1B58A

Oligo-peptide binding protein (oppa) complexed with kyk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b58A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b58A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b58A02
2Z8FA 4YB6A 2HZLA 1VFEA 5TU0A 2NOOA 2F97A 4NMYA 4GQOA 2B4LA 3H6TA 2HQ0A 2HFBA 1LLSA 3OENA 5CC2A 3G3GA 5I59B 1MXXA 4U21A 3FD3A 1AH5A 4EF2A 4FECA 5KCJB 1QKAA 3IOTA 4NF6A 5KDTB 4H65A 3MP1A 1PB7A 3FVOA 4R6KA 5I2KB 1P1WA 1M5DA 3HCQA 4LQ5A 1DSNA 2BJJX 4C1UA 3RN8A 2ZMBA 4ZEIA 3O6IA 3N6TA 2E1SA 3O97A 4M1VA 3KOSA 4OWDA 5M2VA 5H8NB 1FCKA 2FYIA 2OCUA 2ZYNA 2XXQA 1IXHA 3Q26A 5H8HB 5DT6A 1NH7A 3P7IA 1A8FA 1LGBC 1TFDA 4RXLA 1RYXA 5CMMA 5ITOA 1FTLA 1EZ9A 4IY5A 4LQ2A 4U4SA 3OOAA 5F1QA 1JEVA 4LZ5A 1N3WA 3F11A 4NE4A 4E0XA 3O29A 1SQYA 3K00A 4GXAA 1JW5A 3H4ZA 3KN7A 4GFRA 3MZ1A 3MPLA 1N7XA 3FXRA 3TFLA 4RPOA 2UXAA 4OFOA 2REGA 5IAIA 2PBWA 3LSXA 5H8QB 4DLDA 2RKMA 3VVFA 1MPDA 3EHSA 4H5GA 4ZE9A 4GRKA 4IO6A 4MBPA 1AOVA 1VFDA 1R1NA 2ZNTA 1P99A 4NF5A 1DTGA 3PV0E 4DXBA 5A5XA 1LAHE 2B3FA 4KFQA 4G2ZA 4ZE8A 3B6TA 1SI1A 4BLAA 3ILUB 3IX1A 2I49A 2RC9A 2UVIA 3MQ9A 3CG3A 1LFHA 4QRZA 4PE5B 4LZ7A 3ECRA 4POXA 3DM0A 1MY3A 1LB9A 3PMXA 3T96B 1PEBA 5ITPA 3C35A 3UORA 4R9GA 1PC3A 1JQFA 3BBRA 4DCYA 2DWIA 4HW8A 1P1QA 4JWYA 3R7XA 1R9QA 3JYRA 1JW4A 4NF8A 5FHOA 1BKAA 2OBGA 4OENA 4DZ1A 1N7WA 1VE4A 2OLBA 2R9JA 2CZLA 5I2NA 1JVYA 4ISUA 4HCWA 1GV8A 1MXVA 2B65A 3EPEA 3K1PA 3TCHA 4EXLA 1NKXA 5CMBA 4AB6A 1OVTA 1ZTYA 1H3DA 4EQ9A 5K2YA 1O7TA 3TTLA 2H25A 5H8FB 3DRJA 3K6UA 1FQCA 4YKJA 1Z7NE 3V89B 3LUYA 4F1VA 2OWTA 4G4PA 1M5CA 2XXWA 2AYSA 1LAFE 5KCJA 4PQJA 4U23A 4RY1A 1RYOA 1A7LA 1MQHA 1FQBA 5FHNA 4ELRA 5I2KA 3MW0A 1Q1KA 2Y7KA 3QAXA 4HCYA 4QFPA 3TTMA 3VXBA 3JV9A 1B1XA 4UA8A 1H44A 2V25A 2NXOA 2UYEA 4F3GA 5H8NA 4FE8A 2Q88A 2THIA 1IIWA 4DIGA 4R6HA 5H8HA 2D21A 1P1UA 1MQIA 4OEUA 4P0IA 1IITA 4Q30B 2I0BA 2DWHA 3TEPA 4BDLA 4F19A 3C32A 2Y84A 4GVOA 2HCAA 4R2FA 3HN0A 4KR5A 1B0LA 4MF3A 4KQPA 1Y1ZA 1I69A 4O3AA 4XKRA 5L9MA 1URSA 3BKIB 3LR1A 1L5TA 5CI5A 4TQUQ 5H8QA 3TMGA 2B4MA 3IOVA 4FIMA 3E3KA 2DWJA 4F3SA 2ZYKA 1H45A 1MM6A 1D3KA 4Z0IA 3BFUA 3S2VA 5KZTA 4E0WA 3WAEA 2F8DA 1MH4A 1BIYA 1MRPA 4LONB 3SEXA 1SVXB 3VXCA 1M5FA 2XX8A 2O1LA 1LAGE 3K1NA 3V8XB 5EHMA 3CFZA 4GL0A 3DRHA 3VLUA 3K01A 1OIBA 4EXKA 4ONYA 1B3EA 3DRKA 1URGA 3GLBA 1BP5A 1KWHA 1Y4CA 3KJ7A 1DOTA 4Z7EA 1D4NA 3QUJA 4JB7A 4X9TA 1WVJA 4KHZE 1UQWA 1SDXA 4IY6A 1N3XA 2ESNA 4OQOA 4JSOA 1MQDA 3GBBA 5IKBA 3PUZE 4R6YA 4HTGA 3G3JA 2I48A 3PMVA 3O6HA 2XXYA 4U1ZA 1PBQA 4RPNA 3OSQA 4LATA 1N84A 1MDQA 1SYHA 2PMSA 1DPEA 1POY1 1ZBMA 3C4MA 1HSJA 1QJMA 1FW0A 3PPQA 3T93B 4ESXA 1SW5A 4F18A 4LA9A 2XXIA 2PVUA 2RC8A 2YLNA 2F6GA 4Q5TA 4U22A 3H6UA 4F1YA 3I5OA 4PETA 1XT8A 1B52A 2WKYA 1MPCA 3I6VA 1M5BA 2O7IA 2IEEA 5EYFA 1USYE 1PDAA 4K3FA 4AQ4A 3DLNA 4WKMA 3CSBA 4RYAA 1TT1A 4DXCA 1XHYA 3DELB 4DE8A 3MVWA 1B3FA 2Q8JA 3FGSA 2O69A 1HSEA 1XC1A 5LOMA 4IGRA 3H6WA 1PB9A 5CRYA 4BDMA 3PAMA 3CI8A 3FTOA 4ZS9A 1Y3QA 4R74A 3TKDA 2ZYOA 2GHBA 2H9BA 1H76A 3MVXA 3PGFA 1MXUA 1FTKA 2F35A 1F9BA 4GWOA 4ELOA 3U92A 3N94A 1BTJA 1GGGA 3Q28A 1TWYA 2Y7IA 2OZZA 3LBSA 5J1DA 3OO7A 4N13A 1NNTA 4GIZA 3TAJA 2ONSA 1XVXA 1MY0A 4R9FA 1A8EA 2HXWA 1B4HA 5I84A 1IQ7A 5I57B 4IO7A 1P1OA 2I0CA 4ZEBA 2F6PA 2ONRA 1AMFA 4IO4A 3M8UA 3HV1A 4KI0E 3HO7A 3RT8A 3KSXA 3C33A 2Z8DA 3MP8A 5DVFA 3G3KA 4RK2A 5AE4A 3M3FA 1D9VA 4XTCQ 4QFNA 3MPKA 5I56B 4JSDA 3H3GA 2VD2A 3L6GA 3QUFA 1AIVA 2O68A 2XXUA 3MJNA 5TP9B 4FORA 1BLFA 4XKQA 5B70A 3G3FA 3RYBA 3IB1A 2V3QA 3S9LC 3PUYE 3ZS6A 2XHDA 3KSJA 2X7QA 1MXYA 1B1HA 1IZ1A 1MQJA 4RJZA 3FUZA 4FATA 3TQWA 4G68B 2DE2A 4KYDA 5F7VA 2A5SA 3CHGA 1M5EA 3HHGA 1UTBB 5FTIA 1ZU0A 2V3UA 3QK6A 4F31B 4QFOA 4YKPA 4ZDMA 1IUDA 1LB8A 1GR2A 2QL3A 2XX7A 4L17A 5L8DA 1QUIA 1OQGA 4G8HA 1Y4TA 4C0RA 1LSTA 3O66A 2DVCA 4YB7A 4OXVA 1MQGA 4NTLA 2QJEA 3TTRA 4X1BA 3PPOA 3UK4A 4X48A 1LCTA 1IXCA 2VD3A 2Q2CA 4IB2A 2A5TB 2I4BA 3KN3A 1MY4A 4OHNA 3A3CA 4LVQA 3IAZA 2LAOA 2O51A 5ICTA 2XXPA 1LBCA 1Y20A 2GRVA 4R75A 3S9MC 4H8JA 1B51A 2UYFA 3FXQA 3SESA 1B4ZA 3FATA 2DOJA 3MP6A 3MC2A 5AA2D 1JEUA 1FQDA 2VP1A 5DVIA 2H99A 4MLVA 2ALUA 3W9WA 3VLWA 3IO4A 1R9LA 3K02A 5ELVA 4YMBA 3B6WA 1I6BA 1ZMGA 1SW2A 2P2AA 4BDQA 4LP2B 2E0SA 1NH8A 4ZEFA 3ODBA 4OVJA 4N07A 3USDA 3LC8A 3R6UA 2Z23A 1LBBA 3IB0A 3H06B 3FV2A 1B7HA 3SETA 1LAXA 2Y7WA 1A55A 4IO2A 3KZGA 4OESA 2QS1A 3G7WA 3FASA 4QHQA 5I57A 3B7DA 3HSTA 5H8SA 1NMUA 4NF4B 1EZOA 3DRIA 3I3VA 1FQAA 4NWDA 4ELQA 3PMWA 1UTHA 2XXXA 4POWA 1NNKA 3K4UA 3M3LA 4P0GA 1OQHA 3RPWA 2WOLA 4ZEDA 1XVYA 4GLIA 3SEUA 4FEBA 4RA1A 3QYTA 3TPAA 3FJ7A 4FEDA 3DRFA 4YKIA 5I56A 2DE3A 4IO3A 1Y9UA 3RNNA 4G77A 1Y3NA 5HM4B 2QMWA 2O1MA 3TDJA 1IXGA 1B3LA 2PT2A 4P11A 3CFXA 5TP9A 4XXUA 2HAUA 2DSFA 2NVUB 4PP0A 3W9VA 4YB5A 2IA4A 1QUJA 3O6GA 4IO5A 4GL8A 5AA2B 5B7DA 2QSXA 1B2HA 2NWJA 3T9VA 4G68A 3VV5A 1EZPA 1UTBA 3OELA 3SEVA 2GH9A 3T22A 4TLLB 3ONMA 4G68C 3FVNA 5AA1A 1IEJA 2WOKA 1MM7A 3OD7A 2DXRA 4QFKA 3U1OA 1OMPA 3KG2A 1MY2A 4JWXA 3TCFA 4QSCA 3IJOB 4ZECA 1JNFA 3D4CA 2XXTA 3KBRA 2D5WA 4H8IA 2HEUA 5BUUA 1N0TA 4U1OA 1Y1MA 5K2XA 2QMXA 2F7AA 4NWCA 3TTKA 2F78A 3K1MA 2A5TA 3SKPA 1YCJA 2I3VA 2ZXTA 1QVSA 1NFTA 1ZJLA 3MAMA 2VGQA 3G3IA 2X7PA 4ELPA 5DVJA 2AIXA 4U2RA 3VE1B 3K2DA 3KOTA 3K0VA 5CM6A 2W7YA 4UACA 2RCBA 4WXJA 2P0SA 1SI0A 4YZZA 1B7UA 4KCCA 4QFLA 3G3HA 4DCXA 1ZIUA 2I58A 3CR9A 3RGYA 3RLFE 2X26A 4YMAA 2B3BA 4F2QA 1Y3PA 1YTVA 1MXWA 3KJTA 3HPIA 2QS2A 4OMBA 3AXFA 3PU5A 3K6VA 3UGWA 2Z22A 4BDOA 1QUKA 2DVZA 3MWBA 1XS5A 2M8CA 3UP9A 4KCDA 2HZKA 1MXZA 1NNFA 3K6XA 2RF1A 1NNPA 3TQLA 4NF4A 3TELA 2CMOA 3MVZA 2XD2A 1LCFA 4DXUA 3LSWA 2Q89A 1B5JA 1D9YA 3KN8A 1FTJA 1J1NA 3SERA 3T9UA 3IOUA 3O28A 1AL3A 5L9OA 3V5AA 4KPTA 1US5A 2O6AA 1OLCA 1T0KA 3OEKA 2UVHA 3QXMA 5BWJA 5CBRA 3OO9A 1B3GA 4O3BA 4EF1A 2I3WA 4F1UA 1USYH 3RTWB 3U94A 4MLQA 4OYVA 1B3HA 3O9PA 4MH5A 3GXAA 2PT1A 1EU8A 4G8MA 2GHAA 1II5A 1OVBA 3D4GA 3SEYA 2UVGA 5HBCA 5CMKA 2PYYA 1B0HA 3CIJA 1TFAA 4HS7A 3QIMA 3IJXB 1ZKBA 5AA2A 1FTOA 3FV1A 1B6HA 1O63A 3Q27A 3TUSA 1UTHB 3LSFB 3IB2A 4JDFA 4H1XA 4YU0A 3RUMA 4OEVA 1YPNA 4N6PA 3C34A 2DYXA 4Q8RA 1GTKA 2Z8EA 4PFUA 1URDA 3S9NC 4GD5A 4OZ9A 5DYHA 3THIA 1A99A 3CFLA 1ZLQA 3E13X 3KGCA 5L9SA 4NEDA 3T66A 2KLFA 3WAFA 4DDDA 3ZSFA 1HSLA 5JK4A 4THIA 4M4GA 3L6HA 2F7BA 3V83A 4G8NA 1B7ZA 4F2OA 4PFTA 3VDFA 5JTYB 4H5FA 3H03A 3R26A 4H67A 4RNSA 3EHTA 2DWAA 4BDNA 1B58A 3MBPA 1MPBA 3EQ1A 4TOZA 1JVXA 4I62A 3ILTB 1POTA 1LFIA 3W15C 2OK2A 3IK6B 4MFIA 3GBAA 1YAEA 3VVEA 1WDNA 1B46A 1MDP1 1CE2A 1SD3A 3KFMA 4Q0CA 4EQBA 3IR1A 1OLAA 4JBZA 3K6WA 5DEXB 4U4XA 4ZZEA 3PPPA 2ZNUA 1SW4A 2FA7A 4F3BA 3TYHA 1B5HA 1I6AA 1QKBA 3VVDA 4F3PA 1VSOA 3N5LA 3N6UA 2HAVA 2ONKE 3LVUA 4EUOA 2RINA 3CSGA 3RTFB 5I58A 4ND9A 3MZBA 2DE4A 1MG1A 3FJGA 2F7CA 3Q25A 2WOPA 1H43A 1SW1A 2ABHA 1FTMA 5FHMA 1MY1A 3H6VA 1N76A 3EF7A 4XKPA 4OFJA 5HPQA 5AA4B 3OO6A 2RCAA 4YAHX 3PPNA 1I6QA 3VLVA 2YPNA 3MZ9A 2XD3A 2RC7A 5TPAB 1ELJA 4R72A 1QULA 2O7UA 5I59A 2PX1A 1DTZA 2V3TA 1A40A 4BDRA 2I6EA 3QSLA 3DP6A 3SDFA 4F29A 3E4RA 1MS7A 5KDTA 3FXUA 4H0WA 1DMBA 4I9DA 1S9TA 2QS4A 2GFEA 3SEWA 3H7MA 1QW0A 2QRYA 3EHUA 4OETA 3OXNA 2OJTA 4EDPA 4X1DA 2R6GE 1B40A 4I8CA 2Y7PA 3BFTA 1B9JA 4R2BA 4QSEA 1WODA 4WEPA 2YJPA 3O2AA 3S9EA 4TLMB 4PFWA 3UIFA 2QS3A 1SBPA 4RK9A 5FTHA 1B5IA 3PPRA 3EN3A 4JXIA 1FQEA 2VHAA 4GXSB 4I1DA 3GZGA 1US4A 3CRBA 2QPQA 4ZEKA 3C9HA 3M3KA 3N26A 2XXHA 2F36A 4C1TA 3DRGA 1DPPA 2DXYA 1VR5A 3PUWE 3VFJA 4OFLA 4H6DA 4LUBA 1PB8A 2UVJA 2H98A 4NF6B 2REJA 2ZYMA 3T9HB 3TODA 2G29A 4KD5A 3PD9A 1GVCA 3HHFA 3CVGA 3FVKA 4ZZAA 5JTYA 4O3CA 4JWOA 4OTEA 5DTBA 3S4UA 3RY3A 1O64A 3MUQA 3PD8A 1TXFA 2DP8A 2G93A 3DP4A 1ATGA 1P1NA 1MH3A 2D3IA 5CBSA 3ZKKA 1S50A 2Q9TA 2XX9A 2DQVA 3ZKLA 1XOCA 3A3UA 3FZVA 3DP8A 3U8QA 4FJPA 1CB6A 3OSRA 5DEXA 4GOTA 2ZNSA 4IGTA 3FVGA 4GF8A 3B6QA 3RQTA 1IXIA 1EH3A 2OWSA 1JW1A 1A54A 4XKNA 4F39A 4QF9A 3RYAA 2AL5A 5ICQA 1JETA 2H4IA 1PBPA 4OERA 1FQFA 4XIGQ 2XXVA 1Q35A 4F22A 3OMBA 5AA3A 3TCGA 1ANFA 3RT6B 4FAJA 3U72A 1LFGA 3FJMA 1B05A 1B32A 2FNCA 3IORA 1S7YA 4KYSA 5AA4A 2H5YA 4NF5B 3IOWA 3TZAA 2F5XA 1R6ZA 5ISUA 3IL1B 2I4CA 5A5XB 1UIUA 5EHSA 2VOZA 4LZ8A 3JZJA 4PFYA 3UA8A 4QSDA 5TPAA 5H8FA 3PUVE 3PUXE 3T9XB 4ESWA 2ANJA 2DS9A 1Z7ME 4YICA 3OEMA 4YKKA 4ECFA 2XXRA 2NUVA 3CG1A 3KEIA 3O6PA 4KYEA 3Q29A 3TTNA 3A09A 2R71A 5CMCA 4WEDA 1N04A 2V93A 3C36A 1RKMA 4EQ7A 5JEIA 1SYIA 4AB5A 3UN6A 3OO8A 3FIRA 3U93A 2V84A 2P1SA 5I58B 4NF8B 1UIVA 2F34A 3MVYA 3C31A 3IO6A 3E9XA 2O84X 5I2NB 2Y7RA 1NL5A 3LSLA 4R73A 2AL4A 2Q2AA
chains in the Genus database with same CATH superfamily
2Z8FA 4YB6A 2HZLA 1VFEA 5TU0A 2NOOA 2F97A 4NMYA 3T1BA 4GQOA 2B4LA 3H6TA 2HQ0A 2HFBA 1LLSA 3OENA 5CC2A 3G3GA 5I59B 1MXXA 1NI9A 4U21A 3FD3A 1AH5A 4EF2A 2QVRA 4PFRA 4FECA 5KCJB 1QKAA 3IOTA 4NF6A 5KDTB 4H65A 3MP1A 1PB7A 3FVOA 4UABA 1FTAA 1D9QA 4R6KA 5I2KB 4JVDA 1P1WA 1M5DA 3HCQA 4LQ5A 1DSNA 2BJJX 4C1UA 3RN8A 2ZMBA 4ZEIA 3O6IA 3N6TA 2E1SA 3O97A 4M1VA 2OX3A 3KOSA 4OWDA 5M2VA 5H8NB 1FCKA 2FYIA 2HXRA 1FPDA 2OCUA 2ZYNA 2XXQA 1IXHA 3Q26A 5H8HB 5DT6A 1NH7A 3P7IA 1IMFA 1A8FA 1FBGA 1LGBC 1TFDA 4RXLA 1RYXA 4O7IA 5CMMA 1SPIA 5ITOA 1FTLA 1EZ9A 4IY5A 4LQ2A 4U4SA 1LEVA 3OOAA 5F1QA 1JEVA 4JVIA 4LZ5A 2QFLA 1N3WA 3F11A 4NE4A 4E0XA 1FPBA 3O29A 1SQYA 3K00A 2WX9A 5ET8A 4GXAA 1JW5A 3H4ZA 3KN7A 4GFRA 3MZ1A 3MPLA 1N7XA 3FXRA 3TFLA 2P3NA 4RPOA 2UXAA 4OFOA 2REGA 4PFIA 5IAIA 2PBWA 3LSXA 5H8QB 4DLDA 2RKMA 3VVFA 1MPDA 3EHSA 4H5GA 4ZE9A 4GRKA 4IO6A 4MBPA 1AOVA 1VFDA 1R1NA 2ZNTA 1P99A 4NF5A 4P9KA 1DTGA 3PV0E 4DXBA 5A5XA 1LAHE 2B3FA 4KFQA 4G2ZA 4ZE8A 1DBZA 3B6TA 1SI1A 4BLAA 3ILUB 3IX1A 2I49A 4GWUA 2RC9A 4PAFA 2UVIA 3MYUA 3MQ9A 3CG3A 1LFHA 4QRZA 4PE5B 1LBZA 4G61A 4LZ7A 3ECRA 4POXA 4P47A 3DM0A 1MY3A 1RDZA 1LB9A 3PMXA 3T96B 1PEBA 2WYPA 5ITPA 3C35A 3UORA 4R9GA 1PC3A 1JQFA 3BBRA 4DCYA 2DWIA 4HW8A 1P1QA 4JWYA 4O8MA 1R9QA 3R7XA 3JYRA 1JW4A 4NF8A 5FHOA 1BKAA 4GWSA 2OBGA 4OENA 4DZ1A 2FIXA 1N7WA 1VE4A 2OLBA 2R9JA 2CZLA 5I2NA 1JVYA 4ISUA 4HCWA 1GV8A 1MXVA 2B65A 3EPEA 3K1PA 3TCHA 4KXPA 4HE0A 4EXLA 1NKXA 5CMBA 4AB6A 1OVTA 1ZTYA 1H3DA 4EQ9A 3ISPA 4N6DA 5K2YA 1O7TA 3BIHA 3TTLA 2H25A 5H8FB 3DRJA 3K6UA 1FQCA 4YKJA 4FBPA 1Z7NE 3V89B 3LUYA 4F1VA 2OWTA 4G4PA 1M5CA 2XXWA 2AYSA 1LAFE 5KCJA 4PQJA 2JJKA 4U23A 4RY1A 1RYOA 4MAGA 1A7LA 1MQHA 1FQBA 5FHNA 4X04A 5I3SA 4ELRA 5I2KA 3MW0A 1LBYA 1Q1KA 2Y7KA 3QAXA 5F24A 4HCYA 3RYDA 4QFPA 3TTMA 1LBWA 4H46A 3VXBA 3JV9A 4PFBA 1B1XA 4UA8A 1H44A 2V25A 2NXOA 2UYEA 4F3GA 5H8NA 4FE8A 1NUYA 2Q88A 4PF8A 2THIA 1IIWA 4DIGA 4R6HA 5H8HA 2D21A 1P1UA 2CZIA 1MQIA 4OEUA 4P0IA 1IITA 4Q30B 2I0BA 2DWHA 1JP4A 3TEPA 4IR8A 4BDLA 4F19A 3C32A 2Y84A 4GVOA 2HCAA 4R2FA 3HN0A 4KR5A 1B0LA 4MF3A 4KQPA 1Y1ZA 1I69A 4O3AA 4XKRA 5L9MA 1URSA 3BKIB 3LR1A 1L5TA 5CI5A 4PBQA 4TQUQ 5H8QA 3TMGA 2B4MA 3IOVA 4FIMA 3E3KA 4GWYA 2L5VA 2DWJA 4F3SA 2WBBA 2ZYKA 1H45A 1MM6A 1D3KA 4Z0IA 4HE2A 3BFUA 3S2VA 5KZTA 4E0WA 2XWOA 1FPJA 3WAEA 2F8DA 1MH4A 4PGPA 1BIYA 1MRPA 4LONB 3SEXA 1SVXB 1FBHA 1FJ9A 3VXCA 1M5FA 2XX8A 2O1LA 1LAGE 3K1NA 5T3JA 3V8XB 5EHMA 3CFZA 5FBPA 4GL0A 5ET6A 3DRHA 3VLUA 3K01A 1OIBA 1K9ZA 4EXKA 1NV0A 3FXBA 4ONYA 1B3EA 2WEFA 3DRKA 1URGA 3GLBA 1BP5A 1KWHA 1Y4CA 3KJ7A 1DOTA 4Z7EA 1D4NA 3QUJA 4JB7A 4X9TA 1WVJA 4KHZE 1UQWA 1SDXA 2PFYA 4H45A 4NHBA 4IY6A 1N3XA 4MX6A 2ESNA 4PF6A 4OQOA 4JSOA 1MQDA 3GBBA 4XFEA 5IKBA 3PUZE 2GQ1A 4R6YA 4HTGA 3G3JA 2I48A 3PMVA 3O6HA 2XXYA 4U1ZA 1XI6A 1PBQA 4RPNA 3OSQA 4LATA 1K9YA 1N84A 1MDQA 1SYHA 2PMSA 1DPEA 1POY1 1ZBMA 3C4MA 1HSJA 1QJMA 1FW0A 2Y5LA 3PPQA 3T93B 4ESXA 1SW5A 4F18A 4N8GA 4LA9A 2XXIA 2PVUA 4AS5A 2RC8A 2YLNA 2F6GA 4Q5TA 1NV1A 4U22A 3H6UA 1NV5A 4F1YA 3I5OA 4PETA 1XT8A 1B52A 5EQAA 2WKYA 1MPCA 3I6VA 1M5BA 2O7IA 2IEEA 3PTYA 5EYFA 1USYE 1PDAA 4K3FA 4AQ4A 3DLNA 4WKMA 3CSBA 4RYAA 1TT1A 4DXCA 1XHYA 3DELB 4DE8A 3MVWA 1B3FA 1NV3A 2Q8JA 4MMPA 3FGSA 2O69A 1HSEA 1XC1A 5LOMA 4IGRA 3H6WA 4NGUA 1PB9A 2Q74A 5CRYA 4X8RA 4BDMA 3PAMA 3CI8A 3FTOA 4ZS9A 2CEYA 1Y3QA 4R74A 1FRPA 3TKDA 4OANA 2ZYOA 2GHBA 2H9BA 2OWZA 1H76A 3MVXA 3PGFA 1MXUA 1FTKA 2F35A 1F9BA 4GWOA 4ELOA 3U92A 3N94A 3T0JA 3A29A 1BTJA 1GGGA 3Q28A 1TWYA 5IZ3B 2Y7IA 4GX3A 3D1RA 2OZZA 3LBSA 5J1DA 3OO7A 4N13A 1NNTA 1CNQA 4GIZA 3TAJA 2ONSA 4NG7A 1XVXA 1MY0A 1IMBA 4R9FA 1A8EA 2HXWA 1B4HA 5I84A 1IQ7A 5J16A 5I57B 4IO7A 2ZZWA 1P1OA 2I0CA 4ZEBA 2F6PA 2ONRA 1AMFA 4IO4A 4PAKA 3M8UA 3HV1A 4KI0E 3HO7A 3RT8A 3RPLB 3KSXA 3C33A 2Z8DA 3MP8A 5DVFA 3G3KA 4RK2A 5AE4A 1FJ6A 3M3FA 5I5PA 2ZZVA 1D9VA 4XTCQ 4QFNA 3MPKA 5I56B 4JSDA 3H3GA 2VD2A 3L6GA 1FPFA 3QUFA 1DCUA 1AIVA 5EQ8A 1FPEA 2O68A 2XXUA 3MJNA 5TP9B 4FORA 2FBPA 2FVZA 1NUXA 4GWWA 1BLFA 4HE1A 4XKQA 5B70A 3G3FA 3RYBA 3IB1A 4PE3A 4PDDA 2V3QA 4MHFA 3S9LC 3PUYE 3ZS6A 2XHDA 3KSJA 2X7QA 1MXYA 4PAIA 2VPOA 1B1HA 1IZ1A 1MQJA 4RJZA 3FUZA 4FATA 3TQWA 4G68B 2DE2A 4KYDA 5F7VA 2A5SA 3CHGA 1M5EA 2QVVA 5EYHA 3HHGA 1UTBB 5FTIA 4NQ8A 1ZU0A 1KZ8A 4PBHA 2V3UA 3QK6A 4F31B 4QFOA 4YKPA 4ZDMA 1IUDA 1LB8A 1GR2A 2QL3A 2XX7A 1LBXA 4L17A 4MIJA 5L8DA 5ET7A 1QUIA 1OQGA 4G8HA 1Y4TA 4C0RA 1LSTA 3B50A 3O66A 4P1EA 2DVCA 4YB7A 4OXVA 1MQGA 4NTLA 2QJEA 3TTRA 4X1BA 3PPOA 3UK4A 4X48A 1LCTA 1IXCA 2VD3A 2Q2CA 4IB2A 2A5TB 4XF5A 2I4BA 3KN3A 1MY4A 4OHNA 3A3CA 4LVQA 3IAZA 2LAOA 2O51A 5ICTA 2XXPA 1LBCA 1Y20A 2GRVA 4N81A 4R75A 3S9MC 4MEVA 4H8JA 4OVSA 1B51A 2UYFA 3FXQA 5EYGA 3SESA 5EQ7A 1B4ZA 3FATA 2DOJA 1NV2A 3MP6A 3MC2A 5AA2D 1JEUA 1FQDA 4GX4A 2VP1A 5DVIA 2H99A 4MLVA 2ALUA 3W9WA 3VLWA 3IO4A 1R9LA 3K02A 5ELVA 4YMBA 3B6WA 1I6BA 4MNCA 1ZMGA 1SW2A 2P2AA 2CZHA 4BDQA 4LP2B 2E0SA 1NH8A 4ZEFA 1KA0A 3ODBA 3QMFA 4OVJA 4N07A 4OA4A 3USDA 3LC8A 3R6UA 2Z23A 1LBBA 3IB0A 3H06B 3FV2A 5IZ3A 1B7HA 1VDWA 3SETA 1LAXA 2Y7WA 1A55A 4IO2A 1NUZA 4DI4B 3KZGA 4OESA 2QS1A 3G7WA 3FASA 4QHQA 5DW8A 5I57A 2XWKA 1QGXA 3B7DA 3HSTA 5H8SA 1NMUA 4NF4B 2HPGA 1FPKA 1EZOA 3DRIA 3I3VA 1FQAA 4NWDA 4ELQA 1NV4A 3PMWA 1UTHA 2XXXA 4POWA 1NNKA 3K4UA 4I40A 3RPLA 3M3LA 4P0GA 1OQHA 3RPWA 2WOLA 4ZEDA 3E79A 1XVYA 4GLIA 3SEUA 1NUWA 4FEBA 4RA1A 2XWIA 3QYTA 3TPAA 3FJ7A 4FEDA 3DRFA 4YKIA 4GWZA 5I56A 2DE3A 4IO3A 1Y9UA 4I3YA 1AWBA 3RNNA 4G77A 1Y3NA 5HM4B 2QMWA 2O1MA 3TDJA 1IXGA 3ROJA 1B3LA 2PT2A 5IM2A 4P11A 3CFXA 5TP9A 2Q8MA 3LV0A 4XXUA 2HAUA 2DSFA 2XXKA 4GX6A 2FHYA 2NVUB 4PP0A 3W9VA 4YB5A 2IA4A 1QUJA 2VT5A 3O6GA 4IO5A 4GL8A 2XA5A 5AA2B 4QBAA 5B7DA 2QSXA 1B2HA 2NWJA 3T9VA 4G68A 4QXDA 4PDHA 3VV5A 1EZPA 1UTBA 3OELA 3SEVA 2GH9A 3T22A 4TLLB 3ONMA 4G68C 3FVNA 2KQZA 5AA1A 1IEJA 2WOKA 3BIGA 1MM7A 3OD7A 4I3EA 2DXRA 4QFKA 3U1OA 1OMPA 3KG2A 1MY2A 4JWXA 3TCFA 4QSCA 3IJOB 4ZECA 1JNFA 3D4CA 2XXTA 3KBRA 1FBDA 2D5WA 4H8IA 2HEUA 5BUUA 1N0TA 4U1OA 1Y1MA 5K2XA 2QMXA 2F7AA 3SZPA 4NWCA 3TTKA 2F78A 3K1MA 2A5TA 3SKPA 1YCJA 2I3VA 2ZXTA 1IMEA 2WBDA 1QVSA 1NFTA 1ZJLA 3MAMA 2VGQA 1YZ0A 3G3IA 2X7PA 4ELPA 5DVJA 5LDZA 2AIXA 4U2RA 4MJOA 3VE1B 3K2DA 3KOTA 3K0VA 5CM6A 2W7YA 4UACA 2RCBA 4WXJA 2P0SA 1EYKA 1SI0A 4YZZA 1B7UA 4KCCA 4QFLA 3G3HA 3KBZA 3EKIA 4DCXA 1NV6A 1ZIUA 2I58A 3CR9A 3RGYA 3RLFE 2X26A 4YMAA 2B3BA 1Y3PA 1YTVA 1MXWA 4F2QA 3KJTA 3HPIA 2QS2A 4OMBA 3AXFA 3PU5A 3K6VA 3UGWA 2Z22A 4BDOA 5I7IA 1QUKA 4PC9A 2DVZA 3MWBA 5IZ1A 1XS5A 2M8CA 3UP9A 4KCDA 2HZKA 1MXZA 1NNFA 3K6XA 1DK4A 2RF1A 1NNPA 3TQLA 4NF4A 1FBFA 3TELA 2CMOA 3MVZA 2XD2A 4N6KA 1LCFA 4DXUA 3LSWA 2Q89A 1B5JA 1D9YA 3KN8A 1FTJA 1J1NA 3SERA 3T9UA 3IOUA 3O28A 1AL3A 5L9OA 3V5AA 4KPTA 2BJIA 1US5A 2O6AA 1OLCA 3MSTA 1T0KA 4JVCA 3OEKA 2UVHA 3QXMA 5BWJA 5CBRA 3OO9A 1B3GA 2HHMA 2PFZA 4O3BA 4EF1A 4N4UA 3KC1A 2I3WA 4F1UA 1USYH 3RTWB 3U94A 4MLQA 4OYVA 1B3HA 3O9PA 4MH5A 3GXAA 2PT1A 1EU8A 2R8TA 2QVUA 4G8MA 2GHAA 1II5A 3LUZA 1OVBA 3D4GA 4MCOA 3KC0A 3SEYA 2UVGA 5HBCA 1FPGA 5CMKA 2PYYA 1B0HA 3CIJA 1TFAA 4HS7A 3QIMA 3IJXB 1ZKBA 5AA2A 1FTOA 1BK4A 3FV1A 1B6HA 1O63A 3Q27A 3TUSA 1UTHB 3LSFB 3IB2A 4JDFA 4NX1A 4H1XA 4YU0A 3RUMA 4OEVA 1YPNA 4N6PA 2F3DA 3C34A 2DYXA 4Q8RA 1GTKA 2Z8EA 1RDYA 4PFUA 1URDA 1FBPA 3S9NC 4GD5A 4PCDA 4OZ9A 5DYHA 4OVQA 3THIA 5A5LA 1A99A 3CFLA 4O94A 1ZLQA 3E13X 3KGCA 4P56A 5L9SA 4NEDA 3T66A 2KLFA 1G0IA 4NN3A 2DDKA 3WAFA 2Y5KA 4DDDA 4HXVA 4N8YA 3ZSFA 1HSLA 1EYJA 5JK4A 3HFUA 4THIA 4M4GA 3L6HA 2F7BA 3V83A 1G0HA 1FSAA 2F3BA 4G8NA 1B7ZA 4F2OA 4PFTA 3VDFA 5JTYB 4H5FA 3H03A 3R26A 4H67A 4RNSA 3EHTA 2DWAA 2KR0A 4BDNA 1B58A 3MBPA 1MPBA 3EQ1A 4TOZA 1JVXA 1INPA 3B8BA 4I62A 3ILTB 1POTA 1LFIA 3W15C 2OK2A 3IK6B 4MFIA 3GBAA 1YAEA 1YYZA 3VVEA 1WDNA 1B46A 1MDP1 1CE2A 1SD3A 3KFMA 4Q0CA 4EQBA 3IR1A 1OLAA 2V4CA 4JBZA 3K6WA 5DEXB 4NF0A 4U4XA 4ZZEA 2WYKA 3PPPA 2ZNUA 1SW4A 2FA7A 4F3BA 3TYHA 5EQ9A 1B5HA 1I6AA 1QKBA 3VVDA 4F3PA 1VSOA 3N5LA 3N6UA 2HAVA 2ONKE 3LVUA 4EUOA 2RINA 4NAPA 3CSGA 3RTFB 5I58A 4ND9A 3MZBA 2DE4A 1MG1A 3FJGA 1KA1A 2F7CA 3Q25A 2WOPA 1H43A 1SW1A 2ABHA 1FTMA 5FHMA 1MY1A 3H6VA 4PGNA 1N76A 1NV7A 2P3VA 3EF7A 4XKPA 4OFJA 5HPQA 1IMAA 5AA4B 3OO6A 2RCAA 4MNIA 4YAHX 5IGAA 3PPNA 1I6QA 3VLVA 2YPNA 3MZ9A 3IFAA 2XD3A 2RC7A 5TPAB 1ELJA 4R72A 1FBCA 1QULA 2O7UA 5I59A 2PX1A 4GBWA 1DTZA 2V3TA 1A40A 4BDRA 2I6EA 3QSLA 3DP6A 3SDFA 1EYIA 1YXIA 4F29A 4OVPA 3E4RA 1MS7A 5KDTA 3FXUA 4H0WA 1DMBA 4I9DA 1S9TA 2QS4A 4GWXA 2GFEA 3SEWA 2FIEA 3H7MA 1QW0A 2QRYA 3EHUA 4OETA 3OXNA 3NOHA 2OJTA 4LN5A 4EDPA 4X1DA 2R6GE 1B40A 4MNPA 4I8CA 2Y7PA 3BFTA 1B9JA 4R2BA 1IMDA 1LBVA 4QSEA 1RDXA 1WODA 4N91A 1FBEA 4O7MA 4WEPA 4P3LA 2YJPA 3O2AA 3S9EA 4TLMB 4PFWA 3UIFA 2QS3A 1SBPA 4RK9A 5FTHA 4P8BA 1B5IA 3PPRA 3EN3A 4JXIA 1FQEA 2VHAA 4GXSB 4I1DA 3GZGA 5LTCA 2VPNA 1US4A 4N17A 3CRBA 2QPQA 4ZEKA 3C9HA 3M3KA 4OVRA 3N26A 2XXHA 2F36A 4C1TA 3DRGA 2MKZA 3U65A 1DPPA 2DXYA 1VR5A 3PUWE 3VFJA 4OFLA 4H6DA 2CEXA 4LUBA 1PB8A 2UVJA 4N15A 2H98A 4NF6B 2REJA 2PCRA 2ZYMA 3IFCA 3T9HB 3TODA 2G29A 4KD5A 3PD9A 1GVCA 3HHFA 3CVGA 3FVKA 4ZZAA 5JTYA 4O3CA 4JWOA 4OTEA 5DTBA 3S4UA 3RY3A 1O64A 3MUQA 3PD8A 1TXFA 2DP8A 2G93A 3DP4A 1ATGA 1P1NA 1MH3A 2D3IA 5CBSA 3ZKKA 1S50A 2Q9TA 4DI3D 2XX9A 2DQVA 3ZKLA 1XOCA 3A3UA 3FZVA 3DP8A 3GYYA 3U8QA 4FJPA 1CB6A 3OSRA 5DEXA 4GOTA 2ZNSA 4IGTA 3FVGA 4GF8A 3B6QA 1Q9DA 4XEQA 3RQTA 1IXIA 1EH3A 2OWSA 1JW1A 1A54A 4XKNA 4F39A 4QF9A 3RYAA 2AL5A 3FBPA 5ICQA 1JETA 2H4IA 2CZKA 1PBPA 1IMCA 4OERA 1FQFA 4XIGQ 2XXVA 1Q35A 4F22A 3OMBA 5AA3A 5IZZA 4GBVA 3TCGA 1ANFA 3RT6B 4FAJA 1FPLA 3U72A 1LFGA 4OVTA 3FJMA 1B05A 1B32A 2FNCA 3IORA 5ESYA 1S7YA 4KYSA 5AA4A 2H5YA 4NF5B 3IOWA 3TZAA 2F5XA 1R6ZA 5ISUA 3IL1B 2I4CA 5A5XB 4AS4A 1UIUA 5EHSA 2VOZA 3E78A 4LZ8A 3JZJA 4PFYA 2XWVA 3UA8A 4QSDA 5TPAA 5H8FA 3PUVE 3PUXE 3T9XB 4ESWA 2ANJA 2DS9A 1Z7ME 4YICA 3OEMA 4YKKA 4ECFA 2XXRA 2NUVA 3CG1A 3KEIA 3O6PA 4KYEA 3Q29A 3TTNA 2ZZXA 3A09A 2R71A 5CMCA 4PTKA 4WEDA 1N04A 2V93A 3C36A 1RKMA 4EQ7A 5JEIA 4P1LA 1SYIA 4AB5A 3UN6A 3OO8A 3FIRA 3U93A 2V84A 2P1SA 5I58B 4NF8B 1UIVA 2F34A 3MVYA 1FPIA 3C31A 3IO6A 3E9XA 2O84X 5I2NB 2Y7RA 1NL5A 3LSLA 4R73A 2AL4A 5ET5A 2Q2AA
chains in the Genus database with same CATH topology
2Z8FA 4YB6A 2HZLA 1VFEA 5TU0A 2NOOA 2F97A 4NMYA 4GQOA 2B4LA 3H6TA 2HQ0A 2HFBA 1LLSA 3OENA 5CC2A 3G3GA 5I59B 1MXXA 4U21A 3FD3A 1AH5A 4EF2A 4FECA 5KCJB 1QKAA 3IOTA 4NF6A 5KDTB 4H65A 3MP1A 1PB7A 3FVOA 4R6KA 5I2KB 1P1WA 1M5DA 3HCQA 4LQ5A 1DSNA 2BJJX 4C1UA 3RN8A 2ZMBA 4ZEIA 3O6IA 3N6TA 2E1SA 3O97A 4M1VA 3KOSA 4OWDA 5M2VA 5H8NB 1FCKA 2FYIA 2OCUA 2ZYNA 2XXQA 1IXHA 3Q26A 5H8HB 5DT6A 1NH7A 3P7IA 1A8FA 1LGBC 1TFDA 4RXLA 1RYXA 5CMMA 5ITOA 1FTLA 1EZ9A 4IY5A 4LQ2A 4U4SA 3OOAA 5F1QA 1JEVA 4LZ5A 1N3WA 3F11A 4NE4A 4E0XA 3O29A 1SQYA 3K00A 4GXAA 1JW5A 3H4ZA 3KN7A 4GFRA 3MZ1A 3MPLA 1N7XA 3FXRA 3TFLA 4RPOA 2UXAA 4OFOA 2REGA 5IAIA 2PBWA 3LSXA 5H8QB 4DLDA 2RKMA 3VVFA 1MPDA 3EHSA 4H5GA 4ZE9A 4GRKA 4IO6A 4MBPA 1AOVA 1VFDA 1R1NA 2ZNTA 1P99A 4NF5A 1DTGA 3PV0E 4DXBA 5A5XA 1LAHE 2B3FA 4KFQA 4G2ZA 4ZE8A 3B6TA 1SI1A 4BLAA 3ILUB 3IX1A 2I49A 2RC9A 2UVIA 3MQ9A 3CG3A 1LFHA 4QRZA 4PE5B 4LZ7A 3ECRA 4POXA 3DM0A 1MY3A 1LB9A 3PMXA 3T96B 1PEBA 5ITPA 3C35A 3UORA 4R9GA 1PC3A 1JQFA 3BBRA 4DCYA 2DWIA 4HW8A 1P1QA 4JWYA 3R7XA 1R9QA 3JYRA 1JW4A 4NF8A 5FHOA 1BKAA 2OBGA 4OENA 4DZ1A 1N7WA 1VE4A 2OLBA 2R9JA 2CZLA 5I2NA 1JVYA 4ISUA 4HCWA 1GV8A 1MXVA 2B65A 3EPEA 3K1PA 3TCHA 4EXLA 1NKXA 5CMBA 4AB6A 1OVTA 1ZTYA 1H3DA 4EQ9A 5K2YA 1O7TA 3TTLA 2H25A 5H8FB 3DRJA 3K6UA 1FQCA 4YKJA 1Z7NE 3V89B 3LUYA 4F1VA 2OWTA 4G4PA 1M5CA 2XXWA 2AYSA 1LAFE 5KCJA 4PQJA 4U23A 4RY1A 1RYOA 1A7LA 1MQHA 1FQBA 5FHNA 4ELRA 5I2KA 3MW0A 1Q1KA 2Y7KA 3QAXA 4HCYA 4QFPA 3TTMA 3VXBA 3JV9A 1B1XA 4UA8A 1H44A 2V25A 2NXOA 2UYEA 4F3GA 5H8NA 4FE8A 2Q88A 2THIA 1IIWA 4DIGA 4R6HA 5H8HA 2D21A 1P1UA 1MQIA 4OEUA 4P0IA 1IITA 4Q30B 2I0BA 2DWHA 3TEPA 4BDLA 4F19A 3C32A 2Y84A 4GVOA 2HCAA 4R2FA 3HN0A 4KR5A 1B0LA 4MF3A 4KQPA 1Y1ZA 1I69A 4O3AA 4XKRA 5L9MA 1URSA 3BKIB 3LR1A 1L5TA 5CI5A 4TQUQ 5H8QA 3TMGA 2B4MA 3IOVA 4FIMA 3E3KA 2DWJA 4F3SA 2ZYKA 1H45A 1MM6A 1D3KA 4Z0IA 3BFUA 3S2VA 5KZTA 4E0WA 3WAEA 2F8DA 1MH4A 1BIYA 1MRPA 4LONB 3SEXA 1SVXB 3VXCA 1M5FA 2XX8A 2O1LA 1LAGE 3K1NA 3V8XB 5EHMA 3CFZA 4GL0A 3DRHA 3VLUA 3K01A 1OIBA 4EXKA 4ONYA 1B3EA 3DRKA 1URGA 3GLBA 1BP5A 1KWHA 1Y4CA 3KJ7A 1DOTA 4Z7EA 1D4NA 3QUJA 4JB7A 4X9TA 1WVJA 4KHZE 1UQWA 1SDXA 4IY6A 1N3XA 2ESNA 4OQOA 4JSOA 1MQDA 3GBBA 5IKBA 3PUZE 4R6YA 4HTGA 3G3JA 2I48A 3PMVA 3O6HA 2XXYA 4U1ZA 1PBQA 4RPNA 3OSQA 4LATA 1N84A 1MDQA 1SYHA 2PMSA 1DPEA 1POY1 1ZBMA 3C4MA 1HSJA 1QJMA 1FW0A 3PPQA 3T93B 4ESXA 1SW5A 4F18A 4LA9A 2XXIA 2PVUA 2RC8A 2YLNA 2F6GA 4Q5TA 4U22A 3H6UA 4F1YA 3I5OA 4PETA 1XT8A 1B52A 2WKYA 1MPCA 3I6VA 1M5BA 2O7IA 2IEEA 5EYFA 1USYE 1PDAA 4K3FA 4AQ4A 3DLNA 4WKMA 3CSBA 4RYAA 1TT1A 4DXCA 1XHYA 3DELB 4DE8A 3MVWA 1B3FA 2Q8JA 3FGSA 2O69A 1HSEA 1XC1A 5LOMA 4IGRA 3H6WA 1PB9A 5CRYA 4BDMA 3PAMA 3CI8A 3FTOA 4ZS9A 1Y3QA 4R74A 3TKDA 2ZYOA 2GHBA 2H9BA 1H76A 3MVXA 3PGFA 1MXUA 1FTKA 2F35A 1F9BA 4GWOA 4ELOA 3U92A 3N94A 1BTJA 1GGGA 3Q28A 1TWYA 2Y7IA 2OZZA 3LBSA 5J1DA 3OO7A 4N13A 1NNTA 4GIZA 3TAJA 2ONSA 1XVXA 1MY0A 4R9FA 1A8EA 2HXWA 1B4HA 5I84A 1IQ7A 5I57B 4IO7A 1P1OA 2I0CA 4ZEBA 2F6PA 2ONRA 1AMFA 4IO4A 3M8UA 3HV1A 4KI0E 3HO7A 3RT8A 3KSXA 3C33A 2Z8DA 3MP8A 5DVFA 3G3KA 4RK2A 5AE4A 3M3FA 1D9VA 4XTCQ 4QFNA 3MPKA 5I56B 4JSDA 3H3GA 2VD2A 3L6GA 3QUFA 1AIVA 2O68A 2XXUA 3MJNA 5TP9B 4FORA 1BLFA 4XKQA 5B70A 3G3FA 3RYBA 3IB1A 2V3QA 3S9LC 3PUYE 3ZS6A 2XHDA 3KSJA 2X7QA 1MXYA 1B1HA 1IZ1A 1MQJA 4RJZA 3FUZA 4FATA 3TQWA 4G68B 2DE2A 4KYDA 5F7VA 2A5SA 3CHGA 1M5EA 3HHGA 1UTBB 5FTIA 1ZU0A 2V3UA 3QK6A 4F31B 4QFOA 4YKPA 4ZDMA 1IUDA 1LB8A 1GR2A 2QL3A 2XX7A 4L17A 5L8DA 1QUIA 1OQGA 4G8HA 1Y4TA 4C0RA 1LSTA 3O66A 2DVCA 4YB7A 4OXVA 1MQGA 4NTLA 2QJEA 3TTRA 4X1BA 3PPOA 3UK4A 4X48A 1LCTA 1IXCA 2VD3A 2Q2CA 4IB2A 2A5TB 2I4BA 3KN3A 1MY4A 4OHNA 3A3CA 4LVQA 3IAZA 2LAOA 2O51A 5ICTA 2XXPA 1LBCA 1Y20A 2GRVA 4R75A 3S9MC 4H8JA 1B51A 2UYFA 3FXQA 3SESA 1B4ZA 3FATA 2DOJA 3MP6A 3MC2A 5AA2D 1JEUA 1FQDA 2VP1A 5DVIA 2H99A 4MLVA 2ALUA 3W9WA 3VLWA 3IO4A 1R9LA 3K02A 5ELVA 4YMBA 3B6WA 1I6BA 1ZMGA 1SW2A 2P2AA 4BDQA 4LP2B 2E0SA 1NH8A 4ZEFA 3ODBA 4OVJA 4N07A 3USDA 3LC8A 3R6UA 2Z23A 1LBBA 3IB0A 3H06B 3FV2A 1B7HA 3SETA 1LAXA 2Y7WA 1A55A 4IO2A 3KZGA 4OESA 2QS1A 3G7WA 3FASA 4QHQA 5I57A 3B7DA 3HSTA 5H8SA 1NMUA 4NF4B 1EZOA 3DRIA 3I3VA 1FQAA 4NWDA 4ELQA 3PMWA 1UTHA 2XXXA 4POWA 1NNKA 3K4UA 3M3LA 4P0GA 1OQHA 3RPWA 2WOLA 4ZEDA 1XVYA 4GLIA 3SEUA 4FEBA 4RA1A 3QYTA 3TPAA 3FJ7A 4FEDA 3DRFA 4YKIA 5I56A 2DE3A 4IO3A 1Y9UA 3RNNA 4G77A 1Y3NA 5HM4B 2QMWA 2O1MA 3TDJA 1IXGA 1B3LA 2PT2A 4P11A 3CFXA 5TP9A 4XXUA 2HAUA 2DSFA 2NVUB 4PP0A 3W9VA 4YB5A 2IA4A 1QUJA 3O6GA 4IO5A 4GL8A 5AA2B 5B7DA 2QSXA 1B2HA 2NWJA 3T9VA 4G68A 3VV5A 1EZPA 1UTBA 3OELA 3SEVA 2GH9A 3T22A 4TLLB 3ONMA 4G68C 3FVNA 5AA1A 1IEJA 2WOKA 1MM7A 3OD7A 2DXRA 4QFKA 3U1OA 1OMPA 3KG2A 1MY2A 4JWXA 3TCFA 4QSCA 3IJOB 4ZECA 1JNFA 3D4CA 2XXTA 3KBRA 2D5WA 4H8IA 2HEUA 5BUUA 1N0TA 4U1OA 1Y1MA 5K2XA 2QMXA 2F7AA 4NWCA 3TTKA 2F78A 3K1MA 2A5TA 3SKPA 1YCJA 2I3VA 2ZXTA 1QVSA 1NFTA 1ZJLA 3MAMA 2VGQA 3G3IA 2X7PA 4ELPA 5DVJA 2AIXA 4U2RA 3VE1B 3K2DA 3KOTA 3K0VA 5CM6A 2W7YA 4UACA 2RCBA 4WXJA 2P0SA 1SI0A 4YZZA 1B7UA 4KCCA 4QFLA 3G3HA 4DCXA 1ZIUA 2I58A 3CR9A 3RGYA 3RLFE 2X26A 4YMAA 2B3BA 4F2QA 1Y3PA 1YTVA 1MXWA 3KJTA 3HPIA 2QS2A 4OMBA 3AXFA 3PU5A 3K6VA 3UGWA 2Z22A 4BDOA 1QUKA 2DVZA 3MWBA 1XS5A 2M8CA 3UP9A 4KCDA 2HZKA 1MXZA 1NNFA 3K6XA 2RF1A 1NNPA 3TQLA 4NF4A 3TELA 2CMOA 3MVZA 2XD2A 1LCFA 4DXUA 3LSWA 2Q89A 1B5JA 1D9YA 3KN8A 1FTJA 1J1NA 3SERA 3T9UA 3IOUA 3O28A 1AL3A 5L9OA 3V5AA 4KPTA 1US5A 2O6AA 1OLCA 1T0KA 3OEKA 2UVHA 3QXMA 5BWJA 5CBRA 3OO9A 1B3GA 4O3BA 4EF1A 2I3WA 4F1UA 1USYH 3RTWB 3U94A 4MLQA 4OYVA 1B3HA 3O9PA 4MH5A 3GXAA 2PT1A 1EU8A 4G8MA 2GHAA 1II5A 1OVBA 3D4GA 3SEYA 2UVGA 5HBCA 5CMKA 2PYYA 1B0HA 3CIJA 1TFAA 4HS7A 3QIMA 3IJXB 1ZKBA 5AA2A 1FTOA 3FV1A 1B6HA 1O63A 3Q27A 3TUSA 1UTHB 3LSFB 3IB2A 4JDFA 4H1XA 4YU0A 3RUMA 4OEVA 1YPNA 4N6PA 3C34A 2DYXA 4Q8RA 1GTKA 2Z8EA 4PFUA 1URDA 3S9NC 4GD5A 4OZ9A 5DYHA 3THIA 1A99A 3CFLA 1ZLQA 3E13X 3KGCA 5L9SA 4NEDA 3T66A 2KLFA 3WAFA 4DDDA 3ZSFA 1HSLA 5JK4A 4THIA 4M4GA 3L6HA 2F7BA 3V83A 4G8NA 1B7ZA 4F2OA 4PFTA 3VDFA 5JTYB 4H5FA 3H03A 3R26A 4H67A 4RNSA 3EHTA 2DWAA 4BDNA 1B58A 3MBPA 1MPBA 3EQ1A 4TOZA 1JVXA 4I62A 3ILTB 1POTA 1LFIA 3W15C 2OK2A 3IK6B 4MFIA 3GBAA 1YAEA 3VVEA 1WDNA 1B46A 1MDP1 1CE2A 1SD3A 3KFMA 4Q0CA 4EQBA 3IR1A 1OLAA 4JBZA 3K6WA 5DEXB 4U4XA 4ZZEA 3PPPA 2ZNUA 1SW4A 2FA7A 4F3BA 3TYHA 1B5HA 1I6AA 1QKBA 3VVDA 4F3PA 1VSOA 3N5LA 3N6UA 2HAVA 2ONKE 3LVUA 4EUOA 2RINA 3CSGA 3RTFB 5I58A 4ND9A 3MZBA 2DE4A 1MG1A 3FJGA 2F7CA 3Q25A 2WOPA 1H43A 1SW1A 2ABHA 1FTMA 5FHMA 1MY1A 3H6VA 1N76A 3EF7A 4XKPA 4OFJA 5HPQA 5AA4B 3OO6A 2RCAA 4YAHX 3PPNA 1I6QA 3VLVA 2YPNA 3MZ9A 2XD3A 2RC7A 5TPAB 1ELJA 4R72A 1QULA 2O7UA 5I59A 2PX1A 1DTZA 2V3TA 1A40A 4BDRA 2I6EA 3QSLA 3DP6A 3SDFA 4F29A 3E4RA 1MS7A 5KDTA 3FXUA 4H0WA 1DMBA 4I9DA 1S9TA 2QS4A 2GFEA 3SEWA 3H7MA 1QW0A 2QRYA 3EHUA 4OETA 3OXNA 2OJTA 4EDPA 4X1DA 2R6GE 1B40A 4I8CA 2Y7PA 3BFTA 1B9JA 4R2BA 4QSEA 1WODA 4WEPA 2YJPA 3O2AA 3S9EA 4TLMB 4PFWA 3UIFA 2QS3A 1SBPA 4RK9A 5FTHA 1B5IA 3PPRA 3EN3A 4JXIA 1FQEA 2VHAA 4GXSB 4I1DA 3GZGA 1US4A 3CRBA 2QPQA 4ZEKA 3C9HA 3M3KA 3N26A 2XXHA 2F36A 4C1TA 3DRGA 1DPPA 2DXYA 1VR5A 3PUWE 3VFJA 4OFLA 4H6DA 4LUBA 1PB8A 2UVJA 2H98A 4NF6B 2REJA 2ZYMA 3T9HB 3TODA 2G29A 4KD5A 3PD9A 1GVCA 3HHFA 3CVGA 3FVKA 4ZZAA 5JTYA 4O3CA 4JWOA 4OTEA 5DTBA 3S4UA 3RY3A 1O64A 3MUQA 3PD8A 1TXFA 2DP8A 2G93A 3DP4A 1ATGA 1P1NA 1MH3A 2D3IA 5CBSA 3ZKKA 1S50A 2Q9TA 2XX9A 2DQVA 3ZKLA 1XOCA 3A3UA 3FZVA 3DP8A 3U8QA 4FJPA 1CB6A 3OSRA 5DEXA 4GOTA 2ZNSA 4IGTA 3FVGA 4GF8A 3B6QA 3RQTA 1IXIA 1EH3A 2OWSA 1JW1A 1A54A 4XKNA 4F39A 4QF9A 3RYAA 2AL5A 5ICQA 1JETA 2H4IA 1PBPA 4OERA 1FQFA 4XIGQ 2XXVA 1Q35A 4F22A 3OMBA 5AA3A 3TCGA 1ANFA 3RT6B 4FAJA 3U72A 1LFGA 3FJMA 1B05A 1B32A 2FNCA 3IORA 1S7YA 4KYSA 5AA4A 2H5YA 4NF5B 3IOWA 3TZAA 2F5XA 1R6ZA 5ISUA 3IL1B 2I4CA 5A5XB 1UIUA 5EHSA 2VOZA 4LZ8A 3JZJA 4PFYA 3UA8A 4QSDA 5TPAA 5H8FA 3PUVE 3PUXE 3T9XB 4ESWA 2ANJA 2DS9A 1Z7ME 4YICA 3OEMA 4YKKA 4ECFA 2XXRA 2NUVA 3CG1A 3KEIA 3O6PA 4KYEA 3Q29A 3TTNA 3A09A 2R71A 5CMCA 4WEDA 1N04A 2V93A 3C36A 1RKMA 4EQ7A 5JEIA 1SYIA 4AB5A 3UN6A 3OO8A 3FIRA 3U93A 2V84A 2P1SA 5I58B 4NF8B 1UIVA 2F34A 3MVYA 3C31A 3IO6A 3E9XA 2O84X 5I2NB 2Y7RA 1NL5A 3LSLA 4R73A 2AL4A 2Q2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8F A;  4YB6 A;  2HZL A;  1VFE A;  5TU0 A;  2NOO A;  2F97 A;  4NMY A;  4GQO A;  2B4L A;  3H6T A;  2HQ0 A;  2HFB A;  1LLS A;  3OEN A;  5CC2 A;  3G3G A;  5I59 B;  1MXX A;  4U21 A;  3FD3 A;  1AH5 A;  4EF2 A;  4FEC A;  5KCJ B;  1QKA A;  3IOT A;  4NF6 A;  5KDT B;  4H65 A;  3MP1 A;  1PB7 A;  3FVO A;  4R6K A;  5I2K B;  1P1W A;  1M5D A;  3HCQ A;  4LQ5 A;  1DSN A;  2BJJ X;  4C1U A;  3RN8 A;  2ZMB A;  4ZEI A;  3O6I A;  3N6T A;  2E1S A;  3O97 A;  4M1V A;  3KOS A;  4OWD A;  5M2V A;  5H8N B;  1FCK A;  2FYI A;  2OCU A;  2ZYN A;  2XXQ A;  1IXH A;  3Q26 A;  5H8H B;  5DT6 A;  1NH7 A;  3P7I A;  1A8F A;  1LGB C;  1TFD A;  4RXL A;  1RYX A;  5CMM A;  5ITO A;  1FTL A;  1EZ9 A;  4IY5 A;  4LQ2 A;  4U4S A;  3OOA A;  5F1Q A;  1JEV A;  4LZ5 A;  1N3W A;  3F11 A;  4NE4 A;  4E0X A;  3O29 A;  1SQY A;  3K00 A;  4GXA A;  1JW5 A;  3H4Z A;  3KN7 A;  4GFR A;  3MZ1 A;  3MPL A;  1N7X A;  3FXR A;  3TFL A;  4RPO A;  2UXA A;  4OFO A;  2REG A;  5IAI A;  2PBW A;  3LSX A;  5H8Q B;  4DLD A;  2RKM A;  3VVF A;  1MPD A;  3EHS A;  4H5G A;  4ZE9 A;  4GRK A;  4IO6 A;  4MBP A;  1AOV A;  1VFD A;  1R1N A;  2ZNT A;  1P99 A;  4NF5 A;  1DTG A;  3PV0 E;  4DXB A;  5A5X A;  1LAH E;  2B3F A;  4KFQ A;  4G2Z A;  4ZE8 A;  3B6T A;  1SI1 A;  4BLA A;  3ILU B;  3IX1 A;  2I49 A;  2RC9 A;  2UVI A;  3MQ9 A;  3CG3 A;  1LFH A;  4QRZ A;  4PE5 B;  4LZ7 A;  3ECR A;  4POX A;  3DM0 A;  1MY3 A;  1LB9 A;  3PMX A;  3T96 B;  1PEB A;  5ITP A;  3C35 A;  3UOR A;  4R9G A;  1PC3 A;  1JQF A;  3BBR A;  4DCY A;  2DWI A;  4HW8 A;  1P1Q A;  4JWY A;  3R7X A;  1R9Q A;  3JYR A;  1JW4 A;  4NF8 A;  5FHO A;  1BKA A;  2OBG A;  4OEN A;  4DZ1 A;  1N7W A;  1VE4 A;  2OLB A;  2R9J A;  2CZL A;  5I2N A;  1JVY A;  4ISU A;  4HCW A;  1GV8 A;  1MXV A;  2B65 A;  3EPE A;  3K1P A;  3TCH A;  4EXL A;  1NKX A;  5CMB A;  4AB6 A;  1OVT A;  1ZTY A;  1H3D A;  4EQ9 A;  5K2Y A;  1O7T A;  3TTL A;  2H25 A;  5H8F B;  3DRJ A;  3K6U A;  1FQC A;  4YKJ A;  1Z7N E;  3V89 B;  3LUY A;  4F1V A;  2OWT A;  4G4P A;  1M5C A;  2XXW A;  2AYS A;  1LAF E;  5KCJ A;  4PQJ A;  4U23 A;  4RY1 A;  1RYO A;  1A7L A;  1MQH A;  1FQB A;  5FHN A;  4ELR A;  5I2K A;  3MW0 A;  1Q1K A;  2Y7K A;  3QAX A;  4HCY A;  4QFP A;  3TTM A;  3VXB A;  3JV9 A;  1B1X A;  4UA8 A;  1H44 A;  2V25 A;  2NXO A;  2UYE A;  4F3G A;  5H8N A;  4FE8 A;  2Q88 A;  2THI A;  1IIW A;  4DIG A;  4R6H A;  5H8H A;  2D21 A;  1P1U A;  1MQI A;  4OEU A;  4P0I A;  1IIT A;  4Q30 B;  2I0B A;  2DWH A;  3TEP A;  4BDL A;  4F19 A;  3C32 A;  2Y84 A;  4GVO A;  2HCA A;  4R2F A;  3HN0 A;  4KR5 A;  1B0L A;  4MF3 A;  4KQP A;  1Y1Z A;  1I69 A;  4O3A A;  4XKR A;  5L9M A;  1URS A;  3BKI B;  3LR1 A;  1L5T A;  5CI5 A;  4TQU Q;  5H8Q A;  3TMG A;  2B4M A;  3IOV A;  4FIM A;  3E3K A;  2DWJ A;  4F3S A;  2ZYK A;  1H45 A;  1MM6 A;  1D3K A;  4Z0I A;  3BFU A;  3S2V A;  5KZT A;  4E0W A;  3WAE A;  2F8D A;  1MH4 A;  1BIY A;  1MRP A;  4LON B;  3SEX A;  1SVX B;  3VXC A;  1M5F A;  2XX8 A;  2O1L A;  1LAG E;  3K1N A;  3V8X B;  5EHM A;  3CFZ A;  4GL0 A;  3DRH A;  3VLU A;  3K01 A;  1OIB A;  4EXK A;  4ONY A;  1B3E A;  3DRK A;  1URG A;  3GLB A;  1BP5 A;  1KWH A;  1Y4C A;  3KJ7 A;  1DOT A;  4Z7E A;  1D4N A;  3QUJ A;  4JB7 A;  4X9T A;  1WVJ A;  4KHZ E;  1UQW A;  1SDX A;  4IY6 A;  1N3X A;  2ESN A;  4OQO A;  4JSO A;  1MQD A;  3GBB A;  5IKB A;  3PUZ E;  4R6Y A;  4HTG A;  3G3J A;  2I48 A;  3PMV A;  3O6H A;  2XXY A;  4U1Z A;  1PBQ A;  4RPN A;  3OSQ A;  4LAT A;  1N84 A;  1MDQ A;  1SYH A;  2PMS A;  1DPE A;  1POY 1;  1ZBM A;  3C4M A;  1HSJ A;  1QJM A;  1FW0 A;  3PPQ A;  3T93 B;  4ESX A;  1SW5 A;  4F18 A;  4LA9 A;  2XXI A;  2PVU A;  2RC8 A;  2YLN A;  2F6G A;  4Q5T A;  4U22 A;  3H6U A;  4F1Y A;  3I5O A;  4PET A;  1XT8 A;  1B52 A;  2WKY A;  1MPC A;  3I6V A;  1M5B A;  2O7I A;  2IEE A;  5EYF A;  1USY E;  1PDA A;  4K3F A;  4AQ4 A;  3DLN A;  4WKM A;  3CSB A;  4RYA A;  1TT1 A;  4DXC A;  1XHY A;  3DEL B;  4DE8 A;  3MVW A;  1B3F A;  2Q8J A;  3FGS A;  2O69 A;  1HSE A;  1XC1 A;  5LOM A;  4IGR A;  3H6W A;  1PB9 A;  5CRY A;  4BDM A;  3PAM A;  3CI8 A;  3FTO A;  4ZS9 A;  1Y3Q A;  4R74 A;  3TKD A;  2ZYO A;  2GHB A;  2H9B A;  1H76 A;  3MVX A;  3PGF A;  1MXU A;  1FTK A;  2F35 A;  1F9B A;  4GWO A;  4ELO A;  3U92 A;  3N94 A;  1BTJ A;  1GGG A;  3Q28 A;  1TWY A;  2Y7I A;  2OZZ A;  3LBS A;  5J1D A;  3OO7 A;  4N13 A;  1NNT A;  4GIZ A;  3TAJ A;  2ONS A;  1XVX A;  1MY0 A;  4R9F A;  1A8E A;  2HXW A;  1B4H A;  5I84 A;  1IQ7 A;  5I57 B;  4IO7 A;  1P1O A;  2I0C A;  4ZEB A;  2F6P A;  2ONR A;  1AMF A;  4IO4 A;  3M8U A;  3HV1 A;  4KI0 E;  3HO7 A;  3RT8 A;  3KSX A;  3C33 A;  2Z8D A;  3MP8 A;  5DVF A;  3G3K A;  4RK2 A;  5AE4 A;  3M3F A;  1D9V A;  4XTC Q;  4QFN A;  3MPK A;  5I56 B;  4JSD A;  3H3G A;  2VD2 A;  3L6G A;  3QUF A;  1AIV A;  2O68 A;  2XXU A;  3MJN A;  5TP9 B;  4FOR A;  1BLF A;  4XKQ A;  5B70 A;  3G3F A;  3RYB A;  3IB1 A;  2V3Q A;  3S9L C;  3PUY E;  3ZS6 A;  2XHD A;  3KSJ A;  2X7Q A;  1MXY A;  1B1H A;  1IZ1 A;  1MQJ A;  4RJZ A;  3FUZ A;  4FAT A;  3TQW A;  4G68 B;  2DE2 A;  4KYD A;  5F7V A;  2A5S A;  3CHG A;  1M5E A;  3HHG A;  1UTB B;  5FTI A;  1ZU0 A;  2V3U A;  3QK6 A;  4F31 B;  4QFO A;  4YKP A;  4ZDM A;  1IUD A;  1LB8 A;  1GR2 A;  2QL3 A;  2XX7 A;  4L17 A;  5L8D A;  1QUI A;  1OQG A;  4G8H A;  1Y4T A;  4C0R A;  1LST A;  3O66 A;  2DVC A;  4YB7 A;  4OXV A;  1MQG A;  4NTL A;  2QJE A;  3TTR A;  4X1B A;  3PPO A;  3UK4 A;  4X48 A;  1LCT A;  1IXC A;  2VD3 A;  2Q2C A;  4IB2 A;  2A5T B;  2I4B A;  3KN3 A;  1MY4 A;  4OHN A;  3A3C A;  4LVQ A;  3IAZ A;  2LAO A;  2O51 A;  5ICT A;  2XXP A;  1LBC A;  1Y20 A;  2GRV A;  4R75 A;  3S9M C;  4H8J A;  1B51 A;  2UYF A;  3FXQ A;  3SES A;  1B4Z A;  3FAT A;  2DOJ A;  3MP6 A;  3MC2 A;  5AA2 D;  1JEU A;  1FQD A;  2VP1 A;  5DVI A;  2H99 A;  4MLV A;  2ALU A;  3W9W A;  3VLW A;  3IO4 A;  1R9L A;  3K02 A;  5ELV A;  4YMB A;  3B6W A;  1I6B A;  1ZMG A;  1SW2 A;  2P2A A;  4BDQ A;  4LP2 B;  2E0S A;  1NH8 A;  4ZEF A;  3ODB A;  4OVJ A;  4N07 A;  3USD A;  3LC8 A;  3R6U A;  2Z23 A;  1LBB A;  3IB0 A;  3H06 B;  3FV2 A;  1B7H A;  3SET A;  1LAX A;  2Y7W A;  1A55 A;  4IO2 A;  3KZG A;  4OES A;  2QS1 A;  3G7W A;  3FAS A;  4QHQ A;  5I57 A;  3B7D A;  3HST A;  5H8S A;  1NMU A;  4NF4 B;  1EZO A;  3DRI A;  3I3V A;  1FQA A;  4NWD A;  4ELQ A;  3PMW A;  1UTH A;  2XXX A;  4POW A;  1NNK A;  3K4U A;  3M3L A;  4P0G A;  1OQH A;  3RPW A;  2WOL A;  4ZED A;  1XVY A;  4GLI A;  3SEU A;  4FEB A;  4RA1 A;  3QYT A;  3TPA A;  3FJ7 A;  4FED A;  3DRF A;  4YKI A;  5I56 A;  2DE3 A;  4IO3 A;  1Y9U A;  3RNN A;  4G77 A;  1Y3N A;  5HM4 B;  2QMW A;  2O1M A;  3TDJ A;  1IXG A;  1B3L A;  2PT2 A;  4P11 A;  3CFX A;  5TP9 A;  4XXU A;  2HAU A;  2DSF A;  2NVU B;  4PP0 A;  3W9V A;  4YB5 A;  2IA4 A;  1QUJ A;  3O6G A;  4IO5 A;  4GL8 A;  5AA2 B;  5B7D A;  2QSX A;  1B2H A;  2NWJ A;  3T9V A;  4G68 A;  3VV5 A;  1EZP A;  1UTB A;  3OEL A;  3SEV A;  2GH9 A;  3T22 A;  4TLL B;  3ONM A;  4G68 C;  3FVN A;  5AA1 A;  1IEJ A;  2WOK A;  1MM7 A;  3OD7 A;  2DXR A;  4QFK A;  3U1O A;  1OMP A;  3KG2 A;  1MY2 A;  4JWX A;  3TCF A;  4QSC A;  3IJO B;  4ZEC A;  1JNF A;  3D4C A;  2XXT A;  3KBR A;  2D5W A;  4H8I A;  2HEU A;  5BUU A;  1N0T A;  4U1O A;  1Y1M A;  5K2X A;  2QMX A;  2F7A A;  4NWC A;  3TTK A;  2F78 A;  3K1M A;  2A5T A;  3SKP A;  1YCJ A;  2I3V A;  2ZXT A;  1QVS A;  1NFT A;  1ZJL A;  3MAM A;  2VGQ A;  3G3I A;  2X7P A;  4ELP A;  5DVJ A;  2AIX A;  4U2R A;  3VE1 B;  3K2D A;  3KOT A;  3K0V A;  5CM6 A;  2W7Y A;  4UAC A;  2RCB A;  4WXJ A;  2P0S A;  1SI0 A;  4YZZ A;  1B7U A;  4KCC A;  4QFL A;  3G3H A;  4DCX A;  1ZIU A;  2I58 A;  3CR9 A;  3RGY A;  3RLF E;  2X26 A;  4YMA A;  2B3B A;  4F2Q A;  1Y3P A;  1YTV A;  1MXW A;  3KJT A;  3HPI A;  2QS2 A;  4OMB A;  3AXF A;  3PU5 A;  3K6V A;  3UGW A;  2Z22 A;  4BDO A;  1QUK A;  2DVZ A;  3MWB A;  1XS5 A;  2M8C A;  3UP9 A;  4KCD A;  2HZK A;  1MXZ A;  1NNF A;  3K6X A;  2RF1 A;  1NNP A;  3TQL A;  4NF4 A;  3TEL A;  2CMO A;  3MVZ A;  2XD2 A;  1LCF A;  4DXU A;  3LSW A;  2Q89 A;  1B5J A;  1D9Y A;  3KN8 A;  1FTJ A;  1J1N A;  3SER A;  3T9U A;  3IOU A;  3O28 A;  1AL3 A;  5L9O A;  3V5A A;  4KPT A;  1US5 A;  2O6A A;  1OLC A;  1T0K A;  3OEK A;  2UVH A;  3QXM A;  5BWJ A;  5CBR A;  3OO9 A;  1B3G A;  4O3B A;  4EF1 A;  2I3W A;  4F1U A;  1USY H;  3RTW B;  3U94 A;  4MLQ A;  4OYV A;  1B3H A;  3O9P A;  4MH5 A;  3GXA A;  2PT1 A;  1EU8 A;  4G8M A;  2GHA A;  1II5 A;  1OVB A;  3D4G A;  3SEY A;  2UVG A;  5HBC A;  5CMK A;  2PYY A;  1B0H A;  3CIJ A;  1TFA A;  4HS7 A;  3QIM A;  3IJX B;  1ZKB A;  5AA2 A;  1FTO A;  3FV1 A;  1B6H A;  1O63 A;  3Q27 A;  3TUS A;  1UTH B;  3LSF B;  3IB2 A;  4JDF A;  4H1X A;  4YU0 A;  3RUM A;  4OEV A;  1YPN A;  4N6P A;  3C34 A;  2DYX A;  4Q8R A;  1GTK A;  2Z8E A;  4PFU A;  1URD A;  3S9N C;  4GD5 A;  4OZ9 A;  5DYH A;  3THI A;  1A99 A;  3CFL A;  1ZLQ A;  3E13 X;  3KGC A;  5L9S A;  4NED A;  3T66 A;  2KLF A;  3WAF A;  4DDD A;  3ZSF A;  1HSL A;  5JK4 A;  4THI A;  4M4G A;  3L6H A;  2F7B A;  3V83 A;  4G8N A;  1B7Z A;  4F2O A;  4PFT A;  3VDF A;  5JTY B;  4H5F A;  3H03 A;  3R26 A;  4H67 A;  4RNS A;  3EHT A;  2DWA A;  4BDN A;  1B58 A;  3MBP A;  1MPB A;  3EQ1 A;  4TOZ A;  1JVX A;  4I62 A;  3ILT B;  1POT A;  1LFI A;  3W15 C;  2OK2 A;  3IK6 B;  4MFI A;  3GBA A;  1YAE A;  3VVE A;  1WDN A;  1B46 A;  1MDP 1;  1CE2 A;  1SD3 A;  3KFM A;  4Q0C A;  4EQB A;  3IR1 A;  1OLA A;  4JBZ A;  3K6W A;  5DEX B;  4U4X A;  4ZZE A;  3PPP A;  2ZNU A;  1SW4 A;  2FA7 A;  4F3B A;  3TYH A;  1B5H A;  1I6A A;  1QKB A;  3VVD A;  4F3P A;  1VSO A;  3N5L A;  3N6U A;  2HAV A;  2ONK E;  3LVU A;  4EUO A;  2RIN A;  3CSG A;  3RTF B;  5I58 A;  4ND9 A;  3MZB A;  2DE4 A;  1MG1 A;  3FJG A;  2F7C A;  3Q25 A;  2WOP A;  1H43 A;  1SW1 A;  2ABH A;  1FTM A;  5FHM A;  1MY1 A;  3H6V A;  1N76 A;  3EF7 A;  4XKP A;  4OFJ A;  5HPQ A;  5AA4 B;  3OO6 A;  2RCA A;  4YAH X;  3PPN A;  1I6Q A;  3VLV A;  2YPN A;  3MZ9 A;  2XD3 A;  2RC7 A;  5TPA B;  1ELJ A;  4R72 A;  1QUL A;  2O7U A;  5I59 A;  2PX1 A;  1DTZ A;  2V3T A;  1A40 A;  4BDR A;  2I6E A;  3QSL A;  3DP6 A;  3SDF A;  4F29 A;  3E4R A;  1MS7 A;  5KDT A;  3FXU A;  4H0W A;  1DMB A;  4I9D A;  1S9T A;  2QS4 A;  2GFE A;  3SEW A;  3H7M A;  1QW0 A;  2QRY A;  3EHU A;  4OET A;  3OXN A;  2OJT A;  4EDP A;  4X1D A;  2R6G E;  1B40 A;  4I8C A;  2Y7P A;  3BFT A;  1B9J A;  4R2B A;  4QSE A;  1WOD A;  4WEP A;  2YJP A;  3O2A A;  3S9E A;  4TLM B;  4PFW A;  3UIF A;  2QS3 A;  1SBP A;  4RK9 A;  5FTH A;  1B5I A;  3PPR A;  3EN3 A;  4JXI A;  1FQE A;  2VHA A;  4GXS B;  4I1D A;  3GZG A;  1US4 A;  3CRB A;  2QPQ A;  4ZEK A;  3C9H A;  3M3K A;  3N26 A;  2XXH A;  2F36 A;  4C1T A;  3DRG A;  1DPP A;  2DXY A;  1VR5 A;  3PUW E;  3VFJ A;  4OFL A;  4H6D A;  4LUB A;  1PB8 A;  2UVJ A;  2H98 A;  4NF6 B;  2REJ A;  2ZYM A;  3T9H B;  3TOD A;  2G29 A;  4KD5 A;  3PD9 A;  1GVC A;  3HHF A;  3CVG A;  3FVK A;  4ZZA A;  5JTY A;  4O3C A;  4JWO A;  4OTE A;  5DTB A;  3S4U A;  3RY3 A;  1O64 A;  3MUQ A;  3PD8 A;  1TXF A;  2DP8 A;  2G93 A;  3DP4 A;  1ATG A;  1P1N A;  1MH3 A;  2D3I A;  5CBS A;  3ZKK A;  1S50 A;  2Q9T A;  2XX9 A;  2DQV A;  3ZKL A;  1XOC A;  3A3U A;  3FZV A;  3DP8 A;  3U8Q A;  4FJP A;  1CB6 A;  3OSR A;  5DEX A;  4GOT A;  2ZNS A;  4IGT A;  3FVG A;  4GF8 A;  3B6Q A;  3RQT A;  1IXI A;  1EH3 A;  2OWS A;  1JW1 A;  1A54 A;  4XKN A;  4F39 A;  4QF9 A;  3RYA A;  2AL5 A;  5ICQ A;  1JET A;  2H4I A;  1PBP A;  4OER A;  1FQF A;  4XIG Q;  2XXV A;  1Q35 A;  4F22 A;  3OMB A;  5AA3 A;  3TCG A;  1ANF A;  3RT6 B;  4FAJ A;  3U72 A;  1LFG A;  3FJM A;  1B05 A;  1B32 A;  2FNC A;  3IOR A;  1S7Y A;  4KYS A;  5AA4 A;  2H5Y A;  4NF5 B;  3IOW A;  3TZA A;  2F5X A;  1R6Z A;  5ISU A;  3IL1 B;  2I4C A;  5A5X B;  1UIU A;  5EHS A;  2VOZ A;  4LZ8 A;  3JZJ A;  4PFY A;  3UA8 A;  4QSD A;  5TPA A;  5H8F A;  3PUV E;  3PUX E;  3T9X B;  4ESW A;  2ANJ A;  2DS9 A;  1Z7M E;  4YIC A;  3OEM A;  4YKK A;  4ECF A;  2XXR A;  2NUV A;  3CG1 A;  3KEI A;  3O6P A;  4KYE A;  3Q29 A;  3TTN A;  3A09 A;  2R71 A;  5CMC A;  4WED A;  1N04 A;  2V93 A;  3C36 A;  1RKM A;  4EQ7 A;  5JEI A;  1SYI A;  4AB5 A;  3UN6 A;  3OO8 A;  3FIR A;  3U93 A;  2V84 A;  2P1S A;  5I58 B;  4NF8 B;  1UIV A;  2F34 A;  3MVY A;  3C31 A;  3IO6 A;  3E9X A;  2O84 X;  5I2N B;  2Y7R A;  1NL5 A;  3LSL A;  4R73 A;  2AL4 A;  2Q2A A; 
#chains in the Genus database with same CATH topology
 2Z8F A;  4YB6 A;  2HZL A;  1VFE A;  5TU0 A;  2NOO A;  2F97 A;  4NMY A;  3T1B A;  4GQO A;  2B4L A;  3H6T A;  2HQ0 A;  2HFB A;  1LLS A;  3OEN A;  5CC2 A;  3G3G A;  5I59 B;  1MXX A;  1NI9 A;  4U21 A;  3FD3 A;  1AH5 A;  4EF2 A;  2QVR A;  4PFR A;  4FEC A;  5KCJ B;  1QKA A;  3IOT A;  4NF6 A;  5KDT B;  4H65 A;  3MP1 A;  1PB7 A;  3FVO A;  4UAB A;  1FTA A;  1D9Q A;  4R6K A;  5I2K B;  4JVD A;  1P1W A;  1M5D A;  3HCQ A;  4LQ5 A;  1DSN A;  2BJJ X;  4C1U A;  3RN8 A;  2ZMB A;  4ZEI A;  3O6I A;  3N6T A;  2E1S A;  3O97 A;  4M1V A;  2OX3 A;  3KOS A;  4OWD A;  5M2V A;  5H8N B;  1FCK A;  2FYI A;  2HXR A;  1FPD A;  2OCU A;  2ZYN A;  2XXQ A;  1IXH A;  3Q26 A;  5H8H B;  5DT6 A;  1NH7 A;  3P7I A;  1IMF A;  1A8F A;  1FBG A;  1LGB C;  1TFD A;  4RXL A;  1RYX A;  4O7I A;  5CMM A;  1SPI A;  5ITO A;  1FTL A;  1EZ9 A;  4IY5 A;  4LQ2 A;  4U4S A;  1LEV A;  3OOA A;  5F1Q A;  1JEV A;  4JVI A;  4LZ5 A;  2QFL A;  1N3W A;  3F11 A;  4NE4 A;  4E0X A;  1FPB A;  3O29 A;  1SQY A;  3K00 A;  2WX9 A;  5ET8 A;  4GXA A;  1JW5 A;  3H4Z A;  3KN7 A;  4GFR A;  3MZ1 A;  3MPL A;  1N7X A;  3FXR A;  3TFL A;  2P3N A;  4RPO A;  2UXA A;  4OFO A;  2REG A;  4PFI A;  5IAI A;  2PBW A;  3LSX A;  5H8Q B;  4DLD A;  2RKM A;  3VVF A;  1MPD A;  3EHS A;  4H5G A;  4ZE9 A;  4GRK A;  4IO6 A;  4MBP A;  1AOV A;  1VFD A;  1R1N A;  2ZNT A;  1P99 A;  4NF5 A;  4P9K A;  1DTG A;  3PV0 E;  4DXB A;  5A5X A;  1LAH E;  2B3F A;  4KFQ A;  4G2Z A;  4ZE8 A;  1DBZ A;  3B6T A;  1SI1 A;  4BLA A;  3ILU B;  3IX1 A;  2I49 A;  4GWU A;  2RC9 A;  4PAF A;  2UVI A;  3MYU A;  3MQ9 A;  3CG3 A;  1LFH A;  4QRZ A;  4PE5 B;  1LBZ A;  4G61 A;  4LZ7 A;  3ECR A;  4POX A;  4P47 A;  3DM0 A;  1MY3 A;  1RDZ A;  1LB9 A;  3PMX A;  3T96 B;  1PEB A;  2WYP A;  5ITP A;  3C35 A;  3UOR A;  4R9G A;  1PC3 A;  1JQF A;  3BBR A;  4DCY A;  2DWI A;  4HW8 A;  1P1Q A;  4JWY A;  4O8M A;  1R9Q A;  3R7X A;  3JYR A;  1JW4 A;  4NF8 A;  5FHO A;  1BKA A;  4GWS A;  2OBG A;  4OEN A;  4DZ1 A;  2FIX A;  1N7W A;  1VE4 A;  2OLB A;  2R9J A;  2CZL A;  5I2N A;  1JVY A;  4ISU A;  4HCW A;  1GV8 A;  1MXV A;  2B65 A;  3EPE A;  3K1P A;  3TCH A;  4KXP A;  4HE0 A;  4EXL A;  1NKX A;  5CMB A;  4AB6 A;  1OVT A;  1ZTY A;  1H3D A;  4EQ9 A;  3ISP A;  4N6D A;  5K2Y A;  1O7T A;  3BIH A;  3TTL A;  2H25 A;  5H8F B;  3DRJ A;  3K6U A;  1FQC A;  4YKJ A;  4FBP A;  1Z7N E;  3V89 B;  3LUY A;  4F1V A;  2OWT A;  4G4P A;  1M5C A;  2XXW A;  2AYS A;  1LAF E;  5KCJ A;  4PQJ A;  2JJK A;  4U23 A;  4RY1 A;  1RYO A;  4MAG A;  1A7L A;  1MQH A;  1FQB A;  5FHN A;  4X04 A;  5I3S A;  4ELR A;  5I2K A;  3MW0 A;  1LBY A;  1Q1K A;  2Y7K A;  3QAX A;  5F24 A;  4HCY A;  3RYD A;  4QFP A;  3TTM A;  1LBW A;  4H46 A;  3VXB A;  3JV9 A;  4PFB A;  1B1X A;  4UA8 A;  1H44 A;  2V25 A;  2NXO A;  2UYE A;  4F3G A;  5H8N A;  4FE8 A;  1NUY A;  2Q88 A;  4PF8 A;  2THI A;  1IIW A;  4DIG A;  4R6H A;  5H8H A;  2D21 A;  1P1U A;  2CZI A;  1MQI A;  4OEU A;  4P0I A;  1IIT A;  4Q30 B;  2I0B A;  2DWH A;  1JP4 A;  3TEP A;  4IR8 A;  4BDL A;  4F19 A;  3C32 A;  2Y84 A;  4GVO A;  2HCA A;  4R2F A;  3HN0 A;  4KR5 A;  1B0L A;  4MF3 A;  4KQP A;  1Y1Z A;  1I69 A;  4O3A A;  4XKR A;  5L9M A;  1URS A;  3BKI B;  3LR1 A;  1L5T A;  5CI5 A;  4PBQ A;  4TQU Q;  5H8Q A;  3TMG A;  2B4M A;  3IOV A;  4FIM A;  3E3K A;  4GWY A;  2L5V A;  2DWJ A;  4F3S A;  2WBB A;  2ZYK A;  1H45 A;  1MM6 A;  1D3K A;  4Z0I A;  4HE2 A;  3BFU A;  3S2V A;  5KZT A;  4E0W A;  2XWO A;  1FPJ A;  3WAE A;  2F8D A;  1MH4 A;  4PGP A;  1BIY A;  1MRP A;  4LON B;  3SEX A;  1SVX B;  1FBH A;  1FJ9 A;  3VXC A;  1M5F A;  2XX8 A;  2O1L A;  1LAG E;  3K1N A;  5T3J A;  3V8X B;  5EHM A;  3CFZ A;  5FBP A;  4GL0 A;  5ET6 A;  3DRH A;  3VLU A;  3K01 A;  1OIB A;  1K9Z A;  4EXK A;  1NV0 A;  3FXB A;  4ONY A;  1B3E A;  2WEF A;  3DRK A;  1URG A;  3GLB A;  1BP5 A;  1KWH A;  1Y4C A;  3KJ7 A;  1DOT A;  4Z7E A;  1D4N A;  3QUJ A;  4JB7 A;  4X9T A;  1WVJ A;  4KHZ E;  1UQW A;  1SDX A;  2PFY A;  4H45 A;  4NHB A;  4IY6 A;  1N3X A;  4MX6 A;  2ESN A;  4PF6 A;  4OQO A;  4JSO A;  1MQD A;  3GBB A;  4XFE A;  5IKB A;  3PUZ E;  2GQ1 A;  4R6Y A;  4HTG A;  3G3J A;  2I48 A;  3PMV A;  3O6H A;  2XXY A;  4U1Z A;  1XI6 A;  1PBQ A;  4RPN A;  3OSQ A;  4LAT A;  1K9Y A;  1N84 A;  1MDQ A;  1SYH A;  2PMS A;  1DPE A;  1POY 1;  1ZBM A;  3C4M A;  1HSJ A;  1QJM A;  1FW0 A;  2Y5L A;  3PPQ A;  3T93 B;  4ESX A;  1SW5 A;  4F18 A;  4N8G A;  4LA9 A;  2XXI A;  2PVU A;  4AS5 A;  2RC8 A;  2YLN A;  2F6G A;  4Q5T A;  1NV1 A;  4U22 A;  3H6U A;  1NV5 A;  4F1Y A;  3I5O A;  4PET A;  1XT8 A;  1B52 A;  5EQA A;  2WKY A;  1MPC A;  3I6V A;  1M5B A;  2O7I A;  2IEE A;  3PTY A;  5EYF A;  1USY E;  1PDA A;  4K3F A;  4AQ4 A;  3DLN A;  4WKM A;  3CSB A;  4RYA A;  1TT1 A;  4DXC A;  1XHY A;  3DEL B;  4DE8 A;  3MVW A;  1B3F A;  1NV3 A;  2Q8J A;  4MMP A;  3FGS A;  2O69 A;  1HSE A;  1XC1 A;  5LOM A;  4IGR A;  3H6W A;  4NGU A;  1PB9 A;  2Q74 A;  5CRY A;  4X8R A;  4BDM A;  3PAM A;  3CI8 A;  3FTO A;  4ZS9 A;  2CEY A;  1Y3Q A;  4R74 A;  1FRP A;  3TKD A;  4OAN A;  2ZYO A;  2GHB A;  2H9B A;  2OWZ A;  1H76 A;  3MVX A;  3PGF A;  1MXU A;  1FTK A;  2F35 A;  1F9B A;  4GWO A;  4ELO A;  3U92 A;  3N94 A;  3T0J A;  3A29 A;  1BTJ A;  1GGG A;  3Q28 A;  1TWY A;  5IZ3 B;  2Y7I A;  4GX3 A;  3D1R A;  2OZZ A;  3LBS A;  5J1D A;  3OO7 A;  4N13 A;  1NNT A;  1CNQ A;  4GIZ A;  3TAJ A;  2ONS A;  4NG7 A;  1XVX A;  1MY0 A;  1IMB A;  4R9F A;  1A8E A;  2HXW A;  1B4H A;  5I84 A;  1IQ7 A;  5J16 A;  5I57 B;  4IO7 A;  2ZZW A;  1P1O A;  2I0C A;  4ZEB A;  2F6P A;  2ONR A;  1AMF A;  4IO4 A;  4PAK A;  3M8U A;  3HV1 A;  4KI0 E;  3HO7 A;  3RT8 A;  3RPL B;  3KSX A;  3C33 A;  2Z8D A;  3MP8 A;  5DVF A;  3G3K A;  4RK2 A;  5AE4 A;  1FJ6 A;  3M3F A;  5I5P A;  2ZZV A;  1D9V A;  4XTC Q;  4QFN A;  3MPK A;  5I56 B;  4JSD A;  3H3G A;  2VD2 A;  3L6G A;  1FPF A;  3QUF A;  1DCU A;  1AIV A;  5EQ8 A;  1FPE A;  2O68 A;  2XXU A;  3MJN A;  5TP9 B;  4FOR A;  2FBP A;  2FVZ A;  1NUX A;  4GWW A;  1BLF A;  4HE1 A;  4XKQ A;  5B70 A;  3G3F A;  3RYB A;  3IB1 A;  4PE3 A;  4PDD A;  2V3Q A;  4MHF A;  3S9L C;  3PUY E;  3ZS6 A;  2XHD A;  3KSJ A;  2X7Q A;  1MXY A;  4PAI A;  2VPO A;  1B1H A;  1IZ1 A;  1MQJ A;  4RJZ A;  3FUZ A;  4FAT A;  3TQW A;  4G68 B;  2DE2 A;  4KYD A;  5F7V A;  2A5S A;  3CHG A;  1M5E A;  2QVV A;  5EYH A;  3HHG A;  1UTB B;  5FTI A;  4NQ8 A;  1ZU0 A;  1KZ8 A;  4PBH A;  2V3U A;  3QK6 A;  4F31 B;  4QFO A;  4YKP A;  4ZDM A;  1IUD A;  1LB8 A;  1GR2 A;  2QL3 A;  2XX7 A;  1LBX A;  4L17 A;  4MIJ A;  5L8D A;  5ET7 A;  1QUI A;  1OQG A;  4G8H A;  1Y4T A;  4C0R A;  1LST A;  3B50 A;  3O66 A;  4P1E A;  2DVC A;  4YB7 A;  4OXV A;  1MQG A;  4NTL A;  2QJE A;  3TTR A;  4X1B A;  3PPO A;  3UK4 A;  4X48 A;  1LCT A;  1IXC A;  2VD3 A;  2Q2C A;  4IB2 A;  2A5T B;  4XF5 A;  2I4B A;  3KN3 A;  1MY4 A;  4OHN A;  3A3C A;  4LVQ A;  3IAZ A;  2LAO A;  2O51 A;  5ICT A;  2XXP A;  1LBC A;  1Y20 A;  2GRV A;  4N81 A;  4R75 A;  3S9M C;  4MEV A;  4H8J A;  4OVS A;  1B51 A;  2UYF A;  3FXQ A;  5EYG A;  3SES A;  5EQ7 A;  1B4Z A;  3FAT A;  2DOJ A;  1NV2 A;  3MP6 A;  3MC2 A;  5AA2 D;  1JEU A;  1FQD A;  4GX4 A;  2VP1 A;  5DVI A;  2H99 A;  4MLV A;  2ALU A;  3W9W A;  3VLW A;  3IO4 A;  1R9L A;  3K02 A;  5ELV A;  4YMB A;  3B6W A;  1I6B A;  4MNC A;  1ZMG A;  1SW2 A;  2P2A A;  2CZH A;  4BDQ A;  4LP2 B;  2E0S A;  1NH8 A;  4ZEF A;  1KA0 A;  3ODB A;  3QMF A;  4OVJ A;  4N07 A;  4OA4 A;  3USD A;  3LC8 A;  3R6U A;  2Z23 A;  1LBB A;  3IB0 A;  3H06 B;  3FV2 A;  5IZ3 A;  1B7H A;  1VDW A;  3SET A;  1LAX A;  2Y7W A;  1A55 A;  4IO2 A;  1NUZ A;  4DI4 B;  3KZG A;  4OES A;  2QS1 A;  3G7W A;  3FAS A;  4QHQ A;  5DW8 A;  5I57 A;  2XWK A;  1QGX A;  3B7D A;  3HST A;  5H8S A;  1NMU A;  4NF4 B;  2HPG A;  1FPK A;  1EZO A;  3DRI A;  3I3V A;  1FQA A;  4NWD A;  4ELQ A;  1NV4 A;  3PMW A;  1UTH A;  2XXX A;  4POW A;  1NNK A;  3K4U A;  4I40 A;  3RPL A;  3M3L A;  4P0G A;  1OQH A;  3RPW A;  2WOL A;  4ZED A;  3E79 A;  1XVY A;  4GLI A;  3SEU A;  1NUW A;  4FEB A;  4RA1 A;  2XWI A;  3QYT A;  3TPA A;  3FJ7 A;  4FED A;  3DRF A;  4YKI A;  4GWZ A;  5I56 A;  2DE3 A;  4IO3 A;  1Y9U A;  4I3Y A;  1AWB A;  3RNN A;  4G77 A;  1Y3N A;  5HM4 B;  2QMW A;  2O1M A;  3TDJ A;  1IXG A;  3ROJ A;  1B3L A;  2PT2 A;  5IM2 A;  4P11 A;  3CFX A;  5TP9 A;  2Q8M A;  3LV0 A;  4XXU A;  2HAU A;  2DSF A;  2XXK A;  4GX6 A;  2FHY A;  2NVU B;  4PP0 A;  3W9V A;  4YB5 A;  2IA4 A;  1QUJ A;  2VT5 A;  3O6G A;  4IO5 A;  4GL8 A;  2XA5 A;  5AA2 B;  4QBA A;  5B7D A;  2QSX A;  1B2H A;  2NWJ A;  3T9V A;  4G68 A;  4QXD A;  4PDH A;  3VV5 A;  1EZP A;  1UTB A;  3OEL A;  3SEV A;  2GH9 A;  3T22 A;  4TLL B;  3ONM A;  4G68 C;  3FVN A;  2KQZ A;  5AA1 A;  1IEJ A;  2WOK A;  3BIG A;  1MM7 A;  3OD7 A;  4I3E A;  2DXR A;  4QFK A;  3U1O A;  1OMP A;  3KG2 A;  1MY2 A;  4JWX A;  3TCF A;  4QSC A;  3IJO B;  4ZEC A;  1JNF A;  3D4C A;  2XXT A;  3KBR A;  1FBD A;  2D5W A;  4H8I A;  2HEU A;  5BUU A;  1N0T A;  4U1O A;  1Y1M A;  5K2X A;  2QMX A;  2F7A A;  3SZP A;  4NWC A;  3TTK A;  2F78 A;  3K1M A;  2A5T A;  3SKP A;  1YCJ A;  2I3V A;  2ZXT A;  1IME A;  2WBD A;  1QVS A;  1NFT A;  1ZJL A;  3MAM A;  2VGQ A;  1YZ0 A;  3G3I A;  2X7P A;  4ELP A;  5DVJ A;  5LDZ A;  2AIX A;  4U2R A;  4MJO A;  3VE1 B;  3K2D A;  3KOT A;  3K0V A;  5CM6 A;  2W7Y A;  4UAC A;  2RCB A;  4WXJ A;  2P0S A;  1EYK A;  1SI0 A;  4YZZ A;  1B7U A;  4KCC A;  4QFL A;  3G3H A;  3KBZ A;  3EKI A;  4DCX A;  1NV6 A;  1ZIU A;  2I58 A;  3CR9 A;  3RGY A;  3RLF E;  2X26 A;  4YMA A;  2B3B A;  1Y3P A;  1YTV A;  1MXW A;  4F2Q A;  3KJT A;  3HPI A;  2QS2 A;  4OMB A;  3AXF A;  3PU5 A;  3K6V A;  3UGW A;  2Z22 A;  4BDO A;  5I7I A;  1QUK A;  4PC9 A;  2DVZ A;  3MWB A;  5IZ1 A;  1XS5 A;  2M8C A;  3UP9 A;  4KCD A;  2HZK A;  1MXZ A;  1NNF A;  3K6X A;  1DK4 A;  2RF1 A;  1NNP A;  3TQL A;  4NF4 A;  1FBF A;  3TEL A;  2CMO A;  3MVZ A;  2XD2 A;  4N6K A;  1LCF A;  4DXU A;  3LSW A;  2Q89 A;  1B5J A;  1D9Y A;  3KN8 A;  1FTJ A;  1J1N A;  3SER A;  3T9U A;  3IOU A;  3O28 A;  1AL3 A;  5L9O A;  3V5A A;  4KPT A;  2BJI A;  1US5 A;  2O6A A;  1OLC A;  3MST A;  1T0K A;  4JVC A;  3OEK A;  2UVH A;  3QXM A;  5BWJ A;  5CBR A;  3OO9 A;  1B3G A;  2HHM A;  2PFZ A;  4O3B A;  4EF1 A;  4N4U A;  3KC1 A;  2I3W A;  4F1U A;  1USY H;  3RTW B;  3U94 A;  4MLQ A;  4OYV A;  1B3H A;  3O9P A;  4MH5 A;  3GXA A;  2PT1 A;  1EU8 A;  2R8T A;  2QVU A;  4G8M A;  2GHA A;  1II5 A;  3LUZ A;  1OVB A;  3D4G A;  4MCO A;  3KC0 A;  3SEY A;  2UVG A;  5HBC A;  1FPG A;  5CMK A;  2PYY A;  1B0H A;  3CIJ A;  1TFA A;  4HS7 A;  3QIM A;  3IJX B;  1ZKB A;  5AA2 A;  1FTO A;  1BK4 A;  3FV1 A;  1B6H A;  1O63 A;  3Q27 A;  3TUS A;  1UTH B;  3LSF B;  3IB2 A;  4JDF A;  4NX1 A;  4H1X A;  4YU0 A;  3RUM A;  4OEV A;  1YPN A;  4N6P A;  2F3D A;  3C34 A;  2DYX A;  4Q8R A;  1GTK A;  2Z8E A;  1RDY A;  4PFU A;  1URD A;  1FBP A;  3S9N C;  4GD5 A;  4PCD A;  4OZ9 A;  5DYH A;  4OVQ A;  3THI A;  5A5L A;  1A99 A;  3CFL A;  4O94 A;  1ZLQ A;  3E13 X;  3KGC A;  4P56 A;  5L9S A;  4NED A;  3T66 A;  2KLF A;  1G0I A;  4NN3 A;  2DDK A;  3WAF A;  2Y5K A;  4DDD A;  4HXV A;  4N8Y A;  3ZSF A;  1HSL A;  1EYJ A;  5JK4 A;  3HFU A;  4THI A;  4M4G A;  3L6H A;  2F7B A;  3V83 A;  1G0H A;  1FSA A;  2F3B A;  4G8N A;  1B7Z A;  4F2O A;  4PFT A;  3VDF A;  5JTY B;  4H5F A;  3H03 A;  3R26 A;  4H67 A;  4RNS A;  3EHT A;  2DWA A;  2KR0 A;  4BDN A;  1B58 A;  3MBP A;  1MPB A;  3EQ1 A;  4TOZ A;  1JVX A;  1INP A;  3B8B A;  4I62 A;  3ILT B;  1POT A;  1LFI A;  3W15 C;  2OK2 A;  3IK6 B;  4MFI A;  3GBA A;  1YAE A;  1YYZ A;  3VVE A;  1WDN A;  1B46 A;  1MDP 1;  1CE2 A;  1SD3 A;  3KFM A;  4Q0C A;  4EQB A;  3IR1 A;  1OLA A;  2V4C A;  4JBZ A;  3K6W A;  5DEX B;  4NF0 A;  4U4X A;  4ZZE A;  2WYK A;  3PPP A;  2ZNU A;  1SW4 A;  2FA7 A;  4F3B A;  3TYH A;  5EQ9 A;  1B5H A;  1I6A A;  1QKB A;  3VVD A;  4F3P A;  1VSO A;  3N5L A;  3N6U A;  2HAV A;  2ONK E;  3LVU A;  4EUO A;  2RIN A;  4NAP A;  3CSG A;  3RTF B;  5I58 A;  4ND9 A;  3MZB A;  2DE4 A;  1MG1 A;  3FJG A;  1KA1 A;  2F7C A;  3Q25 A;  2WOP A;  1H43 A;  1SW1 A;  2ABH A;  1FTM A;  5FHM A;  1MY1 A;  3H6V A;  4PGN A;  1N76 A;  1NV7 A;  2P3V A;  3EF7 A;  4XKP A;  4OFJ A;  5HPQ A;  1IMA A;  5AA4 B;  3OO6 A;  2RCA A;  4MNI A;  4YAH X;  5IGA A;  3PPN A;  1I6Q A;  3VLV A;  2YPN A;  3MZ9 A;  3IFA A;  2XD3 A;  2RC7 A;  5TPA B;  1ELJ A;  4R72 A;  1FBC A;  1QUL A;  2O7U A;  5I59 A;  2PX1 A;  4GBW A;  1DTZ A;  2V3T A;  1A40 A;  4BDR A;  2I6E A;  3QSL A;  3DP6 A;  3SDF A;  1EYI A;  1YXI A;  4F29 A;  4OVP A;  3E4R A;  1MS7 A;  5KDT A;  3FXU A;  4H0W A;  1DMB A;  4I9D A;  1S9T A;  2QS4 A;  4GWX A;  2GFE A;  3SEW A;  2FIE A;  3H7M A;  1QW0 A;  2QRY A;  3EHU A;  4OET A;  3OXN A;  3NOH A;  2OJT A;  4LN5 A;  4EDP A;  4X1D A;  2R6G E;  1B40 A;  4MNP A;  4I8C A;  2Y7P A;  3BFT A;  1B9J A;  4R2B A;  1IMD A;  1LBV A;  4QSE A;  1RDX A;  1WOD A;  4N91 A;  1FBE A;  4O7M A;  4WEP A;  4P3L A;  2YJP A;  3O2A A;  3S9E A;  4TLM B;  4PFW A;  3UIF A;  2QS3 A;  1SBP A;  4RK9 A;  5FTH A;  4P8B A;  1B5I A;  3PPR A;  3EN3 A;  4JXI A;  1FQE A;  2VHA A;  4GXS B;  4I1D A;  3GZG A;  5LTC A;  2VPN A;  1US4 A;  4N17 A;  3CRB A;  2QPQ A;  4ZEK A;  3C9H A;  3M3K A;  4OVR A;  3N26 A;  2XXH A;  2F36 A;  4C1T A;  3DRG A;  2MKZ A;  3U65 A;  1DPP A;  2DXY A;  1VR5 A;  3PUW E;  3VFJ A;  4OFL A;  4H6D A;  2CEX A;  4LUB A;  1PB8 A;  2UVJ A;  4N15 A;  2H98 A;  4NF6 B;  2REJ A;  2PCR A;  2ZYM A;  3IFC A;  3T9H B;  3TOD A;  2G29 A;  4KD5 A;  3PD9 A;  1GVC A;  3HHF A;  3CVG A;  3FVK A;  4ZZA A;  5JTY A;  4O3C A;  4JWO A;  4OTE A;  5DTB A;  3S4U A;  3RY3 A;  1O64 A;  3MUQ A;  3PD8 A;  1TXF A;  2DP8 A;  2G93 A;  3DP4 A;  1ATG A;  1P1N A;  1MH3 A;  2D3I A;  5CBS A;  3ZKK A;  1S50 A;  2Q9T A;  4DI3 D;  2XX9 A;  2DQV A;  3ZKL A;  1XOC A;  3A3U A;  3FZV A;  3DP8 A;  3GYY A;  3U8Q A;  4FJP A;  1CB6 A;  3OSR A;  5DEX A;  4GOT A;  2ZNS A;  4IGT A;  3FVG A;  4GF8 A;  3B6Q A;  1Q9D A;  4XEQ A;  3RQT A;  1IXI A;  1EH3 A;  2OWS A;  1JW1 A;  1A54 A;  4XKN A;  4F39 A;  4QF9 A;  3RYA A;  2AL5 A;  3FBP A;  5ICQ A;  1JET A;  2H4I A;  2CZK A;  1PBP A;  1IMC A;  4OER A;  1FQF A;  4XIG Q;  2XXV A;  1Q35 A;  4F22 A;  3OMB A;  5AA3 A;  5IZZ A;  4GBV A;  3TCG A;  1ANF A;  3RT6 B;  4FAJ A;  1FPL A;  3U72 A;  1LFG A;  4OVT A;  3FJM A;  1B05 A;  1B32 A;  2FNC A;  3IOR A;  5ESY A;  1S7Y A;  4KYS A;  5AA4 A;  2H5Y A;  4NF5 B;  3IOW A;  3TZA A;  2F5X A;  1R6Z A;  5ISU A;  3IL1 B;  2I4C A;  5A5X B;  4AS4 A;  1UIU A;  5EHS A;  2VOZ A;  3E78 A;  4LZ8 A;  3JZJ A;  4PFY A;  2XWV A;  3UA8 A;  4QSD A;  5TPA A;  5H8F A;  3PUV E;  3PUX E;  3T9X B;  4ESW A;  2ANJ A;  2DS9 A;  1Z7M E;  4YIC A;  3OEM A;  4YKK A;  4ECF A;  2XXR A;  2NUV A;  3CG1 A;  3KEI A;  3O6P A;  4KYE A;  3Q29 A;  3TTN A;  2ZZX A;  3A09 A;  2R71 A;  5CMC A;  4PTK A;  4WED A;  1N04 A;  2V93 A;  3C36 A;  1RKM A;  4EQ7 A;  5JEI A;  4P1L A;  1SYI A;  4AB5 A;  3UN6 A;  3OO8 A;  3FIR A;  3U93 A;  2V84 A;  2P1S A;  5I58 B;  4NF8 B;  1UIV A;  2F34 A;  3MVY A;  1FPI A;  3C31 A;  3IO6 A;  3E9X A;  2O84 X;  5I2N B;  2Y7R A;  1NL5 A;  3LSL A;  4R73 A;  2AL4 A;  5ET5 A;  2Q2A A; 
#chains in the Genus database with same CATH homology
 2Z8F A;  4YB6 A;  2HZL A;  1VFE A;  5TU0 A;  2NOO A;  2F97 A;  4NMY A;  4GQO A;  2B4L A;  3H6T A;  2HQ0 A;  2HFB A;  1LLS A;  3OEN A;  5CC2 A;  3G3G A;  5I59 B;  1MXX A;  4U21 A;  3FD3 A;  1AH5 A;  4EF2 A;  4FEC A;  5KCJ B;  1QKA A;  3IOT A;  4NF6 A;  5KDT B;  4H65 A;  3MP1 A;  1PB7 A;  3FVO A;  4R6K A;  5I2K B;  1P1W A;  1M5D A;  3HCQ A;  4LQ5 A;  1DSN A;  2BJJ X;  4C1U A;  3RN8 A;  2ZMB A;  4ZEI A;  3O6I A;  3N6T A;  2E1S A;  3O97 A;  4M1V A;  3KOS A;  4OWD A;  5M2V A;  5H8N B;  1FCK A;  2FYI A;  2OCU A;  2ZYN A;  2XXQ A;  1IXH A;  3Q26 A;  5H8H B;  5DT6 A;  1NH7 A;  3P7I A;  1A8F A;  1LGB C;  1TFD A;  4RXL A;  1RYX A;  5CMM A;  5ITO A;  1FTL A;  1EZ9 A;  4IY5 A;  4LQ2 A;  4U4S A;  3OOA A;  5F1Q A;  1JEV A;  4LZ5 A;  1N3W A;  3F11 A;  4NE4 A;  4E0X A;  3O29 A;  1SQY A;  3K00 A;  4GXA A;  1JW5 A;  3H4Z A;  3KN7 A;  4GFR A;  3MZ1 A;  3MPL A;  1N7X A;  3FXR A;  3TFL A;  4RPO A;  2UXA A;  4OFO A;  2REG A;  5IAI A;  2PBW A;  3LSX A;  5H8Q B;  4DLD A;  2RKM A;  3VVF A;  1MPD A;  3EHS A;  4H5G A;  4ZE9 A;  4GRK A;  4IO6 A;  4MBP A;  1AOV A;  1VFD A;  1R1N A;  2ZNT A;  1P99 A;  4NF5 A;  1DTG A;  3PV0 E;  4DXB A;  5A5X A;  1LAH E;  2B3F A;  4KFQ A;  4G2Z A;  4ZE8 A;  3B6T A;  1SI1 A;  4BLA A;  3ILU B;  3IX1 A;  2I49 A;  2RC9 A;  2UVI A;  3MQ9 A;  3CG3 A;  1LFH A;  4QRZ A;  4PE5 B;  4LZ7 A;  3ECR A;  4POX A;  3DM0 A;  1MY3 A;  1LB9 A;  3PMX A;  3T96 B;  1PEB A;  5ITP A;  3C35 A;  3UOR A;  4R9G A;  1PC3 A;  1JQF A;  3BBR A;  4DCY A;  2DWI A;  4HW8 A;  1P1Q A;  4JWY A;  3R7X A;  1R9Q A;  3JYR A;  1JW4 A;  4NF8 A;  5FHO A;  1BKA A;  2OBG A;  4OEN A;  4DZ1 A;  1N7W A;  1VE4 A;  2OLB A;  2R9J A;  2CZL A;  5I2N A;  1JVY A;  4ISU A;  4HCW A;  1GV8 A;  1MXV A;  2B65 A;  3EPE A;  3K1P A;  3TCH A;  4EXL A;  1NKX A;  5CMB A;  4AB6 A;  1OVT A;  1ZTY A;  1H3D A;  4EQ9 A;  5K2Y A;  1O7T A;  3TTL A;  2H25 A;  5H8F B;  3DRJ A;  3K6U A;  1FQC A;  4YKJ A;  1Z7N E;  3V89 B;  3LUY A;  4F1V A;  2OWT A;  4G4P A;  1M5C A;  2XXW A;  2AYS A;  1LAF E;  5KCJ A;  4PQJ A;  4U23 A;  4RY1 A;  1RYO A;  1A7L A;  1MQH A;  1FQB A;  5FHN A;  4ELR A;  5I2K A;  3MW0 A;  1Q1K A;  2Y7K A;  3QAX A;  4HCY A;  4QFP A;  3TTM A;  3VXB A;  3JV9 A;  1B1X A;  4UA8 A;  1H44 A;  2V25 A;  2NXO A;  2UYE A;  4F3G A;  5H8N A;  4FE8 A;  2Q88 A;  2THI A;  1IIW A;  4DIG A;  4R6H A;  5H8H A;  2D21 A;  1P1U A;  1MQI A;  4OEU A;  4P0I A;  1IIT A;  4Q30 B;  2I0B A;  2DWH A;  3TEP A;  4BDL A;  4F19 A;  3C32 A;  2Y84 A;  4GVO A;  2HCA A;  4R2F A;  3HN0 A;  4KR5 A;  1B0L A;  4MF3 A;  4KQP A;  1Y1Z A;  1I69 A;  4O3A A;  4XKR A;  5L9M A;  1URS A;  3BKI B;  3LR1 A;  1L5T A;  5CI5 A;  4TQU Q;  5H8Q A;  3TMG A;  2B4M A;  3IOV A;  4FIM A;  3E3K A;  2DWJ A;  4F3S A;  2ZYK A;  1H45 A;  1MM6 A;  1D3K A;  4Z0I A;  3BFU A;  3S2V A;  5KZT A;  4E0W A;  3WAE A;  2F8D A;  1MH4 A;  1BIY A;  1MRP A;  4LON B;  3SEX A;  1SVX B;  3VXC A;  1M5F A;  2XX8 A;  2O1L A;  1LAG E;  3K1N A;  3V8X B;  5EHM A;  3CFZ A;  4GL0 A;  3DRH A;  3VLU A;  3K01 A;  1OIB A;  4EXK A;  4ONY A;  1B3E A;  3DRK A;  1URG A;  3GLB A;  1BP5 A;  1KWH A;  1Y4C A;  3KJ7 A;  1DOT A;  4Z7E A;  1D4N A;  3QUJ A;  4JB7 A;  4X9T A;  1WVJ A;  4KHZ E;  1UQW A;  1SDX A;  4IY6 A;  1N3X A;  2ESN A;  4OQO A;  4JSO A;  1MQD A;  3GBB A;  5IKB A;  3PUZ E;  4R6Y A;  4HTG A;  3G3J A;  2I48 A;  3PMV A;  3O6H A;  2XXY A;  4U1Z A;  1PBQ A;  4RPN A;  3OSQ A;  4LAT A;  1N84 A;  1MDQ A;  1SYH A;  2PMS A;  1DPE A;  1POY 1;  1ZBM A;  3C4M A;  1HSJ A;  1QJM A;  1FW0 A;  3PPQ A;  3T93 B;  4ESX A;  1SW5 A;  4F18 A;  4LA9 A;  2XXI A;  2PVU A;  2RC8 A;  2YLN A;  2F6G A;  4Q5T A;  4U22 A;  3H6U A;  4F1Y A;  3I5O A;  4PET A;  1XT8 A;  1B52 A;  2WKY A;  1MPC A;  3I6V A;  1M5B A;  2O7I A;  2IEE A;  5EYF A;  1USY E;  1PDA A;  4K3F A;  4AQ4 A;  3DLN A;  4WKM A;  3CSB A;  4RYA A;  1TT1 A;  4DXC A;  1XHY A;  3DEL B;  4DE8 A;  3MVW A;  1B3F A;  2Q8J A;  3FGS A;  2O69 A;  1HSE A;  1XC1 A;  5LOM A;  4IGR A;  3H6W A;  1PB9 A;  5CRY A;  4BDM A;  3PAM A;  3CI8 A;  3FTO A;  4ZS9 A;  1Y3Q A;  4R74 A;  3TKD A;  2ZYO A;  2GHB A;  2H9B A;  1H76 A;  3MVX A;  3PGF A;  1MXU A;  1FTK A;  2F35 A;  1F9B A;  4GWO A;  4ELO A;  3U92 A;  3N94 A;  1BTJ A;  1GGG A;  3Q28 A;  1TWY A;  2Y7I A;  2OZZ A;  3LBS A;  5J1D A;  3OO7 A;  4N13 A;  1NNT A;  4GIZ A;  3TAJ A;  2ONS A;  1XVX A;  1MY0 A;  4R9F A;  1A8E A;  2HXW A;  1B4H A;  5I84 A;  1IQ7 A;  5I57 B;  4IO7 A;  1P1O A;  2I0C A;  4ZEB A;  2F6P A;  2ONR A;  1AMF A;  4IO4 A;  3M8U A;  3HV1 A;  4KI0 E;  3HO7 A;  3RT8 A;  3KSX A;  3C33 A;  2Z8D A;  3MP8 A;  5DVF A;  3G3K A;  4RK2 A;  5AE4 A;  3M3F A;  1D9V A;  4XTC Q;  4QFN A;  3MPK A;  5I56 B;  4JSD A;  3H3G A;  2VD2 A;  3L6G A;  3QUF A;  1AIV A;  2O68 A;  2XXU A;  3MJN A;  5TP9 B;  4FOR A;  1BLF A;  4XKQ A;  5B70 A;  3G3F A;  3RYB A;  3IB1 A;  2V3Q A;  3S9L C;  3PUY E;  3ZS6 A;  2XHD A;  3KSJ A;  2X7Q A;  1MXY A;  1B1H A;  1IZ1 A;  1MQJ A;  4RJZ A;  3FUZ A;  4FAT A;  3TQW A;  4G68 B;  2DE2 A;  4KYD A;  5F7V A;  2A5S A;  3CHG A;  1M5E A;  3HHG A;  1UTB B;  5FTI A;  1ZU0 A;  2V3U A;  3QK6 A;  4F31 B;  4QFO A;  4YKP A;  4ZDM A;  1IUD A;  1LB8 A;  1GR2 A;  2QL3 A;  2XX7 A;  4L17 A;  5L8D A;  1QUI A;  1OQG A;  4G8H A;  1Y4T A;  4C0R A;  1LST A;  3O66 A;  2DVC A;  4YB7 A;  4OXV A;  1MQG A;  4NTL A;  2QJE A;  3TTR A;  4X1B A;  3PPO A;  3UK4 A;  4X48 A;  1LCT A;  1IXC A;  2VD3 A;  2Q2C A;  4IB2 A;  2A5T B;  2I4B A;  3KN3 A;  1MY4 A;  4OHN A;  3A3C A;  4LVQ A;  3IAZ A;  2LAO A;  2O51 A;  5ICT A;  2XXP A;  1LBC A;  1Y20 A;  2GRV A;  4R75 A;  3S9M C;  4H8J A;  1B51 A;  2UYF A;  3FXQ A;  3SES A;  1B4Z A;  3FAT A;  2DOJ A;  3MP6 A;  3MC2 A;  5AA2 D;  1JEU A;  1FQD A;  2VP1 A;  5DVI A;  2H99 A;  4MLV A;  2ALU A;  3W9W A;  3VLW A;  3IO4 A;  1R9L A;  3K02 A;  5ELV A;  4YMB A;  3B6W A;  1I6B A;  1ZMG A;  1SW2 A;  2P2A A;  4BDQ A;  4LP2 B;  2E0S A;  1NH8 A;  4ZEF A;  3ODB A;  4OVJ A;  4N07 A;  3USD A;  3LC8 A;  3R6U A;  2Z23 A;  1LBB A;  3IB0 A;  3H06 B;  3FV2 A;  1B7H A;  3SET A;  1LAX A;  2Y7W A;  1A55 A;  4IO2 A;  3KZG A;  4OES A;  2QS1 A;  3G7W A;  3FAS A;  4QHQ A;  5I57 A;  3B7D A;  3HST A;  5H8S A;  1NMU A;  4NF4 B;  1EZO A;  3DRI A;  3I3V A;  1FQA A;  4NWD A;  4ELQ A;  3PMW A;  1UTH A;  2XXX A;  4POW A;  1NNK A;  3K4U A;  3M3L A;  4P0G A;  1OQH A;  3RPW A;  2WOL A;  4ZED A;  1XVY A;  4GLI A;  3SEU A;  4FEB A;  4RA1 A;  3QYT A;  3TPA A;  3FJ7 A;  4FED A;  3DRF A;  4YKI A;  5I56 A;  2DE3 A;  4IO3 A;  1Y9U A;  3RNN A;  4G77 A;  1Y3N A;  5HM4 B;  2QMW A;  2O1M A;  3TDJ A;  1IXG A;  1B3L A;  2PT2 A;  4P11 A;  3CFX A;  5TP9 A;  4XXU A;  2HAU A;  2DSF A;  2NVU B;  4PP0 A;  3W9V A;  4YB5 A;  2IA4 A;  1QUJ A;  3O6G A;  4IO5 A;  4GL8 A;  5AA2 B;  5B7D A;  2QSX A;  1B2H A;  2NWJ A;  3T9V A;  4G68 A;  3VV5 A;  1EZP A;  1UTB A;  3OEL A;  3SEV A;  2GH9 A;  3T22 A;  4TLL B;  3ONM A;  4G68 C;  3FVN A;  5AA1 A;  1IEJ A;  2WOK A;  1MM7 A;  3OD7 A;  2DXR A;  4QFK A;  3U1O A;  1OMP A;  3KG2 A;  1MY2 A;  4JWX A;  3TCF A;  4QSC A;  3IJO B;  4ZEC A;  1JNF A;  3D4C A;  2XXT A;  3KBR A;  2D5W A;  4H8I A;  2HEU A;  5BUU A;  1N0T A;  4U1O A;  1Y1M A;  5K2X A;  2QMX A;  2F7A A;  4NWC A;  3TTK A;  2F78 A;  3K1M A;  2A5T A;  3SKP A;  1YCJ A;  2I3V A;  2ZXT A;  1QVS A;  1NFT A;  1ZJL A;  3MAM A;  2VGQ A;  3G3I A;  2X7P A;  4ELP A;  5DVJ A;  2AIX A;  4U2R A;  3VE1 B;  3K2D A;  3KOT A;  3K0V A;  5CM6 A;  2W7Y A;  4UAC A;  2RCB A;  4WXJ A;  2P0S A;  1SI0 A;  4YZZ A;  1B7U A;  4KCC A;  4QFL A;  3G3H A;  4DCX A;  1ZIU A;  2I58 A;  3CR9 A;  3RGY A;  3RLF E;  2X26 A;  4YMA A;  2B3B A;  4F2Q A;  1Y3P A;  1YTV A;  1MXW A;  3KJT A;  3HPI A;  2QS2 A;  4OMB A;  3AXF A;  3PU5 A;  3K6V A;  3UGW A;  2Z22 A;  4BDO A;  1QUK A;  2DVZ A;  3MWB A;  1XS5 A;  2M8C A;  3UP9 A;  4KCD A;  2HZK A;  1MXZ A;  1NNF A;  3K6X A;  2RF1 A;  1NNP A;  3TQL A;  4NF4 A;  3TEL A;  2CMO A;  3MVZ A;  2XD2 A;  1LCF A;  4DXU A;  3LSW A;  2Q89 A;  1B5J A;  1D9Y A;  3KN8 A;  1FTJ A;  1J1N A;  3SER A;  3T9U A;  3IOU A;  3O28 A;  1AL3 A;  5L9O A;  3V5A A;  4KPT A;  1US5 A;  2O6A A;  1OLC A;  1T0K A;  3OEK A;  2UVH A;  3QXM A;  5BWJ A;  5CBR A;  3OO9 A;  1B3G A;  4O3B A;  4EF1 A;  2I3W A;  4F1U A;  1USY H;  3RTW B;  3U94 A;  4MLQ A;  4OYV A;  1B3H A;  3O9P A;  4MH5 A;  3GXA A;  2PT1 A;  1EU8 A;  4G8M A;  2GHA A;  1II5 A;  1OVB A;  3D4G A;  3SEY A;  2UVG A;  5HBC A;  5CMK A;  2PYY A;  1B0H A;  3CIJ A;  1TFA A;  4HS7 A;  3QIM A;  3IJX B;  1ZKB A;  5AA2 A;  1FTO A;  3FV1 A;  1B6H A;  1O63 A;  3Q27 A;  3TUS A;  1UTH B;  3LSF B;  3IB2 A;  4JDF A;  4H1X A;  4YU0 A;  3RUM A;  4OEV A;  1YPN A;  4N6P A;  3C34 A;  2DYX A;  4Q8R A;  1GTK A;  2Z8E A;  4PFU A;  1URD A;  3S9N C;  4GD5 A;  4OZ9 A;  5DYH A;  3THI A;  1A99 A;  3CFL A;  1ZLQ A;  3E13 X;  3KGC A;  5L9S A;  4NED A;  3T66 A;  2KLF A;  3WAF A;  4DDD A;  3ZSF A;  1HSL A;  5JK4 A;  4THI A;  4M4G A;  3L6H A;  2F7B A;  3V83 A;  4G8N A;  1B7Z A;  4F2O A;  4PFT A;  3VDF A;  5JTY B;  4H5F A;  3H03 A;  3R26 A;  4H67 A;  4RNS A;  3EHT A;  2DWA A;  4BDN A;  1B58 A;  3MBP A;  1MPB A;  3EQ1 A;  4TOZ A;  1JVX A;  4I62 A;  3ILT B;  1POT A;  1LFI A;  3W15 C;  2OK2 A;  3IK6 B;  4MFI A;  3GBA A;  1YAE A;  3VVE A;  1WDN A;  1B46 A;  1MDP 1;  1CE2 A;  1SD3 A;  3KFM A;  4Q0C A;  4EQB A;  3IR1 A;  1OLA A;  4JBZ A;  3K6W A;  5DEX B;  4U4X A;  4ZZE A;  3PPP A;  2ZNU A;  1SW4 A;  2FA7 A;  4F3B A;  3TYH A;  1B5H A;  1I6A A;  1QKB A;  3VVD A;  4F3P A;  1VSO A;  3N5L A;  3N6U A;  2HAV A;  2ONK E;  3LVU A;  4EUO A;  2RIN A;  3CSG A;  3RTF B;  5I58 A;  4ND9 A;  3MZB A;  2DE4 A;  1MG1 A;  3FJG A;  2F7C A;  3Q25 A;  2WOP A;  1H43 A;  1SW1 A;  2ABH A;  1FTM A;  5FHM A;  1MY1 A;  3H6V A;  1N76 A;  3EF7 A;  4XKP A;  4OFJ A;  5HPQ A;  5AA4 B;  3OO6 A;  2RCA A;  4YAH X;  3PPN A;  1I6Q A;  3VLV A;  2YPN A;  3MZ9 A;  2XD3 A;  2RC7 A;  5TPA B;  1ELJ A;  4R72 A;  1QUL A;  2O7U A;  5I59 A;  2PX1 A;  1DTZ A;  2V3T A;  1A40 A;  4BDR A;  2I6E A;  3QSL A;  3DP6 A;  3SDF A;  4F29 A;  3E4R A;  1MS7 A;  5KDT A;  3FXU A;  4H0W A;  1DMB A;  4I9D A;  1S9T A;  2QS4 A;  2GFE A;  3SEW A;  3H7M A;  1QW0 A;  2QRY A;  3EHU A;  4OET A;  3OXN A;  2OJT A;  4EDP A;  4X1D A;  2R6G E;  1B40 A;  4I8C A;  2Y7P A;  3BFT A;  1B9J A;  4R2B A;  4QSE A;  1WOD A;  4WEP A;  2YJP A;  3O2A A;  3S9E A;  4TLM B;  4PFW A;  3UIF A;  2QS3 A;  1SBP A;  4RK9 A;  5FTH A;  1B5I A;  3PPR A;  3EN3 A;  4JXI A;  1FQE A;  2VHA A;  4GXS B;  4I1D A;  3GZG A;  1US4 A;  3CRB A;  2QPQ A;  4ZEK A;  3C9H A;  3M3K A;  3N26 A;  2XXH A;  2F36 A;  4C1T A;  3DRG A;  1DPP A;  2DXY A;  1VR5 A;  3PUW E;  3VFJ A;  4OFL A;  4H6D A;  4LUB A;  1PB8 A;  2UVJ A;  2H98 A;  4NF6 B;  2REJ A;  2ZYM A;  3T9H B;  3TOD A;  2G29 A;  4KD5 A;  3PD9 A;  1GVC A;  3HHF A;  3CVG A;  3FVK A;  4ZZA A;  5JTY A;  4O3C A;  4JWO A;  4OTE A;  5DTB A;  3S4U A;  3RY3 A;  1O64 A;  3MUQ A;  3PD8 A;  1TXF A;  2DP8 A;  2G93 A;  3DP4 A;  1ATG A;  1P1N A;  1MH3 A;  2D3I A;  5CBS A;  3ZKK A;  1S50 A;  2Q9T A;  2XX9 A;  2DQV A;  3ZKL A;  1XOC A;  3A3U A;  3FZV A;  3DP8 A;  3U8Q A;  4FJP A;  1CB6 A;  3OSR A;  5DEX A;  4GOT A;  2ZNS A;  4IGT A;  3FVG A;  4GF8 A;  3B6Q A;  3RQT A;  1IXI A;  1EH3 A;  2OWS A;  1JW1 A;  1A54 A;  4XKN A;  4F39 A;  4QF9 A;  3RYA A;  2AL5 A;  5ICQ A;  1JET A;  2H4I A;  1PBP A;  4OER A;  1FQF A;  4XIG Q;  2XXV A;  1Q35 A;  4F22 A;  3OMB A;  5AA3 A;  3TCG A;  1ANF A;  3RT6 B;  4FAJ A;  3U72 A;  1LFG A;  3FJM A;  1B05 A;  1B32 A;  2FNC A;  3IOR A;  1S7Y A;  4KYS A;  5AA4 A;  2H5Y A;  4NF5 B;  3IOW A;  3TZA A;  2F5X A;  1R6Z A;  5ISU A;  3IL1 B;  2I4C A;  5A5X B;  1UIU A;  5EHS A;  2VOZ A;  4LZ8 A;  3JZJ A;  4PFY A;  3UA8 A;  4QSD A;  5TPA A;  5H8F A;  3PUV E;  3PUX E;  3T9X B;  4ESW A;  2ANJ A;  2DS9 A;  1Z7M E;  4YIC A;  3OEM A;  4YKK A;  4ECF A;  2XXR A;  2NUV A;  3CG1 A;  3KEI A;  3O6P A;  4KYE A;  3Q29 A;  3TTN A;  3A09 A;  2R71 A;  5CMC A;  4WED A;  1N04 A;  2V93 A;  3C36 A;  1RKM A;  4EQ7 A;  5JEI A;  1SYI A;  4AB5 A;  3UN6 A;  3OO8 A;  3FIR A;  3U93 A;  2V84 A;  2P1S A;  5I58 B;  4NF8 B;  1UIV A;  2F34 A;  3MVY A;  3C31 A;  3IO6 A;  3E9X A;  2O84 X;  5I2N B;  2Y7R A;  1NL5 A;  3LSL A;  4R73 A;  2AL4 A;  2Q2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...