1B58A

Oligo-peptide binding protein (oppa) complexed with kyk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b58A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b58A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b58A02
2WOPA 1Y1MA 5H8FA 2DWHA 3K01A 3SEYA 4BLAA 1B05A 2M8CA 1BKAA 4OHNA 4OFLA 3IAZA 2Y7KA 5EHMA 1MG1A 2REGA 3N5LA 2NWJA 1JQFA 2OWTA 4QFKA 2F8DA 5L8DA 2ALUA 1DSNA 4ZS9A 3FGSA 3ZSFA 1Y3QA 1N7XA 3TODA 5L9OA 1ZMGA 1B1XA 2UXAA 5H8QB 4R75A 2UYFA 4G8MA 4IO7A 1YCJA 2XD3A 3C31A 3S9MC 1LCTA 4F39A 2NUVA 1MXYA 2VD3A 4RK2A 3DP8A 1EZPA 2XXXA 1JW5A 2DVZA 1NFTA 3IOVA 1ELJA 2RC7A 2DYXA 2ONKE 1OLAA 4EXLA 1NH7A 3MPKA 3K1NA 1SW2A 1RKMA 4F1YA 4QFNA 3N26A 1XOCA 5TP9A 4DE8A 1J1NA 3VVEA 3EN3A 1QJMA 4ZZEA 1LB9A 4GL8A 2AYSA 3UA8A 1B7UA 1B5JA 3QUJA 1MXXA 3DP4A 5DVFA 4R6YA 3UP9A 4MBPA 2Y84A 4LA9A 1QULA 1CB6A 3IOWA 4O3CA 3CFLA 5BWJA 3TCFA 3VE1B 5BUUA 3DRJA 2QSXA 4FJPA 1NL5A 5H8SA 1R1NA 4KI0E 5ITOA 4MLQA 3UORA 1POY1 2A5TA 1OQGA 2O69A 5HBCA 3IOUA 3MJNA 3TFLA 5L9MA 3IO6A 4PP0A 2WOLA 3PMWA 5FHOA 3GXAA 4QFPA 3O28A 4H6DA 1MXUA 4YMAA 2XHDA 5JK4A 5FHMA 1OVTA 4OEVA 4QFOA 1ZBMA 1QUKA 4IO4A 4F3BA 2VD2A 3HHFA 1QW0A 5CC2A 4AB6A 4HTGA 4YICA 1A8FA 5H8HB 1JNFA 1B5HA 4Z0IA 2F7CA 2NVUB 1S7YA 5A5XA 3FIRA 2RC9A 2Z22A 3TQLA 2Q2AA 3U8QA 2DS9A 1JVXA 4ZECA 4IO6A 3T22A 4G68C 5I2KA 4DCXA 5AA2B 3H7MA 4FIMA 1B0HA 3EHTA 3VDFA 4I62A 1LFIA 1NNKA 2Y7WA 3MAMA 1DPPA 3K1MA 2F7BA 4OWDA 5I56A 1M5DA 4ONYA 4F1VA 3FVOA 3KG2A 2O68A 1MRPA 2DVCA 1S50A 1LFGA 3FXUA 4JWYA 1B5IA 4EQ7A 2DXRA 5AA4A 3TQWA 4XKRA 2XD2A 5KDTA 1QUIA 3C9HA 3IK6B 4RK9A 5I59B 2XXVA 3ONMA 4GFRA 3T9XB 2I0BA 3N6UA 4IB2A 4YB7A 4ZEDA 3JV9A 1R6ZA 4C1TA 2F34A 3K6WA 1QKAA 4YKIA 3K6VA 3GLBA 3HO7A 5CBSA 3W9WA 1IIWA 1GTKA 4KD5A 1MM6A 4WKMA 1B3HA 1B6HA 4R73A 3IL1B 4OFOA 4GXAA 1H76A 1IEJA 3IR1A 2YPNA 3VV5A 4OZ9A 3LC8A 1SW5A 2F97A 3PUVE 5M2VA 2W7YA 4U22A 3MP8A 2O7IA 5ICTA 4K3FA 2O1LA 3KZGA 4OMBA 4F2QA 4X1DA 4GD5A 3U94A 1MXZA 3Q26A 1DOTA 3G3KA 3DELB 3B7DA 1IITA 5AA3A 4M4GA 4ELOA 3K4UA 3ILUB 2QJEA 3R26A 4R2BA 2XXWA 1NNPA 1HSLA 5DT6A 1I6AA 4YKKA 1TFAA 4OYVA 3I6VA 3DP6A 2RKMA 3TAJA 3D4GA 1B7ZA 5TPAA 3TZAA 4WEDA 5I57B 3P7IA 4H0WA 2XX8A 3K1PA 3WAEA 2DWIA 2QS2A 4LQ2A 3G3GA 3KGCA 5DEXA 3B6TA 5DVJA 2XXRA 3DLNA 4ZE9A 2ZYMA 4Z7EA 4U23A 4NWDA 4NF8B 3N6TA 1B0LA 4OTEA 1XVXA 1UIVA 3ZS6A 1FCKA 1R9LA 2B65A 4RNSA 4FEBA 2HZLA 4NWCA 3L6HA 4EQBA 3VXBA 3OENA 3KN3A 1MQGA 3THIA 2X7QA 1JETA 4BDNA 3TKDA 4NF4A 3M3FA 3PPPA 3RT8A 1LAHE 2ZNSA 4JB7A 1P1UA 3TPAA 3G3JA 3FASA 1FQCA 2GFEA 4N6PA 1Y4TA 2XXPA 3FJMA 4OETA 3U1OA 4BDRA 4NEDA 2RCAA 4QF9A 4POXA 1B40A 4F22A 3V83A 1B3LA 4LZ7A 3CIJA 1MY4A 2Y7RA 2Z8DA 2DQVA 1EZ9A 2Z23A 3FTOA 2B3FA 2V25A 2REJA 3LSLA 5H8NA 2HQ0A 3ODBA 5I2NB 1MS7A 4Q0CA 1AMFA 3PMXA 2F7AA 1ATGA 3C4MA 1D9YA 1RYXA 1PB9A 4EF1A 4ELPA 2X7PA 3LUYA 4ZDMA 3D4CA 1FTMA 3TCHA 4NTLA 1TXFA 1B52A 1MY2A 4RY1A 4E0XA 2IA4A 2UYEA 5HM4B 5CBRA 1B4ZA 3I5OA 1XS5A 1O7TA 3QAXA 4ZE8A 3M3LA 3USDA 1N7WA 3KEIA 1Y9UA 2H98A 1MDQA 4H1XA 1R9QA 3W15C 4RYAA 3O9PA 5EYFA 2D21A 2R71A 4DXBA 3CVGA 5JTYA 5L9SA 1Y20A 2H25A 1FTLA 1ZKBA 2I3WA 3KJ7A 3RTWB 3O29A 4LZ8A 5KCJA 4NF5B 2Z8EA 3CFXA 2HCAA 4U21A 1WVJA 4FECA 4OERA 1FTOA 2D3IA 3UIFA 4GOTA 3JZJA 1USYH 1PBPA 4U4SA 2H5YA 3TTRA 2V3QA 2ZYOA 1N3XA 2DP8A 1H3DA 4R2FA 1AOVA 4N13A 1EH3A 3KOTA 4TLLB 3O6GA 4C1UA 3KOSA 2I4BA 1AL3A 1LCFA 4G68B 1SYHA 3ZKKA 4P0IA 4MLVA 1MPCA 2E1SA 3K00A 4H8JA 3E4RA 3JYRA 3IOTA 3GZGA 2THIA 3FATA 3MBPA 1PB8A 5IAIA 2Q2CA 4X48A 3UN6A 3CI8A 5H8QA 3TTLA 2F6GA 1JVYA 2Y7PA 1PC3A 1Q35A 4KFQA 3FJGA 3O6IA 4RPNA 3MPLA 3PMVA 4PFUA 4POWA 3TEPA 3R6UA 1T0KA 4XXUA 1QUJA 1Y3PA 3KFMA 5FTHA 1MQJA 4ELRA 3CG1A 2OCUA 3C35A 3HPIA 2ONRA 3TCGA 1SQYA 3TMGA 2V3TA 4I8CA 3K6UA 4H8IA 3T9HB 3FUZA 2UVGA 4LONB 2V3UA 2H9BA 1VFEA 3RNNA 4HCWA 1ZJLA 3E13X 1BTJA 1M5EA 5CRYA 3MVYA 1OLCA 3OO7A 1XVYA 3RUMA 3MZ9A 1GV8A 2DE3A 2O1MA 2ZYKA 3KN8A 1D9VA 4EDPA 3E9XA 4YB5A 2E0SA 4LP2B 1ZU0A 3MVXA 3M3KA 1A8EA 3VFJA 3DRHA 4UACA 5AE4A 2I58A 1B3EA 1MDP1 1OIBA 5F1QA 1A54A 1VR5A 3WAFA 1HSJA 4IGTA 2NOOA 3MQ9A 3TTMA 3TYHA 1P1OA 5F7VA 1B46A 2DWJA 1MM7A 4QSEA 4E0WA 4OQOA 2I4CA 4NE4A 5H8HA 2WKYA 3SEUA 1HSEA 3PAMA 1BLFA 3SEXA 3H6UA 1SYIA 1LB8A 4ESXA 1EZOA 4F3GA 2VHAA 4GLIA 1LAXA 4ND9A 2I48A 3LVUA 3S9NC 3BKIB 2O84X 4G8HA 3PD8A 5AA2A 5I58B 2F6PA 3FD3A 1USYE 4LZ5A 3LSFB 2ONSA 4R6KA 1GVCA 2XXIA 3EQ1A 3PPNA 4JSOA 4FORA 2V93A 2Y7IA 3A09A 5CM6A 2CMOA 1AH5A 1SW1A 1VFDA 4LVQA 4ECFA 3DRKA 1QVSA 3MP6A 4KCDA 3S2VA 1WODA 3OXNA 3H3GA 5CMKA 4GL0A 1UTBB 2DXYA 3Q29A 4OFJA 1N3WA 2F5XA 5I59A 4GVOA 5ITPA 3DM0A 3OOAA 4R72A 4JWOA 3T93B 4IO5A 2VOZA 1MY3A 2ZXTA 4F19A 4Q30B 1IXIA 2D5WA 1O64A 4P0GA 1PEBA 4NF6B 1BIYA 1ZLQA 3K0VA 2AL5A 4EUOA 3ECRA 3OSRA 4G77A 3S9EA 2PMSA 2PT1A 1Z7ME 1FQAA 2RCBA 3CR9A 4F3SA 1I6QA 1Y3NA 3AXFA 4LATA 1SBPA 4YKPA 3V5AA 3RYAA 3RLFE 1D3KA 4ZEKA 2ZNUA 2P2AA 3RQTA 3C34A 4EXKA 2QL3A 4F2OA 1AIVA 1SI0A 1IXHA 2HAVA 3UK4A 2DSFA 4QSDA 1Y4CA 3BFTA 4BDQA 4IO3A 4QSCA 3N94A 4GQOA 3HCQA 3EHSA 2UVJA 3H6TA 2DWAA 1CE2A 1SDXA 1B3FA 2B3BA 3RT6B 2OBGA 3IB0A 3KJTA 4FAJA 3VVDA 5I57A 2YJPA 4X9TA 3FVGA 4IGRA 4YKJA 4TOZA 2V84A 2G93A 2XXHA 3H4ZA 3LBSA 2XXQA 1LAFE 1IUDA 2PBWA 3MZ1A 3MW0A 4NF8A 2XXUA 4RJZA 2HZKA 1Y1ZA 1WDNA 3VXCA 1N0TA 2AIXA 4RPOA 3EPEA 4GF8A 2B4LA 1I6BA 4JSDA 1QKBA 1UTHB 3C36A 4QRZA 3PPOA 3CFZA 1XT8A 4FATA 2QRYA 3EHUA 3DRIA 2R9JA 4KPTA 4HW8A 4ISUA 5I84A 2RINA 2DOJA 1A99A 4TLMB 1A40A 3BBRA 2OJTA 5CMMA 2XXYA 1S9TA 4BDLA 2CZLA 3RPWA 3PUWE 3QIMA 3C33A 3PUZE 1D4NA 4KYSA 3H6VA 5H8FB 4DIGA 4L17A 4NMYA 3VLUA 4WEPA 3CSGA 3IX1A 2XX9A 3L6GA 2PYYA 1TWYA 4PE5B 4FEDA 3LSXA 1P99A 3DRGA 1MH4A 1B7HA 2ANJA 5IKBA 1B58A 1F9BA 5I2NA 1LLSA 2IEEA 3SDFA 2GHAA 1FQBA 1OVBA 3FXRA 3FZVA 3FV2A 4Q5TA 1EU8A 2ZYNA 1ANFA 4DLDA 4R74A 3FJ7A 4OEUA 3U92A 2GH9A 2F78A 3I3VA 1GR2A 5AA1A 2P1SA 3SEVA 1JW1A 1YAEA 1M5CA 4FE8A 2YLNA 2HFBA 3GBBA 1IQ7A 4QHQA 4DXUA 4DDDA 4ZZAA 4DZ1A 1MH3A 1MQDA 5TP9B 4Q8RA 2FYIA 4TQUQ 4N07A 2ZNTA 3MWBA 1YTVA 3KSJA 2HXWA 4H65A 4PFWA 3IB1A 2RF1A 3O2AA 4NF5A 5HPQA 5AA2D 3R7XA 3TDJA 3CSBA 2AL4A 3MP1A 2I6EA 1POTA 3PPRA 1MY0A 2OK2A 5DVIA 4QFLA 2BJJX 1MXWA 2GRVA 1MPDA 4LQ5A 3GBAA 3A3UA 2A5TB 2Q89A 4F18A 3O97A 4G68A 4GRKA 4YB6A 3BFUA 2A5SA 1B32A 1SW4A 1URGA 4G8NA 3SETA 2QMXA 3KSXA 2OWSA 1N84A 4HCYA 3OO9A 4M1VA 4H5GA 2Q88A 4PFTA 3OSQA 4AQ4A 4I9DA 3G3IA 2X26A 1H43A 3MVZA 4KYDA 1VSOA 1B3GA 1MXVA 1B4HA 1NKXA 3SEWA 4MF3A 2I49A 4U1ZA 2QS1A 5A5XB 1PBQA 2NXOA 4U4XA 4WXJA 1DTZA 3MUQA 4ESWA 1FW0A 4THIA 2ESNA 1DPEA 5I2KB 3EF7A 3PV0E 4RXLA 4HS7A 1IXCA 4YU0A 3MVWA 1MQHA 1NMUA 4H5FA 4EQ9A 2QPQA 4ZEIA 5CI5A 5I56B 1SD3A 3FV1A 1RYOA 3TELA 1VE4A 1GGGA 3K6XA 2LAOA 1TFDA 4JDFA 2QS3A 4G2ZA 1P1NA 1PDAA 4F31B 3O6PA 4F29A 2KLFA 5AA4B 2UVIA 5KDTB 3S4UA 5DTBA 3U93A 3VVFA 3Q27A 1MQIA 3H03A 3IJXB 1DMBA 3LR1A 3PUXE 1NH8A 3G3FA 4KQPA 1IZ1A 5ISUA 3U72A 4KYEA 3SESA 5CMBA 5CMCA 3IB2A 3PU5A 5K2XA 1L5TA 3RYBA 3QXMA 1P1WA 1SVXB 5JEIA 4IO2A 4O3BA 1URSA 5FTIA 4R6HA 5KZTA 2HAUA 1LAGE 3ILTB 1LGBC 1TT1A 3OEMA 3H06B 4I1DA 1B9JA 4PFYA 4BDMA 3HSTA 1I69A 3TTKA 2Q8JA 2OLBA 3B6WA 3SKPA 4XTCQ 2ZMBA 3QYTA 1B1HA 4UA8A 4KHZE 3A3CA 1H45A 2PVUA 3RGYA 2GHBA 5I58A 3E3KA 1LBCA 2RC8A 1LSTA 5FHNA 1N04A 3SERA 3T9UA 5EHSA 3KN7A 4PQJA 1OMPA 2QS4A 3ZKLA 4RA1A 1US5A 4XKQA 1LBBA 2F36A 1SI1A 1NNFA 5TPAB 1UIUA 2DE2A 1ZTYA 1A55A 2O51A 1Z7NE 2F35A 4H67A 2ABHA 2PT2A 2VGQA 2Z8FA 1JW4A 4R9GA 3HV1A 5DEXB 4ELQA 4U1OA 1UTBA 3CRBA 2Q9TA 4GWOA 2DE4A 1ZIUA 3DRFA 2P0SA 4DCYA 3S9LC 1MPBA 3H6WA 3LSWA 5J1DA 3V89B 3C32A 4JBZA 4OESA 4JWXA 1LFHA 2OZZA 5ICQA 1N76A 1P1QA 4AB5A 5LOMA 3MZBA 3TUSA 2VP1A 4X1BA 3O66A 3OEKA 5K2YA 1II5A 4NF6A 4PETA 3HHGA 5B7DA 4NF4B 2O6AA 5DYHA 3M8UA 3MC2A 1H44A 1UQWA 3QK6A 3FVKA 3VLWA 3OD7A 4MFIA 5B70A 3UGWA 4YAHX 1JEUA 1IXGA 1XC1A 3FVNA 3QUFA 4OXVA 1M5FA 1KWHA 4O3AA 3K02A 1PB7A 3PD9A 3OMBA 3IJOB 2R6GE 3B6QA 4GIZA 3PGFA 1FQEA 1NNTA 1M5BA 4C0RA 4BDOA 1Q1KA 3TTNA 3G3HA 4P11A 3KBRA 1MY1A 2G29A 5H8NB 4XKPA 4EF2A 4GXSB 4U2RA 2XXTA 4XIGQ 1B2HA 3IORA 3T66A 3RTFB 1BP5A 1DTGA 3OO8A 3RN8A 1YPNA 4DXCA 3FXQA 1FTKA 4XKNA 4R9FA 4ZEFA 2XX7A 3PPQA 3F11A 3IO4A 4OENA 4YMBA 1XHYA 4IY6A 3O6HA 4IY5A 4KCCA 1OQHA 2QMWA 2H99A 2FA7A 2I3VA 3CHGA 3Q25A 4LUBA 5ELVA 1A7LA 2H4IA 2O7UA 2FNCA 1B51A 3OO6A 4MH5A 3HN0A 1JEVA 5JTYB 3G7WA 3V8XB 2HEUA 2UVHA 3T9VA 2PX1A 4F1UA 2B4MA 5KCJB 3QSLA 1UTHA 3RY3A 3K2DA 1FQDA 4YZZA 2I0CA 1O63A 2WOKA 3OELA 4KR5A 4OVJA 4F3PA 3PUYE 1URDA 4JXIA 3CG3A 1FTJA 4ZEBA 5TU0A 3Q28A 1US4A 3T96B 1FQFA 4G4PA 3W9VA 3VLVA
chains in the Genus database with same CATH superfamily
2WOPA 1Y1MA 5H8FA 2DWHA 2FBPA 3K01A 5IZ3B 2HXRA 3SEYA 4BLAA 1B05A 2M8CA 1BKAA 4OHNA 4OFLA 3IAZA 2Y7KA 5EHMA 1MG1A 2REGA 3N5LA 2NWJA 1IMFA 1JQFA 2OWTA 1KZ8A 4QFKA 2F8DA 5L8DA 2ALUA 1DSNA 4ZS9A 3FGSA 3ZSFA 1Y3QA 1N7XA 3TODA 4PTKA 5L9OA 1ZMGA 1B1XA 2UXAA 5H8QB 5A5LA 4R75A 2UYFA 4G8MA 4IO7A 1YCJA 2XD3A 3C31A 4GBWA 4PBHA 3S9MC 1LCTA 5EQ9A 4GX6A 4MCOA 4P1LA 4F39A 2NUVA 1MXYA 2VD3A 2L5VA 4RK2A 3DP8A 1EZPA 2XXXA 1JW5A 2DVZA 1NFTA 3IOVA 1ELJA 2RC7A 2DYXA 2ONKE 1OLAA 4EXLA 1NH7A 3MPKA 3K1NA 1SW2A 1LEVA 1RKMA 4F1YA 4QFNA 3N26A 1XOCA 4NG7A 5TP9A 4DE8A 1J1NA 3VVEA 3EN3A 1QJMA 4ZZEA 1LB9A 4GL8A 2AYSA 3UA8A 1B7UA 1B5JA 3QUJA 1MXXA 3DP4A 5DVFA 4R6YA 3UP9A 4MBPA 2Y84A 3T0JA 4LA9A 1QULA 1CB6A 3IOWA 4O3CA 4PE3A 3CFLA 5BWJA 3TCFA 1K9YA 3VE1B 5BUUA 3DRJA 2QSXA 4FJPA 1NL5A 5H8SA 1R1NA 5IGAA 4KI0E 5ITOA 4MLQA 3UORA 1POY1 2A5TA 1OQGA 2F3BA 2O69A 5HBCA 3IOUA 3MJNA 2QVVA 3TFLA 5L9MA 3IO6A 4PP0A 2WOLA 4XEQA 3PMWA 3KC1A 5FHOA 3GXAA 4QFPA 4OANA 3SZPA 3O28A 4H6DA 1MXUA 4YMAA 2XHDA 5JK4A 5FHMA 1OVTA 2XWIA 4OEVA 4QFOA 1ZBMA 1QUKA 4IO4A 4F3BA 2VD2A 3HHFA 1QW0A 5CC2A 1G0IA 4AB6A 4HTGA 4YICA 4MHFA 1A8FA 5H8HB 1JNFA 1B5HA 4Z0IA 2F7CA 2NVUB 1S7YA 4G61A 5A5XA 3FIRA 2RC9A 2Z22A 3TQLA 2Q2AA 3U8QA 2DS9A 5FBPA 1JVXA 4ZECA 4IO6A 3T22A 1FJ9A 4G68C 5I2KA 4DCXA 5AA2B 2FHYA 3H7MA 4FIMA 1B0HA 3EHTA 1EYKA 3VDFA 4P1EA 4I62A 1LFIA 1NNKA 2Y7WA 3MAMA 1DPPA 3K1MA 2F7BA 4OWDA 4DI3D 4PFIA 5I56A 2ZZXA 1M5DA 4GBVA 4ONYA 3IFAA 4F1VA 3FVOA 3KG2A 2O68A 1FJ6A 1INPA 1MRPA 2DVCA 4O7MA 1S50A 1LFGA 3FXUA 4JWYA 1FBDA 1B5IA 4EQ7A 2DXRA 5EQ7A 5AA4A 3TQWA 4XKRA 2XD2A 5KDTA 1QUIA 3C9HA 3IK6B 2P3NA 4RK9A 5I59B 2XXVA 3ONMA 4GFRA 1XI6A 4P47A 3T9XB 2I0BA 3N6UA 4IB2A 4PDHA 4YB7A 4ZEDA 3JV9A 1R6ZA 4C1TA 2F34A 3D1RA 1YXIA 3K6WA 1QKAA 4YKIA 1FBPA 3K6VA 4O94A 2Q8MA 1YZ0A 2QVRA 3GLBA 3HO7A 5CBSA 3W9WA 1IIWA 1GTKA 4KD5A 1MM6A 4WKMA 1B3HA 1B6HA 4R73A 2XWVA 3IL1B 4OFOA 4GXAA 1H76A 1IEJA 3IR1A 2YPNA 3VV5A 4OZ9A 3LC8A 1SW5A 2F97A 3PUVE 5M2VA 2W7YA 4U22A 3MP8A 2O7IA 5ICTA 4K3FA 2O1LA 3KZGA 4OMBA 4F2QA 4X1DA 4LN5A 4GD5A 3U94A 1MXZA 3Q26A 4MIJA 1DOTA 2ZZVA 5I3SA 3G3KA 3DELB 3B7DA 1IITA 5AA3A 4M4GA 4N6DA 4ELOA 3K4UA 3ILUB 2QJEA 3R26A 4R2BA 1EYJA 2WYKA 2XXWA 1NNPA 1HSLA 5DT6A 1I6AA 2WEFA 4YKKA 1TFAA 1YYZA 4OYVA 3I6VA 4PAFA 4OVQA 3DP6A 2RKMA 4GWXA 3TAJA 3D4GA 1B7ZA 5TPAA 3TZAA 4WEDA 5I57B 3P7IA 4H0WA 2XX8A 3K1PA 3WAEA 2DWIA 1RDYA 2QS2A 4LQ2A 3MYUA 5LTCA 3G3GA 3KGCA 5DEXA 3B6TA 5DVJA 2XXRA 3DLNA 4ZE9A 2ZYMA 4Z7EA 4U23A 4NWDA 4NF8B 3N6TA 1B0LA 4OTEA 1XVXA 1UIVA 3ZS6A 1FCKA 1R9LA 2B65A 4RNSA 4FEBA 2HZLA 4NWCA 3L6HA 4EQBA 1NV3A 3VXBA 3OENA 4P3LA 3KN3A 1MQGA 3THIA 2X7QA 1JETA 4BDNA 3TKDA 4NF4A 4MX6A 3M3FA 3PPPA 3RT8A 1LAHE 2ZNSA 4JB7A 3EKIA 1FPGA 1P1UA 3TPAA 1FBEA 3G3JA 1NV5A 3FASA 3HFUA 1FQCA 2GFEA 4N6PA 1Y4TA 2XXPA 3FJMA 4OETA 3U1OA 4BDRA 3GYYA 4NEDA 2RCAA 4PF8A 4OVSA 4QF9A 1K9ZA 4POXA 1B40A 4F22A 3V83A 1B3LA 4LZ7A 3CIJA 1MY4A 2Y7RA 2Z8DA 2DQVA 1EZ9A 2Z23A 3FTOA 2B3FA 2V25A 2REJA 3LSLA 5H8NA 2HQ0A 3ODBA 5I2NB 1FBFA 1MS7A 1LBWA 4Q0CA 1AMFA 3PMXA 2F7AA 1ATGA 3C4MA 1D9YA 1RYXA 1PB9A 4EF1A 4ELPA 3KBZA 2X7PA 3LUYA 3U65A 4ZDMA 3D4CA 1FTMA 1NV2A 3TCHA 4NTLA 1TXFA 3BIGA 4NX1A 1B52A 4MNIA 1MY2A 2KQZA 4RY1A 4E0XA 2IA4A 2UYEA 5HM4B 5CBRA 1B4ZA 3I5OA 1XS5A 1O7TA 3QAXA 4ZE8A 3M3LA 4HE0A 3USDA 1N7WA 4MNPA 3KEIA 1Y9UA 2H98A 1MDQA 4H1XA 1R9QA 3W15C 4RYAA 3O9PA 5EYFA 2D21A 2R71A 4DXBA 3CVGA 5JTYA 5L9SA 1Y20A 2H25A 1FTLA 1ZKBA 2I3WA 3QMFA 3KJ7A 3RTWB 4AS4A 3O29A 4LZ8A 5KCJA 1IMAA 1FPEA 4NF5B 1IMCA 1DBZA 2Z8EA 3CFXA 2HCAA 4U21A 1WVJA 4H46A 4FECA 4XFEA 4OERA 1FTOA 2D3IA 3UIFA 3RPLB 4GOTA 3JZJA 1USYH 1PBPA 4U4SA 1D9QA 4NQ8A 2H5YA 3TTRA 2V3QA 2ZYOA 1N3XA 2DP8A 1EYIA 1H3DA 4R2FA 1AOVA 4N13A 1EH3A 5I7IA 3KOTA 2CEXA 1FBGA 2R8TA 4TLLB 3O6GA 4C1UA 3KOSA 2I4BA 1AL3A 1LCFA 4G68B 1IMDA 1SYHA 1NUYA 3ZKKA 4P0IA 5IZ3A 4MLVA 2JJKA 1MPCA 2E1SA 5IM2A 3K00A 4H8JA 3E4RA 3JYRA 3IOTA 3GZGA 2THIA 2FIXA 3FATA 3MBPA 1PB8A 4N15A 5IAIA 2Q2CA 4X48A 2CZKA 3UN6A 3CI8A 5H8QA 2WBDA 4GWYA 3TTLA 2F6GA 2VPNA 4N91A 5DW8A 1JVYA 2Y7PA 1PC3A 1Q35A 3B50A 4KFQA 1FTAA 3FJGA 3O6IA 4RPNA 3MPLA 1FBCA 3PMVA 4PFUA 4POWA 3TEPA 2CZIA 3R6UA 2QVUA 1T0KA 4XXUA 1QUJA 1Y3PA 5ET8A 5T3JA 3KFMA 4N4UA 4PFBA 4N8YA 5FTHA 1MQJA 5ET5A 4ELRA 3CG1A 3HPIA 2OCUA 3C35A 2ONRA 5IZZA 3TCGA 1SQYA 3TMGA 2V3TA 4I8CA 3K6UA 4H8IA 3T9HB 3FUZA 2UVGA 4LONB 2V3UA 2H9BA 1VFEA 3RNNA 4HCWA 1ZJLA 3E13X 1BTJA 1M5EA 5EYHA 5CRYA 3RYDA 3MVYA 1OLCA 3OO7A 1XVYA 3RUMA 3E78A 3MZ9A 1NUZA 1GV8A 2DE3A 2O1MA 2ZYKA 3KN8A 1D9VA 4EDPA 3E9XA 1FPFA 4UABA 4YB5A 4I3EA 1IMBA 1Q9DA 2E0SA 4LP2B 1ZU0A 3MVXA 3M3KA 1A8EA 3VFJA 1FBHA 3DRHA 4UACA 5AE4A 2I58A 1B3EA 1MDP1 1OIBA 4NF0A 5F1QA 1A54A 1VR5A 3WAFA 1HSJA 4IGTA 3LUZA 2NOOA 3MQ9A 3TTMA 3TYHA 2WYPA 1P1OA 5F7VA 4N8GA 1B46A 2DWJA 1MM7A 4QSEA 4E0WA 4OQOA 2I4CA 4NE4A 4KXPA 5H8HA 2WKYA 3SEUA 1HSEA 3PAMA 1BLFA 3FXBA 3SEXA 3H6UA 1SYIA 1LB8A 4ESXA 1EZOA 4F3GA 2VHAA 4GLIA 1LAXA 4ND9A 2I48A 3LVUA 3S9NC 1NV6A 3BKIB 2O84X 4G8HA 4NHBA 3PD8A 3PTYA 4N6KA 5AA2A 5I58B 2F6PA 3FD3A 3FBPA 1USYE 4LZ5A 3LSFB 4IR8A 2ONSA 4R6KA 1GVCA 2XXIA 3EQ1A 3PPNA 4JSOA 4FORA 2V93A 2Y7IA 3MSTA 2CZHA 3A09A 2CMOA 5CM6A 1AH5A 1SW1A 1VFDA 4LVQA 4ECFA 2PFZA 3DRKA 1QVSA 3MP6A 4KCDA 3S2VA 1WODA 3OXNA 5EQ8A 3H3GA 4N17A 5CMKA 4GL0A 1UTBB 1RDZA 2DXYA 3Q29A 4OFJA 1N3WA 2F5XA 5I59A 4GVOA 5ITPA 3T1BA 4I40A 3DM0A 4O7IA 3OOAA 4R72A 4JWOA 3T93B 4IO5A 2VOZA 1MY3A 2ZXTA 4F19A 4Q30B 1IXIA 2D5WA 1KA0A 1O64A 4P0GA 1PEBA 4NF6B 1BIYA 5LDZA 1ZLQA 3K0VA 5IZ1A 2AL5A 4EUOA 3ECRA 3OSRA 4G77A 3S9EA 2PMSA 2PT1A 1Z7ME 1FQAA 2RCBA 3CR9A 4F3SA 1I6QA 1Y3NA 3AXFA 4LATA 1SBPA 4YKPA 3V5AA 3RYAA 3RLFE 1D3KA 4ZEKA 2ZNUA 2P2AA 3RQTA 3C34A 4EXKA 2QL3A 4NN3A 4F2OA 1AIVA 1SI0A 1IXHA 2HAVA 5ET6A 3UK4A 2DSFA 4QSDA 1Y4CA 3BFTA 4BDQA 2XA5A 4IO3A 4QSCA 3N94A 4GQOA 3HCQA 4OVTA 4QBAA 3EHSA 2UVJA 3H6TA 4HE2A 2DWAA 1CE2A 1SDXA 1B3FA 2B3BA 3RT6B 2OBGA 3IB0A 3KJTA 4FAJA 3VVDA 3IFCA 5I57A 4H45A 2YJPA 1CNQA 4X9TA 3FVGA 2MKZA 4IGRA 4YKJA 4TOZA 2V84A 2G93A 2XXHA 3H4ZA 3LBSA 2XXQA 1LAFE 4JVIA 1IUDA 2PBWA 1RDXA 3MZ1A 4GWUA 3MW0A 4NF8A 2XXUA 4RJZA 2HZKA 1Y1ZA 1WDNA 3VXCA 1N0TA 2AIXA 3ROJA 4RPOA 3EPEA 4GF8A 2B4LA 1I6BA 4JSDA 1QKBA 1UTHB 3C36A 4P56A 4QRZA 3PPOA 3CFZA 1XT8A 4FATA 2QRYA 3EHUA 3DRIA 2R9JA 4KPTA 4HW8A 4ISUA 5I84A 2RINA 2DOJA 1A99A 2GQ1A 4TLMB 1A40A 3BBRA 2OJTA 3BIHA 5CMMA 2XXYA 1S9TA 4BDLA 2CZLA 3RPWA 4MAGA 3PUWE 3QIMA 3C33A 3PUZE 1D4NA 4KYSA 4PBQA 3H6VA 5H8FB 4DIGA 4L17A 4NMYA 3VLUA 2V4CA 4WEPA 3CSGA 2XWKA 3IX1A 2XX9A 3L6GA 2PYYA 1TWYA 4PE5B 4FEDA 4PDDA 3LSXA 1P99A 3DRGA 1MH4A 1B7HA 4GX4A 2ANJA 5IKBA 4MJOA 1B58A 1F9BA 5I2NA 1VDWA 1LLSA 2IEEA 3SDFA 2GHAA 1SPIA 2WBBA 1FQBA 1OVBA 3FXRA 3FZVA 3FV2A 4Q5TA 1EU8A 2ZYNA 1FPBA 1ANFA 4P9KA 4DLDA 4R74A 3FJ7A 1FPJA 4OEUA 3U92A 2GH9A 4O8MA 2F78A 3I3VA 1GR2A 5AA1A 2QFLA 2P1SA 3SEVA 1JW1A 1YAEA 1M5CA 4FE8A 4GX3A 2YLNA 4FBPA 5F24A 2HFBA 3A29A 3GBBA 1IQ7A 4QHQA 4DXUA 4DDDA 4ZZAA 4DZ1A 1MH3A 1MQDA 5TP9B 4Q8RA 2FYIA 4TQUQ 2Y5KA 2Q74A 4N07A 2ZNTA 3MWBA 1YTVA 2OX3A 3KSJA 2HXWA 4H65A 4PFWA 1FPKA 2RF1A 3IB1A 3O2AA 4NF5A 4XF5A 5HPQA 5AA2D 3R7XA 3TDJA 3CSBA 2OWZA 4MEVA 2AL4A 3MP1A 4JVDA 3RPLA 2I6EA 1POTA 1NUXA 3PPRA 2FIEA 1MY0A 2OK2A 5DVIA 4QFLA 5ESYA 2BJJX 1MXWA 1NV1A 2GRVA 1MPDA 4LQ5A 4OVPA 3GBAA 3A3UA 2A5TB 2Q89A 1FPIA 3O97A 4G68A 4F18A 4GRKA 4YB6A 3BFUA 2A5SA 1B32A 2XXKA 1SW4A 1URGA 4G8NA 2PFYA 4HXVA 3SETA 2QMXA 3KSXA 2OWSA 1N84A 4HCYA 3OO9A 4M1VA 4H5GA 2Q88A 4PFTA 3OSQA 4AQ4A 4I9DA 3G3IA 3LV0A 3B8BA 2X26A 1H43A 1DK4A 3MVZA 4KYDA 1VSOA 1B3GA 1MXVA 1B4HA 2WX9A 1NKXA 2HHMA 3SEWA 4MF3A 2I49A 4U1ZA 3KC0A 2QS1A 5A5XB 1PBQA 1FSAA 4MNCA 2NXOA 4U4XA 4WXJA 1DTZA 3MUQA 4ESWA 1FW0A 4THIA 2ESNA 1DPEA 1LBYA 5I2KB 1QGXA 3EF7A 3PV0E 4RXLA 4HS7A 2FVZA 2VPOA 1IXCA 4YU0A 3MVWA 1MQHA 1NMUA 4H5FA 4EQ9A 2QPQA 1JP4A 2BJIA 4ZEIA 5CI5A 5J16A 5I56B 1SD3A 4OA4A 3FV1A 1RYOA 3TELA 1VE4A 1GGGA 3K6XA 2LAOA 1TFDA 4NGUA 4JDFA 2QS3A 4G2ZA 1FPLA 1P1NA 1PDAA 4F31B 3O6PA 4F29A 2KLFA 2DDKA 5EYGA 5AA4B 5I5PA 2UVIA 5KDTB 3S4UA 5DTBA 3U93A 4PGNA 4I3YA 3VVFA 2Y5LA 3Q27A 1MQIA 3H03A 3IJXB 4PAKA 1DMBA 3LR1A 3PUXE 1NH8A 4PC9A 3G3FA 4KQPA 1IZ1A 5ISUA 3U72A 4KYEA 3SESA 5CMBA 5CMCA 3IB2A 3PU5A 5K2XA 2CEYA 1L5TA 3RYBA 3QXMA 1P1WA 1SVXB 5JEIA 4JVCA 4IO2A 4O3BA 1URSA 5FTIA 4X8RA 4R6HA 5KZTA 2HAUA 1LAGE 5ET7A 3ILTB 1LGBC 1TT1A 3E79A 3OEMA 3H06B 4I1DA 1B9JA 4PFYA 4BDMA 2F3DA 3HSTA 1I69A 3TTKA 2Q8JA 2OLBA 3B6WA 3SKPA 2VT5A 4XTCQ 2ZMBA 3QYTA 2P3VA 1B1HA 4UA8A 4DI4B 4KHZE 3A3CA 4X04A 1H45A 2PVUA 3RGYA 2GHBA 5I58A 3E3KA 1LBCA 2RC8A 1LSTA 5FHNA 1N04A 1NV7A 3SERA 3T9UA 5EHSA 4AS5A 3KN7A 4PQJA 1OMPA 2QS4A 3ZKLA 4RA1A 1US5A 4XKQA 1LBBA 2F36A 1SI1A 1NNFA 5TPAB 1UIUA 2DE2A 1ZTYA 1A55A 4PGPA 1FRPA 2O51A 1Z7NE 2F35A 1AWBA 4H67A 2ABHA 2PT2A 2VGQA 2Z8FA 1JW4A 4R9GA 3HV1A 4MMPA 5DEXB 2HPGA 4ELQA 4U1OA 1UTBA 3CRBA 1LBXA 2Q9TA 4QXDA 4GWOA 2DE4A 1ZIUA 4GWZA 3DRFA 2P0SA 4DCYA 3S9LC 1MPBA 2KR0A 3H6WA 3LSWA 5J1DA 3V89B 3C32A 4JBZA 4OESA 4JWXA 1LFHA 2OZZA 5ICQA 1N76A 1P1QA 4AB5A 5LOMA 1NV0A 3MZBA 4GWWA 2VP1A 3TUSA 1KA1A 4X1BA 3O66A 3OEKA 5K2YA 1II5A 4NF6A 4PETA 4P8BA 3HHGA 5B7DA 4NF4B 2PCRA 2O6AA 5DYHA 4N81A 3M8UA 3MC2A 1H44A 1UQWA 4NAPA 3QK6A 2XWOA 3FVKA 3VLWA 3OD7A 4MFIA 5B70A 3UGWA 4YAHX 1JEUA 1IXGA 1XC1A 5EQAA 3FVNA 3QUFA 4OXVA 1M5FA 1KWHA 4O3AA 3K02A 1NV4A 1PB7A 3PD9A 3OMBA 3IJOB 4OVRA 2R6GE 3B6QA 1FPDA 1NUWA 4GIZA 3PGFA 1FQEA 1NNTA 4PAIA 1M5BA 4C0RA 4BDOA 1Q1KA 3TTNA 3G3HA 4P11A 3KBRA 1MY1A 2G29A 1BK4A 4PF6A 4XKPA 5H8NB 4EF2A 4GXSB 4U2RA 2XXTA 4XIGQ 1B2HA 3IORA 3T66A 3RTFB 1BP5A 1DTGA 3OO8A 4PCDA 3RN8A 1YPNA 4DXCA 3FXQA 1LBZA 1FTKA 4XKNA 4HE1A 4R9FA 4ZEFA 2XX7A 3PPQA 3F11A 3IO4A 4OENA 4YMBA 1XHYA 4IY6A 3O6HA 4IY5A 4KCCA 1OQHA 2QMWA 4PFRA 2H99A 2FA7A 2I3VA 3CHGA 3Q25A 4LUBA 5ELVA 1A7LA 2H4IA 2O7UA 2FNCA 1DCUA 1B51A 1IMEA 3OO6A 4MH5A 3HN0A 1JEVA 5JTYB 3G7WA 3V8XB 2HEUA 2UVHA 3T9VA 2PX1A 1NI9A 4F1UA 2B4MA 5KCJB 3QSLA 1UTHA 3RY3A 3K2DA 3NOHA 1FQDA 4YZZA 2I0CA 1O63A 2WOKA 3OELA 4KR5A 4OVJA 4F3PA 3PUYE 1URDA 1LBVA 4GWSA 4JXIA 3CG3A 2ZZWA 1FTJA 4ZEBA 5TU0A 3ISPA 3Q28A 1US4A 3T96B 1FQFA 4G4PA 3W9VA 3VLVA 1G0HA
chains in the Genus database with same CATH topology
2WOPA 1Y1MA 5H8FA 2DWHA 3K01A 3SEYA 4BLAA 1B05A 2M8CA 1BKAA 4OHNA 4OFLA 3IAZA 2Y7KA 5EHMA 1MG1A 2REGA 3N5LA 2NWJA 1JQFA 2OWTA 4QFKA 2F8DA 5L8DA 2ALUA 1DSNA 4ZS9A 3FGSA 3ZSFA 1Y3QA 1N7XA 3TODA 5L9OA 1ZMGA 1B1XA 2UXAA 5H8QB 4R75A 2UYFA 4G8MA 4IO7A 1YCJA 2XD3A 3C31A 3S9MC 1LCTA 4F39A 2NUVA 1MXYA 2VD3A 4RK2A 3DP8A 1EZPA 2XXXA 1JW5A 2DVZA 1NFTA 3IOVA 1ELJA 2RC7A 2DYXA 2ONKE 1OLAA 4EXLA 1NH7A 3MPKA 3K1NA 1SW2A 1RKMA 4F1YA 4QFNA 3N26A 1XOCA 5TP9A 4DE8A 1J1NA 3VVEA 3EN3A 1QJMA 4ZZEA 1LB9A 4GL8A 2AYSA 3UA8A 1B7UA 1B5JA 3QUJA 1MXXA 3DP4A 5DVFA 4R6YA 3UP9A 4MBPA 2Y84A 4LA9A 1QULA 1CB6A 3IOWA 4O3CA 3CFLA 5BWJA 3TCFA 3VE1B 5BUUA 3DRJA 2QSXA 4FJPA 1NL5A 5H8SA 1R1NA 4KI0E 5ITOA 4MLQA 3UORA 1POY1 2A5TA 1OQGA 2O69A 5HBCA 3IOUA 3MJNA 3TFLA 5L9MA 3IO6A 4PP0A 2WOLA 3PMWA 5FHOA 3GXAA 4QFPA 3O28A 4H6DA 1MXUA 4YMAA 2XHDA 5JK4A 5FHMA 1OVTA 4OEVA 4QFOA 1ZBMA 1QUKA 4IO4A 4F3BA 2VD2A 3HHFA 1QW0A 5CC2A 4AB6A 4HTGA 4YICA 1A8FA 5H8HB 1JNFA 1B5HA 4Z0IA 2F7CA 2NVUB 1S7YA 5A5XA 3FIRA 2RC9A 2Z22A 3TQLA 2Q2AA 3U8QA 2DS9A 1JVXA 4ZECA 4IO6A 3T22A 4G68C 5I2KA 4DCXA 5AA2B 3H7MA 4FIMA 1B0HA 3EHTA 3VDFA 4I62A 1LFIA 1NNKA 2Y7WA 3MAMA 1DPPA 3K1MA 2F7BA 4OWDA 5I56A 1M5DA 4ONYA 4F1VA 3FVOA 3KG2A 2O68A 1MRPA 2DVCA 1S50A 1LFGA 3FXUA 4JWYA 1B5IA 4EQ7A 2DXRA 5AA4A 3TQWA 4XKRA 2XD2A 5KDTA 1QUIA 3C9HA 3IK6B 4RK9A 5I59B 2XXVA 3ONMA 4GFRA 3T9XB 2I0BA 3N6UA 4IB2A 4YB7A 4ZEDA 3JV9A 1R6ZA 4C1TA 2F34A 3K6WA 1QKAA 4YKIA 3K6VA 3GLBA 3HO7A 5CBSA 3W9WA 1IIWA 1GTKA 4KD5A 1MM6A 4WKMA 1B3HA 1B6HA 4R73A 3IL1B 4OFOA 4GXAA 1H76A 1IEJA 3IR1A 2YPNA 3VV5A 4OZ9A 3LC8A 1SW5A 2F97A 3PUVE 5M2VA 2W7YA 4U22A 3MP8A 2O7IA 5ICTA 4K3FA 2O1LA 3KZGA 4OMBA 4F2QA 4X1DA 4GD5A 3U94A 1MXZA 3Q26A 1DOTA 3G3KA 3DELB 3B7DA 1IITA 5AA3A 4M4GA 4ELOA 3K4UA 3ILUB 2QJEA 3R26A 4R2BA 2XXWA 1NNPA 1HSLA 5DT6A 1I6AA 4YKKA 1TFAA 4OYVA 3I6VA 3DP6A 2RKMA 3TAJA 3D4GA 1B7ZA 5TPAA 3TZAA 4WEDA 5I57B 3P7IA 4H0WA 2XX8A 3K1PA 3WAEA 2DWIA 2QS2A 4LQ2A 3G3GA 3KGCA 5DEXA 3B6TA 5DVJA 2XXRA 3DLNA 4ZE9A 2ZYMA 4Z7EA 4U23A 4NWDA 4NF8B 3N6TA 1B0LA 4OTEA 1XVXA 1UIVA 3ZS6A 1FCKA 1R9LA 2B65A 4RNSA 4FEBA 2HZLA 4NWCA 3L6HA 4EQBA 3VXBA 3OENA 3KN3A 1MQGA 3THIA 2X7QA 1JETA 4BDNA 3TKDA 4NF4A 3M3FA 3PPPA 3RT8A 1LAHE 2ZNSA 4JB7A 1P1UA 3TPAA 3G3JA 3FASA 1FQCA 2GFEA 4N6PA 1Y4TA 2XXPA 3FJMA 4OETA 3U1OA 4BDRA 4NEDA 2RCAA 4QF9A 4POXA 1B40A 4F22A 3V83A 1B3LA 4LZ7A 3CIJA 1MY4A 2Y7RA 2Z8DA 2DQVA 1EZ9A 2Z23A 3FTOA 2B3FA 2V25A 2REJA 3LSLA 5H8NA 2HQ0A 3ODBA 5I2NB 1MS7A 4Q0CA 1AMFA 3PMXA 2F7AA 1ATGA 3C4MA 1D9YA 1RYXA 1PB9A 4EF1A 4ELPA 2X7PA 3LUYA 4ZDMA 3D4CA 1FTMA 3TCHA 4NTLA 1TXFA 1B52A 1MY2A 4RY1A 4E0XA 2IA4A 2UYEA 5HM4B 5CBRA 1B4ZA 3I5OA 1XS5A 1O7TA 3QAXA 4ZE8A 3M3LA 3USDA 1N7WA 3KEIA 1Y9UA 2H98A 1MDQA 4H1XA 1R9QA 3W15C 4RYAA 3O9PA 5EYFA 2D21A 2R71A 4DXBA 3CVGA 5JTYA 5L9SA 1Y20A 2H25A 1FTLA 1ZKBA 2I3WA 3KJ7A 3RTWB 3O29A 4LZ8A 5KCJA 4NF5B 2Z8EA 3CFXA 2HCAA 4U21A 1WVJA 4FECA 4OERA 1FTOA 2D3IA 3UIFA 4GOTA 3JZJA 1USYH 1PBPA 4U4SA 2H5YA 3TTRA 2V3QA 2ZYOA 1N3XA 2DP8A 1H3DA 4R2FA 1AOVA 4N13A 1EH3A 3KOTA 4TLLB 3O6GA 4C1UA 3KOSA 2I4BA 1AL3A 1LCFA 4G68B 1SYHA 3ZKKA 4P0IA 4MLVA 1MPCA 2E1SA 3K00A 4H8JA 3E4RA 3JYRA 3IOTA 3GZGA 2THIA 3FATA 3MBPA 1PB8A 5IAIA 2Q2CA 4X48A 3UN6A 3CI8A 5H8QA 3TTLA 2F6GA 1JVYA 2Y7PA 1PC3A 1Q35A 4KFQA 3FJGA 3O6IA 4RPNA 3MPLA 3PMVA 4PFUA 4POWA 3TEPA 3R6UA 1T0KA 4XXUA 1QUJA 1Y3PA 3KFMA 5FTHA 1MQJA 4ELRA 3CG1A 2OCUA 3C35A 3HPIA 2ONRA 3TCGA 1SQYA 3TMGA 2V3TA 4I8CA 3K6UA 4H8IA 3T9HB 3FUZA 2UVGA 4LONB 2V3UA 2H9BA 1VFEA 3RNNA 4HCWA 1ZJLA 3E13X 1BTJA 1M5EA 5CRYA 3MVYA 1OLCA 3OO7A 1XVYA 3RUMA 3MZ9A 1GV8A 2DE3A 2O1MA 2ZYKA 3KN8A 1D9VA 4EDPA 3E9XA 4YB5A 2E0SA 4LP2B 1ZU0A 3MVXA 3M3KA 1A8EA 3VFJA 3DRHA 4UACA 5AE4A 2I58A 1B3EA 1MDP1 1OIBA 5F1QA 1A54A 1VR5A 3WAFA 1HSJA 4IGTA 2NOOA 3MQ9A 3TTMA 3TYHA 1P1OA 5F7VA 1B46A 2DWJA 1MM7A 4QSEA 4E0WA 4OQOA 2I4CA 4NE4A 5H8HA 2WKYA 3SEUA 1HSEA 3PAMA 1BLFA 3SEXA 3H6UA 1SYIA 1LB8A 4ESXA 1EZOA 4F3GA 2VHAA 4GLIA 1LAXA 4ND9A 2I48A 3LVUA 3S9NC 3BKIB 2O84X 4G8HA 3PD8A 5AA2A 5I58B 2F6PA 3FD3A 1USYE 4LZ5A 3LSFB 2ONSA 4R6KA 1GVCA 2XXIA 3EQ1A 3PPNA 4JSOA 4FORA 2V93A 2Y7IA 3A09A 5CM6A 2CMOA 1AH5A 1SW1A 1VFDA 4LVQA 4ECFA 3DRKA 1QVSA 3MP6A 4KCDA 3S2VA 1WODA 3OXNA 3H3GA 5CMKA 4GL0A 1UTBB 2DXYA 3Q29A 4OFJA 1N3WA 2F5XA 5I59A 4GVOA 5ITPA 3DM0A 3OOAA 4R72A 4JWOA 3T93B 4IO5A 2VOZA 1MY3A 2ZXTA 4F19A 4Q30B 1IXIA 2D5WA 1O64A 4P0GA 1PEBA 4NF6B 1BIYA 1ZLQA 3K0VA 2AL5A 4EUOA 3ECRA 3OSRA 4G77A 3S9EA 2PMSA 2PT1A 1Z7ME 1FQAA 2RCBA 3CR9A 4F3SA 1I6QA 1Y3NA 3AXFA 4LATA 1SBPA 4YKPA 3V5AA 3RYAA 3RLFE 1D3KA 4ZEKA 2ZNUA 2P2AA 3RQTA 3C34A 4EXKA 2QL3A 4F2OA 1AIVA 1SI0A 1IXHA 2HAVA 3UK4A 2DSFA 4QSDA 1Y4CA 3BFTA 4BDQA 4IO3A 4QSCA 3N94A 4GQOA 3HCQA 3EHSA 2UVJA 3H6TA 2DWAA 1CE2A 1SDXA 1B3FA 2B3BA 3RT6B 2OBGA 3IB0A 3KJTA 4FAJA 3VVDA 5I57A 2YJPA 4X9TA 3FVGA 4IGRA 4YKJA 4TOZA 2V84A 2G93A 2XXHA 3H4ZA 3LBSA 2XXQA 1LAFE 1IUDA 2PBWA 3MZ1A 3MW0A 4NF8A 2XXUA 4RJZA 2HZKA 1Y1ZA 1WDNA 3VXCA 1N0TA 2AIXA 4RPOA 3EPEA 4GF8A 2B4LA 1I6BA 4JSDA 1QKBA 1UTHB 3C36A 4QRZA 3PPOA 3CFZA 1XT8A 4FATA 2QRYA 3EHUA 3DRIA 2R9JA 4KPTA 4HW8A 4ISUA 5I84A 2RINA 2DOJA 1A99A 4TLMB 1A40A 3BBRA 2OJTA 5CMMA 2XXYA 1S9TA 4BDLA 2CZLA 3RPWA 3PUWE 3QIMA 3C33A 3PUZE 1D4NA 4KYSA 3H6VA 5H8FB 4DIGA 4L17A 4NMYA 3VLUA 4WEPA 3CSGA 3IX1A 2XX9A 3L6GA 2PYYA 1TWYA 4PE5B 4FEDA 3LSXA 1P99A 3DRGA 1MH4A 1B7HA 2ANJA 5IKBA 1B58A 1F9BA 5I2NA 1LLSA 2IEEA 3SDFA 2GHAA 1FQBA 1OVBA 3FXRA 3FZVA 3FV2A 4Q5TA 1EU8A 2ZYNA 1ANFA 4DLDA 4R74A 3FJ7A 4OEUA 3U92A 2GH9A 2F78A 3I3VA 1GR2A 5AA1A 2P1SA 3SEVA 1JW1A 1YAEA 1M5CA 4FE8A 2YLNA 2HFBA 3GBBA 1IQ7A 4QHQA 4DXUA 4DDDA 4ZZAA 4DZ1A 1MH3A 1MQDA 5TP9B 4Q8RA 2FYIA 4TQUQ 4N07A 2ZNTA 3MWBA 1YTVA 3KSJA 2HXWA 4H65A 4PFWA 3IB1A 2RF1A 3O2AA 4NF5A 5HPQA 5AA2D 3R7XA 3TDJA 3CSBA 2AL4A 3MP1A 2I6EA 1POTA 3PPRA 1MY0A 2OK2A 5DVIA 4QFLA 2BJJX 1MXWA 2GRVA 1MPDA 4LQ5A 3GBAA 3A3UA 2A5TB 2Q89A 4F18A 3O97A 4G68A 4GRKA 4YB6A 3BFUA 2A5SA 1B32A 1SW4A 1URGA 4G8NA 3SETA 2QMXA 3KSXA 2OWSA 1N84A 4HCYA 3OO9A 4M1VA 4H5GA 2Q88A 4PFTA 3OSQA 4AQ4A 4I9DA 3G3IA 2X26A 1H43A 3MVZA 4KYDA 1VSOA 1B3GA 1MXVA 1B4HA 1NKXA 3SEWA 4MF3A 2I49A 4U1ZA 2QS1A 5A5XB 1PBQA 2NXOA 4U4XA 4WXJA 1DTZA 3MUQA 4ESWA 1FW0A 4THIA 2ESNA 1DPEA 5I2KB 3EF7A 3PV0E 4RXLA 4HS7A 1IXCA 4YU0A 3MVWA 1MQHA 1NMUA 4H5FA 4EQ9A 2QPQA 4ZEIA 5CI5A 5I56B 1SD3A 3FV1A 1RYOA 3TELA 1VE4A 1GGGA 3K6XA 2LAOA 1TFDA 4JDFA 2QS3A 4G2ZA 1P1NA 1PDAA 4F31B 3O6PA 4F29A 2KLFA 5AA4B 2UVIA 5KDTB 3S4UA 5DTBA 3U93A 3VVFA 3Q27A 1MQIA 3H03A 3IJXB 1DMBA 3LR1A 3PUXE 1NH8A 3G3FA 4KQPA 1IZ1A 5ISUA 3U72A 4KYEA 3SESA 5CMBA 5CMCA 3IB2A 3PU5A 5K2XA 1L5TA 3RYBA 3QXMA 1P1WA 1SVXB 5JEIA 4IO2A 4O3BA 1URSA 5FTIA 4R6HA 5KZTA 2HAUA 1LAGE 3ILTB 1LGBC 1TT1A 3OEMA 3H06B 4I1DA 1B9JA 4PFYA 4BDMA 3HSTA 1I69A 3TTKA 2Q8JA 2OLBA 3B6WA 3SKPA 4XTCQ 2ZMBA 3QYTA 1B1HA 4UA8A 4KHZE 3A3CA 1H45A 2PVUA 3RGYA 2GHBA 5I58A 3E3KA 1LBCA 2RC8A 1LSTA 5FHNA 1N04A 3SERA 3T9UA 5EHSA 3KN7A 4PQJA 1OMPA 2QS4A 3ZKLA 4RA1A 1US5A 4XKQA 1LBBA 2F36A 1SI1A 1NNFA 5TPAB 1UIUA 2DE2A 1ZTYA 1A55A 2O51A 1Z7NE 2F35A 4H67A 2ABHA 2PT2A 2VGQA 2Z8FA 1JW4A 4R9GA 3HV1A 5DEXB 4ELQA 4U1OA 1UTBA 3CRBA 2Q9TA 4GWOA 2DE4A 1ZIUA 3DRFA 2P0SA 4DCYA 3S9LC 1MPBA 3H6WA 3LSWA 5J1DA 3V89B 3C32A 4JBZA 4OESA 4JWXA 1LFHA 2OZZA 5ICQA 1N76A 1P1QA 4AB5A 5LOMA 3MZBA 3TUSA 2VP1A 4X1BA 3O66A 3OEKA 5K2YA 1II5A 4NF6A 4PETA 3HHGA 5B7DA 4NF4B 2O6AA 5DYHA 3M8UA 3MC2A 1H44A 1UQWA 3QK6A 3FVKA 3VLWA 3OD7A 4MFIA 5B70A 3UGWA 4YAHX 1JEUA 1IXGA 1XC1A 3FVNA 3QUFA 4OXVA 1M5FA 1KWHA 4O3AA 3K02A 1PB7A 3PD9A 3OMBA 3IJOB 2R6GE 3B6QA 4GIZA 3PGFA 1FQEA 1NNTA 1M5BA 4C0RA 4BDOA 1Q1KA 3TTNA 3G3HA 4P11A 3KBRA 1MY1A 2G29A 5H8NB 4XKPA 4EF2A 4GXSB 4U2RA 2XXTA 4XIGQ 1B2HA 3IORA 3T66A 3RTFB 1BP5A 1DTGA 3OO8A 3RN8A 1YPNA 4DXCA 3FXQA 1FTKA 4XKNA 4R9FA 4ZEFA 2XX7A 3PPQA 3F11A 3IO4A 4OENA 4YMBA 1XHYA 4IY6A 3O6HA 4IY5A 4KCCA 1OQHA 2QMWA 2H99A 2FA7A 2I3VA 3CHGA 3Q25A 4LUBA 5ELVA 1A7LA 2H4IA 2O7UA 2FNCA 1B51A 3OO6A 4MH5A 3HN0A 1JEVA 5JTYB 3G7WA 3V8XB 2HEUA 2UVHA 3T9VA 2PX1A 4F1UA 2B4MA 5KCJB 3QSLA 1UTHA 3RY3A 3K2DA 1FQDA 4YZZA 2I0CA 1O63A 2WOKA 3OELA 4KR5A 4OVJA 4F3PA 3PUYE 1URDA 4JXIA 3CG3A 1FTJA 4ZEBA 5TU0A 3Q28A 1US4A 3T96B 1FQFA 4G4PA 3W9VA 3VLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOP A;  1Y1M A;  5H8F A;  2DWH A;  3K01 A;  3SEY A;  4BLA A;  1B05 A;  2M8C A;  1BKA A;  4OHN A;  4OFL A;  3IAZ A;  2Y7K A;  5EHM A;  1MG1 A;  2REG A;  3N5L A;  2NWJ A;  1JQF A;  2OWT A;  4QFK A;  2F8D A;  5L8D A;  2ALU A;  1DSN A;  4ZS9 A;  3FGS A;  3ZSF A;  1Y3Q A;  1N7X A;  3TOD A;  5L9O A;  1ZMG A;  1B1X A;  2UXA A;  5H8Q B;  4R75 A;  2UYF A;  4G8M A;  4IO7 A;  1YCJ A;  2XD3 A;  3C31 A;  3S9M C;  1LCT A;  4F39 A;  2NUV A;  1MXY A;  2VD3 A;  4RK2 A;  3DP8 A;  1EZP A;  2XXX A;  1JW5 A;  2DVZ A;  1NFT A;  3IOV A;  1ELJ A;  2RC7 A;  2DYX A;  2ONK E;  1OLA A;  4EXL A;  1NH7 A;  3MPK A;  3K1N A;  1SW2 A;  1RKM A;  4F1Y A;  4QFN A;  3N26 A;  1XOC A;  5TP9 A;  4DE8 A;  1J1N A;  3VVE A;  3EN3 A;  1QJM A;  4ZZE A;  1LB9 A;  4GL8 A;  2AYS A;  3UA8 A;  1B7U A;  1B5J A;  3QUJ A;  1MXX A;  3DP4 A;  5DVF A;  4R6Y A;  3UP9 A;  4MBP A;  2Y84 A;  4LA9 A;  1QUL A;  1CB6 A;  3IOW A;  4O3C A;  3CFL A;  5BWJ A;  3TCF A;  3VE1 B;  5BUU A;  3DRJ A;  2QSX A;  4FJP A;  1NL5 A;  5H8S A;  1R1N A;  4KI0 E;  5ITO A;  4MLQ A;  3UOR A;  1POY 1;  2A5T A;  1OQG A;  2O69 A;  5HBC A;  3IOU A;  3MJN A;  3TFL A;  5L9M A;  3IO6 A;  4PP0 A;  2WOL A;  3PMW A;  5FHO A;  3GXA A;  4QFP A;  3O28 A;  4H6D A;  1MXU A;  4YMA A;  2XHD A;  5JK4 A;  5FHM A;  1OVT A;  4OEV A;  4QFO A;  1ZBM A;  1QUK A;  4IO4 A;  4F3B A;  2VD2 A;  3HHF A;  1QW0 A;  5CC2 A;  4AB6 A;  4HTG A;  4YIC A;  1A8F A;  5H8H B;  1JNF A;  1B5H A;  4Z0I A;  2F7C A;  2NVU B;  1S7Y A;  5A5X A;  3FIR A;  2RC9 A;  2Z22 A;  3TQL A;  2Q2A A;  3U8Q A;  2DS9 A;  1JVX A;  4ZEC A;  4IO6 A;  3T22 A;  4G68 C;  5I2K A;  4DCX A;  5AA2 B;  3H7M A;  4FIM A;  1B0H A;  3EHT A;  3VDF A;  4I62 A;  1LFI A;  1NNK A;  2Y7W A;  3MAM A;  1DPP A;  3K1M A;  2F7B A;  4OWD A;  5I56 A;  1M5D A;  4ONY A;  4F1V A;  3FVO A;  3KG2 A;  2O68 A;  1MRP A;  2DVC A;  1S50 A;  1LFG A;  3FXU A;  4JWY A;  1B5I A;  4EQ7 A;  2DXR A;  5AA4 A;  3TQW A;  4XKR A;  2XD2 A;  5KDT A;  1QUI A;  3C9H A;  3IK6 B;  4RK9 A;  5I59 B;  2XXV A;  3ONM A;  4GFR A;  3T9X B;  2I0B A;  3N6U A;  4IB2 A;  4YB7 A;  4ZED A;  3JV9 A;  1R6Z A;  4C1T A;  2F34 A;  3K6W A;  1QKA A;  4YKI A;  3K6V A;  3GLB A;  3HO7 A;  5CBS A;  3W9W A;  1IIW A;  1GTK A;  4KD5 A;  1MM6 A;  4WKM A;  1B3H A;  1B6H A;  4R73 A;  3IL1 B;  4OFO A;  4GXA A;  1H76 A;  1IEJ A;  3IR1 A;  2YPN A;  3VV5 A;  4OZ9 A;  3LC8 A;  1SW5 A;  2F97 A;  3PUV E;  5M2V A;  2W7Y A;  4U22 A;  3MP8 A;  2O7I A;  5ICT A;  4K3F A;  2O1L A;  3KZG A;  4OMB A;  4F2Q A;  4X1D A;  4GD5 A;  3U94 A;  1MXZ A;  3Q26 A;  1DOT A;  3G3K A;  3DEL B;  3B7D A;  1IIT A;  5AA3 A;  4M4G A;  4ELO A;  3K4U A;  3ILU B;  2QJE A;  3R26 A;  4R2B A;  2XXW A;  1NNP A;  1HSL A;  5DT6 A;  1I6A A;  4YKK A;  1TFA A;  4OYV A;  3I6V A;  3DP6 A;  2RKM A;  3TAJ A;  3D4G A;  1B7Z A;  5TPA A;  3TZA A;  4WED A;  5I57 B;  3P7I A;  4H0W A;  2XX8 A;  3K1P A;  3WAE A;  2DWI A;  2QS2 A;  4LQ2 A;  3G3G A;  3KGC A;  5DEX A;  3B6T A;  5DVJ A;  2XXR A;  3DLN A;  4ZE9 A;  2ZYM A;  4Z7E A;  4U23 A;  4NWD A;  4NF8 B;  3N6T A;  1B0L A;  4OTE A;  1XVX A;  1UIV A;  3ZS6 A;  1FCK A;  1R9L A;  2B65 A;  4RNS A;  4FEB A;  2HZL A;  4NWC A;  3L6H A;  4EQB A;  3VXB A;  3OEN A;  3KN3 A;  1MQG A;  3THI A;  2X7Q A;  1JET A;  4BDN A;  3TKD A;  4NF4 A;  3M3F A;  3PPP A;  3RT8 A;  1LAH E;  2ZNS A;  4JB7 A;  1P1U A;  3TPA A;  3G3J A;  3FAS A;  1FQC A;  2GFE A;  4N6P A;  1Y4T A;  2XXP A;  3FJM A;  4OET A;  3U1O A;  4BDR A;  4NED A;  2RCA A;  4QF9 A;  4POX A;  1B40 A;  4F22 A;  3V83 A;  1B3L A;  4LZ7 A;  3CIJ A;  1MY4 A;  2Y7R A;  2Z8D A;  2DQV A;  1EZ9 A;  2Z23 A;  3FTO A;  2B3F A;  2V25 A;  2REJ A;  3LSL A;  5H8N A;  2HQ0 A;  3ODB A;  5I2N B;  1MS7 A;  4Q0C A;  1AMF A;  3PMX A;  2F7A A;  1ATG A;  3C4M A;  1D9Y A;  1RYX A;  1PB9 A;  4EF1 A;  4ELP A;  2X7P A;  3LUY A;  4ZDM A;  3D4C A;  1FTM A;  3TCH A;  4NTL A;  1TXF A;  1B52 A;  1MY2 A;  4RY1 A;  4E0X A;  2IA4 A;  2UYE A;  5HM4 B;  5CBR A;  1B4Z A;  3I5O A;  1XS5 A;  1O7T A;  3QAX A;  4ZE8 A;  3M3L A;  3USD A;  1N7W A;  3KEI A;  1Y9U A;  2H98 A;  1MDQ A;  4H1X A;  1R9Q A;  3W15 C;  4RYA A;  3O9P A;  5EYF A;  2D21 A;  2R71 A;  4DXB A;  3CVG A;  5JTY A;  5L9S A;  1Y20 A;  2H25 A;  1FTL A;  1ZKB A;  2I3W A;  3KJ7 A;  3RTW B;  3O29 A;  4LZ8 A;  5KCJ A;  4NF5 B;  2Z8E A;  3CFX A;  2HCA A;  4U21 A;  1WVJ A;  4FEC A;  4OER A;  1FTO A;  2D3I A;  3UIF A;  4GOT A;  3JZJ A;  1USY H;  1PBP A;  4U4S A;  2H5Y A;  3TTR A;  2V3Q A;  2ZYO A;  1N3X A;  2DP8 A;  1H3D A;  4R2F A;  1AOV A;  4N13 A;  1EH3 A;  3KOT A;  4TLL B;  3O6G A;  4C1U A;  3KOS A;  2I4B A;  1AL3 A;  1LCF A;  4G68 B;  1SYH A;  3ZKK A;  4P0I A;  4MLV A;  1MPC A;  2E1S A;  3K00 A;  4H8J A;  3E4R A;  3JYR A;  3IOT A;  3GZG A;  2THI A;  3FAT A;  3MBP A;  1PB8 A;  5IAI A;  2Q2C A;  4X48 A;  3UN6 A;  3CI8 A;  5H8Q A;  3TTL A;  2F6G A;  1JVY A;  2Y7P A;  1PC3 A;  1Q35 A;  4KFQ A;  3FJG A;  3O6I A;  4RPN A;  3MPL A;  3PMV A;  4PFU A;  4POW A;  3TEP A;  3R6U A;  1T0K A;  4XXU A;  1QUJ A;  1Y3P A;  3KFM A;  5FTH A;  1MQJ A;  4ELR A;  3CG1 A;  2OCU A;  3C35 A;  3HPI A;  2ONR A;  3TCG A;  1SQY A;  3TMG A;  2V3T A;  4I8C A;  3K6U A;  4H8I A;  3T9H B;  3FUZ A;  2UVG A;  4LON B;  2V3U A;  2H9B A;  1VFE A;  3RNN A;  4HCW A;  1ZJL A;  3E13 X;  1BTJ A;  1M5E A;  5CRY A;  3MVY A;  1OLC A;  3OO7 A;  1XVY A;  3RUM A;  3MZ9 A;  1GV8 A;  2DE3 A;  2O1M A;  2ZYK A;  3KN8 A;  1D9V A;  4EDP A;  3E9X A;  4YB5 A;  2E0S A;  4LP2 B;  1ZU0 A;  3MVX A;  3M3K A;  1A8E A;  3VFJ A;  3DRH A;  4UAC A;  5AE4 A;  2I58 A;  1B3E A;  1MDP 1;  1OIB A;  5F1Q A;  1A54 A;  1VR5 A;  3WAF A;  1HSJ A;  4IGT A;  2NOO A;  3MQ9 A;  3TTM A;  3TYH A;  1P1O A;  5F7V A;  1B46 A;  2DWJ A;  1MM7 A;  4QSE A;  4E0W A;  4OQO A;  2I4C A;  4NE4 A;  5H8H A;  2WKY A;  3SEU A;  1HSE A;  3PAM A;  1BLF A;  3SEX A;  3H6U A;  1SYI A;  1LB8 A;  4ESX A;  1EZO A;  4F3G A;  2VHA A;  4GLI A;  1LAX A;  4ND9 A;  2I48 A;  3LVU A;  3S9N C;  3BKI B;  2O84 X;  4G8H A;  3PD8 A;  5AA2 A;  5I58 B;  2F6P A;  3FD3 A;  1USY E;  4LZ5 A;  3LSF B;  2ONS A;  4R6K A;  1GVC A;  2XXI A;  3EQ1 A;  3PPN A;  4JSO A;  4FOR A;  2V93 A;  2Y7I A;  3A09 A;  5CM6 A;  2CMO A;  1AH5 A;  1SW1 A;  1VFD A;  4LVQ A;  4ECF A;  3DRK A;  1QVS A;  3MP6 A;  4KCD A;  3S2V A;  1WOD A;  3OXN A;  3H3G A;  5CMK A;  4GL0 A;  1UTB B;  2DXY A;  3Q29 A;  4OFJ A;  1N3W A;  2F5X A;  5I59 A;  4GVO A;  5ITP A;  3DM0 A;  3OOA A;  4R72 A;  4JWO A;  3T93 B;  4IO5 A;  2VOZ A;  1MY3 A;  2ZXT A;  4F19 A;  4Q30 B;  1IXI A;  2D5W A;  1O64 A;  4P0G A;  1PEB A;  4NF6 B;  1BIY A;  1ZLQ A;  3K0V A;  2AL5 A;  4EUO A;  3ECR A;  3OSR A;  4G77 A;  3S9E A;  2PMS A;  2PT1 A;  1Z7M E;  1FQA A;  2RCB A;  3CR9 A;  4F3S A;  1I6Q A;  1Y3N A;  3AXF A;  4LAT A;  1SBP A;  4YKP A;  3V5A A;  3RYA A;  3RLF E;  1D3K A;  4ZEK A;  2ZNU A;  2P2A A;  3RQT A;  3C34 A;  4EXK A;  2QL3 A;  4F2O A;  1AIV A;  1SI0 A;  1IXH A;  2HAV A;  3UK4 A;  2DSF A;  4QSD A;  1Y4C A;  3BFT A;  4BDQ A;  4IO3 A;  4QSC A;  3N94 A;  4GQO A;  3HCQ A;  3EHS A;  2UVJ A;  3H6T A;  2DWA A;  1CE2 A;  1SDX A;  1B3F A;  2B3B A;  3RT6 B;  2OBG A;  3IB0 A;  3KJT A;  4FAJ A;  3VVD A;  5I57 A;  2YJP A;  4X9T A;  3FVG A;  4IGR A;  4YKJ A;  4TOZ A;  2V84 A;  2G93 A;  2XXH A;  3H4Z A;  3LBS A;  2XXQ A;  1LAF E;  1IUD A;  2PBW A;  3MZ1 A;  3MW0 A;  4NF8 A;  2XXU A;  4RJZ A;  2HZK A;  1Y1Z A;  1WDN A;  3VXC A;  1N0T A;  2AIX A;  4RPO A;  3EPE A;  4GF8 A;  2B4L A;  1I6B A;  4JSD A;  1QKB A;  1UTH B;  3C36 A;  4QRZ A;  3PPO A;  3CFZ A;  1XT8 A;  4FAT A;  2QRY A;  3EHU A;  3DRI A;  2R9J A;  4KPT A;  4HW8 A;  4ISU A;  5I84 A;  2RIN A;  2DOJ A;  1A99 A;  4TLM B;  1A40 A;  3BBR A;  2OJT A;  5CMM A;  2XXY A;  1S9T A;  4BDL A;  2CZL A;  3RPW A;  3PUW E;  3QIM A;  3C33 A;  3PUZ E;  1D4N A;  4KYS A;  3H6V A;  5H8F B;  4DIG A;  4L17 A;  4NMY A;  3VLU A;  4WEP A;  3CSG A;  3IX1 A;  2XX9 A;  3L6G A;  2PYY A;  1TWY A;  4PE5 B;  4FED A;  3LSX A;  1P99 A;  3DRG A;  1MH4 A;  1B7H A;  2ANJ A;  5IKB A;  1B58 A;  1F9B A;  5I2N A;  1LLS A;  2IEE A;  3SDF A;  2GHA A;  1FQB A;  1OVB A;  3FXR A;  3FZV A;  3FV2 A;  4Q5T A;  1EU8 A;  2ZYN A;  1ANF A;  4DLD A;  4R74 A;  3FJ7 A;  4OEU A;  3U92 A;  2GH9 A;  2F78 A;  3I3V A;  1GR2 A;  5AA1 A;  2P1S A;  3SEV A;  1JW1 A;  1YAE A;  1M5C A;  4FE8 A;  2YLN A;  2HFB A;  3GBB A;  1IQ7 A;  4QHQ A;  4DXU A;  4DDD A;  4ZZA A;  4DZ1 A;  1MH3 A;  1MQD A;  5TP9 B;  4Q8R A;  2FYI A;  4TQU Q;  4N07 A;  2ZNT A;  3MWB A;  1YTV A;  3KSJ A;  2HXW A;  4H65 A;  4PFW A;  3IB1 A;  2RF1 A;  3O2A A;  4NF5 A;  5HPQ A;  5AA2 D;  3R7X A;  3TDJ A;  3CSB A;  2AL4 A;  3MP1 A;  2I6E A;  1POT A;  3PPR A;  1MY0 A;  2OK2 A;  5DVI A;  4QFL A;  2BJJ X;  1MXW A;  2GRV A;  1MPD A;  4LQ5 A;  3GBA A;  3A3U A;  2A5T B;  2Q89 A;  4F18 A;  3O97 A;  4G68 A;  4GRK A;  4YB6 A;  3BFU A;  2A5S A;  1B32 A;  1SW4 A;  1URG A;  4G8N A;  3SET A;  2QMX A;  3KSX A;  2OWS A;  1N84 A;  4HCY A;  3OO9 A;  4M1V A;  4H5G A;  2Q88 A;  4PFT A;  3OSQ A;  4AQ4 A;  4I9D A;  3G3I A;  2X26 A;  1H43 A;  3MVZ A;  4KYD A;  1VSO A;  1B3G A;  1MXV A;  1B4H A;  1NKX A;  3SEW A;  4MF3 A;  2I49 A;  4U1Z A;  2QS1 A;  5A5X B;  1PBQ A;  2NXO A;  4U4X A;  4WXJ A;  1DTZ A;  3MUQ A;  4ESW A;  1FW0 A;  4THI A;  2ESN A;  1DPE A;  5I2K B;  3EF7 A;  3PV0 E;  4RXL A;  4HS7 A;  1IXC A;  4YU0 A;  3MVW A;  1MQH A;  1NMU A;  4H5F A;  4EQ9 A;  2QPQ A;  4ZEI A;  5CI5 A;  5I56 B;  1SD3 A;  3FV1 A;  1RYO A;  3TEL A;  1VE4 A;  1GGG A;  3K6X A;  2LAO A;  1TFD A;  4JDF A;  2QS3 A;  4G2Z A;  1P1N A;  1PDA A;  4F31 B;  3O6P A;  4F29 A;  2KLF A;  5AA4 B;  2UVI A;  5KDT B;  3S4U A;  5DTB A;  3U93 A;  3VVF A;  3Q27 A;  1MQI A;  3H03 A;  3IJX B;  1DMB A;  3LR1 A;  3PUX E;  1NH8 A;  3G3F A;  4KQP A;  1IZ1 A;  5ISU A;  3U72 A;  4KYE A;  3SES A;  5CMB A;  5CMC A;  3IB2 A;  3PU5 A;  5K2X A;  1L5T A;  3RYB A;  3QXM A;  1P1W A;  1SVX B;  5JEI A;  4IO2 A;  4O3B A;  1URS A;  5FTI A;  4R6H A;  5KZT A;  2HAU A;  1LAG E;  3ILT B;  1LGB C;  1TT1 A;  3OEM A;  3H06 B;  4I1D A;  1B9J A;  4PFY A;  4BDM A;  3HST A;  1I69 A;  3TTK A;  2Q8J A;  2OLB A;  3B6W A;  3SKP A;  4XTC Q;  2ZMB A;  3QYT A;  1B1H A;  4UA8 A;  4KHZ E;  3A3C A;  1H45 A;  2PVU A;  3RGY A;  2GHB A;  5I58 A;  3E3K A;  1LBC A;  2RC8 A;  1LST A;  5FHN A;  1N04 A;  3SER A;  3T9U A;  5EHS A;  3KN7 A;  4PQJ A;  1OMP A;  2QS4 A;  3ZKL A;  4RA1 A;  1US5 A;  4XKQ A;  1LBB A;  2F36 A;  1SI1 A;  1NNF A;  5TPA B;  1UIU A;  2DE2 A;  1ZTY A;  1A55 A;  2O51 A;  1Z7N E;  2F35 A;  4H67 A;  2ABH A;  2PT2 A;  2VGQ A;  2Z8F A;  1JW4 A;  4R9G A;  3HV1 A;  5DEX B;  4ELQ A;  4U1O A;  1UTB A;  3CRB A;  2Q9T A;  4GWO A;  2DE4 A;  1ZIU A;  3DRF A;  2P0S A;  4DCY A;  3S9L C;  1MPB A;  3H6W A;  3LSW A;  5J1D A;  3V89 B;  3C32 A;  4JBZ A;  4OES A;  4JWX A;  1LFH A;  2OZZ A;  5ICQ A;  1N76 A;  1P1Q A;  4AB5 A;  5LOM A;  3MZB A;  3TUS A;  2VP1 A;  4X1B A;  3O66 A;  3OEK A;  5K2Y A;  1II5 A;  4NF6 A;  4PET A;  3HHG A;  5B7D A;  4NF4 B;  2O6A A;  5DYH A;  3M8U A;  3MC2 A;  1H44 A;  1UQW A;  3QK6 A;  3FVK A;  3VLW A;  3OD7 A;  4MFI A;  5B70 A;  3UGW A;  4YAH X;  1JEU A;  1IXG A;  1XC1 A;  3FVN A;  3QUF A;  4OXV A;  1M5F A;  1KWH A;  4O3A A;  3K02 A;  1PB7 A;  3PD9 A;  3OMB A;  3IJO B;  2R6G E;  3B6Q A;  4GIZ A;  3PGF A;  1FQE A;  1NNT A;  1M5B A;  4C0R A;  4BDO A;  1Q1K A;  3TTN A;  3G3H A;  4P11 A;  3KBR A;  1MY1 A;  2G29 A;  5H8N B;  4XKP A;  4EF2 A;  4GXS B;  4U2R A;  2XXT A;  4XIG Q;  1B2H A;  3IOR A;  3T66 A;  3RTF B;  1BP5 A;  1DTG A;  3OO8 A;  3RN8 A;  1YPN A;  4DXC A;  3FXQ A;  1FTK A;  4XKN A;  4R9F A;  4ZEF A;  2XX7 A;  3PPQ A;  3F11 A;  3IO4 A;  4OEN A;  4YMB A;  1XHY A;  4IY6 A;  3O6H A;  4IY5 A;  4KCC A;  1OQH A;  2QMW A;  2H99 A;  2FA7 A;  2I3V A;  3CHG A;  3Q25 A;  4LUB A;  5ELV A;  1A7L A;  2H4I A;  2O7U A;  2FNC A;  1B51 A;  3OO6 A;  4MH5 A;  3HN0 A;  1JEV A;  5JTY B;  3G7W A;  3V8X B;  2HEU A;  2UVH A;  3T9V A;  2PX1 A;  4F1U A;  2B4M A;  5KCJ B;  3QSL A;  1UTH A;  3RY3 A;  3K2D A;  1FQD A;  4YZZ A;  2I0C A;  1O63 A;  2WOK A;  3OEL A;  4KR5 A;  4OVJ A;  4F3P A;  3PUY E;  1URD A;  4JXI A;  3CG3 A;  1FTJ A;  4ZEB A;  5TU0 A;  3Q28 A;  1US4 A;  3T96 B;  1FQF A;  4G4P A;  3W9V A;  3VLV A; 
#chains in the Genus database with same CATH topology
 2WOP A;  1Y1M A;  5H8F A;  2DWH A;  2FBP A;  3K01 A;  5IZ3 B;  2HXR A;  3SEY A;  4BLA A;  1B05 A;  2M8C A;  1BKA A;  4OHN A;  4OFL A;  3IAZ A;  2Y7K A;  5EHM A;  1MG1 A;  2REG A;  3N5L A;  2NWJ A;  1IMF A;  1JQF A;  2OWT A;  1KZ8 A;  4QFK A;  2F8D A;  5L8D A;  2ALU A;  1DSN A;  4ZS9 A;  3FGS A;  3ZSF A;  1Y3Q A;  1N7X A;  3TOD A;  4PTK A;  5L9O A;  1ZMG A;  1B1X A;  2UXA A;  5H8Q B;  5A5L A;  4R75 A;  2UYF A;  4G8M A;  4IO7 A;  1YCJ A;  2XD3 A;  3C31 A;  4GBW A;  4PBH A;  3S9M C;  1LCT A;  5EQ9 A;  4GX6 A;  4MCO A;  4P1L A;  4F39 A;  2NUV A;  1MXY A;  2VD3 A;  2L5V A;  4RK2 A;  3DP8 A;  1EZP A;  2XXX A;  1JW5 A;  2DVZ A;  1NFT A;  3IOV A;  1ELJ A;  2RC7 A;  2DYX A;  2ONK E;  1OLA A;  4EXL A;  1NH7 A;  3MPK A;  3K1N A;  1SW2 A;  1LEV A;  1RKM A;  4F1Y A;  4QFN A;  3N26 A;  1XOC A;  4NG7 A;  5TP9 A;  4DE8 A;  1J1N A;  3VVE A;  3EN3 A;  1QJM A;  4ZZE A;  1LB9 A;  4GL8 A;  2AYS A;  3UA8 A;  1B7U A;  1B5J A;  3QUJ A;  1MXX A;  3DP4 A;  5DVF A;  4R6Y A;  3UP9 A;  4MBP A;  2Y84 A;  3T0J A;  4LA9 A;  1QUL A;  1CB6 A;  3IOW A;  4O3C A;  4PE3 A;  3CFL A;  5BWJ A;  3TCF A;  1K9Y A;  3VE1 B;  5BUU A;  3DRJ A;  2QSX A;  4FJP A;  1NL5 A;  5H8S A;  1R1N A;  5IGA A;  4KI0 E;  5ITO A;  4MLQ A;  3UOR A;  1POY 1;  2A5T A;  1OQG A;  2F3B A;  2O69 A;  5HBC A;  3IOU A;  3MJN A;  2QVV A;  3TFL A;  5L9M A;  3IO6 A;  4PP0 A;  2WOL A;  4XEQ A;  3PMW A;  3KC1 A;  5FHO A;  3GXA A;  4QFP A;  4OAN A;  3SZP A;  3O28 A;  4H6D A;  1MXU A;  4YMA A;  2XHD A;  5JK4 A;  5FHM A;  1OVT A;  2XWI A;  4OEV A;  4QFO A;  1ZBM A;  1QUK A;  4IO4 A;  4F3B A;  2VD2 A;  3HHF A;  1QW0 A;  5CC2 A;  1G0I A;  4AB6 A;  4HTG A;  4YIC A;  4MHF A;  1A8F A;  5H8H B;  1JNF A;  1B5H A;  4Z0I A;  2F7C A;  2NVU B;  1S7Y A;  4G61 A;  5A5X A;  3FIR A;  2RC9 A;  2Z22 A;  3TQL A;  2Q2A A;  3U8Q A;  2DS9 A;  5FBP A;  1JVX A;  4ZEC A;  4IO6 A;  3T22 A;  1FJ9 A;  4G68 C;  5I2K A;  4DCX A;  5AA2 B;  2FHY A;  3H7M A;  4FIM A;  1B0H A;  3EHT A;  1EYK A;  3VDF A;  4P1E A;  4I62 A;  1LFI A;  1NNK A;  2Y7W A;  3MAM A;  1DPP A;  3K1M A;  2F7B A;  4OWD A;  4DI3 D;  4PFI A;  5I56 A;  2ZZX A;  1M5D A;  4GBV A;  4ONY A;  3IFA A;  4F1V A;  3FVO A;  3KG2 A;  2O68 A;  1FJ6 A;  1INP A;  1MRP A;  2DVC A;  4O7M A;  1S50 A;  1LFG A;  3FXU A;  4JWY A;  1FBD A;  1B5I A;  4EQ7 A;  2DXR A;  5EQ7 A;  5AA4 A;  3TQW A;  4XKR A;  2XD2 A;  5KDT A;  1QUI A;  3C9H A;  3IK6 B;  2P3N A;  4RK9 A;  5I59 B;  2XXV A;  3ONM A;  4GFR A;  1XI6 A;  4P47 A;  3T9X B;  2I0B A;  3N6U A;  4IB2 A;  4PDH A;  4YB7 A;  4ZED A;  3JV9 A;  1R6Z A;  4C1T A;  2F34 A;  3D1R A;  1YXI A;  3K6W A;  1QKA A;  4YKI A;  1FBP A;  3K6V A;  4O94 A;  2Q8M A;  1YZ0 A;  2QVR A;  3GLB A;  3HO7 A;  5CBS A;  3W9W A;  1IIW A;  1GTK A;  4KD5 A;  1MM6 A;  4WKM A;  1B3H A;  1B6H A;  4R73 A;  2XWV A;  3IL1 B;  4OFO A;  4GXA A;  1H76 A;  1IEJ A;  3IR1 A;  2YPN A;  3VV5 A;  4OZ9 A;  3LC8 A;  1SW5 A;  2F97 A;  3PUV E;  5M2V A;  2W7Y A;  4U22 A;  3MP8 A;  2O7I A;  5ICT A;  4K3F A;  2O1L A;  3KZG A;  4OMB A;  4F2Q A;  4X1D A;  4LN5 A;  4GD5 A;  3U94 A;  1MXZ A;  3Q26 A;  4MIJ A;  1DOT A;  2ZZV A;  5I3S A;  3G3K A;  3DEL B;  3B7D A;  1IIT A;  5AA3 A;  4M4G A;  4N6D A;  4ELO A;  3K4U A;  3ILU B;  2QJE A;  3R26 A;  4R2B A;  1EYJ A;  2WYK A;  2XXW A;  1NNP A;  1HSL A;  5DT6 A;  1I6A A;  2WEF A;  4YKK A;  1TFA A;  1YYZ A;  4OYV A;  3I6V A;  4PAF A;  4OVQ A;  3DP6 A;  2RKM A;  4GWX A;  3TAJ A;  3D4G A;  1B7Z A;  5TPA A;  3TZA A;  4WED A;  5I57 B;  3P7I A;  4H0W A;  2XX8 A;  3K1P A;  3WAE A;  2DWI A;  1RDY A;  2QS2 A;  4LQ2 A;  3MYU A;  5LTC A;  3G3G A;  3KGC A;  5DEX A;  3B6T A;  5DVJ A;  2XXR A;  3DLN A;  4ZE9 A;  2ZYM A;  4Z7E A;  4U23 A;  4NWD A;  4NF8 B;  3N6T A;  1B0L A;  4OTE A;  1XVX A;  1UIV A;  3ZS6 A;  1FCK A;  1R9L A;  2B65 A;  4RNS A;  4FEB A;  2HZL A;  4NWC A;  3L6H A;  4EQB A;  1NV3 A;  3VXB A;  3OEN A;  4P3L A;  3KN3 A;  1MQG A;  3THI A;  2X7Q A;  1JET A;  4BDN A;  3TKD A;  4NF4 A;  4MX6 A;  3M3F A;  3PPP A;  3RT8 A;  1LAH E;  2ZNS A;  4JB7 A;  3EKI A;  1FPG A;  1P1U A;  3TPA A;  1FBE A;  3G3J A;  1NV5 A;  3FAS A;  3HFU A;  1FQC A;  2GFE A;  4N6P A;  1Y4T A;  2XXP A;  3FJM A;  4OET A;  3U1O A;  4BDR A;  3GYY A;  4NED A;  2RCA A;  4PF8 A;  4OVS A;  4QF9 A;  1K9Z A;  4POX A;  1B40 A;  4F22 A;  3V83 A;  1B3L A;  4LZ7 A;  3CIJ A;  1MY4 A;  2Y7R A;  2Z8D A;  2DQV A;  1EZ9 A;  2Z23 A;  3FTO A;  2B3F A;  2V25 A;  2REJ A;  3LSL A;  5H8N A;  2HQ0 A;  3ODB A;  5I2N B;  1FBF A;  1MS7 A;  1LBW A;  4Q0C A;  1AMF A;  3PMX A;  2F7A A;  1ATG A;  3C4M A;  1D9Y A;  1RYX A;  1PB9 A;  4EF1 A;  4ELP A;  3KBZ A;  2X7P A;  3LUY A;  3U65 A;  4ZDM A;  3D4C A;  1FTM A;  1NV2 A;  3TCH A;  4NTL A;  1TXF A;  3BIG A;  4NX1 A;  1B52 A;  4MNI A;  1MY2 A;  2KQZ A;  4RY1 A;  4E0X A;  2IA4 A;  2UYE A;  5HM4 B;  5CBR A;  1B4Z A;  3I5O A;  1XS5 A;  1O7T A;  3QAX A;  4ZE8 A;  3M3L A;  4HE0 A;  3USD A;  1N7W A;  4MNP A;  3KEI A;  1Y9U A;  2H98 A;  1MDQ A;  4H1X A;  1R9Q A;  3W15 C;  4RYA A;  3O9P A;  5EYF A;  2D21 A;  2R71 A;  4DXB A;  3CVG A;  5JTY A;  5L9S A;  1Y20 A;  2H25 A;  1FTL A;  1ZKB A;  2I3W A;  3QMF A;  3KJ7 A;  3RTW B;  4AS4 A;  3O29 A;  4LZ8 A;  5KCJ A;  1IMA A;  1FPE A;  4NF5 B;  1IMC A;  1DBZ A;  2Z8E A;  3CFX A;  2HCA A;  4U21 A;  1WVJ A;  4H46 A;  4FEC A;  4XFE A;  4OER A;  1FTO A;  2D3I A;  3UIF A;  3RPL B;  4GOT A;  3JZJ A;  1USY H;  1PBP A;  4U4S A;  1D9Q A;  4NQ8 A;  2H5Y A;  3TTR A;  2V3Q A;  2ZYO A;  1N3X A;  2DP8 A;  1EYI A;  1H3D A;  4R2F A;  1AOV A;  4N13 A;  1EH3 A;  5I7I A;  3KOT A;  2CEX A;  1FBG A;  2R8T A;  4TLL B;  3O6G A;  4C1U A;  3KOS A;  2I4B A;  1AL3 A;  1LCF A;  4G68 B;  1IMD A;  1SYH A;  1NUY A;  3ZKK A;  4P0I A;  5IZ3 A;  4MLV A;  2JJK A;  1MPC A;  2E1S A;  5IM2 A;  3K00 A;  4H8J A;  3E4R A;  3JYR A;  3IOT A;  3GZG A;  2THI A;  2FIX A;  3FAT A;  3MBP A;  1PB8 A;  4N15 A;  5IAI A;  2Q2C A;  4X48 A;  2CZK A;  3UN6 A;  3CI8 A;  5H8Q A;  2WBD A;  4GWY A;  3TTL A;  2F6G A;  2VPN A;  4N91 A;  5DW8 A;  1JVY A;  2Y7P A;  1PC3 A;  1Q35 A;  3B50 A;  4KFQ A;  1FTA A;  3FJG A;  3O6I A;  4RPN A;  3MPL A;  1FBC A;  3PMV A;  4PFU A;  4POW A;  3TEP A;  2CZI A;  3R6U A;  2QVU A;  1T0K A;  4XXU A;  1QUJ A;  1Y3P A;  5ET8 A;  5T3J A;  3KFM A;  4N4U A;  4PFB A;  4N8Y A;  5FTH A;  1MQJ A;  5ET5 A;  4ELR A;  3CG1 A;  3HPI A;  2OCU A;  3C35 A;  2ONR A;  5IZZ A;  3TCG A;  1SQY A;  3TMG A;  2V3T A;  4I8C A;  3K6U A;  4H8I A;  3T9H B;  3FUZ A;  2UVG A;  4LON B;  2V3U A;  2H9B A;  1VFE A;  3RNN A;  4HCW A;  1ZJL A;  3E13 X;  1BTJ A;  1M5E A;  5EYH A;  5CRY A;  3RYD A;  3MVY A;  1OLC A;  3OO7 A;  1XVY A;  3RUM A;  3E78 A;  3MZ9 A;  1NUZ A;  1GV8 A;  2DE3 A;  2O1M A;  2ZYK A;  3KN8 A;  1D9V A;  4EDP A;  3E9X A;  1FPF A;  4UAB A;  4YB5 A;  4I3E A;  1IMB A;  1Q9D A;  2E0S A;  4LP2 B;  1ZU0 A;  3MVX A;  3M3K A;  1A8E A;  3VFJ A;  1FBH A;  3DRH A;  4UAC A;  5AE4 A;  2I58 A;  1B3E A;  1MDP 1;  1OIB A;  4NF0 A;  5F1Q A;  1A54 A;  1VR5 A;  3WAF A;  1HSJ A;  4IGT A;  3LUZ A;  2NOO A;  3MQ9 A;  3TTM A;  3TYH A;  2WYP A;  1P1O A;  5F7V A;  4N8G A;  1B46 A;  2DWJ A;  1MM7 A;  4QSE A;  4E0W A;  4OQO A;  2I4C A;  4NE4 A;  4KXP A;  5H8H A;  2WKY A;  3SEU A;  1HSE A;  3PAM A;  1BLF A;  3FXB A;  3SEX A;  3H6U A;  1SYI A;  1LB8 A;  4ESX A;  1EZO A;  4F3G A;  2VHA A;  4GLI A;  1LAX A;  4ND9 A;  2I48 A;  3LVU A;  3S9N C;  1NV6 A;  3BKI B;  2O84 X;  4G8H A;  4NHB A;  3PD8 A;  3PTY A;  4N6K A;  5AA2 A;  5I58 B;  2F6P A;  3FD3 A;  3FBP A;  1USY E;  4LZ5 A;  3LSF B;  4IR8 A;  2ONS A;  4R6K A;  1GVC A;  2XXI A;  3EQ1 A;  3PPN A;  4JSO A;  4FOR A;  2V93 A;  2Y7I A;  3MST A;  2CZH A;  3A09 A;  2CMO A;  5CM6 A;  1AH5 A;  1SW1 A;  1VFD A;  4LVQ A;  4ECF A;  2PFZ A;  3DRK A;  1QVS A;  3MP6 A;  4KCD A;  3S2V A;  1WOD A;  3OXN A;  5EQ8 A;  3H3G A;  4N17 A;  5CMK A;  4GL0 A;  1UTB B;  1RDZ A;  2DXY A;  3Q29 A;  4OFJ A;  1N3W A;  2F5X A;  5I59 A;  4GVO A;  5ITP A;  3T1B A;  4I40 A;  3DM0 A;  4O7I A;  3OOA A;  4R72 A;  4JWO A;  3T93 B;  4IO5 A;  2VOZ A;  1MY3 A;  2ZXT A;  4F19 A;  4Q30 B;  1IXI A;  2D5W A;  1KA0 A;  1O64 A;  4P0G A;  1PEB A;  4NF6 B;  1BIY A;  5LDZ A;  1ZLQ A;  3K0V A;  5IZ1 A;  2AL5 A;  4EUO A;  3ECR A;  3OSR A;  4G77 A;  3S9E A;  2PMS A;  2PT1 A;  1Z7M E;  1FQA A;  2RCB A;  3CR9 A;  4F3S A;  1I6Q A;  1Y3N A;  3AXF A;  4LAT A;  1SBP A;  4YKP A;  3V5A A;  3RYA A;  3RLF E;  1D3K A;  4ZEK A;  2ZNU A;  2P2A A;  3RQT A;  3C34 A;  4EXK A;  2QL3 A;  4NN3 A;  4F2O A;  1AIV A;  1SI0 A;  1IXH A;  2HAV A;  5ET6 A;  3UK4 A;  2DSF A;  4QSD A;  1Y4C A;  3BFT A;  4BDQ A;  2XA5 A;  4IO3 A;  4QSC A;  3N94 A;  4GQO A;  3HCQ A;  4OVT A;  4QBA A;  3EHS A;  2UVJ A;  3H6T A;  4HE2 A;  2DWA A;  1CE2 A;  1SDX A;  1B3F A;  2B3B A;  3RT6 B;  2OBG A;  3IB0 A;  3KJT A;  4FAJ A;  3VVD A;  3IFC A;  5I57 A;  4H45 A;  2YJP A;  1CNQ A;  4X9T A;  3FVG A;  2MKZ A;  4IGR A;  4YKJ A;  4TOZ A;  2V84 A;  2G93 A;  2XXH A;  3H4Z A;  3LBS A;  2XXQ A;  1LAF E;  4JVI A;  1IUD A;  2PBW A;  1RDX A;  3MZ1 A;  4GWU A;  3MW0 A;  4NF8 A;  2XXU A;  4RJZ A;  2HZK A;  1Y1Z A;  1WDN A;  3VXC A;  1N0T A;  2AIX A;  3ROJ A;  4RPO A;  3EPE A;  4GF8 A;  2B4L A;  1I6B A;  4JSD A;  1QKB A;  1UTH B;  3C36 A;  4P56 A;  4QRZ A;  3PPO A;  3CFZ A;  1XT8 A;  4FAT A;  2QRY A;  3EHU A;  3DRI A;  2R9J A;  4KPT A;  4HW8 A;  4ISU A;  5I84 A;  2RIN A;  2DOJ A;  1A99 A;  2GQ1 A;  4TLM B;  1A40 A;  3BBR A;  2OJT A;  3BIH A;  5CMM A;  2XXY A;  1S9T A;  4BDL A;  2CZL A;  3RPW A;  4MAG A;  3PUW E;  3QIM A;  3C33 A;  3PUZ E;  1D4N A;  4KYS A;  4PBQ A;  3H6V A;  5H8F B;  4DIG A;  4L17 A;  4NMY A;  3VLU A;  2V4C A;  4WEP A;  3CSG A;  2XWK A;  3IX1 A;  2XX9 A;  3L6G A;  2PYY A;  1TWY A;  4PE5 B;  4FED A;  4PDD A;  3LSX A;  1P99 A;  3DRG A;  1MH4 A;  1B7H A;  4GX4 A;  2ANJ A;  5IKB A;  4MJO A;  1B58 A;  1F9B A;  5I2N A;  1VDW A;  1LLS A;  2IEE A;  3SDF A;  2GHA A;  1SPI A;  2WBB A;  1FQB A;  1OVB A;  3FXR A;  3FZV A;  3FV2 A;  4Q5T A;  1EU8 A;  2ZYN A;  1FPB A;  1ANF A;  4P9K A;  4DLD A;  4R74 A;  3FJ7 A;  1FPJ A;  4OEU A;  3U92 A;  2GH9 A;  4O8M A;  2F78 A;  3I3V A;  1GR2 A;  5AA1 A;  2QFL A;  2P1S A;  3SEV A;  1JW1 A;  1YAE A;  1M5C A;  4FE8 A;  4GX3 A;  2YLN A;  4FBP A;  5F24 A;  2HFB A;  3A29 A;  3GBB A;  1IQ7 A;  4QHQ A;  4DXU A;  4DDD A;  4ZZA A;  4DZ1 A;  1MH3 A;  1MQD A;  5TP9 B;  4Q8R A;  2FYI A;  4TQU Q;  2Y5K A;  2Q74 A;  4N07 A;  2ZNT A;  3MWB A;  1YTV A;  2OX3 A;  3KSJ A;  2HXW A;  4H65 A;  4PFW A;  1FPK A;  2RF1 A;  3IB1 A;  3O2A A;  4NF5 A;  4XF5 A;  5HPQ A;  5AA2 D;  3R7X A;  3TDJ A;  3CSB A;  2OWZ A;  4MEV A;  2AL4 A;  3MP1 A;  4JVD A;  3RPL A;  2I6E A;  1POT A;  1NUX A;  3PPR A;  2FIE A;  1MY0 A;  2OK2 A;  5DVI A;  4QFL A;  5ESY A;  2BJJ X;  1MXW A;  1NV1 A;  2GRV A;  1MPD A;  4LQ5 A;  4OVP A;  3GBA A;  3A3U A;  2A5T B;  2Q89 A;  1FPI A;  3O97 A;  4G68 A;  4F18 A;  4GRK A;  4YB6 A;  3BFU A;  2A5S A;  1B32 A;  2XXK A;  1SW4 A;  1URG A;  4G8N A;  2PFY A;  4HXV A;  3SET A;  2QMX A;  3KSX A;  2OWS A;  1N84 A;  4HCY A;  3OO9 A;  4M1V A;  4H5G A;  2Q88 A;  4PFT A;  3OSQ A;  4AQ4 A;  4I9D A;  3G3I A;  3LV0 A;  3B8B A;  2X26 A;  1H43 A;  1DK4 A;  3MVZ A;  4KYD A;  1VSO A;  1B3G A;  1MXV A;  1B4H A;  2WX9 A;  1NKX A;  2HHM A;  3SEW A;  4MF3 A;  2I49 A;  4U1Z A;  3KC0 A;  2QS1 A;  5A5X B;  1PBQ A;  1FSA A;  4MNC A;  2NXO A;  4U4X A;  4WXJ A;  1DTZ A;  3MUQ A;  4ESW A;  1FW0 A;  4THI A;  2ESN A;  1DPE A;  1LBY A;  5I2K B;  1QGX A;  3EF7 A;  3PV0 E;  4RXL A;  4HS7 A;  2FVZ A;  2VPO A;  1IXC A;  4YU0 A;  3MVW A;  1MQH A;  1NMU A;  4H5F A;  4EQ9 A;  2QPQ A;  1JP4 A;  2BJI A;  4ZEI A;  5CI5 A;  5J16 A;  5I56 B;  1SD3 A;  4OA4 A;  3FV1 A;  1RYO A;  3TEL A;  1VE4 A;  1GGG A;  3K6X A;  2LAO A;  1TFD A;  4NGU A;  4JDF A;  2QS3 A;  4G2Z A;  1FPL A;  1P1N A;  1PDA A;  4F31 B;  3O6P A;  4F29 A;  2KLF A;  2DDK A;  5EYG A;  5AA4 B;  5I5P A;  2UVI A;  5KDT B;  3S4U A;  5DTB A;  3U93 A;  4PGN A;  4I3Y A;  3VVF A;  2Y5L A;  3Q27 A;  1MQI A;  3H03 A;  3IJX B;  4PAK A;  1DMB A;  3LR1 A;  3PUX E;  1NH8 A;  4PC9 A;  3G3F A;  4KQP A;  1IZ1 A;  5ISU A;  3U72 A;  4KYE A;  3SES A;  5CMB A;  5CMC A;  3IB2 A;  3PU5 A;  5K2X A;  2CEY A;  1L5T A;  3RYB A;  3QXM A;  1P1W A;  1SVX B;  5JEI A;  4JVC A;  4IO2 A;  4O3B A;  1URS A;  5FTI A;  4X8R A;  4R6H A;  5KZT A;  2HAU A;  1LAG E;  5ET7 A;  3ILT B;  1LGB C;  1TT1 A;  3E79 A;  3OEM A;  3H06 B;  4I1D A;  1B9J A;  4PFY A;  4BDM A;  2F3D A;  3HST A;  1I69 A;  3TTK A;  2Q8J A;  2OLB A;  3B6W A;  3SKP A;  2VT5 A;  4XTC Q;  2ZMB A;  3QYT A;  2P3V A;  1B1H A;  4UA8 A;  4DI4 B;  4KHZ E;  3A3C A;  4X04 A;  1H45 A;  2PVU A;  3RGY A;  2GHB A;  5I58 A;  3E3K A;  1LBC A;  2RC8 A;  1LST A;  5FHN A;  1N04 A;  1NV7 A;  3SER A;  3T9U A;  5EHS A;  4AS5 A;  3KN7 A;  4PQJ A;  1OMP A;  2QS4 A;  3ZKL A;  4RA1 A;  1US5 A;  4XKQ A;  1LBB A;  2F36 A;  1SI1 A;  1NNF A;  5TPA B;  1UIU A;  2DE2 A;  1ZTY A;  1A55 A;  4PGP A;  1FRP A;  2O51 A;  1Z7N E;  2F35 A;  1AWB A;  4H67 A;  2ABH A;  2PT2 A;  2VGQ A;  2Z8F A;  1JW4 A;  4R9G A;  3HV1 A;  4MMP A;  5DEX B;  2HPG A;  4ELQ A;  4U1O A;  1UTB A;  3CRB A;  1LBX A;  2Q9T A;  4QXD A;  4GWO A;  2DE4 A;  1ZIU A;  4GWZ A;  3DRF A;  2P0S A;  4DCY A;  3S9L C;  1MPB A;  2KR0 A;  3H6W A;  3LSW A;  5J1D A;  3V89 B;  3C32 A;  4JBZ A;  4OES A;  4JWX A;  1LFH A;  2OZZ A;  5ICQ A;  1N76 A;  1P1Q A;  4AB5 A;  5LOM A;  1NV0 A;  3MZB A;  4GWW A;  2VP1 A;  3TUS A;  1KA1 A;  4X1B A;  3O66 A;  3OEK A;  5K2Y A;  1II5 A;  4NF6 A;  4PET A;  4P8B A;  3HHG A;  5B7D A;  4NF4 B;  2PCR A;  2O6A A;  5DYH A;  4N81 A;  3M8U A;  3MC2 A;  1H44 A;  1UQW A;  4NAP A;  3QK6 A;  2XWO A;  3FVK A;  3VLW A;  3OD7 A;  4MFI A;  5B70 A;  3UGW A;  4YAH X;  1JEU A;  1IXG A;  1XC1 A;  5EQA A;  3FVN A;  3QUF A;  4OXV A;  1M5F A;  1KWH A;  4O3A A;  3K02 A;  1NV4 A;  1PB7 A;  3PD9 A;  3OMB A;  3IJO B;  4OVR A;  2R6G E;  3B6Q A;  1FPD A;  1NUW A;  4GIZ A;  3PGF A;  1FQE A;  1NNT A;  4PAI A;  1M5B A;  4C0R A;  4BDO A;  1Q1K A;  3TTN A;  3G3H A;  4P11 A;  3KBR A;  1MY1 A;  2G29 A;  1BK4 A;  4PF6 A;  4XKP A;  5H8N B;  4EF2 A;  4GXS B;  4U2R A;  2XXT A;  4XIG Q;  1B2H A;  3IOR A;  3T66 A;  3RTF B;  1BP5 A;  1DTG A;  3OO8 A;  4PCD A;  3RN8 A;  1YPN A;  4DXC A;  3FXQ A;  1LBZ A;  1FTK A;  4XKN A;  4HE1 A;  4R9F A;  4ZEF A;  2XX7 A;  3PPQ A;  3F11 A;  3IO4 A;  4OEN A;  4YMB A;  1XHY A;  4IY6 A;  3O6H A;  4IY5 A;  4KCC A;  1OQH A;  2QMW A;  4PFR A;  2H99 A;  2FA7 A;  2I3V A;  3CHG A;  3Q25 A;  4LUB A;  5ELV A;  1A7L A;  2H4I A;  2O7U A;  2FNC A;  1DCU A;  1B51 A;  1IME A;  3OO6 A;  4MH5 A;  3HN0 A;  1JEV A;  5JTY B;  3G7W A;  3V8X B;  2HEU A;  2UVH A;  3T9V A;  2PX1 A;  1NI9 A;  4F1U A;  2B4M A;  5KCJ B;  3QSL A;  1UTH A;  3RY3 A;  3K2D A;  3NOH A;  1FQD A;  4YZZ A;  2I0C A;  1O63 A;  2WOK A;  3OEL A;  4KR5 A;  4OVJ A;  4F3P A;  3PUY E;  1URD A;  1LBV A;  4GWS A;  4JXI A;  3CG3 A;  2ZZW A;  1FTJ A;  4ZEB A;  5TU0 A;  3ISP A;  3Q28 A;  1US4 A;  3T96 B;  1FQF A;  4G4P A;  3W9V A;  3VLV A;  1G0H A; 
#chains in the Genus database with same CATH homology
 2WOP A;  1Y1M A;  5H8F A;  2DWH A;  3K01 A;  3SEY A;  4BLA A;  1B05 A;  2M8C A;  1BKA A;  4OHN A;  4OFL A;  3IAZ A;  2Y7K A;  5EHM A;  1MG1 A;  2REG A;  3N5L A;  2NWJ A;  1JQF A;  2OWT A;  4QFK A;  2F8D A;  5L8D A;  2ALU A;  1DSN A;  4ZS9 A;  3FGS A;  3ZSF A;  1Y3Q A;  1N7X A;  3TOD A;  5L9O A;  1ZMG A;  1B1X A;  2UXA A;  5H8Q B;  4R75 A;  2UYF A;  4G8M A;  4IO7 A;  1YCJ A;  2XD3 A;  3C31 A;  3S9M C;  1LCT A;  4F39 A;  2NUV A;  1MXY A;  2VD3 A;  4RK2 A;  3DP8 A;  1EZP A;  2XXX A;  1JW5 A;  2DVZ A;  1NFT A;  3IOV A;  1ELJ A;  2RC7 A;  2DYX A;  2ONK E;  1OLA A;  4EXL A;  1NH7 A;  3MPK A;  3K1N A;  1SW2 A;  1RKM A;  4F1Y A;  4QFN A;  3N26 A;  1XOC A;  5TP9 A;  4DE8 A;  1J1N A;  3VVE A;  3EN3 A;  1QJM A;  4ZZE A;  1LB9 A;  4GL8 A;  2AYS A;  3UA8 A;  1B7U A;  1B5J A;  3QUJ A;  1MXX A;  3DP4 A;  5DVF A;  4R6Y A;  3UP9 A;  4MBP A;  2Y84 A;  4LA9 A;  1QUL A;  1CB6 A;  3IOW A;  4O3C A;  3CFL A;  5BWJ A;  3TCF A;  3VE1 B;  5BUU A;  3DRJ A;  2QSX A;  4FJP A;  1NL5 A;  5H8S A;  1R1N A;  4KI0 E;  5ITO A;  4MLQ A;  3UOR A;  1POY 1;  2A5T A;  1OQG A;  2O69 A;  5HBC A;  3IOU A;  3MJN A;  3TFL A;  5L9M A;  3IO6 A;  4PP0 A;  2WOL A;  3PMW A;  5FHO A;  3GXA A;  4QFP A;  3O28 A;  4H6D A;  1MXU A;  4YMA A;  2XHD A;  5JK4 A;  5FHM A;  1OVT A;  4OEV A;  4QFO A;  1ZBM A;  1QUK A;  4IO4 A;  4F3B A;  2VD2 A;  3HHF A;  1QW0 A;  5CC2 A;  4AB6 A;  4HTG A;  4YIC A;  1A8F A;  5H8H B;  1JNF A;  1B5H A;  4Z0I A;  2F7C A;  2NVU B;  1S7Y A;  5A5X A;  3FIR A;  2RC9 A;  2Z22 A;  3TQL A;  2Q2A A;  3U8Q A;  2DS9 A;  1JVX A;  4ZEC A;  4IO6 A;  3T22 A;  4G68 C;  5I2K A;  4DCX A;  5AA2 B;  3H7M A;  4FIM A;  1B0H A;  3EHT A;  3VDF A;  4I62 A;  1LFI A;  1NNK A;  2Y7W A;  3MAM A;  1DPP A;  3K1M A;  2F7B A;  4OWD A;  5I56 A;  1M5D A;  4ONY A;  4F1V A;  3FVO A;  3KG2 A;  2O68 A;  1MRP A;  2DVC A;  1S50 A;  1LFG A;  3FXU A;  4JWY A;  1B5I A;  4EQ7 A;  2DXR A;  5AA4 A;  3TQW A;  4XKR A;  2XD2 A;  5KDT A;  1QUI A;  3C9H A;  3IK6 B;  4RK9 A;  5I59 B;  2XXV A;  3ONM A;  4GFR A;  3T9X B;  2I0B A;  3N6U A;  4IB2 A;  4YB7 A;  4ZED A;  3JV9 A;  1R6Z A;  4C1T A;  2F34 A;  3K6W A;  1QKA A;  4YKI A;  3K6V A;  3GLB A;  3HO7 A;  5CBS A;  3W9W A;  1IIW A;  1GTK A;  4KD5 A;  1MM6 A;  4WKM A;  1B3H A;  1B6H A;  4R73 A;  3IL1 B;  4OFO A;  4GXA A;  1H76 A;  1IEJ A;  3IR1 A;  2YPN A;  3VV5 A;  4OZ9 A;  3LC8 A;  1SW5 A;  2F97 A;  3PUV E;  5M2V A;  2W7Y A;  4U22 A;  3MP8 A;  2O7I A;  5ICT A;  4K3F A;  2O1L A;  3KZG A;  4OMB A;  4F2Q A;  4X1D A;  4GD5 A;  3U94 A;  1MXZ A;  3Q26 A;  1DOT A;  3G3K A;  3DEL B;  3B7D A;  1IIT A;  5AA3 A;  4M4G A;  4ELO A;  3K4U A;  3ILU B;  2QJE A;  3R26 A;  4R2B A;  2XXW A;  1NNP A;  1HSL A;  5DT6 A;  1I6A A;  4YKK A;  1TFA A;  4OYV A;  3I6V A;  3DP6 A;  2RKM A;  3TAJ A;  3D4G A;  1B7Z A;  5TPA A;  3TZA A;  4WED A;  5I57 B;  3P7I A;  4H0W A;  2XX8 A;  3K1P A;  3WAE A;  2DWI A;  2QS2 A;  4LQ2 A;  3G3G A;  3KGC A;  5DEX A;  3B6T A;  5DVJ A;  2XXR A;  3DLN A;  4ZE9 A;  2ZYM A;  4Z7E A;  4U23 A;  4NWD A;  4NF8 B;  3N6T A;  1B0L A;  4OTE A;  1XVX A;  1UIV A;  3ZS6 A;  1FCK A;  1R9L A;  2B65 A;  4RNS A;  4FEB A;  2HZL A;  4NWC A;  3L6H A;  4EQB A;  3VXB A;  3OEN A;  3KN3 A;  1MQG A;  3THI A;  2X7Q A;  1JET A;  4BDN A;  3TKD A;  4NF4 A;  3M3F A;  3PPP A;  3RT8 A;  1LAH E;  2ZNS A;  4JB7 A;  1P1U A;  3TPA A;  3G3J A;  3FAS A;  1FQC A;  2GFE A;  4N6P A;  1Y4T A;  2XXP A;  3FJM A;  4OET A;  3U1O A;  4BDR A;  4NED A;  2RCA A;  4QF9 A;  4POX A;  1B40 A;  4F22 A;  3V83 A;  1B3L A;  4LZ7 A;  3CIJ A;  1MY4 A;  2Y7R A;  2Z8D A;  2DQV A;  1EZ9 A;  2Z23 A;  3FTO A;  2B3F A;  2V25 A;  2REJ A;  3LSL A;  5H8N A;  2HQ0 A;  3ODB A;  5I2N B;  1MS7 A;  4Q0C A;  1AMF A;  3PMX A;  2F7A A;  1ATG A;  3C4M A;  1D9Y A;  1RYX A;  1PB9 A;  4EF1 A;  4ELP A;  2X7P A;  3LUY A;  4ZDM A;  3D4C A;  1FTM A;  3TCH A;  4NTL A;  1TXF A;  1B52 A;  1MY2 A;  4RY1 A;  4E0X A;  2IA4 A;  2UYE A;  5HM4 B;  5CBR A;  1B4Z A;  3I5O A;  1XS5 A;  1O7T A;  3QAX A;  4ZE8 A;  3M3L A;  3USD A;  1N7W A;  3KEI A;  1Y9U A;  2H98 A;  1MDQ A;  4H1X A;  1R9Q A;  3W15 C;  4RYA A;  3O9P A;  5EYF A;  2D21 A;  2R71 A;  4DXB A;  3CVG A;  5JTY A;  5L9S A;  1Y20 A;  2H25 A;  1FTL A;  1ZKB A;  2I3W A;  3KJ7 A;  3RTW B;  3O29 A;  4LZ8 A;  5KCJ A;  4NF5 B;  2Z8E A;  3CFX A;  2HCA A;  4U21 A;  1WVJ A;  4FEC A;  4OER A;  1FTO A;  2D3I A;  3UIF A;  4GOT A;  3JZJ A;  1USY H;  1PBP A;  4U4S A;  2H5Y A;  3TTR A;  2V3Q A;  2ZYO A;  1N3X A;  2DP8 A;  1H3D A;  4R2F A;  1AOV A;  4N13 A;  1EH3 A;  3KOT A;  4TLL B;  3O6G A;  4C1U A;  3KOS A;  2I4B A;  1AL3 A;  1LCF A;  4G68 B;  1SYH A;  3ZKK A;  4P0I A;  4MLV A;  1MPC A;  2E1S A;  3K00 A;  4H8J A;  3E4R A;  3JYR A;  3IOT A;  3GZG A;  2THI A;  3FAT A;  3MBP A;  1PB8 A;  5IAI A;  2Q2C A;  4X48 A;  3UN6 A;  3CI8 A;  5H8Q A;  3TTL A;  2F6G A;  1JVY A;  2Y7P A;  1PC3 A;  1Q35 A;  4KFQ A;  3FJG A;  3O6I A;  4RPN A;  3MPL A;  3PMV A;  4PFU A;  4POW A;  3TEP A;  3R6U A;  1T0K A;  4XXU A;  1QUJ A;  1Y3P A;  3KFM A;  5FTH A;  1MQJ A;  4ELR A;  3CG1 A;  2OCU A;  3C35 A;  3HPI A;  2ONR A;  3TCG A;  1SQY A;  3TMG A;  2V3T A;  4I8C A;  3K6U A;  4H8I A;  3T9H B;  3FUZ A;  2UVG A;  4LON B;  2V3U A;  2H9B A;  1VFE A;  3RNN A;  4HCW A;  1ZJL A;  3E13 X;  1BTJ A;  1M5E A;  5CRY A;  3MVY A;  1OLC A;  3OO7 A;  1XVY A;  3RUM A;  3MZ9 A;  1GV8 A;  2DE3 A;  2O1M A;  2ZYK A;  3KN8 A;  1D9V A;  4EDP A;  3E9X A;  4YB5 A;  2E0S A;  4LP2 B;  1ZU0 A;  3MVX A;  3M3K A;  1A8E A;  3VFJ A;  3DRH A;  4UAC A;  5AE4 A;  2I58 A;  1B3E A;  1MDP 1;  1OIB A;  5F1Q A;  1A54 A;  1VR5 A;  3WAF A;  1HSJ A;  4IGT A;  2NOO A;  3MQ9 A;  3TTM A;  3TYH A;  1P1O A;  5F7V A;  1B46 A;  2DWJ A;  1MM7 A;  4QSE A;  4E0W A;  4OQO A;  2I4C A;  4NE4 A;  5H8H A;  2WKY A;  3SEU A;  1HSE A;  3PAM A;  1BLF A;  3SEX A;  3H6U A;  1SYI A;  1LB8 A;  4ESX A;  1EZO A;  4F3G A;  2VHA A;  4GLI A;  1LAX A;  4ND9 A;  2I48 A;  3LVU A;  3S9N C;  3BKI B;  2O84 X;  4G8H A;  3PD8 A;  5AA2 A;  5I58 B;  2F6P A;  3FD3 A;  1USY E;  4LZ5 A;  3LSF B;  2ONS A;  4R6K A;  1GVC A;  2XXI A;  3EQ1 A;  3PPN A;  4JSO A;  4FOR A;  2V93 A;  2Y7I A;  3A09 A;  5CM6 A;  2CMO A;  1AH5 A;  1SW1 A;  1VFD A;  4LVQ A;  4ECF A;  3DRK A;  1QVS A;  3MP6 A;  4KCD A;  3S2V A;  1WOD A;  3OXN A;  3H3G A;  5CMK A;  4GL0 A;  1UTB B;  2DXY A;  3Q29 A;  4OFJ A;  1N3W A;  2F5X A;  5I59 A;  4GVO A;  5ITP A;  3DM0 A;  3OOA A;  4R72 A;  4JWO A;  3T93 B;  4IO5 A;  2VOZ A;  1MY3 A;  2ZXT A;  4F19 A;  4Q30 B;  1IXI A;  2D5W A;  1O64 A;  4P0G A;  1PEB A;  4NF6 B;  1BIY A;  1ZLQ A;  3K0V A;  2AL5 A;  4EUO A;  3ECR A;  3OSR A;  4G77 A;  3S9E A;  2PMS A;  2PT1 A;  1Z7M E;  1FQA A;  2RCB A;  3CR9 A;  4F3S A;  1I6Q A;  1Y3N A;  3AXF A;  4LAT A;  1SBP A;  4YKP A;  3V5A A;  3RYA A;  3RLF E;  1D3K A;  4ZEK A;  2ZNU A;  2P2A A;  3RQT A;  3C34 A;  4EXK A;  2QL3 A;  4F2O A;  1AIV A;  1SI0 A;  1IXH A;  2HAV A;  3UK4 A;  2DSF A;  4QSD A;  1Y4C A;  3BFT A;  4BDQ A;  4IO3 A;  4QSC A;  3N94 A;  4GQO A;  3HCQ A;  3EHS A;  2UVJ A;  3H6T A;  2DWA A;  1CE2 A;  1SDX A;  1B3F A;  2B3B A;  3RT6 B;  2OBG A;  3IB0 A;  3KJT A;  4FAJ A;  3VVD A;  5I57 A;  2YJP A;  4X9T A;  3FVG A;  4IGR A;  4YKJ A;  4TOZ A;  2V84 A;  2G93 A;  2XXH A;  3H4Z A;  3LBS A;  2XXQ A;  1LAF E;  1IUD A;  2PBW A;  3MZ1 A;  3MW0 A;  4NF8 A;  2XXU A;  4RJZ A;  2HZK A;  1Y1Z A;  1WDN A;  3VXC A;  1N0T A;  2AIX A;  4RPO A;  3EPE A;  4GF8 A;  2B4L A;  1I6B A;  4JSD A;  1QKB A;  1UTH B;  3C36 A;  4QRZ A;  3PPO A;  3CFZ A;  1XT8 A;  4FAT A;  2QRY A;  3EHU A;  3DRI A;  2R9J A;  4KPT A;  4HW8 A;  4ISU A;  5I84 A;  2RIN A;  2DOJ A;  1A99 A;  4TLM B;  1A40 A;  3BBR A;  2OJT A;  5CMM A;  2XXY A;  1S9T A;  4BDL A;  2CZL A;  3RPW A;  3PUW E;  3QIM A;  3C33 A;  3PUZ E;  1D4N A;  4KYS A;  3H6V A;  5H8F B;  4DIG A;  4L17 A;  4NMY A;  3VLU A;  4WEP A;  3CSG A;  3IX1 A;  2XX9 A;  3L6G A;  2PYY A;  1TWY A;  4PE5 B;  4FED A;  3LSX A;  1P99 A;  3DRG A;  1MH4 A;  1B7H A;  2ANJ A;  5IKB A;  1B58 A;  1F9B A;  5I2N A;  1LLS A;  2IEE A;  3SDF A;  2GHA A;  1FQB A;  1OVB A;  3FXR A;  3FZV A;  3FV2 A;  4Q5T A;  1EU8 A;  2ZYN A;  1ANF A;  4DLD A;  4R74 A;  3FJ7 A;  4OEU A;  3U92 A;  2GH9 A;  2F78 A;  3I3V A;  1GR2 A;  5AA1 A;  2P1S A;  3SEV A;  1JW1 A;  1YAE A;  1M5C A;  4FE8 A;  2YLN A;  2HFB A;  3GBB A;  1IQ7 A;  4QHQ A;  4DXU A;  4DDD A;  4ZZA A;  4DZ1 A;  1MH3 A;  1MQD A;  5TP9 B;  4Q8R A;  2FYI A;  4TQU Q;  4N07 A;  2ZNT A;  3MWB A;  1YTV A;  3KSJ A;  2HXW A;  4H65 A;  4PFW A;  3IB1 A;  2RF1 A;  3O2A A;  4NF5 A;  5HPQ A;  5AA2 D;  3R7X A;  3TDJ A;  3CSB A;  2AL4 A;  3MP1 A;  2I6E A;  1POT A;  3PPR A;  1MY0 A;  2OK2 A;  5DVI A;  4QFL A;  2BJJ X;  1MXW A;  2GRV A;  1MPD A;  4LQ5 A;  3GBA A;  3A3U A;  2A5T B;  2Q89 A;  4F18 A;  3O97 A;  4G68 A;  4GRK A;  4YB6 A;  3BFU A;  2A5S A;  1B32 A;  1SW4 A;  1URG A;  4G8N A;  3SET A;  2QMX A;  3KSX A;  2OWS A;  1N84 A;  4HCY A;  3OO9 A;  4M1V A;  4H5G A;  2Q88 A;  4PFT A;  3OSQ A;  4AQ4 A;  4I9D A;  3G3I A;  2X26 A;  1H43 A;  3MVZ A;  4KYD A;  1VSO A;  1B3G A;  1MXV A;  1B4H A;  1NKX A;  3SEW A;  4MF3 A;  2I49 A;  4U1Z A;  2QS1 A;  5A5X B;  1PBQ A;  2NXO A;  4U4X A;  4WXJ A;  1DTZ A;  3MUQ A;  4ESW A;  1FW0 A;  4THI A;  2ESN A;  1DPE A;  5I2K B;  3EF7 A;  3PV0 E;  4RXL A;  4HS7 A;  1IXC A;  4YU0 A;  3MVW A;  1MQH A;  1NMU A;  4H5F A;  4EQ9 A;  2QPQ A;  4ZEI A;  5CI5 A;  5I56 B;  1SD3 A;  3FV1 A;  1RYO A;  3TEL A;  1VE4 A;  1GGG A;  3K6X A;  2LAO A;  1TFD A;  4JDF A;  2QS3 A;  4G2Z A;  1P1N A;  1PDA A;  4F31 B;  3O6P A;  4F29 A;  2KLF A;  5AA4 B;  2UVI A;  5KDT B;  3S4U A;  5DTB A;  3U93 A;  3VVF A;  3Q27 A;  1MQI A;  3H03 A;  3IJX B;  1DMB A;  3LR1 A;  3PUX E;  1NH8 A;  3G3F A;  4KQP A;  1IZ1 A;  5ISU A;  3U72 A;  4KYE A;  3SES A;  5CMB A;  5CMC A;  3IB2 A;  3PU5 A;  5K2X A;  1L5T A;  3RYB A;  3QXM A;  1P1W A;  1SVX B;  5JEI A;  4IO2 A;  4O3B A;  1URS A;  5FTI A;  4R6H A;  5KZT A;  2HAU A;  1LAG E;  3ILT B;  1LGB C;  1TT1 A;  3OEM A;  3H06 B;  4I1D A;  1B9J A;  4PFY A;  4BDM A;  3HST A;  1I69 A;  3TTK A;  2Q8J A;  2OLB A;  3B6W A;  3SKP A;  4XTC Q;  2ZMB A;  3QYT A;  1B1H A;  4UA8 A;  4KHZ E;  3A3C A;  1H45 A;  2PVU A;  3RGY A;  2GHB A;  5I58 A;  3E3K A;  1LBC A;  2RC8 A;  1LST A;  5FHN A;  1N04 A;  3SER A;  3T9U A;  5EHS A;  3KN7 A;  4PQJ A;  1OMP A;  2QS4 A;  3ZKL A;  4RA1 A;  1US5 A;  4XKQ A;  1LBB A;  2F36 A;  1SI1 A;  1NNF A;  5TPA B;  1UIU A;  2DE2 A;  1ZTY A;  1A55 A;  2O51 A;  1Z7N E;  2F35 A;  4H67 A;  2ABH A;  2PT2 A;  2VGQ A;  2Z8F A;  1JW4 A;  4R9G A;  3HV1 A;  5DEX B;  4ELQ A;  4U1O A;  1UTB A;  3CRB A;  2Q9T A;  4GWO A;  2DE4 A;  1ZIU A;  3DRF A;  2P0S A;  4DCY A;  3S9L C;  1MPB A;  3H6W A;  3LSW A;  5J1D A;  3V89 B;  3C32 A;  4JBZ A;  4OES A;  4JWX A;  1LFH A;  2OZZ A;  5ICQ A;  1N76 A;  1P1Q A;  4AB5 A;  5LOM A;  3MZB A;  3TUS A;  2VP1 A;  4X1B A;  3O66 A;  3OEK A;  5K2Y A;  1II5 A;  4NF6 A;  4PET A;  3HHG A;  5B7D A;  4NF4 B;  2O6A A;  5DYH A;  3M8U A;  3MC2 A;  1H44 A;  1UQW A;  3QK6 A;  3FVK A;  3VLW A;  3OD7 A;  4MFI A;  5B70 A;  3UGW A;  4YAH X;  1JEU A;  1IXG A;  1XC1 A;  3FVN A;  3QUF A;  4OXV A;  1M5F A;  1KWH A;  4O3A A;  3K02 A;  1PB7 A;  3PD9 A;  3OMB A;  3IJO B;  2R6G E;  3B6Q A;  4GIZ A;  3PGF A;  1FQE A;  1NNT A;  1M5B A;  4C0R A;  4BDO A;  1Q1K A;  3TTN A;  3G3H A;  4P11 A;  3KBR A;  1MY1 A;  2G29 A;  5H8N B;  4XKP A;  4EF2 A;  4GXS B;  4U2R A;  2XXT A;  4XIG Q;  1B2H A;  3IOR A;  3T66 A;  3RTF B;  1BP5 A;  1DTG A;  3OO8 A;  3RN8 A;  1YPN A;  4DXC A;  3FXQ A;  1FTK A;  4XKN A;  4R9F A;  4ZEF A;  2XX7 A;  3PPQ A;  3F11 A;  3IO4 A;  4OEN A;  4YMB A;  1XHY A;  4IY6 A;  3O6H A;  4IY5 A;  4KCC A;  1OQH A;  2QMW A;  2H99 A;  2FA7 A;  2I3V A;  3CHG A;  3Q25 A;  4LUB A;  5ELV A;  1A7L A;  2H4I A;  2O7U A;  2FNC A;  1B51 A;  3OO6 A;  4MH5 A;  3HN0 A;  1JEV A;  5JTY B;  3G7W A;  3V8X B;  2HEU A;  2UVH A;  3T9V A;  2PX1 A;  4F1U A;  2B4M A;  5KCJ B;  3QSL A;  1UTH A;  3RY3 A;  3K2D A;  1FQD A;  4YZZ A;  2I0C A;  1O63 A;  2WOK A;  3OEL A;  4KR5 A;  4OVJ A;  4F3P A;  3PUY E;  1URD A;  4JXI A;  3CG3 A;  1FTJ A;  4ZEB A;  5TU0 A;  3Q28 A;  1US4 A;  3T96 B;  1FQF A;  4G4P A;  3W9V A;  3VLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...