 3FD3A 4RPNA 5EQ9A 4EF2A 1CE2A 4FIMA 4IO6A 1MY1A 5TPAA 3PMVA 3VV5A 1MDQA 1DPPA 4AS4A 2YPNA 4X8RA 4ZDMA 2F6GA 3DRGA 1VFDA 3ZKKA 4TOZA 1SW5A 4IR8A 1Z7ME 4R9FA 4G4PA 4RNSA 4R2FA 4QRZA 1B58A 3BFUA 5H8FA 3M8UA 3S4UA 1PBQA 3C36A 1QKBA 1FBDA 4ZS9A 1M5FA 2H4IA 4JWYA 4NEDA 4MNPA 2ZZWA 2HXWA 4NG7A 1Y3QA 4NF8A 3MVZA 3RYBA 1NV2A 4N13A 3T93B 4XKRA 5EYHA 2RF1A 2F5XA 1H45A 3U94A 4XIGQ 1LBYA 3SDFA 2IA4A 4PETA 4TQUQ 1B3LA 2AL5A 4YKPA 1P1OA 5ET6A 4I3YA 2HHMA 4GL8A 1OMPA 2B3FA 4K3FA 3TKDA 2E0SA 1M5DA 1F9BA 2X7QA 3K02A 2QMXA 4GVOA 1BKAA 1S50A 2Y7IA 4YU0A 1OLCA 1EZOA 1I6AA 1P1NA 5I57B 2IEEA 2YJPA 1M5BA 3LUYA 3MBPA 2ZXTA 3K1PA 3OO9A 5CMCA 1KWHA 1EYKA 2DQVA 4OVJA 2Z22A 2CMOA 2FHYA 2A5SA 1OVBA 1NUWA 4YB5A 1SPIA 1I69A 4Q30B 2RC8A 3G3KA 3MP1A 2XWIA 1DPEA 4XXUA 1H43A 3TZAA 4EQ9A 1VSOA 3IL1B 4RK2A 4QFPA 1NUXA 4GXSB 3W15C 2I4CA 1MH3A 1YCJA 3DRHA 3KC0A 3CFLA 4DIGA 2WYKA 4Z7EA 3N6TA 1OLAA 2H99A 3TCGA 4PDHA 3T22A 3RPLA 4UABA 1ANFA 1I6QA 4YAHX 3H6WA 1B0LA 4N4UA 3IOVA 1AOVA 1Y9UA 3IOUA 1BP5A 4X1DA 2KR0A 4N6PA 1T0KA 1FJ9A 4P0GA 1XT8A 3GLBA 4I1DA 1ZTYA 4IO7A 3BBRA 5DVIA 3MQ9A 3R26A 3B6WA 1ZMGA 4PQJA 5EHSA 1S7YA 4NTLA 5FHOA 3G3GA 2DE2A 4QBAA 2DOJA 3HV1A 1NNPA 4GD5A 1LSTA 4G68A 4FATA 2XXKA 1SI1A 1XHYA 3KZGA 4G8NA 4FE8A 3RYDA 3OO7A 3B8BA 3Q25A 1FTLA 3NOHA 3PTYA 1FPDA 3MJNA 1WVJA 2QVRA 4WXJA 2G29A 3ZSFA 2ZYNA 3H6UA 4G68C 4GIZA 3QIMA 2THIA 3G3FA 1MQIA 3MW0A 1N3WA 3T9UA 3PV0E 1FBGA 2CZIA 3A09A 2L5VA 1Q35A 3N26A 3U8QA 4OETA 2UXAA 1MPCA 1NNTA 5HBCA 3O6HA 1IMAA 1A8EA 2V3TA 2P0SA 2Y84A 2B4MA 2PX1A 3LSWA 3FXBA 2OLBA 2V84A 1D9QA 3OENA 2VT5A 1OIBA 2W7YA 1SQYA 4DI4B 4F19A 5H8NB 3IB0A 3EQ1A 3QK6A 3MC2A 3UK4A 2G93A 1FPJA 4OVQA 1EZ9A 2VD2A 4NF4B 1KZ8A 1MXXA 3K1MA 1DBZA 4FECA 2XX8A 1FPEA 2ZNSA 2Z8EA 2A5TB 3TYHA 3V5AA 4QSDA 3S9LC 4JB7A 2I3VA 3CVGA 3TTKA 3PPQA 3TAJA 5ET5A 3IJOB 5I2KB 1XVYA 1IQ7A 4OZ9A 2O7IA 1JW4A 2PFYA 2AL4A 3G3IA 4PDDA 1ZU0A 2DXRA 5H8QA 4GLIA 1B4ZA 4MBPA 3E78A 1YYZA 5TP9B 5ET7A 4OWDA 4QFNA 4F1YA 1ZJLA 4M1VA 2REGA 1P99A 4O7IA 1GGGA 1XOCA 2XWOA 4X1BA 4X04A 5DEXB 4R2BA 4R74A 2O7UA 4ISUA 3UP9A 3HFUA 2WOPA 3B6QA 5HM4B 1MQHA 4MJOA 1B46A 4OESA 1FTJA 4NHBA 5CMKA 2PBWA 1A54A 5IZZA 4NWCA 2Q8JA 4HE0A 1MM6A 4PGPA 2CEXA 3P7IA 3PPOA 1NV0A 5I2NA 3H6TA 2H9BA 3A3CA 3PUXE 4OANA 3B50A 3D4CA 2XXHA 3MVXA 4GF8A 4BDMA 3IFAA 5LTCA 1IXHA 3D4GA 2XD3A 4XF5A 3SZPA 2Y5LA 4EXKA 1IXIA 2Q2CA 3F11A 2WEFA 3TTMA 3O6IA 3UGWA 1UTBA 1RDZA 3EF7A 3FIRA 1H3DA 3FVOA 2VGQA 4MNIA 3TEPA 4F1VA 1Y20A 2D5WA 3C34A 4DXBA 5FTIA 4JVDA 5JEIA 1A7LA 2XX9A 1NKXA 3KSXA 3LC8A 2QRYA 2XXTA 1FPLA 4JBZA 3K6UA 3PAMA 4OFLA 4C1TA 4OQOA 2Q74A 3CG1A 1NFTA 5TPAB 2UVGA 4NAPA 2ONKE 3R7XA 2I49A 3TQLA 2DE4A 4H5FA 4N6DA 4N91A 2O1MA 4ZEKA 3MP8A 3BIGA 3ROJA 5AA2B 3EHUA 4JVIA 5H8FB 1QUIA 2I58A 3RTWB 4N8GA 4KR5A 1UIVA 3THIA 4DCYA 3DELB 1QUJA 2NOOA 4IY6A 3IR1A 4HS7A 4DLDA 4KQPA 4BDRA 1K9YA 1QUKA 2XXXA 1SW4A 5KZTA 1PB9A 5DT6A 1CNQA 4XKPA 1Y3NA 2RC9A 2I3WA 2H25A 2YLNA 1N7XA 4KYSA 2DYXA 3MP6A 1JVXA 4IO5A 3ONMA 5CRYA 4NQ8A 3MVYA 1URDA 4ZE8A 4OFOA 4YKIA 1B05A 1P1WA 3RT8A 3EHTA 4BLAA 4BDQA 5I56A 1R9LA 4MNCA 3S9MC 4E0WA 5ICQA 2PVUA 4DCXA 3I5OA 2DSFA 2F7BA 2ZNTA 5J16A 1SW2A 1MDP1 2KLFA 5AA4A 1PB8A 1PEBA 3V89B 3DP6A 4PFTA 3M3KA 2RCBA 3OOAA 4OEVA 1TFAA 3T0JA 4O3AA 3CFZA 1HSJA 1JQFA 3RNNA 5ICTA 1YAEA 4N07A 3EHSA 4NF5A 1B1HA 3W9WA 4NN3A 3FUZA 4GWXA 3TTNA 3EKIA 3E79A 3TODA 5AA3A 1NNKA 3RQTA 2WOKA 2OWZA 4HCYA 3S9EA 3H6VA 1FTOA 4OTEA 3FV2A 3RY3A 1B6HA 4IO4A 3RPLB 3CI8A 1NMUA 1MY3A 4THIA 3QUFA 2OWTA 3EN3A 5IM2A 4JWOA 4H6DA 1KA0A 2ZNUA 3SEYA 4P56A 1B40A 2B3BA 1RYOA 4X9TA 4U4XA 3VE1B 2QJEA 2DWAA 5I58A 2O51A 1WODA 1POY1 4X48A 2GHBA 2UVJA 1IEJA 3FATA 3JZJA 4N6KA 4F3PA 3H4ZA 2QFLA 4H5GA 1LAXA 3MVWA 2ABHA 5T3JA 3JV9A 4U1ZA 1USYH 4IO2A 1MPDA 1FQCA 1WDNA 4ZECA 4P9KA 1FJ6A 3K1NA 5IZ3A 3SESA 4DZ1A 5I84A 2HAVA 5FHMA 2DDKA 1LFGA 4OERA 2ESNA 4LA9A 1TT1A 1TFDA 2V3QA 1N7WA 3IOWA 1J1NA 3G7WA 3G3HA 4GWOA 1IMCA 5CI5A 3RLFE 1QULA 1INPA 2F36A 3QAXA 1QGXA 4U21A 3MAMA 1B3EA 2ANJA 1NUYA 4TLMB 3K6WA 1URSA 1VFEA 1QVSA 4R6HA 5A5LA 1NV4A 3Q29A 1NV3A 3VVFA 3ILUB 2XX7A 1B5IA 4N15A 1FQAA 4PC9A 4GWWA 3PMWA 1JNFA 4MF3A 2ZZVA 5L9MA 1L5TA 2JJKA 2R71A 3K6VA 3GZGA 4LQ2A 2FYIA 3K0VA 3CG3A 4GWSA 2I0CA 4HE2A 1K9ZA 3KBRA 4GX3A 4LZ5A 4XKNA 4ESWA 2ZZXA 3RT6B 2F7AA 1MY4A 4U23A 4ELOA 4U2RA 1MXZA 3BFTA 3PU5A 1AWBA 1B7UA 1XI6A 1BK4A 3KOTA 5EQ8A 1UTHB 2QS2A 4GWUA 4U22A 2DS9A 2DXYA 1DCUA 1B52A 2O68A 1EU8A 1Q9DA 3PPRA 3U65A 3O28A 2D21A 2QS3A 4DDDA 3D1RA 3DP8A 3LVUA 4EXLA 1JP4A 2HZLA 3N5LA 1FTMA 4NGUA 2NXOA 1MQDA 1N3XA 2VP1A 4RJZA 3T9HB 2GFEA 5EYFA 5H8QB 3OEKA 5AA1A 1GTKA 1RDXA 4DXUA 5EQAA 4Q0CA 1B3FA 2WBBA 4PBQA 4OEUA 1VDWA 3T66A 4DXCA 3C4MA 1SI0A 2OBGA 4F39A 2Q2AA 1POTA 3VVEA 2Z23A 4GOTA 3A29A 4GRKA 4U4SA 5L9OA 5DYHA 3R6UA 4F3GA 2O1LA 3G3JA 2DWIA 1LBBA 3M3LA 4H45A 2HEUA 5H8HA 3DM0A 4F22A 4H8IA 3UA8A 3L6HA 2H5YA 1ZLQA 2Y7KA 2D3IA 4ND9A 4MIJA 1LB9A 3ZS6A 1B3HA 2FVZA 1MQJA 3IAZA 2PYYA 1JVYA 4MLVA 3AXFA 3U92A 4XFEA 4GWYA 1LFIA 4OXVA 4YKJA 2QSXA 3LR1A 4N81A 4PFRA 3IK6B 1ZBMA 4WEPA 3E13X 4XTCQ 2OJTA 1JW5A 5EQ7A 5IGAA 3BIHA 1R1NA 2QPQA 2VPNA 4GBWA 1S9TA 4ESXA 4ZEBA 3U93A 1US5A 1LEVA 4I40A 2XXRA 3QXMA 4P47A 3SKPA 4YMAA 4DE8A 1MXVA 2Y7WA 3V8XB 4ZZEA 3LSXA 1N76A 4NF6B 2DWJA 3Q28A 1RKMA 5KDTB 2FNCA 2FIEA 4EQ7A 4AQ4A 1G0HA 3ODBA 5H8SA 4GFRA 4HCWA 2OK2A 4N17A 3C9HA 3Q26A 3K01A 4NF0A 4BDOA 3O97A 4RXLA 2XWVA 5I3SA 4PFUA 3CIJA 1LBZA 1FBHA 1LBWA 4L17A 2VD3A 4HTGA 4BDLA 2XD2A 1LAGE 4IGTA 4QF9A 4JDFA 2CZHA 1QW0A 4OENA 4YMBA 4Z0IA 4U1OA 3FV1A 4HXVA 2QL3A 2F34A 4PFYA 1FBCA 1EYJA 3I6VA 3WAFA 5ISUA 1MH4A 1BTJA 3TELA 3PUYE 3PMXA 1LCFA 4P1EA 4H8JA 1OQHA 4AB6A 3USDA 4QFLA 2WOLA 4EQBA 4GWZA 3N6UA 5BUUA 4ZEDA 1US4A 3MSTA 5LDZA 4QXDA 3FGSA 3GXAA 3I3VA 2NVUB 3KC1A 3KEIA 3LV0A 3GBAA 1OVTA 4PFWA 4OVRA 4PCDA 3RN8A 2XXWA 4G8HA 3TUSA 1H76A 3KN3A 5I5PA 1LCTA 1LFHA 1FPBA 1Y1ZA 1DK4A 1NH7A 4EF1A 4OVPA 2HXRA 2O69A 1HSEA 2HAUA 2XWKA 3PD8A 4F31B 5H8NA 1MY2A 2OZZA 5I59A 4R6YA 2XXUA 1B5HA 4KFQA 2KQZA 3TCFA 4NF4A 5KCJB 1A55A 2XXYA 1G0IA 2P2AA 1B9JA 4ZZAA 4PAKA 5JK4A 3QMFA 4ELRA 1QJMA 3MPLA 4FEDA 2AYSA 3LUZA 2PMSA 1P1QA 3JYRA 3O29A 3PUZE 4KPTA 3K6XA 1GR2A 3O2AA 1I6BA 1N84A 5AA2D 2PT1A 2GQ1A 4OVSA 1B32A 3FJ7A 2B65A 3V83A 1DTZA 2V93A 1D4NA 1CB6A 1OQGA 1ELJA 4NF8B 2X26A 1NV7A 3OMBA 2F8DA 5TP9A 2QVUA 3TMGA 4KI0E 4FAJA 1BLFA 5M2VA 4POXA 5L8DA 2VPOA 4LONB 3IO4A 1B7ZA 4QSEA 3CSBA 5IKBA 4ZE9A 2NUVA 4O7MA 5ELVA 3PD9A 4C1UA 1TXFA 3TCHA 4R6KA 4MMPA 3KJ7A 4I9DA 3SEVA 2ZMBA 3SEUA 3DRJA 1YPNA 5DEXA 4RYAA 5HPQA 5JTYA 4LP2B 4MLQA 4R72A 2F3DA 4PBHA 4P0IA 1A99A 4M4GA 1FBFA 2XHDA 4PFIA 1LLSA 1NUZA 1VE4A 4MAGA 4MH5A 3FVGA 1IUDA 1DOTA 1PC3A 2Z8DA 2XA5A 3N94A 2PT2A 3O9PA 1XS5A 2GH9A 2PFZA 4HW8A 1YTVA 2I4BA 4H65A 1SDXA 3LBSA 5EHMA 3K4UA 1Q1KA 4JSDA 1IMDA 3MYUA 3MZ1A 2HZKA 4LQ5A 4YB7A 3W9VA 1IMFA 2REJA 1IXGA 1A40A 4PE3A 1FSAA 1SYIA 1MPBA 2OWSA 3DRIA 2QS4A 2RCAA 2F35A 3TDJA 3OSRA 4FJPA 3FTOA 4F1UA 4MCOA 2CZLA 3C35A 3FJGA 2BJIA 3KJTA 5ESYA 2O6AA 4OA4A 3RGYA 4I62A 2PCRA 3O6GA 2NWJA 3VLVA 5AA2A 3HHGA 3CHGA 3FZVA 1IITA 3QUJA 3SEXA 2XXVA 1LBCA 1LB8A 4MX6A 3PUWE 2ONSA 1PDAA 4H1XA 1O7TA 2Q88A 1ZKBA 2OX3A 3CR9A 3KSJA 4G68B 3WAEA 2F3BA 2RINA 3IB2A 3KBZA 4OYVA 4PGNA 1NI9A 1IMBA 1JEVA 3HPIA 2MKZA 4AS5A 1URGA 3T1BA 4G2ZA 1AIVA 4OHNA 2Q89A 4F3SA 2ZYOA 3SERA 3HHFA 3IO6A 1N0TA 1FPKA 1N04A 2F78A 2F97A 1FTAA 4ECFA 1NNFA 2HCAA 3CRBA 3RTFB 2Y7RA 2DWHA 4PTKA 5A5XA 1EYIA 3ILTB 3OXNA 3OO6A 4IB2A 3M3FA 3RPWA 1ZIUA 1JEUA 1FQBA 5H8HB 3FJMA 2QS1A 4PAIA 5ET8A 1KA1A 2DE3A 1MS7A 1TWYA 3VLUA 3H03A 4LZ8A 1HSLA 2HFBA 1LBXA 2V4CA 2WX9A 4LUBA 1FQEA 1XC1A 3HCQA 3GBBA 4PP0A 4F18A 3VVDA 4ZEFA 3FXQA 2Y5KA 2OCUA 2O84X 2Z8FA 2RC7A 3C31A 4O3CA 1GV8A 1FBEA 4KCCA 4OMBA 3DLNA 4LVQA 2XXPA 1JETA 1IZ1A 3HO7A 4EDPA 2I0BA 2R9JA 1YZ0A 5B70A 1PB7A 1LGBC 2WYPA 3L6GA 4F2QA 1B4HA 2R8TA 3KFMA 3C32A 2HQ0A 4FEBA 3UORA 1VR5A 3FVNA 1EH3A 4FORA 3UN6A 5I7IA 1MY0A 3PUVE 3OEMA 4Q5TA 3B6TA 4PF8A 4G8MA 1D3KA 5CBRA 4P11A 3H7MA 4YZZA 4OFJA 4NWDA 1IMEA 1BIYA 4RA1A 5K2XA 5DTBA 3UIFA 3SEWA 2AIXA 2ONRA 4NMYA 4N8YA 1A8FA 4GL0A 1B3GA 1B7HA 3HN0A 4JXIA 4XEQA 4FBPA 2CEYA 3OO8A 1Y4CA 4G77A 5CC2A 4UACA 5FHNA 1EZPA 5I57A 4P3LA 2QMWA 1R9QA 4QSCA 4IO3A 4IY5A 2P1SA 1IXCA 5BWJA 5FBPA 1FQDA 2UVIA 3MZBA 3KG2A 3OSQA 1FBPA 1AH5A 4GXAA 4PFBA 5I2NB 4LZ7A 1SYHA 4GQOA 1M5CA 3QYTA 1IIWA 2DVCA 4O8MA 1AMFA 1MXYA 4F3BA 3K2DA 4DI3D 2FA7A 2I6EA 3PGFA 3GYYA 1LBVA 5CMMA 1UTBB 5ITPA 2P3NA 4E0XA 2WBDA 5FTHA 5I59B 3IB1A 4PF6A 5TU0A 1UQWA 1Y3PA 3IOTA 2E1SA 3SETA 5F1QA 3MZ9A 3MUQA 4YB6A 2FBPA 3O66A 5CM6A 1UTHA 2WKYA 3IFCA 4LATA 2QVVA 3TPAA 3KOSA 4TLLB 1LAHE 1M5EA 4I8CA 1MXUA 3LSLA 2LAOA 4G61A 4QFKA 1DTGA 4YKKA 2XXIA 3U1OA 4KYDA 4BDNA 3TFLA 5IAIA 4NX1A 4ZEIA 3FXRA 4KD5A 1LAFE 1NV6A 4JSOA 1FQFA 3CSGA 4WEDA 1O64A 1FRPA 3QSLA 1R6ZA 2CZKA 4O94A 1FPFA 4H0WA 1RYXA 3BKIB 2RKMA 1MXWA 3ISPA 4I3EA 4F2OA 2ZYKA 3T96B 2DVZA 4POWA 5F24A 4KYEA 5DVFA 1H44A 1D9YA 1MRPA 4AB5A 3MPKA 2UYFA 3VDFA 5CMBA 1QKAA 2ALUA 1FPIA 1NL5A 3U72A 1PBPA 4GX4A 4GBVA 5JTYB 1JW1A 4YICA 5CBSA 3O6PA 4RPOA 4R9GA 1FW0A 4H67A 5I56B 2B4LA 1ATGA 1MQGA 1P1UA 3K00A 2GRVA 3S2VA 2BJJX 2F6PA 2FIXA 3E4RA 4F29A 1B51A 4C0RA 3ECRA 3CFXA 1SBPA 3ZKLA 4UA8A 4MEVA 1YXIA 4IGRA 4R75A 5AA4B 3IX1A 2M8CA 3S9NC 3VFJA 4RK9A 4NF5B 1MG1A 4MHFA 5K2YA 2F7CA 3E3KA 2V3UA 3OELA 4R73A 3TTLA 4RY1A
chains in the Genus database with same CATH topology
3DP4A 3E9XA 3EPEA 2UVHA 4QFOA 2A5TA 4ELPA 1SW1A 4NE4A 3KN7A 1B1XA 1MM7A 2ZYMA 3T9VA 4WKMA 3OD7A 3TQWA 5I2KA 3FVKA 3FASA 1GVCA 1XVXA 4ONYA 2UYEA 4JWXA 4NF6A 1SD3A 3KGCA 1FCKA 4KHZE 5KDTA 2DP8A 3H3GA 1DSNA 4KCDA 5I58B 1FTKA 3T9XB 3IORA 2Q9TA 3RUMA 2Y7PA 2R6GE 5L9SA 1B2HA 3MWBA 4Q8RA 1Y4TA 1O63A 1UIUA 3IJXB 3VLWA 4ELQA 5LOMA 1NH8A 1D9VA 2XXQA 3HSTA 3VXCA 3LSFB 2X7PA 5AE4A 3PPPA 1Y1MA 4EUOA 1DMBA 2V25A 2GHAA 1AL3A 3VXBA 4QHQA 3H06B 1Z7NE 3FXUA 3Q27A 3TTRA 5A5XB 5F7VA 3A3UA 3C33A 4O3BA 4MFIA 3DRKA 3B7DA 3KN8A 5J1DA 5B7DA 1II5A 2I48A 2H98A 5ITOA 1SVXB 1B5JA 5DVJA 4PE5B 3DRFA 1USYE 3PPNA 4XKQA 2VHAA 2VOZA 5KCJA 1B0HA 3RYAA 3FD3A 4RPNA 4EF2A 1CE2A 4FIMA 4IO6A 1MY1A 5TPAA 3PMVA 3VV5A 1MDQA 1DPPA 2YPNA 4ZDMA 2F6GA 3DRGA 1VFDA 3ZKKA 4TOZA 1SW5A 1Z7ME 4R9FA 4G4PA 4RNSA 4R2FA 4QRZA 1B58A 3BFUA 5H8FA 3M8UA 3S4UA 1PBQA 3C36A 1QKBA 4ZS9A 1M5FA 2H4IA 4JWYA 4NEDA 2HXWA 1Y3QA 4NF8A 3MVZA 3RYBA 4N13A 3T93B 4XKRA 2RF1A 2F5XA 1H45A 3U94A 4XIGQ 3SDFA 2IA4A 4PETA 4TQUQ 1B3LA 2AL5A 4YKPA 1P1OA 4GL8A 1OMPA 2B3FA 4K3FA 3TKDA 2E0SA 1M5DA 1F9BA 2X7QA 3K02A 2QMXA 4GVOA 1BKAA 1S50A 2Y7IA 4YU0A 1OLCA 1EZOA 1I6AA 1P1NA 5I57B 2IEEA 2YJPA 1M5BA 3LUYA 3MBPA 2ZXTA 3K1PA 3OO9A 5CMCA 1KWHA 2DQVA 4OVJA 2Z22A 2CMOA 2A5SA 1OVBA 4YB5A 1I69A 4Q30B 2RC8A 3G3KA 3MP1A 1DPEA 4XXUA 1H43A 3TZAA 4EQ9A 1VSOA 3IL1B 4RK2A 4QFPA 4GXSB 3W15C 2I4CA 1MH3A 1YCJA 3DRHA 3CFLA 4DIGA 4Z7EA 3N6TA 1OLAA 2H99A 3TCGA 3T22A 1ANFA 1I6QA 4YAHX 3H6WA 1B0LA 3IOVA 1AOVA 1Y9UA 3IOUA 1BP5A 4X1DA 4N6PA 1T0KA 4P0GA 1XT8A 3GLBA 4I1DA 1ZTYA 4IO7A 3BBRA 5DVIA 3MQ9A 3R26A 3B6WA 1ZMGA 4PQJA 5EHSA 1S7YA 4NTLA 5FHOA 3G3GA 2DE2A 2DOJA 3HV1A 1NNPA 4GD5A 1LSTA 4G68A 4FATA 1SI1A 1XHYA 3KZGA 4G8NA 4FE8A 3OO7A 3Q25A 1FTLA 3MJNA 1WVJA 4WXJA 2G29A 3ZSFA 2ZYNA 3H6UA 4G68C 4GIZA 3QIMA 2THIA 3G3FA 1MQIA 3MW0A 1N3WA 3T9UA 3PV0E 3A09A 1Q35A 3N26A 3U8QA 4OETA 2UXAA 1MPCA 1NNTA 5HBCA 3O6HA 1A8EA 2V3TA 2P0SA 2Y84A 2B4MA 2PX1A 3LSWA 2OLBA 2V84A 3OENA 1OIBA 2W7YA 1SQYA 4F19A 5H8NB 3IB0A 3EQ1A 3QK6A 3MC2A 3UK4A 2G93A 1EZ9A 2VD2A 4NF4B 1MXXA 3K1MA 4FECA 2XX8A 2ZNSA 2Z8EA 2A5TB 3TYHA 3V5AA 4QSDA 3S9LC 4JB7A 2I3VA 3CVGA 3TTKA 3PPQA 3TAJA 3IJOB 5I2KB 1XVYA 1IQ7A 4OZ9A 2O7IA 1JW4A 2AL4A 3G3IA 1ZU0A 2DXRA 5H8QA 4GLIA 1B4ZA 4MBPA 5TP9B 4OWDA 4QFNA 4F1YA 1ZJLA 4M1VA 2REGA 1P99A 1GGGA 1XOCA 4X1BA 5DEXB 4R2BA 4R74A 2O7UA 4ISUA 3UP9A 2WOPA 3B6QA 5HM4B 1MQHA 1B46A 4OESA 1FTJA 5CMKA 2PBWA 1A54A 4NWCA 2Q8JA 1MM6A 3PPOA 3P7IA 5I2NA 3H6TA 2H9BA 3A3CA 3PUXE 3D4CA 2XXHA 3MVXA 4GF8A 4BDMA 1IXHA 3D4GA 2XD3A 4EXKA 1IXIA 2Q2CA 3F11A 3TTMA 3O6IA 3UGWA 1UTBA 3FIRA 3EF7A 1H3DA 3FVOA 2VGQA 3TEPA 4F1VA 1Y20A 2D5WA 3C34A 4DXBA 5FTIA 5JEIA 1A7LA 2XX9A 1NKXA 3KSXA 3LC8A 2QRYA 2XXTA 4JBZA 3K6UA 3PAMA 4OFLA 4C1TA 4OQOA 3CG1A 1NFTA 5TPAB 2UVGA 2ONKE 3R7XA 2I49A 3TQLA 2DE4A 4H5FA 2O1MA 5AA2B 4ZEKA 3MP8A 3EHUA 5H8FB 1QUIA 2I58A 3RTWB 4KR5A 1UIVA 3THIA 4DCYA 3DELB 1QUJA 2NOOA 4IY6A 3IR1A 4HS7A 4DLDA 4KQPA 4BDRA 2XXXA 1QUKA 1SW4A 5KZTA 1PB9A 5DT6A 4XKPA 1Y3NA 2RC9A 2I3WA 2H25A 2YLNA 1N7XA 4KYSA 2DYXA 3MP6A 1JVXA 4IO5A 3ONMA 5CRYA 3MVYA 1URDA 4ZE8A 4OFOA 4YKIA 1B05A 1P1WA 3RT8A 3EHTA 4BLAA 4BDQA 5I56A 1R9LA 3S9MC 4E0WA 5ICQA 2PVUA 4DCXA 3I5OA 2DSFA 2F7BA 2ZNTA 1SW2A 1MDP1 2KLFA 5AA4A 1PB8A 1PEBA 3V89B 3DP6A 4PFTA 3M3KA 2RCBA 3OOAA 4OEVA 1TFAA 4O3AA 3CFZA 1HSJA 1JQFA 3RNNA 5ICTA 1YAEA 4N07A 3EHSA 4NF5A 1B1HA 3W9WA 3FUZA 3TTNA 3TODA 5AA3A 1NNKA 3RQTA 2WOKA 4HCYA 3S9EA 3H6VA 1FTOA 4OTEA 3FV2A 3RY3A 1B6HA 4IO4A 3CI8A 1NMUA 1MY3A 4THIA 3QUFA 2OWTA 3EN3A 4JWOA 4H6DA 3SEYA 2ZNUA 1B40A 2B3BA 1RYOA 4X9TA 4U4XA 3VE1B 2QJEA 2DWAA 5I58A 2O51A 1WODA 1POY1 4X48A 2GHBA 2UVJA 1IEJA 3FATA 3JZJA 4F3PA 3H4ZA 4H5GA 1LAXA 3MVWA 2ABHA 3JV9A 4U1ZA 1USYH 4IO2A 1MPDA 1FQCA 1WDNA 4ZECA 3K1NA 3SESA 4DZ1A 5I84A 2HAVA 5FHMA 1LFGA 4OERA 2ESNA 4LA9A 1TT1A 1TFDA 2V3QA 1N7WA 3IOWA 1J1NA 3G7WA 3G3HA 4GWOA 5CI5A 3RLFE 1QULA 2F36A 3QAXA 4U21A 3MAMA 1B3EA 2ANJA 4TLMB 3K6WA 1URSA 1VFEA 1QVSA 4R6HA 3Q29A 3VVFA 3ILUB 2XX7A 1B5IA 1FQAA 3PMWA 1JNFA 4MF3A 5L9MA 1L5TA 2R71A 3K6VA 3GZGA 4LQ2A 2FYIA 3K0VA 3CG3A 2I0CA 3KBRA 4LZ5A 4XKNA 4ESWA 3RT6B 2F7AA 1MY4A 4U23A 4ELOA 4U2RA 1MXZA 3BFTA 3PU5A 1B7UA 3KOTA 1UTHB 2QS2A 4U22A 2DS9A 2DXYA 1B52A 2O68A 1EU8A 3PPRA 3O28A 2D21A 2QS3A 4DDDA 3DP8A 3LVUA 4EXLA 2HZLA 3N5LA 1FTMA 2NXOA 1MQDA 1N3XA 2VP1A 4RJZA 3T9HB 2GFEA 5EYFA 5H8QB 3OEKA 5AA1A 1GTKA 4DXUA 4Q0CA 1B3FA 4OEUA 3T66A 4DXCA 3C4MA 1SI0A 2OBGA 4F39A 2Q2AA 1POTA 3VVEA 2Z23A 4GOTA 4GRKA 4U4SA 5L9OA 5DYHA 3R6UA 4F3GA 2O1LA 3G3JA 2DWIA 1LBBA 3M3LA 2HEUA 5H8HA 3DM0A 4F22A 4H8IA 3UA8A 3L6HA 2H5YA 1ZLQA 2Y7KA 2D3IA 4ND9A 1LB9A 3ZS6A 1B3HA 1MQJA 3IAZA 2PYYA 1JVYA 4MLVA 3AXFA 3U92A 1LFIA 4OXVA 4YKJA 2QSXA 3LR1A 4WEPA 3IK6B 1ZBMA 3E13X 4XTCQ 2OJTA 1JW5A 1R1NA 2QPQA 1S9TA 4ESXA 4ZEBA 3U93A 1US5A 2XXRA 3QXMA 3SKPA 4YMAA 4DE8A 1MXVA 2Y7WA 3V8XB 4ZZEA 3LSXA 1N76A 4NF6B 2DWJA 3Q28A 1RKMA 5KDTB 2FNCA 4EQ7A 4AQ4A 3ODBA 5H8SA 4GFRA 4HCWA 2OK2A 3C9HA 3Q26A 3K01A 4BDOA 3O97A 4RXLA 4PFUA 3CIJA 4L17A 2VD3A 4HTGA 4BDLA 2XD2A 1LAGE 4IGTA 4QF9A 4JDFA 1QW0A 4OENA 4YMBA 4Z0IA 4U1OA 3FV1A 2QL3A 2F34A 4PFYA 3I6VA 3WAFA 5ISUA 1MH4A 1BTJA 3TELA 3PUYE 3PMXA 1LCFA 4AB6A 4H8JA 1OQHA 3USDA 4QFLA 2WOLA 4EQBA 3N6UA 5BUUA 4ZEDA 1US4A 3FGSA 3GXAA 3I3VA 2NVUB 3KEIA 3GBAA 1OVTA 4PFWA 3RN8A 2XXWA 4G8HA 3TUSA 1H76A 3KN3A 1LCTA 1LFHA 1Y1ZA 1NH7A 4EF1A 2O69A 1HSEA 2HAUA 3PD8A 4F31B 5H8NA 1MY2A 2OZZA 5I59A 4R6YA 2XXUA 1B5HA 4KFQA 3TCFA 4NF4A 5KCJB 1A55A 2XXYA 2P2AA 1B9JA 4ZZAA 5JK4A 4ELRA 1QJMA 3MPLA 4FEDA 2AYSA 2PMSA 1P1QA 3JYRA 3O29A 3PUZE 4KPTA 3K6XA 1GR2A 3O2AA 1I6BA 1N84A 5AA2D 2PT1A 1B32A 3FJ7A 2B65A 3V83A 1DTZA 2V93A 1D4NA 1CB6A 1OQGA 1ELJA 4NF8B 2X26A 3OMBA 2F8DA 5TP9A 3TMGA 4KI0E 4FAJA 1BLFA 5M2VA 4POXA 5L8DA 4LONB 3IO4A 1B7ZA 4QSEA 3CSBA 5IKBA 4ZE9A 2NUVA 5ELVA 3PD9A 4C1UA 1TXFA 3TCHA 4R6KA 3KJ7A 4I9DA 3SEVA 2ZMBA 3SEUA 3DRJA 1YPNA 5DEXA 4RYAA 5HPQA 5JTYA 4LP2B 4MLQA 4R72A 4P0IA 1A99A 4M4GA 2XHDA 1LLSA 1VE4A 4MH5A 3FVGA 1IUDA 1DOTA 1PC3A 2Z8DA 3N94A 2PT2A 3O9PA 1XS5A 2GH9A 4HW8A 1YTVA 2I4BA 4H65A 1SDXA 3LBSA 5EHMA 3K4UA 1Q1KA 4JSDA 3MZ1A 2HZKA 4LQ5A 4YB7A 3W9VA 2REJA 1IXGA 1A40A 1SYIA 1MPBA 2OWSA 3DRIA 2QS4A 2RCAA 2F35A 3TDJA 3OSRA 4FJPA 3FTOA 4F1UA 2CZLA 3C35A 3FJGA 3KJTA 2O6AA 3RGYA 4I62A 3O6GA 2NWJA 3VLVA 5AA2A 3HHGA 3CHGA 3FZVA 1IITA 3QUJA 3SEXA 2XXVA 1LBCA 1LB8A 3PUWE 2ONSA 1PDAA 4H1XA 1O7TA 2Q88A 1ZKBA 3CR9A 3KSJA 4G68B 3WAEA 2RINA 3IB2A 4OYVA 1JEVA 3HPIA 1URGA 4G2ZA 1AIVA 4OHNA 2Q89A 4F3SA 2ZYOA 3SERA 3HHFA 3IO6A 1N0TA 1N04A 2F78A 2F97A 4ECFA 1NNFA 2HCAA 3CRBA 3RTFB 2Y7RA 2DWHA 5A5XA 3ILTB 3OXNA 3OO6A 4IB2A 3M3FA 3RPWA 1ZIUA 1JEUA 1FQBA 5H8HB 3FJMA 2QS1A 2DE3A 1MS7A 1TWYA 3VLUA 3H03A 4LZ8A 1HSLA 2HFBA 4LUBA 1FQEA 1XC1A 3HCQA 3GBBA 4PP0A 4F18A 3VVDA 4ZEFA 3FXQA 2OCUA 2O84X 2Z8FA 2RC7A 3C31A 4O3CA 1GV8A 4KCCA 4OMBA 3DLNA 4LVQA 2XXPA 1JETA 1IZ1A 3HO7A 4EDPA 2I0BA 2R9JA 5B70A 1PB7A 1LGBC 3L6GA 4F2QA 1B4HA 3KFMA 3C32A 2HQ0A 4FEBA 3UORA 1VR5A 3FVNA 1EH3A 4FORA 3UN6A 1MY0A 3PUVE 3OEMA 4Q5TA 3B6TA 4G8MA 1D3KA 5CBRA 4P11A 3H7MA 4YZZA 4OFJA 4NWDA 1BIYA 4RA1A 5K2XA 5DTBA 3UIFA 3SEWA 2AIXA 2ONRA 4NMYA 1A8FA 4GL0A 1B3GA 1B7HA 3HN0A 4JXIA 3OO8A 1Y4CA 4G77A 5CC2A 4UACA 5FHNA 1EZPA 5I57A 2QMWA 1R9QA 4QSCA 4IO3A 4IY5A 2P1SA 1IXCA 5BWJA 1FQDA 2UVIA 3MZBA 3KG2A 3OSQA 1AH5A 4GXAA 5I2NB 4LZ7A 1SYHA 4GQOA 1M5CA 3QYTA 1IIWA 2DVCA 1AMFA 1MXYA 4F3BA 3K2DA 2FA7A 2I6EA 3PGFA 5CMMA 1UTBB 5ITPA 4E0XA 5FTHA 5I59B 3IB1A 5TU0A 1UQWA 1Y3PA 3IOTA 2E1SA 3SETA 5F1QA 3MZ9A 3MUQA 4YB6A 3O66A 5CM6A 1UTHA 2WKYA 4LATA 3TPAA 3KOSA 4TLLB 1LAHE 1M5EA 4I8CA 1MXUA 3LSLA 2LAOA 4QFKA 1DTGA 4YKKA 2XXIA 3U1OA 4KYDA 4BDNA 3TFLA 5IAIA 4ZEIA 3FXRA 4KD5A 1LAFE 4JSOA 1FQFA 3CSGA 4WEDA 1O64A 3QSLA 1R6ZA 4H0WA 1RYXA 3BKIB 2RKMA 1MXWA 4F2OA 2ZYKA 3T96B 2DVZA 4POWA 4KYEA 5DVFA 1H44A 1D9YA 1MRPA 4AB5A 3MPKA 2UYFA 3VDFA 5CMBA 1QKAA 2ALUA 1NL5A 3U72A 1PBPA 5JTYB 1JW1A 4YICA 5CBSA 3O6PA 4RPOA 4R9GA 1FW0A 4H67A 5I56B 2B4LA 1ATGA 1MQGA 1P1UA 3K00A 2GRVA 3S2VA 2BJJX 2F6PA 3E4RA 4F29A 1B51A 4C0RA 3ECRA 3CFXA 1SBPA 3ZKLA 4UA8A 4IGRA 5AA4B 4R75A 3IX1A 2M8CA 3S9NC 3VFJA 4RK9A 4NF5B 1MG1A 5K2YA 2F7CA 3E3KA 2V3UA 3OELA 4R73A 3TTLA 4RY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP4 A;  3E9X A;  3EPE A;  2UVH A;  4QFO A;  2A5T A;  4ELP A;  1SW1 A;  4NE4 A;  3KN7 A;  1B1X A;  1MM7 A;  2ZYM A;  3T9V A;  4WKM A;  3OD7 A;  3TQW A;  5I2K A;  3FVK A;  3FAS A;  1GVC A;  1XVX A;  4ONY A;  2UYE A;  4JWX A;  4NF6 A;  1SD3 A;  3KGC A;  1FCK A;  4KHZ E;  5KDT A;  2DP8 A;  3H3G A;  1DSN A;  4KCD A;  5I58 B;  1FTK A;  3T9X B;  3IOR A;  2Q9T A;  3RUM A;  2Y7P A;  2R6G E;  5L9S A;  1B2H A;  3MWB A;  4Q8R A;  1Y4T A;  1O63 A;  1UIU A;  3IJX B;  3VLW A;  4ELQ A;  5LOM A;  1NH8 A;  1D9V A;  2XXQ A;  3HST A;  3VXC A;  3LSF B;  2X7P A;  5AE4 A;  3PPP A;  1Y1M A;  4EUO A;  1DMB A;  2V25 A;  2GHA A;  1AL3 A;  3VXB A;  4QHQ A;  3H06 B;  1Z7N E;  3FXU A;  3Q27 A;  3TTR A;  5A5X B;  5F7V A;  3A3U A;  3C33 A;  4O3B A;  4MFI A;  3DRK A;  3B7D A;  3KN8 A;  5J1D A;  5B7D A;  1II5 A;  2I48 A;  2H98 A;  5ITO A;  1SVX B;  1B5J A;  5DVJ A;  4PE5 B;  3DRF A;  1USY E;  3PPN A;  4XKQ A;  2VHA A;  2VOZ A;  5KCJ A;  1B0H A;  3RYA A;  3FD3 A;  4RPN A;  4EF2 A;  1CE2 A;  4FIM A;  4IO6 A;  1MY1 A;  5TPA A;  3PMV A;  3VV5 A;  1MDQ A;  1DPP A;  2YPN A;  4ZDM A;  2F6G A;  3DRG A;  1VFD A;  3ZKK A;  4TOZ A;  1SW5 A;  1Z7M E;  4R9F A;  4G4P A;  4RNS A;  4R2F A;  4QRZ A;  1B58 A;  3BFU A;  5H8F A;  3M8U A;  3S4U A;  1PBQ A;  3C36 A;  1QKB A;  4ZS9 A;  1M5F A;  2H4I A;  4JWY A;  4NED A;  2HXW A;  1Y3Q A;  4NF8 A;  3MVZ A;  3RYB A;  4N13 A;  3T93 B;  4XKR A;  2RF1 A;  2F5X A;  1H45 A;  3U94 A;  4XIG Q;  3SDF A;  2IA4 A;  4PET A;  4TQU Q;  1B3L A;  2AL5 A;  4YKP A;  1P1O A;  4GL8 A;  1OMP A;  2B3F A;  4K3F A;  3TKD A;  2E0S A;  1M5D A;  1F9B A;  2X7Q A;  3K02 A;  2QMX A;  4GVO A;  1BKA A;  1S50 A;  2Y7I A;  4YU0 A;  1OLC A;  1EZO A;  1I6A A;  1P1N A;  5I57 B;  2IEE A;  2YJP A;  1M5B A;  3LUY A;  3MBP A;  2ZXT A;  3K1P A;  3OO9 A;  5CMC A;  1KWH A;  2DQV A;  4OVJ A;  2Z22 A;  2CMO A;  2A5S A;  1OVB A;  4YB5 A;  1I69 A;  4Q30 B;  2RC8 A;  3G3K A;  3MP1 A;  1DPE A;  4XXU A;  1H43 A;  3TZA A;  4EQ9 A;  1VSO A;  3IL1 B;  4RK2 A;  4QFP A;  4GXS B;  3W15 C;  2I4C A;  1MH3 A;  1YCJ A;  3DRH A;  3CFL A;  4DIG A;  4Z7E A;  3N6T A;  1OLA A;  2H99 A;  3TCG A;  3T22 A;  1ANF A;  1I6Q A;  4YAH X;  3H6W A;  1B0L A;  3IOV A;  1AOV A;  1Y9U A;  3IOU A;  1BP5 A;  4X1D A;  4N6P A;  1T0K A;  4P0G A;  1XT8 A;  3GLB A;  4I1D A;  1ZTY A;  4IO7 A;  3BBR A;  5DVI A;  3MQ9 A;  3R26 A;  3B6W A;  1ZMG A;  4PQJ A;  5EHS A;  1S7Y A;  4NTL A;  5FHO A;  3G3G A;  2DE2 A;  2DOJ A;  3HV1 A;  1NNP A;  4GD5 A;  1LST A;  4G68 A;  4FAT A;  1SI1 A;  1XHY A;  3KZG A;  4G8N A;  4FE8 A;  3OO7 A;  3Q25 A;  1FTL A;  3MJN A;  1WVJ A;  4WXJ A;  2G29 A;  3ZSF A;  2ZYN A;  3H6U A;  4G68 C;  4GIZ A;  3QIM A;  2THI A;  3G3F A;  1MQI A;  3MW0 A;  1N3W A;  3T9U A;  3PV0 E;  3A09 A;  1Q35 A;  3N26 A;  3U8Q A;  4OET A;  2UXA A;  1MPC A;  1NNT A;  5HBC A;  3O6H A;  1A8E A;  2V3T A;  2P0S A;  2Y84 A;  2B4M A;  2PX1 A;  3LSW A;  2OLB A;  2V84 A;  3OEN A;  1OIB A;  2W7Y A;  1SQY A;  4F19 A;  5H8N B;  3IB0 A;  3EQ1 A;  3QK6 A;  3MC2 A;  3UK4 A;  2G93 A;  1EZ9 A;  2VD2 A;  4NF4 B;  1MXX A;  3K1M A;  4FEC A;  2XX8 A;  2ZNS A;  2Z8E A;  2A5T B;  3TYH A;  3V5A A;  4QSD A;  3S9L C;  4JB7 A;  2I3V A;  3CVG A;  3TTK A;  3PPQ A;  3TAJ A;  3IJO B;  5I2K B;  1XVY A;  1IQ7 A;  4OZ9 A;  2O7I A;  1JW4 A;  2AL4 A;  3G3I A;  1ZU0 A;  2DXR A;  5H8Q A;  4GLI A;  1B4Z A;  4MBP A;  5TP9 B;  4OWD A;  4QFN A;  4F1Y A;  1ZJL A;  4M1V A;  2REG A;  1P99 A;  1GGG A;  1XOC A;  4X1B A;  5DEX B;  4R2B A;  4R74 A;  2O7U A;  4ISU A;  3UP9 A;  2WOP A;  3B6Q A;  5HM4 B;  1MQH A;  1B46 A;  4OES A;  1FTJ A;  5CMK A;  2PBW A;  1A54 A;  4NWC A;  2Q8J A;  1MM6 A;  3PPO A;  3P7I A;  5I2N A;  3H6T A;  2H9B A;  3A3C A;  3PUX E;  3D4C A;  2XXH A;  3MVX A;  4GF8 A;  4BDM A;  1IXH A;  3D4G A;  2XD3 A;  4EXK A;  1IXI A;  2Q2C A;  3F11 A;  3TTM A;  3O6I A;  3UGW A;  1UTB A;  3FIR A;  3EF7 A;  1H3D A;  3FVO A;  2VGQ A;  3TEP A;  4F1V A;  1Y20 A;  2D5W A;  3C34 A;  4DXB A;  5FTI A;  5JEI A;  1A7L A;  2XX9 A;  1NKX A;  3KSX A;  3LC8 A;  2QRY A;  2XXT A;  4JBZ A;  3K6U A;  3PAM A;  4OFL A;  4C1T A;  4OQO A;  3CG1 A;  1NFT A;  5TPA B;  2UVG A;  2ONK E;  3R7X A;  2I49 A;  3TQL A;  2DE4 A;  4H5F A;  2O1M A;  5AA2 B;  4ZEK A;  3MP8 A;  3EHU A;  5H8F B;  1QUI A;  2I58 A;  3RTW B;  4KR5 A;  1UIV A;  3THI A;  4DCY A;  3DEL B;  1QUJ A;  2NOO A;  4IY6 A;  3IR1 A;  4HS7 A;  4DLD A;  4KQP A;  4BDR A;  2XXX A;  1QUK A;  1SW4 A;  5KZT A;  1PB9 A;  5DT6 A;  4XKP A;  1Y3N A;  2RC9 A;  2I3W A;  2H25 A;  2YLN A;  1N7X A;  4KYS A;  2DYX A;  3MP6 A;  1JVX A;  4IO5 A;  3ONM A;  5CRY A;  3MVY A;  1URD A;  4ZE8 A;  4OFO A;  4YKI A;  1B05 A;  1P1W A;  3RT8 A;  3EHT A;  4BLA A;  4BDQ A;  5I56 A;  1R9L A;  3S9M C;  4E0W A;  5ICQ A;  2PVU A;  4DCX A;  3I5O A;  2DSF A;  2F7B A;  2ZNT A;  1SW2 A;  1MDP 1;  2KLF A;  5AA4 A;  1PB8 A;  1PEB A;  3V89 B;  3DP6 A;  4PFT A;  3M3K A;  2RCB A;  3OOA A;  4OEV A;  1TFA A;  4O3A A;  3CFZ A;  1HSJ A;  1JQF A;  3RNN A;  5ICT A;  1YAE A;  4N07 A;  3EHS A;  4NF5 A;  1B1H A;  3W9W A;  3FUZ A;  3TTN A;  3TOD A;  5AA3 A;  1NNK A;  3RQT A;  2WOK A;  4HCY A;  3S9E A;  3H6V A;  1FTO A;  4OTE A;  3FV2 A;  3RY3 A;  1B6H A;  4IO4 A;  3CI8 A;  1NMU A;  1MY3 A;  4THI A;  3QUF A;  2OWT A;  3EN3 A;  4JWO A;  4H6D A;  3SEY A;  2ZNU A;  1B40 A;  2B3B A;  1RYO A;  4X9T A;  4U4X A;  3VE1 B;  2QJE A;  2DWA A;  5I58 A;  2O51 A;  1WOD A;  1POY 1;  4X48 A;  2GHB A;  2UVJ A;  1IEJ A;  3FAT A;  3JZJ A;  4F3P A;  3H4Z A;  4H5G A;  1LAX A;  3MVW A;  2ABH A;  3JV9 A;  4U1Z A;  1USY H;  4IO2 A;  1MPD A;  1FQC A;  1WDN A;  4ZEC A;  3K1N A;  3SES A;  4DZ1 A;  5I84 A;  2HAV A;  5FHM A;  1LFG A;  4OER A;  2ESN A;  4LA9 A;  1TT1 A;  1TFD A;  2V3Q A;  1N7W A;  3IOW A;  1J1N A;  3G7W A;  3G3H A;  4GWO A;  5CI5 A;  3RLF E;  1QUL A;  2F36 A;  3QAX A;  4U21 A;  3MAM A;  1B3E A;  2ANJ A;  4TLM B;  3K6W A;  1URS A;  1VFE A;  1QVS A;  4R6H A;  3Q29 A;  3VVF A;  3ILU B;  2XX7 A;  1B5I A;  1FQA A;  3PMW A;  1JNF A;  4MF3 A;  5L9M A;  1L5T A;  2R71 A;  3K6V A;  3GZG A;  4LQ2 A;  2FYI A;  3K0V A;  3CG3 A;  2I0C A;  3KBR A;  4LZ5 A;  4XKN A;  4ESW A;  3RT6 B;  2F7A A;  1MY4 A;  4U23 A;  4ELO A;  4U2R A;  1MXZ A;  3BFT A;  3PU5 A;  1B7U A;  3KOT A;  1UTH B;  2QS2 A;  4U22 A;  2DS9 A;  2DXY A;  1B52 A;  2O68 A;  1EU8 A;  3PPR A;  3O28 A;  2D21 A;  2QS3 A;  4DDD A;  3DP8 A;  3LVU A;  4EXL A;  2HZL A;  3N5L A;  1FTM A;  2NXO A;  1MQD A;  1N3X A;  2VP1 A;  4RJZ A;  3T9H B;  2GFE A;  5EYF A;  5H8Q B;  3OEK A;  5AA1 A;  1GTK A;  4DXU A;  4Q0C A;  1B3F A;  4OEU A;  3T66 A;  4DXC A;  3C4M A;  1SI0 A;  2OBG A;  4F39 A;  2Q2A A;  1POT A;  3VVE A;  2Z23 A;  4GOT A;  4GRK A;  4U4S A;  5L9O A;  5DYH A;  3R6U A;  4F3G A;  2O1L A;  3G3J A;  2DWI A;  1LBB A;  3M3L A;  2HEU A;  5H8H A;  3DM0 A;  4F22 A;  4H8I A;  3UA8 A;  3L6H A;  2H5Y A;  1ZLQ A;  2Y7K A;  2D3I A;  4ND9 A;  1LB9 A;  3ZS6 A;  1B3H A;  1MQJ A;  3IAZ A;  2PYY A;  1JVY A;  4MLV A;  3AXF A;  3U92 A;  1LFI A;  4OXV A;  4YKJ A;  2QSX A;  3LR1 A;  4WEP A;  3IK6 B;  1ZBM A;  3E13 X;  4XTC Q;  2OJT A;  1JW5 A;  1R1N A;  2QPQ A;  1S9T A;  4ESX A;  4ZEB A;  3U93 A;  1US5 A;  2XXR A;  3QXM A;  3SKP A;  4YMA A;  4DE8 A;  1MXV A;  2Y7W A;  3V8X B;  4ZZE A;  3LSX A;  1N76 A;  4NF6 B;  2DWJ A;  3Q28 A;  1RKM A;  5KDT B;  2FNC A;  4EQ7 A;  4AQ4 A;  3ODB A;  5H8S A;  4GFR A;  4HCW A;  2OK2 A;  3C9H A;  3Q26 A;  3K01 A;  4BDO A;  3O97 A;  4RXL A;  4PFU A;  3CIJ A;  4L17 A;  2VD3 A;  4HTG A;  4BDL A;  2XD2 A;  1LAG E;  4IGT A;  4QF9 A;  4JDF A;  1QW0 A;  4OEN A;  4YMB A;  4Z0I A;  4U1O A;  3FV1 A;  2QL3 A;  2F34 A;  4PFY A;  3I6V A;  3WAF A;  5ISU A;  1MH4 A;  1BTJ A;  3TEL A;  3PUY E;  3PMX A;  1LCF A;  4AB6 A;  4H8J A;  1OQH A;  3USD A;  4QFL A;  2WOL A;  4EQB A;  3N6U A;  5BUU A;  4ZED A;  1US4 A;  3FGS A;  3GXA A;  3I3V A;  2NVU B;  3KEI A;  3GBA A;  1OVT A;  4PFW A;  3RN8 A;  2XXW A;  4G8H A;  3TUS A;  1H76 A;  3KN3 A;  1LCT A;  1LFH A;  1Y1Z A;  1NH7 A;  4EF1 A;  2O69 A;  1HSE A;  2HAU A;  3PD8 A;  4F31 B;  5H8N A;  1MY2 A;  2OZZ A;  5I59 A;  4R6Y A;  2XXU A;  1B5H A;  4KFQ A;  3TCF A;  4NF4 A;  5KCJ B;  1A55 A;  2XXY A;  2P2A A;  1B9J A;  4ZZA A;  5JK4 A;  4ELR A;  1QJM A;  3MPL A;  4FED A;  2AYS A;  2PMS A;  1P1Q A;  3JYR A;  3O29 A;  3PUZ E;  4KPT A;  3K6X A;  1GR2 A;  3O2A A;  1I6B A;  1N84 A;  5AA2 D;  2PT1 A;  1B32 A;  3FJ7 A;  2B65 A;  3V83 A;  1DTZ A;  2V93 A;  1D4N A;  1CB6 A;  1OQG A;  1ELJ A;  4NF8 B;  2X26 A;  3OMB A;  2F8D A;  5TP9 A;  3TMG A;  4KI0 E;  4FAJ A;  1BLF A;  5M2V A;  4POX A;  5L8D A;  4LON B;  3IO4 A;  1B7Z A;  4QSE A;  3CSB A;  5IKB A;  4ZE9 A;  2NUV A;  5ELV A;  3PD9 A;  4C1U A;  1TXF A;  3TCH A;  4R6K A;  3KJ7 A;  4I9D A;  3SEV A;  2ZMB A;  3SEU A;  3DRJ A;  1YPN A;  5DEX A;  4RYA A;  5HPQ A;  5JTY A;  4LP2 B;  4MLQ A;  4R72 A;  4P0I A;  1A99 A;  4M4G A;  2XHD A;  1LLS A;  1VE4 A;  4MH5 A;  3FVG A;  1IUD A;  1DOT A;  1PC3 A;  2Z8D A;  3N94 A;  2PT2 A;  3O9P A;  1XS5 A;  2GH9 A;  4HW8 A;  1YTV A;  2I4B A;  4H65 A;  1SDX A;  3LBS A;  5EHM A;  3K4U A;  1Q1K A;  4JSD A;  3MZ1 A;  2HZK A;  4LQ5 A;  4YB7 A;  3W9V A;  2REJ A;  1IXG A;  1A40 A;  1SYI A;  1MPB A;  2OWS A;  3DRI A;  2QS4 A;  2RCA A;  2F35 A;  3TDJ A;  3OSR A;  4FJP A;  3FTO A;  4F1U A;  2CZL A;  3C35 A;  3FJG A;  3KJT A;  2O6A A;  3RGY A;  4I62 A;  3O6G A;  2NWJ A;  3VLV A;  5AA2 A;  3HHG A;  3CHG A;  3FZV A;  1IIT A;  3QUJ A;  3SEX A;  2XXV A;  1LBC A;  1LB8 A;  3PUW E;  2ONS A;  1PDA A;  4H1X A;  1O7T A;  2Q88 A;  1ZKB A;  3CR9 A;  3KSJ A;  4G68 B;  3WAE A;  2RIN A;  3IB2 A;  4OYV A;  1JEV A;  3HPI A;  1URG A;  4G2Z A;  1AIV A;  4OHN A;  2Q89 A;  4F3S A;  2ZYO A;  3SER A;  3HHF A;  3IO6 A;  1N0T A;  1N04 A;  2F78 A;  2F97 A;  4ECF A;  1NNF A;  2HCA A;  3CRB A;  3RTF B;  2Y7R A;  2DWH A;  5A5X A;  3ILT B;  3OXN A;  3OO6 A;  4IB2 A;  3M3F A;  3RPW A;  1ZIU A;  1JEU A;  1FQB A;  5H8H B;  3FJM A;  2QS1 A;  2DE3 A;  1MS7 A;  1TWY A;  3VLU A;  3H03 A;  4LZ8 A;  1HSL A;  2HFB A;  4LUB A;  1FQE A;  1XC1 A;  3HCQ A;  3GBB A;  4PP0 A;  4F18 A;  3VVD A;  4ZEF A;  3FXQ A;  2OCU A;  2O84 X;  2Z8F A;  2RC7 A;  3C31 A;  4O3C A;  1GV8 A;  4KCC A;  4OMB A;  3DLN A;  4LVQ A;  2XXP A;  1JET A;  1IZ1 A;  3HO7 A;  4EDP A;  2I0B A;  2R9J A;  5B70 A;  1PB7 A;  1LGB C;  3L6G A;  4F2Q A;  1B4H A;  3KFM A;  3C32 A;  2HQ0 A;  4FEB A;  3UOR A;  1VR5 A;  3FVN A;  1EH3 A;  4FOR A;  3UN6 A;  1MY0 A;  3PUV E;  3OEM A;  4Q5T A;  3B6T A;  4G8M A;  1D3K A;  5CBR A;  4P11 A;  3H7M A;  4YZZ A;  4OFJ A;  4NWD A;  1BIY A;  4RA1 A;  5K2X A;  5DTB A;  3UIF A;  3SEW A;  2AIX A;  2ONR A;  4NMY A;  1A8F A;  4GL0 A;  1B3G A;  1B7H A;  3HN0 A;  4JXI A;  3OO8 A;  1Y4C A;  4G77 A;  5CC2 A;  4UAC A;  5FHN A;  1EZP A;  5I57 A;  2QMW A;  1R9Q A;  4QSC A;  4IO3 A;  4IY5 A;  2P1S A;  1IXC A;  5BWJ A;  1FQD A;  2UVI A;  3MZB A;  3KG2 A;  3OSQ A;  1AH5 A;  4GXA A;  5I2N B;  4LZ7 A;  1SYH A;  4GQO A;  1M5C A;  3QYT A;  1IIW A;  2DVC A;  1AMF A;  1MXY A;  4F3B A;  3K2D A;  2FA7 A;  2I6E A;  3PGF A;  5CMM A;  1UTB B;  5ITP A;  4E0X A;  5FTH A;  5I59 B;  3IB1 A;  5TU0 A;  1UQW A;  1Y3P A;  3IOT A;  2E1S A;  3SET A;  5F1Q A;  3MZ9 A;  3MUQ A;  4YB6 A;  3O66 A;  5CM6 A;  1UTH A;  2WKY A;  4LAT A;  3TPA A;  3KOS A;  4TLL B;  1LAH E;  1M5E A;  4I8C A;  1MXU A;  3LSL A;  2LAO A;  4QFK A;  1DTG A;  4YKK A;  2XXI A;  3U1O A;  4KYD A;  4BDN A;  3TFL A;  5IAI A;  4ZEI A;  3FXR A;  4KD5 A;  1LAF E;  4JSO A;  1FQF A;  3CSG A;  4WED A;  1O64 A;  3QSL A;  1R6Z A;  4H0W A;  1RYX A;  3BKI B;  2RKM A;  1MXW A;  4F2O A;  2ZYK A;  3T96 B;  2DVZ A;  4POW A;  4KYE A;  5DVF A;  1H44 A;  1D9Y A;  1MRP A;  4AB5 A;  3MPK A;  2UYF A;  3VDF A;  5CMB A;  1QKA A;  2ALU A;  1NL5 A;  3U72 A;  1PBP A;  5JTY B;  1JW1 A;  4YIC A;  5CBS A;  3O6P A;  4RPO A;  4R9G A;  1FW0 A;  4H67 A;  5I56 B;  2B4L A;  1ATG A;  1MQG A;  1P1U A;  3K00 A;  2GRV A;  3S2V A;  2BJJ X;  2F6P A;  3E4R A;  4F29 A;  1B51 A;  4C0R A;  3ECR A;  3CFX A;  1SBP A;  3ZKL A;  4UA8 A;  4IGR A;  5AA4 B;  4R75 A;  3IX1 A;  2M8C A;  3S9N C;  3VFJ A;  4RK9 A;  4NF5 B;  1MG1 A;  5K2Y A;  2F7C A;  3E3K A;  2V3U A;  3OEL A;  4R73 A;  3TTL A;  4RY1 A; 
#chains in the Genus database with same CATH topology
 3DP4 A;  3E9X A;  3EPE A;  2UVH A;  4QFO A;  2A5T A;  4ELP A;  1SW1 A;  4NE4 A;  3KN7 A;  1B1X A;  4P1L A;  1MM7 A;  2ZYM A;  3T9V A;  4WKM A;  3OD7 A;  3TQW A;  5I2K A;  3FVK A;  3FAS A;  1GVC A;  1XVX A;  5EYG A;  4ONY A;  2UYE A;  4JWX A;  4NF6 A;  1SD3 A;  3KGC A;  1FCK A;  4JVC A;  4KHZ E;  5KDT A;  2DP8 A;  3H3G A;  1DSN A;  4KCD A;  5I58 B;  1FTK A;  3T9X B;  3IOR A;  2Q9T A;  3RUM A;  2Y7P A;  2R6G E;  5L9S A;  1B2H A;  5DW8 A;  3MWB A;  4Q8R A;  1Y4T A;  1O63 A;  1UIU A;  1FPG A;  3IJX B;  3VLW A;  3FBP A;  2HPG A;  4ELQ A;  5LOM A;  1NH8 A;  2Q8M A;  1D9V A;  5IZ3 B;  2XXQ A;  3HST A;  3VXC A;  3LSF B;  4LN5 A;  2X7P A;  5AE4 A;  3PPP A;  1RDY A;  1Y1M A;  4EUO A;  1DMB A;  2V25 A;  4GX6 A;  2GHA A;  1AL3 A;  3VXB A;  4QHQ A;  3H06 B;  1Z7N E;  3FXU A;  2P3V A;  3Q27 A;  3TTR A;  4OVT A;  1NV1 A;  5A5X B;  5F7V A;  3A3U A;  3C33 A;  4O3B A;  4KXP A;  4MFI A;  3DRK A;  3B7D A;  3KN8 A;  5J1D A;  5B7D A;  1II5 A;  4HE1 A;  1NV5 A;  2I48 A;  4H46 A;  2H98 A;  5IZ1 A;  5ITO A;  1SVX B;  1B5J A;  5DVJ A;  4PE5 B;  3DRF A;  1USY E;  3PPN A;  4PAF A;  4XKQ A;  4P8B A;  2VHA A;  2VOZ A;  5KCJ A;  1B0H A;  3RYA A;  3FD3 A;  4RPN A;  5EQ9 A;  4EF2 A;  1CE2 A;  4FIM A;  4IO6 A;  1MY1 A;  5TPA A;  3PMV A;  3VV5 A;  1MDQ A;  1DPP A;  4AS4 A;  2YPN A;  4X8R A;  4ZDM A;  2F6G A;  3DRG A;  1VFD A;  3ZKK A;  4TOZ A;  1SW5 A;  4IR8 A;  1Z7M E;  4R9F A;  4G4P A;  4RNS A;  4R2F A;  4QRZ A;  1B58 A;  3BFU A;  5H8F A;  3M8U A;  3S4U A;  1PBQ A;  3C36 A;  1QKB A;  1FBD A;  4ZS9 A;  1M5F A;  2H4I A;  4JWY A;  4NED A;  4MNP A;  2ZZW A;  2HXW A;  4NG7 A;  1Y3Q A;  4NF8 A;  3MVZ A;  3RYB A;  1NV2 A;  4N13 A;  3T93 B;  4XKR A;  5EYH A;  2RF1 A;  2F5X A;  1H45 A;  3U94 A;  4XIG Q;  1LBY A;  3SDF A;  2IA4 A;  4PET A;  4TQU Q;  1B3L A;  2AL5 A;  4YKP A;  1P1O A;  5ET6 A;  4I3Y A;  2HHM A;  4GL8 A;  1OMP A;  2B3F A;  4K3F A;  3TKD A;  2E0S A;  1M5D A;  1F9B A;  2X7Q A;  3K02 A;  2QMX A;  4GVO A;  1BKA A;  1S50 A;  2Y7I A;  4YU0 A;  1OLC A;  1EZO A;  1I6A A;  1P1N A;  5I57 B;  2IEE A;  2YJP A;  1M5B A;  3LUY A;  3MBP A;  2ZXT A;  3K1P A;  3OO9 A;  5CMC A;  1KWH A;  1EYK A;  2DQV A;  4OVJ A;  2Z22 A;  2CMO A;  2FHY A;  2A5S A;  1OVB A;  1NUW A;  4YB5 A;  1SPI A;  1I69 A;  4Q30 B;  2RC8 A;  3G3K A;  3MP1 A;  2XWI A;  1DPE A;  4XXU A;  1H43 A;  3TZA A;  4EQ9 A;  1VSO A;  3IL1 B;  4RK2 A;  4QFP A;  1NUX A;  4GXS B;  3W15 C;  2I4C A;  1MH3 A;  1YCJ A;  3DRH A;  3KC0 A;  3CFL A;  4DIG A;  2WYK A;  4Z7E A;  3N6T A;  1OLA A;  2H99 A;  3TCG A;  4PDH A;  3T22 A;  3RPL A;  4UAB A;  1ANF A;  1I6Q A;  4YAH X;  3H6W A;  1B0L A;  4N4U A;  3IOV A;  1AOV A;  1Y9U A;  3IOU A;  1BP5 A;  4X1D A;  2KR0 A;  4N6P A;  1T0K A;  1FJ9 A;  4P0G A;  1XT8 A;  3GLB A;  4I1D A;  1ZTY A;  4IO7 A;  3BBR A;  5DVI A;  3MQ9 A;  3R26 A;  3B6W A;  1ZMG A;  4PQJ A;  5EHS A;  1S7Y A;  4NTL A;  5FHO A;  3G3G A;  2DE2 A;  4QBA A;  2DOJ A;  3HV1 A;  1NNP A;  4GD5 A;  1LST A;  4G68 A;  4FAT A;  2XXK A;  1SI1 A;  1XHY A;  3KZG A;  4G8N A;  4FE8 A;  3RYD A;  3OO7 A;  3B8B A;  3Q25 A;  1FTL A;  3NOH A;  3PTY A;  1FPD A;  3MJN A;  1WVJ A;  2QVR A;  4WXJ A;  2G29 A;  3ZSF A;  2ZYN A;  3H6U A;  4G68 C;  4GIZ A;  3QIM A;  2THI A;  3G3F A;  1MQI A;  3MW0 A;  1N3W A;  3T9U A;  3PV0 E;  1FBG A;  2CZI A;  3A09 A;  2L5V A;  1Q35 A;  3N26 A;  3U8Q A;  4OET A;  2UXA A;  1MPC A;  1NNT A;  5HBC A;  3O6H A;  1IMA A;  1A8E A;  2V3T A;  2P0S A;  2Y84 A;  2B4M A;  2PX1 A;  3LSW A;  3FXB A;  2OLB A;  2V84 A;  1D9Q A;  3OEN A;  2VT5 A;  1OIB A;  2W7Y A;  1SQY A;  4DI4 B;  4F19 A;  5H8N B;  3IB0 A;  3EQ1 A;  3QK6 A;  3MC2 A;  3UK4 A;  2G93 A;  1FPJ A;  4OVQ A;  1EZ9 A;  2VD2 A;  4NF4 B;  1KZ8 A;  1MXX A;  3K1M A;  1DBZ A;  4FEC A;  2XX8 A;  1FPE A;  2ZNS A;  2Z8E A;  2A5T B;  3TYH A;  3V5A A;  4QSD A;  3S9L C;  4JB7 A;  2I3V A;  3CVG A;  3TTK A;  3PPQ A;  3TAJ A;  5ET5 A;  3IJO B;  5I2K B;  1XVY A;  1IQ7 A;  4OZ9 A;  2O7I A;  1JW4 A;  2PFY A;  2AL4 A;  3G3I A;  4PDD A;  1ZU0 A;  2DXR A;  5H8Q A;  4GLI A;  1B4Z A;  4MBP A;  3E78 A;  1YYZ A;  5TP9 B;  5ET7 A;  4OWD A;  4QFN A;  4F1Y A;  1ZJL A;  4M1V A;  2REG A;  1P99 A;  4O7I A;  1GGG A;  1XOC A;  2XWO A;  4X1B A;  4X04 A;  5DEX B;  4R2B A;  4R74 A;  2O7U A;  4ISU A;  3UP9 A;  3HFU A;  2WOP A;  3B6Q A;  5HM4 B;  1MQH A;  4MJO A;  1B46 A;  4OES A;  1FTJ A;  4NHB A;  5CMK A;  2PBW A;  1A54 A;  5IZZ A;  4NWC A;  2Q8J A;  4HE0 A;  1MM6 A;  4PGP A;  2CEX A;  3P7I A;  3PPO A;  1NV0 A;  5I2N A;  3H6T A;  2H9B A;  3A3C A;  3PUX E;  4OAN A;  3B50 A;  3D4C A;  2XXH A;  3MVX A;  4GF8 A;  4BDM A;  3IFA A;  5LTC A;  1IXH A;  3D4G A;  2XD3 A;  4XF5 A;  3SZP A;  2Y5L A;  4EXK A;  1IXI A;  2Q2C A;  3F11 A;  2WEF A;  3TTM A;  3O6I A;  3UGW A;  1UTB A;  1RDZ A;  3EF7 A;  3FIR A;  1H3D A;  3FVO A;  2VGQ A;  4MNI A;  3TEP A;  4F1V A;  1Y20 A;  2D5W A;  3C34 A;  4DXB A;  5FTI A;  4JVD A;  5JEI A;  1A7L A;  2XX9 A;  1NKX A;  3KSX A;  3LC8 A;  2QRY A;  2XXT A;  1FPL A;  4JBZ A;  3K6U A;  3PAM A;  4OFL A;  4C1T A;  4OQO A;  2Q74 A;  3CG1 A;  1NFT A;  5TPA B;  2UVG A;  4NAP A;  2ONK E;  3R7X A;  2I49 A;  3TQL A;  2DE4 A;  4H5F A;  4N6D A;  4N91 A;  2O1M A;  4ZEK A;  3MP8 A;  3BIG A;  3ROJ A;  5AA2 B;  3EHU A;  4JVI A;  5H8F B;  1QUI A;  2I58 A;  3RTW B;  4N8G A;  4KR5 A;  1UIV A;  3THI A;  4DCY A;  3DEL B;  1QUJ A;  2NOO A;  4IY6 A;  3IR1 A;  4HS7 A;  4DLD A;  4KQP A;  4BDR A;  1K9Y A;  1QUK A;  2XXX A;  1SW4 A;  5KZT A;  1PB9 A;  5DT6 A;  1CNQ A;  4XKP A;  1Y3N A;  2RC9 A;  2I3W A;  2H25 A;  2YLN A;  1N7X A;  4KYS A;  2DYX A;  3MP6 A;  1JVX A;  4IO5 A;  3ONM A;  5CRY A;  4NQ8 A;  3MVY A;  1URD A;  4ZE8 A;  4OFO A;  4YKI A;  1B05 A;  1P1W A;  3RT8 A;  3EHT A;  4BLA A;  4BDQ A;  5I56 A;  1R9L A;  4MNC A;  3S9M C;  4E0W A;  5ICQ A;  2PVU A;  4DCX A;  3I5O A;  2DSF A;  2F7B A;  2ZNT A;  5J16 A;  1SW2 A;  1MDP 1;  2KLF A;  5AA4 A;  1PB8 A;  1PEB A;  3V89 B;  3DP6 A;  4PFT A;  3M3K A;  2RCB A;  3OOA A;  4OEV A;  1TFA A;  3T0J A;  4O3A A;  3CFZ A;  1HSJ A;  1JQF A;  3RNN A;  5ICT A;  1YAE A;  4N07 A;  3EHS A;  4NF5 A;  1B1H A;  3W9W A;  4NN3 A;  3FUZ A;  4GWX A;  3TTN A;  3EKI A;  3E79 A;  3TOD A;  5AA3 A;  1NNK A;  3RQT A;  2WOK A;  2OWZ A;  4HCY A;  3S9E A;  3H6V A;  1FTO A;  4OTE A;  3FV2 A;  3RY3 A;  1B6H A;  4IO4 A;  3RPL B;  3CI8 A;  1NMU A;  1MY3 A;  4THI A;  3QUF A;  2OWT A;  3EN3 A;  5IM2 A;  4JWO A;  4H6D A;  1KA0 A;  2ZNU A;  3SEY A;  4P56 A;  1B40 A;  2B3B A;  1RYO A;  4X9T A;  4U4X A;  3VE1 B;  2QJE A;  2DWA A;  5I58 A;  2O51 A;  1WOD A;  1POY 1;  4X48 A;  2GHB A;  2UVJ A;  1IEJ A;  3FAT A;  3JZJ A;  4N6K A;  4F3P A;  3H4Z A;  2QFL A;  4H5G A;  1LAX A;  3MVW A;  2ABH A;  5T3J A;  3JV9 A;  4U1Z A;  1USY H;  4IO2 A;  1MPD A;  1FQC A;  1WDN A;  4ZEC A;  4P9K A;  1FJ6 A;  3K1N A;  5IZ3 A;  3SES A;  4DZ1 A;  5I84 A;  2HAV A;  5FHM A;  2DDK A;  1LFG A;  4OER A;  2ESN A;  4LA9 A;  1TT1 A;  1TFD A;  2V3Q A;  1N7W A;  3IOW A;  1J1N A;  3G7W A;  3G3H A;  4GWO A;  1IMC A;  5CI5 A;  3RLF E;  1QUL A;  1INP A;  2F36 A;  3QAX A;  1QGX A;  4U21 A;  3MAM A;  1B3E A;  2ANJ A;  1NUY A;  4TLM B;  3K6W A;  1URS A;  1VFE A;  1QVS A;  4R6H A;  5A5L A;  1NV4 A;  3Q29 A;  1NV3 A;  3VVF A;  3ILU B;  2XX7 A;  1B5I A;  4N15 A;  1FQA A;  4PC9 A;  4GWW A;  3PMW A;  1JNF A;  4MF3 A;  2ZZV A;  5L9M A;  1L5T A;  2JJK A;  2R71 A;  3K6V A;  3GZG A;  4LQ2 A;  2FYI A;  3K0V A;  3CG3 A;  4GWS A;  2I0C A;  4HE2 A;  1K9Z A;  3KBR A;  4GX3 A;  4LZ5 A;  4XKN A;  4ESW A;  2ZZX A;  3RT6 B;  2F7A A;  1MY4 A;  4U23 A;  4ELO A;  4U2R A;  1MXZ A;  3BFT A;  3PU5 A;  1AWB A;  1B7U A;  1XI6 A;  1BK4 A;  3KOT A;  5EQ8 A;  1UTH B;  2QS2 A;  4GWU A;  4U22 A;  2DS9 A;  2DXY A;  1DCU A;  1B52 A;  2O68 A;  1EU8 A;  1Q9D A;  3PPR A;  3U65 A;  3O28 A;  2D21 A;  2QS3 A;  4DDD A;  3D1R A;  3DP8 A;  3LVU A;  4EXL A;  1JP4 A;  2HZL A;  3N5L A;  1FTM A;  4NGU A;  2NXO A;  1MQD A;  1N3X A;  2VP1 A;  4RJZ A;  3T9H B;  2GFE A;  5EYF A;  5H8Q B;  3OEK A;  5AA1 A;  1GTK A;  1RDX A;  4DXU A;  5EQA A;  4Q0C A;  1B3F A;  2WBB A;  4PBQ A;  4OEU A;  1VDW A;  3T66 A;  4DXC A;  3C4M A;  1SI0 A;  2OBG A;  4F39 A;  2Q2A A;  1POT A;  3VVE A;  2Z23 A;  4GOT A;  3A29 A;  4GRK A;  4U4S A;  5L9O A;  5DYH A;  3R6U A;  4F3G A;  2O1L A;  3G3J A;  2DWI A;  1LBB A;  3M3L A;  4H45 A;  2HEU A;  5H8H A;  3DM0 A;  4F22 A;  4H8I A;  3UA8 A;  3L6H A;  2H5Y A;  1ZLQ A;  2Y7K A;  2D3I A;  4ND9 A;  4MIJ A;  1LB9 A;  3ZS6 A;  1B3H A;  2FVZ A;  1MQJ A;  3IAZ A;  2PYY A;  1JVY A;  4MLV A;  3AXF A;  3U92 A;  4XFE A;  4GWY A;  1LFI A;  4OXV A;  4YKJ A;  2QSX A;  3LR1 A;  4N81 A;  4PFR A;  3IK6 B;  1ZBM A;  4WEP A;  3E13 X;  4XTC Q;  2OJT A;  1JW5 A;  5EQ7 A;  5IGA A;  3BIH A;  1R1N A;  2QPQ A;  2VPN A;  4GBW A;  1S9T A;  4ESX A;  4ZEB A;  3U93 A;  1US5 A;  1LEV A;  4I40 A;  2XXR A;  3QXM A;  4P47 A;  3SKP A;  4YMA A;  4DE8 A;  1MXV A;  2Y7W A;  3V8X B;  4ZZE A;  3LSX A;  1N76 A;  4NF6 B;  2DWJ A;  3Q28 A;  1RKM A;  5KDT B;  2FNC A;  2FIE A;  4EQ7 A;  4AQ4 A;  1G0H A;  3ODB A;  5H8S A;  4GFR A;  4HCW A;  2OK2 A;  4N17 A;  3C9H A;  3Q26 A;  3K01 A;  4NF0 A;  4BDO A;  3O97 A;  4RXL A;  2XWV A;  5I3S A;  4PFU A;  3CIJ A;  1LBZ A;  1FBH A;  1LBW A;  4L17 A;  2VD3 A;  4HTG A;  4BDL A;  2XD2 A;  1LAG E;  4IGT A;  4QF9 A;  4JDF A;  2CZH A;  1QW0 A;  4OEN A;  4YMB A;  4Z0I A;  4U1O A;  3FV1 A;  4HXV A;  2QL3 A;  2F34 A;  4PFY A;  1FBC A;  1EYJ A;  3I6V A;  3WAF A;  5ISU A;  1MH4 A;  1BTJ A;  3TEL A;  3PUY E;  3PMX A;  1LCF A;  4P1E A;  4H8J A;  1OQH A;  4AB6 A;  3USD A;  4QFL A;  2WOL A;  4EQB A;  4GWZ A;  3N6U A;  5BUU A;  4ZED A;  1US4 A;  3MST A;  5LDZ A;  4QXD A;  3FGS A;  3GXA A;  3I3V A;  2NVU B;  3KC1 A;  3KEI A;  3LV0 A;  3GBA A;  1OVT A;  4PFW A;  4OVR A;  4PCD A;  3RN8 A;  2XXW A;  4G8H A;  3TUS A;  1H76 A;  3KN3 A;  5I5P A;  1LCT A;  1LFH A;  1FPB A;  1Y1Z A;  1DK4 A;  1NH7 A;  4EF1 A;  4OVP A;  2HXR A;  2O69 A;  1HSE A;  2HAU A;  2XWK A;  3PD8 A;  4F31 B;  5H8N A;  1MY2 A;  2OZZ A;  5I59 A;  4R6Y A;  2XXU A;  1B5H A;  4KFQ A;  2KQZ A;  3TCF A;  4NF4 A;  5KCJ B;  1A55 A;  2XXY A;  1G0I A;  2P2A A;  1B9J A;  4ZZA A;  4PAK A;  5JK4 A;  3QMF A;  4ELR A;  1QJM A;  3MPL A;  4FED A;  2AYS A;  3LUZ A;  2PMS A;  1P1Q A;  3JYR A;  3O29 A;  3PUZ E;  4KPT A;  3K6X A;  1GR2 A;  3O2A A;  1I6B A;  1N84 A;  5AA2 D;  2PT1 A;  2GQ1 A;  4OVS A;  1B32 A;  3FJ7 A;  2B65 A;  3V83 A;  1DTZ A;  2V93 A;  1D4N A;  1CB6 A;  1OQG A;  1ELJ A;  4NF8 B;  2X26 A;  1NV7 A;  3OMB A;  2F8D A;  5TP9 A;  2QVU A;  3TMG A;  4KI0 E;  4FAJ A;  1BLF A;  5M2V A;  4POX A;  5L8D A;  2VPO A;  4LON B;  3IO4 A;  1B7Z A;  4QSE A;  3CSB A;  5IKB A;  4ZE9 A;  2NUV A;  4O7M A;  5ELV A;  3PD9 A;  4C1U A;  1TXF A;  3TCH A;  4R6K A;  4MMP A;  3KJ7 A;  4I9D A;  3SEV A;  2ZMB A;  3SEU A;  3DRJ A;  1YPN A;  5DEX A;  4RYA A;  5HPQ A;  5JTY A;  4LP2 B;  4MLQ A;  4R72 A;  2F3D A;  4PBH A;  4P0I A;  1A99 A;  4M4G A;  1FBF A;  2XHD A;  4PFI A;  1LLS A;  1NUZ A;  1VE4 A;  4MAG A;  4MH5 A;  3FVG A;  1IUD A;  1DOT A;  1PC3 A;  2Z8D A;  2XA5 A;  3N94 A;  2PT2 A;  3O9P A;  1XS5 A;  2GH9 A;  2PFZ A;  4HW8 A;  1YTV A;  2I4B A;  4H65 A;  1SDX A;  3LBS A;  5EHM A;  3K4U A;  1Q1K A;  4JSD A;  1IMD A;  3MYU A;  3MZ1 A;  2HZK A;  4LQ5 A;  4YB7 A;  3W9V A;  1IMF A;  2REJ A;  1IXG A;  1A40 A;  4PE3 A;  1FSA A;  1SYI A;  1MPB A;  2OWS A;  3DRI A;  2QS4 A;  2RCA A;  2F35 A;  3TDJ A;  3OSR A;  4FJP A;  3FTO A;  4F1U A;  4MCO A;  2CZL A;  3C35 A;  3FJG A;  2BJI A;  3KJT A;  5ESY A;  2O6A A;  4OA4 A;  3RGY A;  4I62 A;  2PCR A;  3O6G A;  2NWJ A;  3VLV A;  5AA2 A;  3HHG A;  3CHG A;  3FZV A;  1IIT A;  3QUJ A;  3SEX A;  2XXV A;  1LBC A;  1LB8 A;  4MX6 A;  3PUW E;  2ONS A;  1PDA A;  4H1X A;  1O7T A;  2Q88 A;  1ZKB A;  2OX3 A;  3CR9 A;  3KSJ A;  4G68 B;  3WAE A;  2F3B A;  2RIN A;  3IB2 A;  3KBZ A;  4OYV A;  4PGN A;  1NI9 A;  1IMB A;  1JEV A;  3HPI A;  2MKZ A;  4AS5 A;  1URG A;  3T1B A;  4G2Z A;  1AIV A;  4OHN A;  2Q89 A;  4F3S A;  2ZYO A;  3SER A;  3HHF A;  3IO6 A;  1N0T A;  1FPK A;  1N04 A;  2F78 A;  2F97 A;  1FTA A;  4ECF A;  1NNF A;  2HCA A;  3CRB A;  3RTF B;  2Y7R A;  2DWH A;  4PTK A;  5A5X A;  1EYI A;  3ILT B;  3OXN A;  3OO6 A;  4IB2 A;  3M3F A;  3RPW A;  1ZIU A;  1JEU A;  1FQB A;  5H8H B;  3FJM A;  2QS1 A;  4PAI A;  5ET8 A;  1KA1 A;  2DE3 A;  1MS7 A;  1TWY A;  3VLU A;  3H03 A;  4LZ8 A;  1HSL A;  2HFB A;  1LBX A;  2V4C A;  2WX9 A;  4LUB A;  1FQE A;  1XC1 A;  3HCQ A;  3GBB A;  4PP0 A;  4F18 A;  3VVD A;  4ZEF A;  3FXQ A;  2Y5K A;  2OCU A;  2O84 X;  2Z8F A;  2RC7 A;  3C31 A;  4O3C A;  1GV8 A;  1FBE A;  4KCC A;  4OMB A;  3DLN A;  4LVQ A;  2XXP A;  1JET A;  1IZ1 A;  3HO7 A;  4EDP A;  2I0B A;  2R9J A;  1YZ0 A;  5B70 A;  1PB7 A;  1LGB C;  2WYP A;  3L6G A;  4F2Q A;  1B4H A;  2R8T A;  3KFM A;  3C32 A;  2HQ0 A;  4FEB A;  3UOR A;  1VR5 A;  3FVN A;  1EH3 A;  4FOR A;  3UN6 A;  5I7I A;  1MY0 A;  3PUV E;  3OEM A;  4Q5T A;  3B6T A;  4PF8 A;  4G8M A;  1D3K A;  5CBR A;  4P11 A;  3H7M A;  4YZZ A;  4OFJ A;  4NWD A;  1IME A;  1BIY A;  4RA1 A;  5K2X A;  5DTB A;  3UIF A;  3SEW A;  2AIX A;  2ONR A;  4NMY A;  4N8Y A;  1A8F A;  4GL0 A;  1B3G A;  1B7H A;  3HN0 A;  4JXI A;  4XEQ A;  4FBP A;  2CEY A;  3OO8 A;  1Y4C A;  4G77 A;  5CC2 A;  4UAC A;  5FHN A;  1EZP A;  5I57 A;  4P3L A;  2QMW A;  1R9Q A;  4QSC A;  4IO3 A;  4IY5 A;  2P1S A;  1IXC A;  5BWJ A;  5FBP A;  1FQD A;  2UVI A;  3MZB A;  3KG2 A;  3OSQ A;  1FBP A;  1AH5 A;  4GXA A;  4PFB A;  5I2N B;  4LZ7 A;  1SYH A;  4GQO A;  1M5C A;  3QYT A;  1IIW A;  2DVC A;  4O8M A;  1AMF A;  1MXY A;  4F3B A;  3K2D A;  4DI3 D;  2FA7 A;  2I6E A;  3PGF A;  3GYY A;  1LBV A;  5CMM A;  1UTB B;  5ITP A;  2P3N A;  4E0X A;  2WBD A;  5FTH A;  5I59 B;  3IB1 A;  4PF6 A;  5TU0 A;  1UQW A;  1Y3P A;  3IOT A;  2E1S A;  3SET A;  5F1Q A;  3MZ9 A;  3MUQ A;  4YB6 A;  2FBP A;  3O66 A;  5CM6 A;  1UTH A;  2WKY A;  3IFC A;  4LAT A;  2QVV A;  3TPA A;  3KOS A;  4TLL B;  1LAH E;  1M5E A;  4I8C A;  1MXU A;  3LSL A;  2LAO A;  4G61 A;  4QFK A;  1DTG A;  4YKK A;  2XXI A;  3U1O A;  4KYD A;  4BDN A;  3TFL A;  5IAI A;  4NX1 A;  4ZEI A;  3FXR A;  4KD5 A;  1LAF E;  1NV6 A;  4JSO A;  1FQF A;  3CSG A;  4WED A;  1O64 A;  1FRP A;  3QSL A;  1R6Z A;  2CZK A;  4O94 A;  1FPF A;  4H0W A;  1RYX A;  3BKI B;  2RKM A;  1MXW A;  3ISP A;  4I3E A;  4F2O A;  2ZYK A;  3T96 B;  2DVZ A;  4POW A;  5F24 A;  4KYE A;  5DVF A;  1H44 A;  1D9Y A;  1MRP A;  4AB5 A;  3MPK A;  2UYF A;  3VDF A;  5CMB A;  1QKA A;  2ALU A;  1FPI A;  1NL5 A;  3U72 A;  1PBP A;  4GX4 A;  4GBV A;  5JTY B;  1JW1 A;  4YIC A;  5CBS A;  3O6P A;  4RPO A;  4R9G A;  1FW0 A;  4H67 A;  5I56 B;  2B4L A;  1ATG A;  1MQG A;  1P1U A;  3K00 A;  2GRV A;  3S2V A;  2BJJ X;  2F6P A;  2FIX A;  3E4R A;  4F29 A;  1B51 A;  4C0R A;  3ECR A;  3CFX A;  1SBP A;  3ZKL A;  4UA8 A;  4MEV A;  1YXI A;  4IGR A;  4R75 A;  5AA4 B;  3IX1 A;  2M8C A;  3S9N C;  3VFJ A;  4RK9 A;  4NF5 B;  1MG1 A;  4MHF A;  5K2Y A;  2F7C A;  3E3K A;  2V3U A;  3OEL A;  4R73 A;  3TTL A;  4RY1 A; 
#chains in the Genus database with same CATH homology
 3DP4 A;  3E9X A;  3EPE A;  2UVH A;  4QFO A;  2A5T A;  4ELP A;  1SW1 A;  4NE4 A;  3KN7 A;  1B1X A;  1MM7 A;  2ZYM A;  3T9V A;  4WKM A;  3OD7 A;  3TQW A;  5I2K A;  3FVK A;  3FAS A;  1GVC A;  1XVX A;  4ONY A;  2UYE A;  4JWX A;  4NF6 A;  1SD3 A;  3KGC A;  1FCK A;  4KHZ E;  5KDT A;  2DP8 A;  3H3G A;  1DSN A;  4KCD A;  5I58 B;  1FTK A;  3T9X B;  3IOR A;  2Q9T A;  3RUM A;  2Y7P A;  2R6G E;  5L9S A;  1B2H A;  3MWB A;  4Q8R A;  1Y4T A;  1O63 A;  1UIU A;  3IJX B;  3VLW A;  4ELQ A;  5LOM A;  1NH8 A;  1D9V A;  2XXQ A;  3HST A;  3VXC A;  3LSF B;  2X7P A;  5AE4 A;  3PPP A;  1Y1M A;  4EUO A;  1DMB A;  2V25 A;  2GHA A;  1AL3 A;  3VXB A;  4QHQ A;  3H06 B;  1Z7N E;  3FXU A;  3Q27 A;  3TTR A;  5A5X B;  5F7V A;  3A3U A;  3C33 A;  4O3B A;  4MFI A;  3DRK A;  3B7D A;  3KN8 A;  5J1D A;  5B7D A;  1II5 A;  2I48 A;  2H98 A;  5ITO A;  1SVX B;  1B5J A;  5DVJ A;  4PE5 B;  3DRF A;  1USY E;  3PPN A;  4XKQ A;  2VHA A;  2VOZ A;  5KCJ A;  1B0H A;  3RYA A;  3FD3 A;  4RPN A;  4EF2 A;  1CE2 A;  4FIM A;  4IO6 A;  1MY1 A;  5TPA A;  3PMV A;  3VV5 A;  1MDQ A;  1DPP A;  2YPN A;  4ZDM A;  2F6G A;  3DRG A;  1VFD A;  3ZKK A;  4TOZ A;  1SW5 A;  1Z7M E;  4R9F A;  4G4P A;  4RNS A;  4R2F A;  4QRZ A;  1B58 A;  3BFU A;  5H8F A;  3M8U A;  3S4U A;  1PBQ A;  3C36 A;  1QKB A;  4ZS9 A;  1M5F A;  2H4I A;  4JWY A;  4NED A;  2HXW A;  1Y3Q A;  4NF8 A;  3MVZ A;  3RYB A;  4N13 A;  3T93 B;  4XKR A;  2RF1 A;  2F5X A;  1H45 A;  3U94 A;  4XIG Q;  3SDF A;  2IA4 A;  4PET A;  4TQU Q;  1B3L A;  2AL5 A;  4YKP A;  1P1O A;  4GL8 A;  1OMP A;  2B3F A;  4K3F A;  3TKD A;  2E0S A;  1M5D A;  1F9B A;  2X7Q A;  3K02 A;  2QMX A;  4GVO A;  1BKA A;  1S50 A;  2Y7I A;  4YU0 A;  1OLC A;  1EZO A;  1I6A A;  1P1N A;  5I57 B;  2IEE A;  2YJP A;  1M5B A;  3LUY A;  3MBP A;  2ZXT A;  3K1P A;  3OO9 A;  5CMC A;  1KWH A;  2DQV A;  4OVJ A;  2Z22 A;  2CMO A;  2A5S A;  1OVB A;  4YB5 A;  1I69 A;  4Q30 B;  2RC8 A;  3G3K A;  3MP1 A;  1DPE A;  4XXU A;  1H43 A;  3TZA A;  4EQ9 A;  1VSO A;  3IL1 B;  4RK2 A;  4QFP A;  4GXS B;  3W15 C;  2I4C A;  1MH3 A;  1YCJ A;  3DRH A;  3CFL A;  4DIG A;  4Z7E A;  3N6T A;  1OLA A;  2H99 A;  3TCG A;  3T22 A;  1ANF A;  1I6Q A;  4YAH X;  3H6W A;  1B0L A;  3IOV A;  1AOV A;  1Y9U A;  3IOU A;  1BP5 A;  4X1D A;  4N6P A;  1T0K A;  4P0G A;  1XT8 A;  3GLB A;  4I1D A;  1ZTY A;  4IO7 A;  3BBR A;  5DVI A;  3MQ9 A;  3R26 A;  3B6W A;  1ZMG A;  4PQJ A;  5EHS A;  1S7Y A;  4NTL A;  5FHO A;  3G3G A;  2DE2 A;  2DOJ A;  3HV1 A;  1NNP A;  4GD5 A;  1LST A;  4G68 A;  4FAT A;  1SI1 A;  1XHY A;  3KZG A;  4G8N A;  4FE8 A;  3OO7 A;  3Q25 A;  1FTL A;  3MJN A;  1WVJ A;  4WXJ A;  2G29 A;  3ZSF A;  2ZYN A;  3H6U A;  4G68 C;  4GIZ A;  3QIM A;  2THI A;  3G3F A;  1MQI A;  3MW0 A;  1N3W A;  3T9U A;  3PV0 E;  3A09 A;  1Q35 A;  3N26 A;  3U8Q A;  4OET A;  2UXA A;  1MPC A;  1NNT A;  5HBC A;  3O6H A;  1A8E A;  2V3T A;  2P0S A;  2Y84 A;  2B4M A;  2PX1 A;  3LSW A;  2OLB A;  2V84 A;  3OEN A;  1OIB A;  2W7Y A;  1SQY A;  4F19 A;  5H8N B;  3IB0 A;  3EQ1 A;  3QK6 A;  3MC2 A;  3UK4 A;  2G93 A;  1EZ9 A;  2VD2 A;  4NF4 B;  1MXX A;  3K1M A;  4FEC A;  2XX8 A;  2ZNS A;  2Z8E A;  2A5T B;  3TYH A;  3V5A A;  4QSD A;  3S9L C;  4JB7 A;  2I3V A;  3CVG A;  3TTK A;  3PPQ A;  3TAJ A;  3IJO B;  5I2K B;  1XVY A;  1IQ7 A;  4OZ9 A;  2O7I A;  1JW4 A;  2AL4 A;  3G3I A;  1ZU0 A;  2DXR A;  5H8Q A;  4GLI A;  1B4Z A;  4MBP A;  5TP9 B;  4OWD A;  4QFN A;  4F1Y A;  1ZJL A;  4M1V A;  2REG A;  1P99 A;  1GGG A;  1XOC A;  4X1B A;  5DEX B;  4R2B A;  4R74 A;  2O7U A;  4ISU A;  3UP9 A;  2WOP A;  3B6Q A;  5HM4 B;  1MQH A;  1B46 A;  4OES A;  1FTJ A;  5CMK A;  2PBW A;  1A54 A;  4NWC A;  2Q8J A;  1MM6 A;  3PPO A;  3P7I A;  5I2N A;  3H6T A;  2H9B A;  3A3C A;  3PUX E;  3D4C A;  2XXH A;  3MVX A;  4GF8 A;  4BDM A;  1IXH A;  3D4G A;  2XD3 A;  4EXK A;  1IXI A;  2Q2C A;  3F11 A;  3TTM A;  3O6I A;  3UGW A;  1UTB A;  3FIR A;  3EF7 A;  1H3D A;  3FVO A;  2VGQ A;  3TEP A;  4F1V A;  1Y20 A;  2D5W A;  3C34 A;  4DXB A;  5FTI A;  5JEI A;  1A7L A;  2XX9 A;  1NKX A;  3KSX A;  3LC8 A;  2QRY A;  2XXT A;  4JBZ A;  3K6U A;  3PAM A;  4OFL A;  4C1T A;  4OQO A;  3CG1 A;  1NFT A;  5TPA B;  2UVG A;  2ONK E;  3R7X A;  2I49 A;  3TQL A;  2DE4 A;  4H5F A;  2O1M A;  5AA2 B;  4ZEK A;  3MP8 A;  3EHU A;  5H8F B;  1QUI A;  2I58 A;  3RTW B;  4KR5 A;  1UIV A;  3THI A;  4DCY A;  3DEL B;  1QUJ A;  2NOO A;  4IY6 A;  3IR1 A;  4HS7 A;  4DLD A;  4KQP A;  4BDR A;  2XXX A;  1QUK A;  1SW4 A;  5KZT A;  1PB9 A;  5DT6 A;  4XKP A;  1Y3N A;  2RC9 A;  2I3W A;  2H25 A;  2YLN A;  1N7X A;  4KYS A;  2DYX A;  3MP6 A;  1JVX A;  4IO5 A;  3ONM A;  5CRY A;  3MVY A;  1URD A;  4ZE8 A;  4OFO A;  4YKI A;  1B05 A;  1P1W A;  3RT8 A;  3EHT A;  4BLA A;  4BDQ A;  5I56 A;  1R9L A;  3S9M C;  4E0W A;  5ICQ A;  2PVU A;  4DCX A;  3I5O A;  2DSF A;  2F7B A;  2ZNT A;  1SW2 A;  1MDP 1;  2KLF A;  5AA4 A;  1PB8 A;  1PEB A;  3V89 B;  3DP6 A;  4PFT A;  3M3K A;  2RCB A;  3OOA A;  4OEV A;  1TFA A;  4O3A A;  3CFZ A;  1HSJ A;  1JQF A;  3RNN A;  5ICT A;  1YAE A;  4N07 A;  3EHS A;  4NF5 A;  1B1H A;  3W9W A;  3FUZ A;  3TTN A;  3TOD A;  5AA3 A;  1NNK A;  3RQT A;  2WOK A;  4HCY A;  3S9E A;  3H6V A;  1FTO A;  4OTE A;  3FV2 A;  3RY3 A;  1B6H A;  4IO4 A;  3CI8 A;  1NMU A;  1MY3 A;  4THI A;  3QUF A;  2OWT A;  3EN3 A;  4JWO A;  4H6D A;  3SEY A;  2ZNU A;  1B40 A;  2B3B A;  1RYO A;  4X9T A;  4U4X A;  3VE1 B;  2QJE A;  2DWA A;  5I58 A;  2O51 A;  1WOD A;  1POY 1;  4X48 A;  2GHB A;  2UVJ A;  1IEJ A;  3FAT A;  3JZJ A;  4F3P A;  3H4Z A;  4H5G A;  1LAX A;  3MVW A;  2ABH A;  3JV9 A;  4U1Z A;  1USY H;  4IO2 A;  1MPD A;  1FQC A;  1WDN A;  4ZEC A;  3K1N A;  3SES A;  4DZ1 A;  5I84 A;  2HAV A;  5FHM A;  1LFG A;  4OER A;  2ESN A;  4LA9 A;  1TT1 A;  1TFD A;  2V3Q A;  1N7W A;  3IOW A;  1J1N A;  3G7W A;  3G3H A;  4GWO A;  5CI5 A;  3RLF E;  1QUL A;  2F36 A;  3QAX A;  4U21 A;  3MAM A;  1B3E A;  2ANJ A;  4TLM B;  3K6W A;  1URS A;  1VFE A;  1QVS A;  4R6H A;  3Q29 A;  3VVF A;  3ILU B;  2XX7 A;  1B5I A;  1FQA A;  3PMW A;  1JNF A;  4MF3 A;  5L9M A;  1L5T A;  2R71 A;  3K6V A;  3GZG A;  4LQ2 A;  2FYI A;  3K0V A;  3CG3 A;  2I0C A;  3KBR A;  4LZ5 A;  4XKN A;  4ESW A;  3RT6 B;  2F7A A;  1MY4 A;  4U23 A;  4ELO A;  4U2R A;  1MXZ A;  3BFT A;  3PU5 A;  1B7U A;  3KOT A;  1UTH B;  2QS2 A;  4U22 A;  2DS9 A;  2DXY A;  1B52 A;  2O68 A;  1EU8 A;  3PPR A;  3O28 A;  2D21 A;  2QS3 A;  4DDD A;  3DP8 A;  3LVU A;  4EXL A;  2HZL A;  3N5L A;  1FTM A;  2NXO A;  1MQD A;  1N3X A;  2VP1 A;  4RJZ A;  3T9H B;  2GFE A;  5EYF A;  5H8Q B;  3OEK A;  5AA1 A;  1GTK A;  4DXU A;  4Q0C A;  1B3F A;  4OEU A;  3T66 A;  4DXC A;  3C4M A;  1SI0 A;  2OBG A;  4F39 A;  2Q2A A;  1POT A;  3VVE A;  2Z23 A;  4GOT A;  4GRK A;  4U4S A;  5L9O A;  5DYH A;  3R6U A;  4F3G A;  2O1L A;  3G3J A;  2DWI A;  1LBB A;  3M3L A;  2HEU A;  5H8H A;  3DM0 A;  4F22 A;  4H8I A;  3UA8 A;  3L6H A;  2H5Y A;  1ZLQ A;  2Y7K A;  2D3I A;  4ND9 A;  1LB9 A;  3ZS6 A;  1B3H A;  1MQJ A;  3IAZ A;  2PYY A;  1JVY A;  4MLV A;  3AXF A;  3U92 A;  1LFI A;  4OXV A;  4YKJ A;  2QSX A;  3LR1 A;  4WEP A;  3IK6 B;  1ZBM A;  3E13 X;  4XTC Q;  2OJT A;  1JW5 A;  1R1N A;  2QPQ A;  1S9T A;  4ESX A;  4ZEB A;  3U93 A;  1US5 A;  2XXR A;  3QXM A;  3SKP A;  4YMA A;  4DE8 A;  1MXV A;  2Y7W A;  3V8X B;  4ZZE A;  3LSX A;  1N76 A;  4NF6 B;  2DWJ A;  3Q28 A;  1RKM A;  5KDT B;  2FNC A;  4EQ7 A;  4AQ4 A;  3ODB A;  5H8S A;  4GFR A;  4HCW A;  2OK2 A;  3C9H A;  3Q26 A;  3K01 A;  4BDO A;  3O97 A;  4RXL A;  4PFU A;  3CIJ A;  4L17 A;  2VD3 A;  4HTG A;  4BDL A;  2XD2 A;  1LAG E;  4IGT A;  4QF9 A;  4JDF A;  1QW0 A;  4OEN A;  4YMB A;  4Z0I A;  4U1O A;  3FV1 A;  2QL3 A;  2F34 A;  4PFY A;  3I6V A;  3WAF A;  5ISU A;  1MH4 A;  1BTJ A;  3TEL A;  3PUY E;  3PMX A;  1LCF A;  4AB6 A;  4H8J A;  1OQH A;  3USD A;  4QFL A;  2WOL A;  4EQB A;  3N6U A;  5BUU A;  4ZED A;  1US4 A;  3FGS A;  3GXA A;  3I3V A;  2NVU B;  3KEI A;  3GBA A;  1OVT A;  4PFW A;  3RN8 A;  2XXW A;  4G8H A;  3TUS A;  1H76 A;  3KN3 A;  1LCT A;  1LFH A;  1Y1Z A;  1NH7 A;  4EF1 A;  2O69 A;  1HSE A;  2HAU A;  3PD8 A;  4F31 B;  5H8N A;  1MY2 A;  2OZZ A;  5I59 A;  4R6Y A;  2XXU A;  1B5H A;  4KFQ A;  3TCF A;  4NF4 A;  5KCJ B;  1A55 A;  2XXY A;  2P2A A;  1B9J A;  4ZZA A;  5JK4 A;  4ELR A;  1QJM A;  3MPL A;  4FED A;  2AYS A;  2PMS A;  1P1Q A;  3JYR A;  3O29 A;  3PUZ E;  4KPT A;  3K6X A;  1GR2 A;  3O2A A;  1I6B A;  1N84 A;  5AA2 D;  2PT1 A;  1B32 A;  3FJ7 A;  2B65 A;  3V83 A;  1DTZ A;  2V93 A;  1D4N A;  1CB6 A;  1OQG A;  1ELJ A;  4NF8 B;  2X26 A;  3OMB A;  2F8D A;  5TP9 A;  3TMG A;  4KI0 E;  4FAJ A;  1BLF A;  5M2V A;  4POX A;  5L8D A;  4LON B;  3IO4 A;  1B7Z A;  4QSE A;  3CSB A;  5IKB A;  4ZE9 A;  2NUV A;  5ELV A;  3PD9 A;  4C1U A;  1TXF A;  3TCH A;  4R6K A;  3KJ7 A;  4I9D A;  3SEV A;  2ZMB A;  3SEU A;  3DRJ A;  1YPN A;  5DEX A;  4RYA A;  5HPQ A;  5JTY A;  4LP2 B;  4MLQ A;  4R72 A;  4P0I A;  1A99 A;  4M4G A;  2XHD A;  1LLS A;  1VE4 A;  4MH5 A;  3FVG A;  1IUD A;  1DOT A;  1PC3 A;  2Z8D A;  3N94 A;  2PT2 A;  3O9P A;  1XS5 A;  2GH9 A;  4HW8 A;  1YTV A;  2I4B A;  4H65 A;  1SDX A;  3LBS A;  5EHM A;  3K4U A;  1Q1K A;  4JSD A;  3MZ1 A;  2HZK A;  4LQ5 A;  4YB7 A;  3W9V A;  2REJ A;  1IXG A;  1A40 A;  1SYI A;  1MPB A;  2OWS A;  3DRI A;  2QS4 A;  2RCA A;  2F35 A;  3TDJ A;  3OSR A;  4FJP A;  3FTO A;  4F1U A;  2CZL A;  3C35 A;  3FJG A;  3KJT A;  2O6A A;  3RGY A;  4I62 A;  3O6G A;  2NWJ A;  3VLV A;  5AA2 A;  3HHG A;  3CHG A;  3FZV A;  1IIT A;  3QUJ A;  3SEX A;  2XXV A;  1LBC A;  1LB8 A;  3PUW E;  2ONS A;  1PDA A;  4H1X A;  1O7T A;  2Q88 A;  1ZKB A;  3CR9 A;  3KSJ A;  4G68 B;  3WAE A;  2RIN A;  3IB2 A;  4OYV A;  1JEV A;  3HPI A;  1URG A;  4G2Z A;  1AIV A;  4OHN A;  2Q89 A;  4F3S A;  2ZYO A;  3SER A;  3HHF A;  3IO6 A;  1N0T A;  1N04 A;  2F78 A;  2F97 A;  4ECF A;  1NNF A;  2HCA A;  3CRB A;  3RTF B;  2Y7R A;  2DWH A;  5A5X A;  3ILT B;  3OXN A;  3OO6 A;  4IB2 A;  3M3F A;  3RPW A;  1ZIU A;  1JEU A;  1FQB A;  5H8H B;  3FJM A;  2QS1 A;  2DE3 A;  1MS7 A;  1TWY A;  3VLU A;  3H03 A;  4LZ8 A;  1HSL A;  2HFB A;  4LUB A;  1FQE A;  1XC1 A;  3HCQ A;  3GBB A;  4PP0 A;  4F18 A;  3VVD A;  4ZEF A;  3FXQ A;  2OCU A;  2O84 X;  2Z8F A;  2RC7 A;  3C31 A;  4O3C A;  1GV8 A;  4KCC A;  4OMB A;  3DLN A;  4LVQ A;  2XXP A;  1JET A;  1IZ1 A;  3HO7 A;  4EDP A;  2I0B A;  2R9J A;  5B70 A;  1PB7 A;  1LGB C;  3L6G A;  4F2Q A;  1B4H A;  3KFM A;  3C32 A;  2HQ0 A;  4FEB A;  3UOR A;  1VR5 A;  3FVN A;  1EH3 A;  4FOR A;  3UN6 A;  1MY0 A;  3PUV E;  3OEM A;  4Q5T A;  3B6T A;  4G8M A;  1D3K A;  5CBR A;  4P11 A;  3H7M A;  4YZZ A;  4OFJ A;  4NWD A;  1BIY A;  4RA1 A;  5K2X A;  5DTB A;  3UIF A;  3SEW A;  2AIX A;  2ONR A;  4NMY A;  1A8F A;  4GL0 A;  1B3G A;  1B7H A;  3HN0 A;  4JXI A;  3OO8 A;  1Y4C A;  4G77 A;  5CC2 A;  4UAC A;  5FHN A;  1EZP A;  5I57 A;  2QMW A;  1R9Q A;  4QSC A;  4IO3 A;  4IY5 A;  2P1S A;  1IXC A;  5BWJ A;  1FQD A;  2UVI A;  3MZB A;  3KG2 A;  3OSQ A;  1AH5 A;  4GXA A;  5I2N B;  4LZ7 A;  1SYH A;  4GQO A;  1M5C A;  3QYT A;  1IIW A;  2DVC A;  1AMF A;  1MXY A;  4F3B A;  3K2D A;  2FA7 A;  2I6E A;  3PGF A;  5CMM A;  1UTB B;  5ITP A;  4E0X A;  5FTH A;  5I59 B;  3IB1 A;  5TU0 A;  1UQW A;  1Y3P A;  3IOT A;  2E1S A;  3SET A;  5F1Q A;  3MZ9 A;  3MUQ A;  4YB6 A;  3O66 A;  5CM6 A;  1UTH A;  2WKY A;  4LAT A;  3TPA A;  3KOS A;  4TLL B;  1LAH E;  1M5E A;  4I8C A;  1MXU A;  3LSL A;  2LAO A;  4QFK A;  1DTG A;  4YKK A;  2XXI A;  3U1O A;  4KYD A;  4BDN A;  3TFL A;  5IAI A;  4ZEI A;  3FXR A;  4KD5 A;  1LAF E;  4JSO A;  1FQF A;  3CSG A;  4WED A;  1O64 A;  3QSL A;  1R6Z A;  4H0W A;  1RYX A;  3BKI B;  2RKM A;  1MXW A;  4F2O A;  2ZYK A;  3T96 B;  2DVZ A;  4POW A;  4KYE A;  5DVF A;  1H44 A;  1D9Y A;  1MRP A;  4AB5 A;  3MPK A;  2UYF A;  3VDF A;  5CMB A;  1QKA A;  2ALU A;  1NL5 A;  3U72 A;  1PBP A;  5JTY B;  1JW1 A;  4YIC A;  5CBS A;  3O6P A;  4RPO A;  4R9G A;  1FW0 A;  4H67 A;  5I56 B;  2B4L A;  1ATG A;  1MQG A;  1P1U A;  3K00 A;  2GRV A;  3S2V A;  2BJJ X;  2F6P A;  3E4R A;  4F29 A;  1B51 A;  4C0R A;  3ECR A;  3CFX A;  1SBP A;  3ZKL A;  4UA8 A;  4IGR A;  5AA4 B;  4R75 A;  3IX1 A;  2M8C A;  3S9N C;  3VFJ A;  4RK9 A;  4NF5 B;  1MG1 A;  5K2Y A;  2F7C A;  3E3K A;  2V3U A;  3OEL A;  4R73 A;  3TTL A;  4RY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...