3O9PA

The structure of the escherichia coli murein tripeptide binding protein mppa
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
509
structure length
509
Chain Sequence
TVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein/peptide
molecule keywords Periplasmic murein peptide-binding protein
publication title Compensating Stereochemical Changes Allow Murein Tripeptide to Be Accommodated in a Conventional Peptide-binding Protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 166
structure length 509
sequence length 509
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3o9pA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3o9pA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3o9pA02
3F11A 3V5AA 2F6PA 2RINA 5TU0A 3IX1A 3SEXA 1XHYA 1TFAA 1Y3QA 1MXWA 4MH5A 3C32A 2Q89A 5F1QA 4EF2A 4OESA 3KN7A 1PB7A 1AL3A 4E0XA 3FGSA 4RK9A 4G68C 4ZDMA 4H5FA 1P1WA 4DZ1A 3K4UA 3OSQA 3DRFA 3UGWA 4PETA 3PPRA 2F7CA 4THIA 4QSCA 1A54A 2NVUB 3MVWA 1JQFA 4YKJA 1MY0A 4QFKA 4NEDA 4RPNA 4ZS9A 4C1TA 2D21A 5A5XB 3KN3A 2REJA 3TTMA 2H98A 2RC7A 1URDA 1JEVA 3VXCA 1B7ZA 4JSDA 4FIMA 1B40A 3S2VA 3DRIA 4WEDA 4BDRA 2CMOA 1UTBB 4LVQA 3T9HB 2WOPA 2QSXA 4Q8RA 3FTOA 4OEUA 2O6AA 4KYSA 2F8DA 4FEBA 2BJJX 4JWOA 3MJNA 5H8NB 3CIJA 1NNPA 1NNFA 4PQJA 4FEDA 4R6YA 1DTGA 4X1DA 4FATA 1JW1A 3H4ZA 3RT8A 2HAVA 3VLWA 4IO6A 3OD7A 2XXXA 3T9XB 1GVCA 2OJTA 2GH9A 4XTCQ 4F3SA 1IXCA 3OEKA 3SEUA 3O6HA 3LR1A 4KPTA 2AL5A 1BTJA 1YAEA 3PV0E 1B0HA 1R9QA 1BKAA 3T9VA 1EU8A 1LBBA 4KHZE 3UN6A 3PU5A 4WKMA 1ZIUA 4FAJA 1LFHA 3IAZA 4ZEFA 2YJPA 1LBCA 1LAGE 2ZNUA 3VVFA 3FJ7A 2ANJA 1MQGA 3IJXB 4IO2A 1RYOA 2UVJA 5HBCA 2Y84A 3HPIA 2P0SA 3A3UA 3SKPA 5JTYA 5TPAB 3MBPA 1WODA 1ATGA 3QYTA 1L5TA 3CHGA 2V25A 5FHNA 1FQFA 2DE2A 2I49A 4YZZA 1OVTA 4JWXA 5J1DA 4F2OA 1MY1A 3O97A 3RLFE 3O6PA 3MVZA 1WDNA 1B1HA 3MP6A 4FECA 1TFDA 3SDFA 3FZVA 2GHBA 1D4NA 2X7PA 2PVUA 1GR2A 1SBPA 3RUMA 3LC8A 5IKBA 3VVDA 1POTA 3OOAA 3CG3A 3V8XB 2E0SA 4F31B 2OZZA 3VVEA 4UACA 1XVYA 1LFIA 4IO7A 3TUSA 1FTKA 3V83A 5TP9A 4Z7EA 1AOVA 1DTZA 3B6TA 4PE5B 1SQYA 2HCAA 3S9EA 3IB1A 1XC1A 4ZEIA 4LATA 1QUKA 3MVYA 4RY1A 3N6UA 1SYIA 2F7BA 3HCQA 1SD3A 1YCJA 4BDLA 1UQWA 1B3HA 3KJ7A 1B3GA 1OMPA 1P99A 4OZ9A 1FTJA 1PB8A 4AB6A 2X7QA 3DP4A 2CZLA 3K6UA 2RCBA 3HN0A 1USYH 4H8JA 1JW4A 1B51A 1ZLQA 1UTHA 4PFWA 2Z8DA 1P1QA 3T93B 3R7XA 3C4MA 1USYE 5CBRA 1VSOA 2QS4A 3QUFA 4L17A 3T96B 1FW0A 2PT1A 4QSDA 2VOZA 2Z23A 1HSJA 4YICA 3DP8A 2I4CA 3TODA 3M3KA 3PMWA 1PB9A 3OO9A 3EHTA 4ESWA 1SYHA 5DVJA 3TTKA 4R73A 2KLFA 3MZBA 2Q2CA 4HW8A 1SW1A 3FUZA 4RJZA 5JTYB 2V84A 4LA9A 3PUVE 3E13X 3LSLA 4ZZEA 3FXUA 4GIZA 2GRVA 1JW5A 3C9HA 2I48A 4BDQA 1MM6A 4BLAA 4H65A 1IUDA 1SW5A 3U92A 2B65A 4N6PA 1WVJA 4YMBA 3VLUA 4POXA 1MPBA 2XX9A 1IXHA 4PFTA 3IOVA 3DRJA 5AA1A 4I1DA 3LSXA 4JSOA 1HSEA 2GHAA 4BDMA 1NL5A 1CE2A 3O6GA 3V89B 3UA8A 5DEXA 4IO5A 3TDJA 1TT1A 1B5IA 4X1BA 3KOTA 1II5A 3BFUA 4ONYA 4GRKA 5TP9B 2DWHA 4H6DA 3HHFA 1SW4A 2V93A 1S7YA 3TEPA 3FASA 1OLAA 2OWTA 2XX7A 1H3DA 2HFBA 1Z7NE 2ZYMA 3HSTA 4RK2A 3EF7A 2XXUA 5B7DA 4NF6A 2B4MA 1Y4CA 1DMBA 3PD9A 3FV2A 1B32A 5CMBA 3Q29A 1B9JA 1M5CA 3RN8A 1LGBC 1MY3A 3MWBA 1QVSA 4YU0A 3G3HA 1O7TA 3ILTB 4OXVA 2ONSA 4F39A 1XS5A 3RYAA 2UXAA 1SVXB 1DOTA 1FCKA 3TFLA 4F18A 3S9MC 4FORA 1Y1ZA 4I62A 5AA4A 2DXRA 3UORA 1UIVA 3N5LA 2R9JA 3W9WA 4F2QA 3IORA 5AA3A 1R9LA 4OEVA 4R74A 1JNFA 2I4BA 4QSEA 2I0BA 4NWCA 3ZSFA 1S50A 2X26A 1NH8A 1DPPA 3AXFA 4R6KA 1OQGA 3OMBA 2IA4A 5ISUA 3IK6B 1I6QA 3LVUA 4IGRA 2WOLA 3TTRA 4AQ4A 4QF9A 2NUVA 3EQ1A 3O29A 1A40A 3H06B 3P7IA 3CG1A 1B05A 3Q28A 2QRYA 4M1VA 4U2RA 1EZ9A 4GXSB 3A3CA 3QAXA 3UK4A 2ZYOA 1NKXA 3FIRA 1LCTA 3IOTA 3PUYE 3CVGA 3MVXA 2QS3A 5DT6A 4MBPA 3KG2A 4HTGA 5DVIA 1ZKBA 3EPEA 1NMUA 5DVFA 5AA2A 3H6VA 2XXHA 2Y7PA 5I58A 3B6QA 5DEXB 2V3TA 4TQUQ 4ELPA 2OWSA 4XKPA 2R6GE 1FTOA 2VGQA 3G3GA 3U72A 3ONMA 3Q26A 2B3FA 4G8NA 3E4RA 3DM0A 4XXUA 4OHNA 1B3FA 1B58A 3SESA 1ANFA 3TYHA 4GL8A 3LBSA 2DS9A 4U23A 3DRGA 3E9XA 2OLBA 3WAEA 2P1SA 1IITA 2Y7KA 5ITOA 3S4UA 3OO8A 5H8HA 4RXLA 4NF6B 3VE1B 5BWJA 1M5FA 4LP2B 1PBQA 4OFLA 4XKQA 4F3BA 3M3FA 5H8FA 3TCGA 1B7UA 1CB6A 4NF5A 1Y1MA 2HQ0A 2Z8EA 4XIGQ 5L9SA 1MQHA 3B6WA 4OMBA 1LB9A 3K6XA 3N26A 1RYXA 4EQBA 3FXRA 1QW0A 4TOZA 1LSTA 3O9PA 4R72A 1JETA 3C31A 5AA4B 2I3WA 2XHDA 5CM6A 2RCAA 4DCXA 1QKAA 4Q0CA 1MPDA 1MH3A 4Q5TA 4MF3A 1PC3A 4GF8A 3G3FA 1MXUA 2DE3A 3K6VA 3G3JA 4X48A 1M5DA 2Y7RA 1J1NA 1LLSA 2V3UA 2RF1A 4GVOA 4KD5A 3CRBA 4IO3A 1AMFA 3TTLA 4U1ZA 3JZJA 3ZKKA 4U4SA 5CC2A 1MXXA 4AB5A 1M5EA 1POY1 3PUWE 3U94A 3RTWB 4DCYA 2NOOA 3FXQA 4F1UA 1T0KA 3C36A 4OERA 2YLNA 3UP9A 1B5JA 1EZOA 3TQLA 4EDPA 1MQIA 1EH3A 1JEUA 3PMVA 3RGYA 5K2XA 4OQOA 4N13A 1MRPA 3IOUA 4U22A 2UVGA 2ZMBA 1UIUA 5AA2B 3TZAA 2RC8A 1MQJA 5I58B 3WAFA 4PFYA 4YB7A 4XKRA 1QKBA 4QRZA 1QUJA 3UIFA 3M3LA 5H8SA 4YKPA 2O7UA 2Z8FA 3IJOB 4MFIA 4IB2A 4BDOA 3OELA 3CFZA 3LSWA 1SI1A 2I6EA 3U8QA 1Q35A 1H44A 5KDTA 3PPPA 1MM7A 2PT2A 1FQAA 1NFTA 4JBZA 5I2KA 5H8HB 3O28A 4HCWA 3IO6A 2F5XA 3TELA 2RKMA 1D3KA 4IY5A 5H8FB 4YKIA 1MXVA 1QULA 2DE4A 3K1NA 4NF5B 1SDXA 3ZKLA 4WEPA 3VV5A 1NH7A 4ZECA 4O3AA 3FVNA 1FTLA 5CBSA 2E1SA 5CMMA 3GBBA 4H0WA 1I69A 1IZ1A 1ZMGA 4IY6A 4I9DA 4H5GA 2HZKA 3RQTA 2PYYA 5EHMA 2HXWA 4PFUA 3I5OA 1FTMA 4ELQA 2FYIA 2H4IA 3OXNA 1IEJA 1VFDA 2Q88A 2ONKE 3EN3A 5KZTA 4YAHX 3O66A 2DVCA 3KJTA 1GGGA 3VLVA 1N84A 2FNCA 2OK2A 1N3WA 5CMKA 4F1YA 3VXBA 2YPNA 3KSJA 5K2YA 1B4ZA 1FQBA 1JVYA 3MP1A 5EYFA 1ZTYA 4LUBA 1YPNA 3PUZE 4OWDA 3EHUA 3FJMA 4R2FA 1I6AA 1R1NA 1XVXA 5LOMA 4N07A 5I84A 1FQDA 1US5A 2DWJA 4G8MA 1FQCA 3G7WA 4RNSA 4EXKA 2H99A 1LAHE 3MC2A 3IB2A 2HZLA 1OIBA 4Z0IA 1YTVA 2D3IA 2DSFA 4G4PA 3ODBA 2Y7IA 1B3EA 3GLBA 2ZYNA 1H76A 4ZE8A 1LB8A 4ECFA 1I6BA 4KFQA 3H6WA 3MQ9A 3PAMA 2ABHA 3QIMA 1O63A 2ZNSA 5CMCA 2IEEA 4DXBA 1Q1KA 3IOWA 5KDTB 2ZYKA 1OLCA 2QL3A 3KZGA 4FJPA 4KCCA 3FVGA 3T9UA 5CRYA 1QUIA 5JEIA 4QFLA 4JB7A 5I2KB 1VE4A 2WKYA 2DVZA 2UVIA 2R71A 2I0CA 1LAXA 4FE8A 4MLVA 4ISUA 1GV8A 2NWJA 5FTHA 3KBRA 4TLMB 2HAUA 4GOTA 4KR5A 2OBGA 3FD3A 1A55A 3Q27A 1D9YA 3KN8A 3MUQA 4ZE9A 5I57A 3T66A 5AE4A 3R26A 3IL1B 1EZPA 4R6HA 1D9VA 4NF8A 1ZJLA 2Z22A 4XKNA 3PPNA 2GFEA 2PMSA 1HSLA 2ZXTA 2WOKA 2XD2A 2P2AA 2F34A 3PPOA 3DELB 4O3BA 4LZ5A 1PDAA 1N76A 2DP8A 4LZ8A 3S9LC 4JXIA 1LAFE 2H5YA 3KEIA 3RTFB 3HHGA 5BUUA 4DDDA 3QUJA 1IXGA 4G2ZA 2F36A 3H03A 5HPQA 5ICTA 1NNKA 5EHSA 4LZ7A 2F78A 1H45A 2QS2A 5L8DA 3CSGA 5I59A 1P1UA 4KCDA 4ELOA 3FJGA 2F97A 3O2AA 5DYHA 4NMYA 2O7IA 3CFLA 4NTLA 4JWYA 2XXPA 4YKKA 1PEBA 5IAIA 4POWA 4IO4A 4F22A 1IQ7A 3PGFA 2F6GA 3LSFB 2VD2A 4ZEKA 2UYFA 4OTEA 3IB0A 1A99A 2DWIA 1B5HA 3IR1A 4F19A 1A7LA 1N7XA 3TTNA 4KYDA 4NWDA 2F35A 3K6WA 1P1NA 5FTIA 2B4LA 3PUXE 2A5TA 4GLIA 4F3GA 4QFOA 3TMGA 1B2HA 4OYVA 3KFMA 3RNNA 2H9BA 3D4GA 1MH4A 3MAMA 4ZEDA 5ITPA 2ALUA 5L9MA 3SERA 3KSXA 3K01A 2QS1A 3PD8A 1MY4A 1MXZA 3PMXA 5FHMA 1TWYA 4DIGA 4U1OA 4YMAA 2D5WA 2Q9TA 3DRHA 3H3GA 1OQHA 1PBPA 2V3QA 3MZ1A 3N6TA 1A8FA 3BFTA 4RPOA 4U4XA 4RA1A 1URSA 3TPAA 4RYAA 3W15C 4F3PA 4QHQA 2AIXA 1AIVA 1MXYA 4LQ5A 1SI0A 3VFJA 4GFRA 2XXWA 4R9GA 5H8QA 2XD3A 2Q8JA 3TAJA 2FA7A 3KGCA 1GTKA 3FVKA 2XXIA 3A09A 3KOSA 3OENA 2QMXA 5KCJA 4G68A 5HM4B 1B46A 1TXFA 2LAOA 5I57B 1VR5A 5L9OA 1B7HA 3ECRA 4Q30B 4NF8B 2ONRA 2QPQA 3B7DA 2M8CA 3OO6A 2UYEA 2O1MA 1NNTA 3CSBA 1F9BA 3TKDA 2B3BA 3RT6B 2O1LA 4C1UA 3D4CA 4ND9A 1IIWA 2VHAA 2AYSA 4PP0A 3E3KA 2NXOA 2DXYA 2XXRA 4DE8A 4LONB 5B70A 1N04A 2QJEA 2Y7WA 4C0RA 3MPLA 4TLLB 4OFJA 1MPCA 3ZS6A 2G93A 1LFGA 1Z7ME 3OEMA 4H8IA 5AA2D 2DYXA 3FATA 4EQ7A 5I59B 1MDQA 4OENA 3QK6A 3HO7A 4MLQA 1VFEA 4X9TA 3SETA 4GD5A 5I2NA 3G3IA 1A8EA 2XXYA 3MP8A 5CI5A 3K1MA 3W9VA 2O51A 2RC9A 1N7WA 1ZBMA 5DTBA 4KYEA 2W7YA 4JDFA 2G29A 5I56A 2HEUA 3CR9A 1AH5A 3L6GA 2A5TB 1Y20A 3BBRA 2XXVA 3Q25A 3T22A 1B3LA 4DLDA 3DP6A 3TQWA 1R6ZA 1B4HA 4NF4A 4R9FA 2DOJA 2A5SA 4O3CA 4EF1A 3U93A 4QFNA 4EXLA 1MDP1 2I58A 4GWOA 1ZU0A 2AL4A 1Y3NA 2XX8A 2H25A 4R2BA 2VD3A 3K2DA 3SEWA 1N0TA 3K02A 3GBAA 3ILUB 3N94A 5ELVA 2DQVA 2O84X 1XT8A 5M2VA 2PX1A 3C35A 5H8QB 1RKMA 4H67A 4F1VA 1H43A 3QSLA 4GL0A 2ESNA 3USDA 1DPEA 4EQ9A 4YB5A 4M4GA 5KCJB 4G68B 4NE4A 1M5BA 2O69A 1S9TA 1MS7A 3FV1A 4OETA 1MQDA 3FVOA 2DWAA 3RY3A 1SW2A 1B52A 3MPKA 1BP5A 2XXQA 3TCHA 5FHOA 1QJMA 1DSNA 3H6TA 3H6UA 4OVJA 3SEVA 3CI8A 4P0IA 3U1OA 3JV9A 4F29A 3JYRA 3EHSA 2I3VA 4H1XA 1KWHA 1ELJA 3OO7A 5JK4A 3HV1A 1Y9UA 4K3FA 1MG1A 1IXIA 3C33A 2F7AA 2XXTA 5A5XA 3MZ9A 1BIYA 3DLNA 5ICQA 1Y4TA 3LUYA 4ZZAA 4HS7A 2UVHA 4UA8A 1UTBA 2O68A 3H7MA 3SEYA 3I6VA 3L6HA 2QMWA 3GZGA 1N3XA 3BKIB 5I2NB 4G8HA 3VDFA 1B0LA 5F7VA 1B1XA 2REGA 3GXAA 4WXJA 5H8NA 3K1PA 2Q2AA 4GXAA 1LCFA 4GQOA 2ZNTA 1JVXA 1FQEA 1BLFA 3R6UA 1Y3PA 3RPWA 1OVBA 1XOCA 1P1OA 4YB6A 1URGA 4P0GA 1O64A 5I56B 4EUOA 3O6IA 4BDNA 3OSRA 3DRKA 3S9NC 1B6HA 4G77A 2PBWA 3QXMA 4DXUA 3MW0A 3RYBA 4ESXA 4U21A 3TCFA 4NF4B 2OCUA 3G3KA 4OFOA 3K0VA 4IGTA 4I8CA 4HCYA 3CFXA 3IO4A 2THIA 1UTHB 3C34A 1US4A 3I3VA 4ELRA 4ZEBA 4QFPA 4E0WA 4KQPA 4LQ2A 4KI0E 4P11A 4DXCA 1MY2A 5TPAA 2VP1A 4R75A 3M8UA 3THIA 3PPQA 3K00A
chains in the Genus database with same CATH superfamily
2CEXA 3F11A 3V5AA 2F6PA 2RINA 5TU0A 3IX1A 3SEXA 1XHYA 1TFAA 1Y3QA 1MXWA 4MH5A 3C32A 2Q89A 1EYJA 5F1QA 4EF2A 4OESA 2HPGA 1LBZA 1JP4A 3KN7A 5I5PA 1PB7A 2Q74A 1AL3A 4E0XA 4PC9A 3FGSA 3GYYA 5J16A 4O94A 4RK9A 4G68C 4ZDMA 3BIHA 4H5FA 1P1WA 4DZ1A 4XEQA 1SPIA 3K4UA 5IZ3B 3OSQA 3DRFA 3UGWA 3KBZA 4PETA 4PGNA 3PPRA 5EQAA 2F7CA 4THIA 4QSCA 1A54A 2NVUB 3FBPA 1NUYA 3MVWA 1JQFA 4GWWA 4YKJA 1MY0A 4QFKA 4NEDA 4P1LA 4RPNA 4ZS9A 4C1TA 2D21A 5A5XB 3KN3A 2REJA 3TTMA 2H98A 2RC7A 1URDA 1JEVA 3VXCA 1B7ZA 4JSDA 4FIMA 1D9QA 4N8YA 4PBQA 1B40A 3S2VA 3DRIA 4WEDA 4BDRA 2CMOA 1UTBB 4LVQA 3T9HB 2WOPA 2QSXA 4Q8RA 3FTOA 4OEUA 2O6AA 4KYSA 1NUWA 2F8DA 4FEBA 2KR0A 2BJJX 4JWOA 3MJNA 5H8NB 2XWOA 3CIJA 1NNPA 3MYUA 1NNFA 4PQJA 4FEDA 4R6YA 1DTGA 5ET6A 4X1DA 4FATA 1JW1A 3H4ZA 3RT8A 2HAVA 3VLWA 4IO6A 3OD7A 2XXXA 4NF0A 3T9XB 1GVCA 2OJTA 2WEFA 2GH9A 4XTCQ 4F3SA 1IXCA 3OEKA 3SEUA 3O6HA 3LR1A 4KPTA 2AL5A 1BTJA 1YAEA 3PV0E 1B0HA 4P1EA 1R9QA 1BKAA 3T9VA 1EU8A 1LBBA 4KHZE 3UN6A 3PU5A 4WKMA 1ZIUA 4FAJA 1LFHA 3IAZA 4ZEFA 2YJPA 1LBCA 1LAGE 2ZNUA 3EKIA 4N81A 3VVFA 3FJ7A 2ANJA 1MQGA 3IJXB 4IO2A 1RYOA 4I40A 2FBPA 3RYDA 4N8GA 2UVJA 5HBCA 2Y84A 3HPIA 2P0SA 3A3UA 3SKPA 4QXDA 5JTYA 5TPAB 3MBPA 1WODA 1ATGA 3QYTA 1L5TA 3CHGA 2V25A 5FHNA 1FQFA 3HFUA 2DE2A 2I49A 4YZZA 4GWUA 1OVTA 4JWXA 5J1DA 4F2OA 1MY1A 3B8BA 2ZZVA 3O97A 3RLFE 3O6PA 1NV0A 3MVZA 2P3VA 1FTAA 1WDNA 1B1HA 3MP6A 1RDXA 4FECA 1TFDA 3SDFA 3FZVA 2GHBA 1D4NA 2X7PA 1IMCA 4P47A 2PVUA 1GR2A 1SBPA 3RUMA 2V4CA 3LC8A 5IKBA 3VVDA 1POTA 3OOAA 4NN3A 3CG3A 2E0SA 3V8XB 2OZZA 2CEYA 3VVEA 4F31B 4UACA 1XVYA 1LFIA 4OA4A 4IO7A 3TUSA 1FTKA 3V83A 5TP9A 2PCRA 4Z7EA 4N17A 1AOVA 1DTZA 3B6TA 4PE5B 4MNIA 1SQYA 2HCAA 3S9EA 3IB1A 1XC1A 4ZEIA 4LATA 1QUKA 3MVYA 4RY1A 3N6UA 1SYIA 2F7BA 3HCQA 1SD3A 1YCJA 4P8BA 4P3LA 4BDLA 4O8MA 1UQWA 1B3HA 3KJ7A 1B3GA 1OMPA 1NV5A 1P99A 4OZ9A 4N4UA 4LN5A 1FTJA 1PB8A 4AB6A 2X7QA 3DP4A 2CZLA 3K6UA 4G61A 2RCBA 3HN0A 4PF6A 1USYH 4H8JA 1JW4A 1B51A 1ZLQA 1UTHA 4PFWA 2Z8DA 1P1QA 3T93B 3R7XA 3C4MA 1USYE 5CBRA 1VSOA 2QS4A 3QUFA 1G0IA 4L17A 3T96B 1FW0A 2PT1A 4QSDA 2VOZA 4NAPA 2Z23A 1HSJA 4YICA 3DP8A 2I4CA 3TODA 3M3KA 3PMWA 1PB9A 3OO9A 3EHTA 4ESWA 1SYHA 5DVJA 3TTKA 3T1BA 4R73A 2KLFA 3MZBA 2Q2CA 4HW8A 1SW1A 3FUZA 4RJZA 5JTYB 2V84A 2GQ1A 4LA9A 2Y5KA 3PUVE 3E13X 3LSLA 4H45A 4ZZEA 3E78A 3FXUA 4GIZA 2GRVA 4PCDA 1JW5A 3C9HA 2I48A 4BDQA 1YXIA 1KA1A 1MM6A 4BLAA 4H65A 1IUDA 1SW5A 3U92A 2B65A 4N6PA 1WVJA 4OVRA 4YMBA 3VLUA 4POXA 1MPBA 2XX9A 1IXHA 4PFTA 3IOVA 1NV2A 3DRJA 4I1DA 5AA1A 3LSXA 2OWZA 4MNCA 4JSOA 1HSEA 2GHAA 4BDMA 1NL5A 1CE2A 3O6GA 3V89B 3UA8A 5DEXA 4IO5A 3TDJA 5I3SA 1TT1A 1B5IA 4X1BA 3KOTA 1II5A 3BFUA 4ONYA 2QVRA 4GRKA 5TP9B 2DWHA 4H6DA 3HHFA 1SW4A 2WBBA 2V93A 1S7YA 3TEPA 3FASA 1OLAA 2OWTA 2XX7A 1H3DA 2HFBA 1Z7NE 2ZYMA 3HSTA 2KQZA 4RK2A 3EF7A 2XXUA 5B7DA 4NF6A 2B4MA 1DK4A 4HE1A 1Y4CA 2R8TA 3B50A 1XI6A 1DMBA 3PD9A 3FV2A 1B32A 5CMBA 3Q29A 1B9JA 1IMEA 1M5CA 3RN8A 1LGBC 1MY3A 3MWBA 1QVSA 4NGUA 4YU0A 3G3HA 1O7TA 3ILTB 4OXVA 2ONSA 4F39A 1XS5A 2JJKA 3RYAA 2UXAA 1SVXB 1DOTA 1FCKA 3TFLA 4F18A 3S9MC 4FORA 1Y1ZA 4I62A 5AA4A 4QBAA 2DXRA 1NV6A 3UORA 1UIVA 3N5LA 2R9JA 3W9WA 5EYHA 4F2QA 3IORA 5AA3A 1R9LA 3IFCA 4OEVA 4R74A 1JNFA 2I4BA 4QSEA 1LEVA 2I0BA 4NWCA 3ZSFA 1S50A 2X26A 1DCUA 1NH8A 1DPPA 3AXFA 4R6KA 1BK4A 1OQGA 3OMBA 2IA4A 4GWZA 5ISUA 3IK6B 1I6QA 3LVUA 4IGRA 2WOLA 3TTRA 4AQ4A 4QF9A 2NUVA 3EQ1A 3O29A 1A40A 2MKZA 3H06B 3P7IA 3CG1A 1B05A 3Q28A 2QRYA 4M1VA 4U2RA 1EZ9A 4GXSB 1FPGA 4GWYA 3A3CA 3QAXA 3UK4A 2ZYOA 1NKXA 1IMBA 3FIRA 4X04A 2QVVA 1LCTA 3IOTA 4PAKA 3PUYE 3CVGA 3MVXA 2QS3A 5DT6A 4MBPA 3KG2A 4HTGA 2VPOA 5DVIA 1ZKBA 3EPEA 1FBCA 1NMUA 5DVFA 5AA2A 4HXVA 3H6VA 3U65A 2XXHA 2Y7PA 5I58A 3B6QA 5DEXB 2V3TA 4TQUQ 4ELPA 2OWSA 4XKPA 2R6GE 4PFIA 1FTOA 2VGQA 2Q8MA 3G3GA 4N15A 3U72A 3ONMA 3Q26A 2B3FA 4G8NA 3E4RA 1RDYA 2VT5A 3DM0A 4XXUA 4OHNA 1B3FA 1B58A 3SESA 1ANFA 3TYHA 4GL8A 3LBSA 2DS9A 4U23A 3DRGA 4I3YA 3E9XA 4H46A 2OLBA 3WAEA 2P1SA 1IITA 2Y7KA 5ITOA 3S4UA 3OO8A 2CZHA 1LBVA 1NV7A 5H8HA 5I7IA 4RXLA 4NF6B 3VE1B 1YYZA 5BWJA 1M5FA 4LP2B 1PBQA 4OFLA 4XKQA 4F3BA 3M3FA 4N91A 5H8FA 3TCGA 1B7UA 1CB6A 4MMPA 4NF5A 4AS5A 1Y1MA 2HQ0A 5LDZA 2Z8EA 1FPLA 2WX9A 4XIGQ 5L9SA 1MQHA 3B6WA 4OMBA 1LB9A 1NV3A 3K6XA 3N26A 1RYXA 4EQBA 3FXRA 4PE3A 3LV0A 1QW0A 1LSTA 4TOZA 3O9PA 4R72A 1JETA 3C31A 5AA4B 2I3WA 2XHDA 5CM6A 2HHMA 2RCAA 4DCXA 1QKAA 4Q0CA 1MPDA 1MH3A 4Q5TA 4PTKA 4MF3A 1PC3A 4GF8A 3G3FA 1MXUA 2DE3A 3K6VA 2OX3A 3G3JA 1RDZA 4X48A 1M5DA 2Y7RA 1J1NA 1LLSA 2V3UA 2RF1A 4GVOA 4KD5A 3CRBA 4IO3A 1AMFA 3TTLA 2QVUA 4U1ZA 3JZJA 3ZKKA 4U4SA 5CC2A 1MXXA 5T3JA 4AB5A 1M5EA 1POY1 3PUWE 5ESYA 4OVTA 3U94A 3RTWB 4DCYA 2NOOA 3FXQA 4GWSA 2ZZWA 4F1UA 1T0KA 3C36A 1FBHA 4OERA 2YLNA 4OVPA 3UP9A 1B5JA 1EZOA 3TQLA 4EDPA 1MQIA 1EH3A 2FIXA 3RPLA 4PAFA 1FPEA 1JEUA 1Q9DA 3PMVA 3RGYA 5K2XA 4OQOA 4N13A 1MRPA 3IOUA 4U22A 2UVGA 2ZMBA 1UIUA 5AA2B 3TZAA 2RC8A 1MQJA 5I58B 3WAFA 4PFYA 4YB7A 4XKRA 3ROJA 5DW8A 1QKBA 4QRZA 1QUJA 3UIFA 3M3LA 5H8SA 4YKPA 2O7UA 2Z8FA 4MNPA 2XWIA 3IJOB 4MFIA 4NQ8A 4IB2A 4BDOA 3OELA 3CFZA 3LSWA 1SI1A 2I6EA 3U8QA 1Q35A 1H44A 5KDTA 3PPPA 1FSAA 1MM7A 2PT2A 4MIJA 1FQAA 1NFTA 4JBZA 2DDKA 3ISPA 1FBFA 3MSTA 5H8HB 3O28A 5I2KA 4HCWA 3IO6A 2F5XA 4HE0A 5ET5A 3TELA 2RKMA 1D3KA 4IY5A 5H8FB 4YKIA 1MXVA 4FBPA 1QULA 2PFYA 2DE4A 1AWBA 3NOHA 3K1NA 4NF5B 1FPBA 1SDXA 3ZKLA 4GWXA 4WEPA 3VV5A 2XWKA 1NH7A 4ZECA 4O3AA 3FVNA 2WYPA 1FTLA 4HE2A 5CBSA 2E1SA 4PDHA 5IZZA 5CMMA 3GBBA 4H0WA 1I69A 1IZ1A 1ZMGA 4IY6A 4I9DA 4H5GA 2ZZXA 2HZKA 3RQTA 2PYYA 1FJ9A 5EHMA 2HXWA 4PFUA 5EQ9A 3I5OA 1FTMA 4ELQA 2FYIA 2H4IA 5ET8A 3OXNA 1IEJA 1VFDA 2Q88A 2ONKE 3EN3A 5KZTA 1FPFA 4MCOA 3O66A 4YAHX 2DVCA 3KJTA 1GGGA 3VLVA 1N84A 2FNCA 2OK2A 1N3WA 5CMKA 2PFZA 4F1YA 3VXBA 2XA5A 2YPNA 3SZPA 3KSJA 5EQ8A 5K2YA 1B4ZA 1FQBA 4MHFA 1JVYA 3MP1A 5EYFA 1ZTYA 4LUBA 1YPNA 3PUZE 4OWDA 3EHUA 3FJMA 4R2FA 1I6AA 1R1NA 1XVXA 5LOMA 4N07A 5I84A 1FQDA 1US5A 3RPLB 2DWJA 4G8MA 1FPIA 1FQCA 3G7WA 4RNSA 1YZ0A 4EXKA 2H99A 1LAHE 3MC2A 3IB2A 2HZLA 1OIBA 4Z0IA 1IMFA 1YTVA 2D3IA 5EYGA 2DSFA 4G4PA 3ODBA 2Y7IA 1B3EA 3GLBA 2ZYNA 1H76A 4ZE8A 1LB8A 4ECFA 1I6BA 1K9YA 4KFQA 3T0JA 3H6WA 3MQ9A 3PAMA 2ABHA 3QIMA 1O63A 4GBVA 2ZNSA 3PTYA 1K9ZA 5CMCA 2IEEA 4DXBA 1Q1KA 4AS4A 3IOWA 5KDTB 2ZYKA 1OLCA 2QL3A 3LUZA 3KZGA 4FJPA 4KCCA 3FVGA 3T9UA 5CRYA 4OVQA 4NX1A 1QUIA 5JEIA 4QFLA 4JB7A 5I2KB 1VE4A 2WKYA 2DVZA 2UVIA 4XFEA 2R71A 2I0CA 1LAXA 2L5VA 4FE8A 4MLVA 4ISUA 1GV8A 2NWJA 4PGPA 5FTHA 3KBRA 4TLMB 2HAUA 4GOTA 4KR5A 2OBGA 3FD3A 1A55A 3Q27A 1D9YA 3KN8A 3MUQA 4ZE9A 5I57A 3T66A 5AE4A 3R26A 3IL1B 1EZPA 4R6HA 1D9VA 4NF8A 1ZJLA 2Z22A 1FPDA 4XKNA 3PPNA 2GFEA 2CZKA 2PMSA 1HSLA 2ZXTA 2WOKA 2XD2A 2P2AA 2F34A 3PPOA 3DELB 4O3BA 4LZ5A 1PDAA 1N76A 1IMDA 2DP8A 4LZ8A 3S9LC 4JXIA 1LAFE 2H5YA 3KEIA 3RTFB 3HHGA 5BUUA 4DDDA 3QUJA 1IXGA 4G2ZA 2F36A 3H03A 5HPQA 5ICTA 1NNKA 2FIEA 5EHSA 4LZ7A 2F78A 1H45A 2QS2A 5L8DA 3CSGA 5I59A 3D1RA 1P1UA 4I3EA 4KCDA 4ELOA 3FJGA 4PDDA 2F97A 3O2AA 5DYHA 4NMYA 2O7IA 3CFLA 4NTLA 4JWYA 2XXPA 1NUZA 4YKKA 1PEBA 5IAIA 4MAGA 4POWA 4IO4A 4F22A 1IQ7A 3PGFA 2F6GA 3LSFB 2VD2A 4ZEKA 2UYFA 4OTEA 3IB0A 1A99A 1FBDA 2DWIA 1B5HA 3IR1A 4F19A 2WBDA 4IR8A 1A7LA 1N7XA 3TTNA 4KYDA 4NWDA 2F35A 3K6WA 1P1NA 5FTIA 2B4LA 3PUXE 3E79A 1IMAA 2A5TA 4GLIA 4F3GA 4QFOA 3TMGA 1B2HA 4OYVA 3BIGA 3KFMA 3RNNA 2H9BA 3D4GA 1MH4A 3MAMA 4ZEDA 5ITPA 2ALUA 5L9MA 3SERA 3KSXA 3K01A 2QS1A 2QFLA 4X8RA 3PD8A 1MY4A 1MXZA 4N6DA 3PMXA 5FHMA 1TWYA 4DIGA 4U1OA 5IM2A 4YMAA 2D5WA 2Q9TA 3DRHA 2F3DA 3H3GA 1OQHA 1PBPA 2F3BA 2V3QA 3MZ1A 3N6TA 1A8FA 3BFTA 4RPOA 4U4XA 4RA1A 1URSA 3TPAA 4RYAA 3IFAA 3W15C 4F3PA 4QHQA 2AIXA 1AIVA 1MXYA 4LQ5A 1SI0A 3VFJA 4GFRA 2XXWA 4R9GA 5H8QA 2XD3A 2Q8JA 1VDWA 3TAJA 1QGXA 2FA7A 3KGCA 1GTKA 3FVKA 2FVZA 2XXIA 3A09A 3KOSA 3OENA 2QMXA 5KCJA 4G68A 5HM4B 1B46A 1TXFA 2LAOA 5I57B 1VR5A 5L9OA 1B7HA 4MX6A 3ECRA 4Q30B 4NF8B 2ONRA 4DI3D 3QMFA 2QPQA 3B7DA 2M8CA 3OO6A 4PFBA 2UYEA 1NI9A 2O1MA 1NNTA 3CSBA 3FXBA 1F9BA 3TKDA 2B3BA 3RT6B 2CZIA 2O1LA 4C1UA 3D4CA 4ND9A 1IIWA 2VHAA 2AYSA 5IZ1A 4PP0A 3E3KA 3KC1A 2NXOA 2DXYA 2XXRA 4DE8A 4LONB 1FBEA 1LBYA 5B70A 1N04A 2QJEA 2Y7WA 4MJOA 4C0RA 1KZ8A 3MPLA 4TLLB 4GX4A 4OFJA 1DBZA 1MPCA 3ZS6A 1EYKA 2G93A 1LFGA 1Z7ME 3OEMA 4H8IA 5AA2D 2DYXA 3FATA 1NV4A 4EQ7A 5I59B 1MDQA 4OENA 3QK6A 3HO7A 4MLQA 1VFEA 4X9TA 3SETA 2HXRA 4GD5A 4NG7A 4GX6A 5I2NA 3G3IA 1A8EA 5A5LA 2XXYA 3MP8A 5CI5A 3K1MA 3W9VA 4GBWA 2O51A 2RC9A 5F24A 3KC0A 1N7WA 4O7MA 1NUXA 1ZBMA 5DTBA 5EQ7A 4KYEA 2W7YA 4JDFA 2G29A 5I56A 2HEUA 3CR9A 1AH5A 3L6GA 2A5TB 1Y20A 4MEVA 3BBRA 2XXVA 3Q25A 3T22A 2P3NA 1B3LA 4DLDA 3DP6A 1CNQA 3TQWA 4NHBA 1FPJA 1R6ZA 1B4HA 4NF4A 4R9FA 2DOJA 2A5SA 4O3CA 4EF1A 3U93A 4QFNA 4EXLA 1MDP1 2I58A 4GWOA 1ZU0A 2AL4A 1Y3NA 1FRPA 4PAIA 2XX8A 1EYIA 2H25A 4R2BA 2VD3A 3K2DA 3SEWA 1N0TA 3K02A 3GBAA 3ILUB 3N94A 5ELVA 2DQVA 2O84X 1XT8A 4GX3A 5M2VA 2PX1A 1INPA 3C35A 5H8QB 1RKMA 5IGAA 1FBPA 2BJIA 4H67A 4F1VA 1H43A 3QSLA 4GL0A 2ESNA 3USDA 1DPEA 4EQ9A 4YB5A 4M4GA 5KCJB 5FBPA 4G68B 4NE4A 4PBHA 1M5BA 2O69A 1LBWA 4JVIA 1S9TA 1MS7A 3FV1A 4OETA 1MQDA 3FVOA 2XWVA 4OANA 2DWAA 3RY3A 2XXKA 1SW2A 1B52A 3MPKA 1BP5A 2XXQA 3TCHA 5FHOA 1QJMA 1DSNA 3H6TA 3H6UA 4OVJA 3SEVA 5IZ3A 3CI8A 4P0IA 3U1OA 3JV9A 4JVDA 4F29A 3JYRA 3EHSA 2I3VA 4H1XA 1KWHA 2WYKA 1ELJA 3OO7A 5JK4A 3HV1A 1Y9UA 4K3FA 1MG1A 1IXIA 3C33A 2F7AA 2XXTA 4JVCA 5A5XA 3MZ9A 4UABA 1BIYA 3DLNA 5ICQA 1Y4TA 3LUYA 4ZZAA 4HS7A 2UVHA 4UA8A 4KXPA 1UTBA 2O68A 3H7MA 3SEYA 3I6VA 3L6HA 1FJ6A 2QMWA 3GZGA 1N3XA 1NV1A 3BKIB 5I2NB 4G8HA 3VDFA 1B0LA 5F7VA 4P9KA 1B1XA 2REGA 3GXAA 4WXJA 5H8NA 3K1PA 2Q2AA 4GXAA 1LCFA 4GQOA 2ZNTA 1JVXA 1FQEA 1BLFA 4P56A 3R6UA 1Y3PA 3RPWA 1OVBA 1XOCA 1FPKA 1P1OA 4YB6A 1LBXA 4OVSA 4DI4B 1URGA 4P0GA 2VPNA 1O64A 1KA0A 5I56B 4EUOA 3O6IA 4PF8A 4BDNA 3OSRA 3DRKA 3S9NC 5LTCA 1B6HA 4G77A 2PBWA 3QXMA 4DXUA 3MW0A 2Y5LA 3RYBA 4ESXA 4U21A 3TCFA 4NF4B 2OCUA 3G3KA 4OFOA 3K0VA 4IGTA 4I8CA 4HCYA 1FBGA 4PFRA 4N6KA 3CFXA 3IO4A 2THIA 1UTHB 3C34A 1US4A 1G0HA 2FHYA 3I3VA 3A29A 4ELRA 4ZEBA 4QFPA 4E0WA 4KQPA 4LQ2A 4KI0E 4XF5A 4P11A 4DXCA 1MY2A 5TPAA 5ET7A 2VP1A 4R75A 3M8UA 3THIA 4O7IA 3PPQA 3K00A
chains in the Genus database with same CATH topology
3F11A 3V5AA 2F6PA 2RINA 5TU0A 3IX1A 3SEXA 1XHYA 1TFAA 1Y3QA 1MXWA 4MH5A 3C32A 2Q89A 5F1QA 4EF2A 4OESA 3KN7A 1PB7A 1AL3A 4E0XA 3FGSA 4RK9A 4G68C 4ZDMA 4H5FA 1P1WA 4DZ1A 3K4UA 3OSQA 3DRFA 3UGWA 4PETA 3PPRA 2F7CA 4THIA 4QSCA 1A54A 2NVUB 3MVWA 1JQFA 4YKJA 1MY0A 4QFKA 4NEDA 4RPNA 4ZS9A 4C1TA 2D21A 5A5XB 3KN3A 2REJA 3TTMA 2H98A 2RC7A 1URDA 1JEVA 3VXCA 1B7ZA 4JSDA 4FIMA 1B40A 3S2VA 3DRIA 4WEDA 4BDRA 2CMOA 1UTBB 4LVQA 3T9HB 2WOPA 2QSXA 4Q8RA 3FTOA 4OEUA 2O6AA 4KYSA 2F8DA 4FEBA 2BJJX 4JWOA 3MJNA 5H8NB 3CIJA 1NNPA 1NNFA 4PQJA 4FEDA 4R6YA 1DTGA 4X1DA 4FATA 1JW1A 3H4ZA 3RT8A 2HAVA 3VLWA 4IO6A 3OD7A 2XXXA 3T9XB 1GVCA 2OJTA 2GH9A 4XTCQ 4F3SA 1IXCA 3OEKA 3SEUA 3O6HA 3LR1A 4KPTA 2AL5A 1BTJA 1YAEA 3PV0E 1B0HA 1R9QA 1BKAA 3T9VA 1EU8A 1LBBA 4KHZE 3UN6A 3PU5A 4WKMA 1ZIUA 4FAJA 1LFHA 3IAZA 4ZEFA 2YJPA 1LBCA 1LAGE 2ZNUA 3VVFA 3FJ7A 2ANJA 1MQGA 3IJXB 4IO2A 1RYOA 2UVJA 5HBCA 2Y84A 3HPIA 2P0SA 3A3UA 3SKPA 5JTYA 5TPAB 3MBPA 1WODA 1ATGA 3QYTA 1L5TA 3CHGA 2V25A 5FHNA 1FQFA 2DE2A 2I49A 4YZZA 1OVTA 4JWXA 5J1DA 4F2OA 1MY1A 3O97A 3RLFE 3O6PA 3MVZA 1WDNA 1B1HA 3MP6A 4FECA 1TFDA 3SDFA 3FZVA 2GHBA 1D4NA 2X7PA 2PVUA 1GR2A 1SBPA 3RUMA 3LC8A 5IKBA 3VVDA 1POTA 3OOAA 3CG3A 3V8XB 2E0SA 4F31B 2OZZA 3VVEA 4UACA 1XVYA 1LFIA 4IO7A 3TUSA 1FTKA 3V83A 5TP9A 4Z7EA 1AOVA 1DTZA 3B6TA 4PE5B 1SQYA 2HCAA 3S9EA 3IB1A 1XC1A 4ZEIA 4LATA 1QUKA 3MVYA 4RY1A 3N6UA 1SYIA 2F7BA 3HCQA 1SD3A 1YCJA 4BDLA 1UQWA 1B3HA 3KJ7A 1B3GA 1OMPA 1P99A 4OZ9A 1FTJA 1PB8A 4AB6A 2X7QA 3DP4A 2CZLA 3K6UA 2RCBA 3HN0A 1USYH 4H8JA 1JW4A 1B51A 1ZLQA 1UTHA 4PFWA 2Z8DA 1P1QA 3T93B 3R7XA 3C4MA 1USYE 5CBRA 1VSOA 2QS4A 3QUFA 4L17A 3T96B 1FW0A 2PT1A 4QSDA 2VOZA 2Z23A 1HSJA 4YICA 3DP8A 2I4CA 3TODA 3M3KA 3PMWA 1PB9A 3OO9A 3EHTA 4ESWA 1SYHA 5DVJA 3TTKA 4R73A 2KLFA 3MZBA 2Q2CA 4HW8A 1SW1A 3FUZA 4RJZA 5JTYB 2V84A 4LA9A 3PUVE 3E13X 3LSLA 4ZZEA 3FXUA 4GIZA 2GRVA 1JW5A 3C9HA 2I48A 4BDQA 1MM6A 4BLAA 4H65A 1IUDA 1SW5A 3U92A 2B65A 4N6PA 1WVJA 4YMBA 3VLUA 4POXA 1MPBA 2XX9A 1IXHA 4PFTA 3IOVA 3DRJA 5AA1A 4I1DA 3LSXA 4JSOA 1HSEA 2GHAA 4BDMA 1NL5A 1CE2A 3O6GA 3V89B 3UA8A 5DEXA 4IO5A 3TDJA 1TT1A 1B5IA 4X1BA 3KOTA 1II5A 3BFUA 4ONYA 4GRKA 5TP9B 2DWHA 4H6DA 3HHFA 1SW4A 2V93A 1S7YA 3TEPA 3FASA 1OLAA 2OWTA 2XX7A 1H3DA 2HFBA 1Z7NE 2ZYMA 3HSTA 4RK2A 3EF7A 2XXUA 5B7DA 4NF6A 2B4MA 1Y4CA 1DMBA 3PD9A 3FV2A 1B32A 5CMBA 3Q29A 1B9JA 1M5CA 3RN8A 1LGBC 1MY3A 3MWBA 1QVSA 4YU0A 3G3HA 1O7TA 3ILTB 4OXVA 2ONSA 4F39A 1XS5A 3RYAA 2UXAA 1SVXB 1DOTA 1FCKA 3TFLA 4F18A 3S9MC 4FORA 1Y1ZA 4I62A 5AA4A 2DXRA 3UORA 1UIVA 3N5LA 2R9JA 3W9WA 4F2QA 3IORA 5AA3A 1R9LA 4OEVA 4R74A 1JNFA 2I4BA 4QSEA 2I0BA 4NWCA 3ZSFA 1S50A 2X26A 1NH8A 1DPPA 3AXFA 4R6KA 1OQGA 3OMBA 2IA4A 5ISUA 3IK6B 1I6QA 3LVUA 4IGRA 2WOLA 3TTRA 4AQ4A 4QF9A 2NUVA 3EQ1A 3O29A 1A40A 3H06B 3P7IA 3CG1A 1B05A 3Q28A 2QRYA 4M1VA 4U2RA 1EZ9A 4GXSB 3A3CA 3QAXA 3UK4A 2ZYOA 1NKXA 3FIRA 1LCTA 3IOTA 3PUYE 3CVGA 3MVXA 2QS3A 5DT6A 4MBPA 3KG2A 4HTGA 5DVIA 1ZKBA 3EPEA 1NMUA 5DVFA 5AA2A 3H6VA 2XXHA 2Y7PA 5I58A 3B6QA 5DEXB 2V3TA 4TQUQ 4ELPA 2OWSA 4XKPA 2R6GE 1FTOA 2VGQA 3G3GA 3U72A 3ONMA 3Q26A 2B3FA 4G8NA 3E4RA 3DM0A 4XXUA 4OHNA 1B3FA 1B58A 3SESA 1ANFA 3TYHA 4GL8A 3LBSA 2DS9A 4U23A 3DRGA 3E9XA 2OLBA 3WAEA 2P1SA 1IITA 2Y7KA 5ITOA 3S4UA 3OO8A 5H8HA 4RXLA 4NF6B 3VE1B 5BWJA 1M5FA 4LP2B 1PBQA 4OFLA 4XKQA 4F3BA 3M3FA 5H8FA 3TCGA 1B7UA 1CB6A 4NF5A 1Y1MA 2HQ0A 2Z8EA 4XIGQ 5L9SA 1MQHA 3B6WA 4OMBA 1LB9A 3K6XA 3N26A 1RYXA 4EQBA 3FXRA 1QW0A 4TOZA 1LSTA 3O9PA 4R72A 1JETA 3C31A 5AA4B 2I3WA 2XHDA 5CM6A 2RCAA 4DCXA 1QKAA 4Q0CA 1MPDA 1MH3A 4Q5TA 4MF3A 1PC3A 4GF8A 3G3FA 1MXUA 2DE3A 3K6VA 3G3JA 4X48A 1M5DA 2Y7RA 1J1NA 1LLSA 2V3UA 2RF1A 4GVOA 4KD5A 3CRBA 4IO3A 1AMFA 3TTLA 4U1ZA 3JZJA 3ZKKA 4U4SA 5CC2A 1MXXA 4AB5A 1M5EA 1POY1 3PUWE 3U94A 3RTWB 4DCYA 2NOOA 3FXQA 4F1UA 1T0KA 3C36A 4OERA 2YLNA 3UP9A 1B5JA 1EZOA 3TQLA 4EDPA 1MQIA 1EH3A 1JEUA 3PMVA 3RGYA 5K2XA 4OQOA 4N13A 1MRPA 3IOUA 4U22A 2UVGA 2ZMBA 1UIUA 5AA2B 3TZAA 2RC8A 1MQJA 5I58B 3WAFA 4PFYA 4YB7A 4XKRA 1QKBA 4QRZA 1QUJA 3UIFA 3M3LA 5H8SA 4YKPA 2O7UA 2Z8FA 3IJOB 4MFIA 4IB2A 4BDOA 3OELA 3CFZA 3LSWA 1SI1A 2I6EA 3U8QA 1Q35A 1H44A 5KDTA 3PPPA 1MM7A 2PT2A 1FQAA 1NFTA 4JBZA 5I2KA 5H8HB 3O28A 4HCWA 3IO6A 2F5XA 3TELA 2RKMA 1D3KA 4IY5A 5H8FB 4YKIA 1MXVA 1QULA 2DE4A 3K1NA 4NF5B 1SDXA 3ZKLA 4WEPA 3VV5A 1NH7A 4ZECA 4O3AA 3FVNA 1FTLA 5CBSA 2E1SA 5CMMA 3GBBA 4H0WA 1I69A 1IZ1A 1ZMGA 4IY6A 4I9DA 4H5GA 2HZKA 3RQTA 2PYYA 5EHMA 2HXWA 4PFUA 3I5OA 1FTMA 4ELQA 2FYIA 2H4IA 3OXNA 1IEJA 1VFDA 2Q88A 2ONKE 3EN3A 5KZTA 4YAHX 3O66A 2DVCA 3KJTA 1GGGA 3VLVA 1N84A 2FNCA 2OK2A 1N3WA 5CMKA 4F1YA 3VXBA 2YPNA 3KSJA 5K2YA 1B4ZA 1FQBA 1JVYA 3MP1A 5EYFA 1ZTYA 4LUBA 1YPNA 3PUZE 4OWDA 3EHUA 3FJMA 4R2FA 1I6AA 1R1NA 1XVXA 5LOMA 4N07A 5I84A 1FQDA 1US5A 2DWJA 4G8MA 1FQCA 3G7WA 4RNSA 4EXKA 2H99A 1LAHE 3MC2A 3IB2A 2HZLA 1OIBA 4Z0IA 1YTVA 2D3IA 2DSFA 4G4PA 3ODBA 2Y7IA 1B3EA 3GLBA 2ZYNA 1H76A 4ZE8A 1LB8A 4ECFA 1I6BA 4KFQA 3H6WA 3MQ9A 3PAMA 2ABHA 3QIMA 1O63A 2ZNSA 5CMCA 2IEEA 4DXBA 1Q1KA 3IOWA 5KDTB 2ZYKA 1OLCA 2QL3A 3KZGA 4FJPA 4KCCA 3FVGA 3T9UA 5CRYA 1QUIA 5JEIA 4QFLA 4JB7A 5I2KB 1VE4A 2WKYA 2DVZA 2UVIA 2R71A 2I0CA 1LAXA 4FE8A 4MLVA 4ISUA 1GV8A 2NWJA 5FTHA 3KBRA 4TLMB 2HAUA 4GOTA 4KR5A 2OBGA 3FD3A 1A55A 3Q27A 1D9YA 3KN8A 3MUQA 4ZE9A 5I57A 3T66A 5AE4A 3R26A 3IL1B 1EZPA 4R6HA 1D9VA 4NF8A 1ZJLA 2Z22A 4XKNA 3PPNA 2GFEA 2PMSA 1HSLA 2ZXTA 2WOKA 2XD2A 2P2AA 2F34A 3PPOA 3DELB 4O3BA 4LZ5A 1PDAA 1N76A 2DP8A 4LZ8A 3S9LC 4JXIA 1LAFE 2H5YA 3KEIA 3RTFB 3HHGA 5BUUA 4DDDA 3QUJA 1IXGA 4G2ZA 2F36A 3H03A 5HPQA 5ICTA 1NNKA 5EHSA 4LZ7A 2F78A 1H45A 2QS2A 5L8DA 3CSGA 5I59A 1P1UA 4KCDA 4ELOA 3FJGA 2F97A 3O2AA 5DYHA 4NMYA 2O7IA 3CFLA 4NTLA 4JWYA 2XXPA 4YKKA 1PEBA 5IAIA 4POWA 4IO4A 4F22A 1IQ7A 3PGFA 2F6GA 3LSFB 2VD2A 4ZEKA 2UYFA 4OTEA 3IB0A 1A99A 2DWIA 1B5HA 3IR1A 4F19A 1A7LA 1N7XA 3TTNA 4KYDA 4NWDA 2F35A 3K6WA 1P1NA 5FTIA 2B4LA 3PUXE 2A5TA 4GLIA 4F3GA 4QFOA 3TMGA 1B2HA 4OYVA 3KFMA 3RNNA 2H9BA 3D4GA 1MH4A 3MAMA 4ZEDA 5ITPA 2ALUA 5L9MA 3SERA 3KSXA 3K01A 2QS1A 3PD8A 1MY4A 1MXZA 3PMXA 5FHMA 1TWYA 4DIGA 4U1OA 4YMAA 2D5WA 2Q9TA 3DRHA 3H3GA 1OQHA 1PBPA 2V3QA 3MZ1A 3N6TA 1A8FA 3BFTA 4RPOA 4U4XA 4RA1A 1URSA 3TPAA 4RYAA 3W15C 4F3PA 4QHQA 2AIXA 1AIVA 1MXYA 4LQ5A 1SI0A 3VFJA 4GFRA 2XXWA 4R9GA 5H8QA 2XD3A 2Q8JA 3TAJA 2FA7A 3KGCA 1GTKA 3FVKA 2XXIA 3A09A 3KOSA 3OENA 2QMXA 5KCJA 4G68A 5HM4B 1B46A 1TXFA 2LAOA 5I57B 1VR5A 5L9OA 1B7HA 3ECRA 4Q30B 4NF8B 2ONRA 2QPQA 3B7DA 2M8CA 3OO6A 2UYEA 2O1MA 1NNTA 3CSBA 1F9BA 3TKDA 2B3BA 3RT6B 2O1LA 4C1UA 3D4CA 4ND9A 1IIWA 2VHAA 2AYSA 4PP0A 3E3KA 2NXOA 2DXYA 2XXRA 4DE8A 4LONB 5B70A 1N04A 2QJEA 2Y7WA 4C0RA 3MPLA 4TLLB 4OFJA 1MPCA 3ZS6A 2G93A 1LFGA 1Z7ME 3OEMA 4H8IA 5AA2D 2DYXA 3FATA 4EQ7A 5I59B 1MDQA 4OENA 3QK6A 3HO7A 4MLQA 1VFEA 4X9TA 3SETA 4GD5A 5I2NA 3G3IA 1A8EA 2XXYA 3MP8A 5CI5A 3K1MA 3W9VA 2O51A 2RC9A 1N7WA 1ZBMA 5DTBA 4KYEA 2W7YA 4JDFA 2G29A 5I56A 2HEUA 3CR9A 1AH5A 3L6GA 2A5TB 1Y20A 3BBRA 2XXVA 3Q25A 3T22A 1B3LA 4DLDA 3DP6A 3TQWA 1R6ZA 1B4HA 4NF4A 4R9FA 2DOJA 2A5SA 4O3CA 4EF1A 3U93A 4QFNA 4EXLA 1MDP1 2I58A 4GWOA 1ZU0A 2AL4A 1Y3NA 2XX8A 2H25A 4R2BA 2VD3A 3K2DA 3SEWA 1N0TA 3K02A 3GBAA 3ILUB 3N94A 5ELVA 2DQVA 2O84X 1XT8A 5M2VA 2PX1A 3C35A 5H8QB 1RKMA 4H67A 4F1VA 1H43A 3QSLA 4GL0A 2ESNA 3USDA 1DPEA 4EQ9A 4YB5A 4M4GA 5KCJB 4G68B 4NE4A 1M5BA 2O69A 1S9TA 1MS7A 3FV1A 4OETA 1MQDA 3FVOA 2DWAA 3RY3A 1SW2A 1B52A 3MPKA 1BP5A 2XXQA 3TCHA 5FHOA 1QJMA 1DSNA 3H6TA 3H6UA 4OVJA 3SEVA 3CI8A 4P0IA 3U1OA 3JV9A 4F29A 3JYRA 3EHSA 2I3VA 4H1XA 1KWHA 1ELJA 3OO7A 5JK4A 3HV1A 1Y9UA 4K3FA 1MG1A 1IXIA 3C33A 2F7AA 2XXTA 5A5XA 3MZ9A 1BIYA 3DLNA 5ICQA 1Y4TA 3LUYA 4ZZAA 4HS7A 2UVHA 4UA8A 1UTBA 2O68A 3H7MA 3SEYA 3I6VA 3L6HA 2QMWA 3GZGA 1N3XA 3BKIB 5I2NB 4G8HA 3VDFA 1B0LA 5F7VA 1B1XA 2REGA 3GXAA 4WXJA 5H8NA 3K1PA 2Q2AA 4GXAA 1LCFA 4GQOA 2ZNTA 1JVXA 1FQEA 1BLFA 3R6UA 1Y3PA 3RPWA 1OVBA 1XOCA 1P1OA 4YB6A 1URGA 4P0GA 1O64A 5I56B 4EUOA 3O6IA 4BDNA 3OSRA 3DRKA 3S9NC 1B6HA 4G77A 2PBWA 3QXMA 4DXUA 3MW0A 3RYBA 4ESXA 4U21A 3TCFA 4NF4B 2OCUA 3G3KA 4OFOA 3K0VA 4IGTA 4I8CA 4HCYA 3CFXA 3IO4A 2THIA 1UTHB 3C34A 1US4A 3I3VA 4ELRA 4ZEBA 4QFPA 4E0WA 4KQPA 4LQ2A 4KI0E 4P11A 4DXCA 1MY2A 5TPAA 2VP1A 4R75A 3M8UA 3THIA 3PPQA 3K00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F11 A;  3V5A A;  2F6P A;  2RIN A;  5TU0 A;  3IX1 A;  3SEX A;  1XHY A;  1TFA A;  1Y3Q A;  1MXW A;  4MH5 A;  3C32 A;  2Q89 A;  5F1Q A;  4EF2 A;  4OES A;  3KN7 A;  1PB7 A;  1AL3 A;  4E0X A;  3FGS A;  4RK9 A;  4G68 C;  4ZDM A;  4H5F A;  1P1W A;  4DZ1 A;  3K4U A;  3OSQ A;  3DRF A;  3UGW A;  4PET A;  3PPR A;  2F7C A;  4THI A;  4QSC A;  1A54 A;  2NVU B;  3MVW A;  1JQF A;  4YKJ A;  1MY0 A;  4QFK A;  4NED A;  4RPN A;  4ZS9 A;  4C1T A;  2D21 A;  5A5X B;  3KN3 A;  2REJ A;  3TTM A;  2H98 A;  2RC7 A;  1URD A;  1JEV A;  3VXC A;  1B7Z A;  4JSD A;  4FIM A;  1B40 A;  3S2V A;  3DRI A;  4WED A;  4BDR A;  2CMO A;  1UTB B;  4LVQ A;  3T9H B;  2WOP A;  2QSX A;  4Q8R A;  3FTO A;  4OEU A;  2O6A A;  4KYS A;  2F8D A;  4FEB A;  2BJJ X;  4JWO A;  3MJN A;  5H8N B;  3CIJ A;  1NNP A;  1NNF A;  4PQJ A;  4FED A;  4R6Y A;  1DTG A;  4X1D A;  4FAT A;  1JW1 A;  3H4Z A;  3RT8 A;  2HAV A;  3VLW A;  4IO6 A;  3OD7 A;  2XXX A;  3T9X B;  1GVC A;  2OJT A;  2GH9 A;  4XTC Q;  4F3S A;  1IXC A;  3OEK A;  3SEU A;  3O6H A;  3LR1 A;  4KPT A;  2AL5 A;  1BTJ A;  1YAE A;  3PV0 E;  1B0H A;  1R9Q A;  1BKA A;  3T9V A;  1EU8 A;  1LBB A;  4KHZ E;  3UN6 A;  3PU5 A;  4WKM A;  1ZIU A;  4FAJ A;  1LFH A;  3IAZ A;  4ZEF A;  2YJP A;  1LBC A;  1LAG E;  2ZNU A;  3VVF A;  3FJ7 A;  2ANJ A;  1MQG A;  3IJX B;  4IO2 A;  1RYO A;  2UVJ A;  5HBC A;  2Y84 A;  3HPI A;  2P0S A;  3A3U A;  3SKP A;  5JTY A;  5TPA B;  3MBP A;  1WOD A;  1ATG A;  3QYT A;  1L5T A;  3CHG A;  2V25 A;  5FHN A;  1FQF A;  2DE2 A;  2I49 A;  4YZZ A;  1OVT A;  4JWX A;  5J1D A;  4F2O A;  1MY1 A;  3O97 A;  3RLF E;  3O6P A;  3MVZ A;  1WDN A;  1B1H A;  3MP6 A;  4FEC A;  1TFD A;  3SDF A;  3FZV A;  2GHB A;  1D4N A;  2X7P A;  2PVU A;  1GR2 A;  1SBP A;  3RUM A;  3LC8 A;  5IKB A;  3VVD A;  1POT A;  3OOA A;  3CG3 A;  3V8X B;  2E0S A;  4F31 B;  2OZZ A;  3VVE A;  4UAC A;  1XVY A;  1LFI A;  4IO7 A;  3TUS A;  1FTK A;  3V83 A;  5TP9 A;  4Z7E A;  1AOV A;  1DTZ A;  3B6T A;  4PE5 B;  1SQY A;  2HCA A;  3S9E A;  3IB1 A;  1XC1 A;  4ZEI A;  4LAT A;  1QUK A;  3MVY A;  4RY1 A;  3N6U A;  1SYI A;  2F7B A;  3HCQ A;  1SD3 A;  1YCJ A;  4BDL A;  1UQW A;  1B3H A;  3KJ7 A;  1B3G A;  1OMP A;  1P99 A;  4OZ9 A;  1FTJ A;  1PB8 A;  4AB6 A;  2X7Q A;  3DP4 A;  2CZL A;  3K6U A;  2RCB A;  3HN0 A;  1USY H;  4H8J A;  1JW4 A;  1B51 A;  1ZLQ A;  1UTH A;  4PFW A;  2Z8D A;  1P1Q A;  3T93 B;  3R7X A;  3C4M A;  1USY E;  5CBR A;  1VSO A;  2QS4 A;  3QUF A;  4L17 A;  3T96 B;  1FW0 A;  2PT1 A;  4QSD A;  2VOZ A;  2Z23 A;  1HSJ A;  4YIC A;  3DP8 A;  2I4C A;  3TOD A;  3M3K A;  3PMW A;  1PB9 A;  3OO9 A;  3EHT A;  4ESW A;  1SYH A;  5DVJ A;  3TTK A;  4R73 A;  2KLF A;  3MZB A;  2Q2C A;  4HW8 A;  1SW1 A;  3FUZ A;  4RJZ A;  5JTY B;  2V84 A;  4LA9 A;  3PUV E;  3E13 X;  3LSL A;  4ZZE A;  3FXU A;  4GIZ A;  2GRV A;  1JW5 A;  3C9H A;  2I48 A;  4BDQ A;  1MM6 A;  4BLA A;  4H65 A;  1IUD A;  1SW5 A;  3U92 A;  2B65 A;  4N6P A;  1WVJ A;  4YMB A;  3VLU A;  4POX A;  1MPB A;  2XX9 A;  1IXH A;  4PFT A;  3IOV A;  3DRJ A;  5AA1 A;  4I1D A;  3LSX A;  4JSO A;  1HSE A;  2GHA A;  4BDM A;  1NL5 A;  1CE2 A;  3O6G A;  3V89 B;  3UA8 A;  5DEX A;  4IO5 A;  3TDJ A;  1TT1 A;  1B5I A;  4X1B A;  3KOT A;  1II5 A;  3BFU A;  4ONY A;  4GRK A;  5TP9 B;  2DWH A;  4H6D A;  3HHF A;  1SW4 A;  2V93 A;  1S7Y A;  3TEP A;  3FAS A;  1OLA A;  2OWT A;  2XX7 A;  1H3D A;  2HFB A;  1Z7N E;  2ZYM A;  3HST A;  4RK2 A;  3EF7 A;  2XXU A;  5B7D A;  4NF6 A;  2B4M A;  1Y4C A;  1DMB A;  3PD9 A;  3FV2 A;  1B32 A;  5CMB A;  3Q29 A;  1B9J A;  1M5C A;  3RN8 A;  1LGB C;  1MY3 A;  3MWB A;  1QVS A;  4YU0 A;  3G3H A;  1O7T A;  3ILT B;  4OXV A;  2ONS A;  4F39 A;  1XS5 A;  3RYA A;  2UXA A;  1SVX B;  1DOT A;  1FCK A;  3TFL A;  4F18 A;  3S9M C;  4FOR A;  1Y1Z A;  4I62 A;  5AA4 A;  2DXR A;  3UOR A;  1UIV A;  3N5L A;  2R9J A;  3W9W A;  4F2Q A;  3IOR A;  5AA3 A;  1R9L A;  4OEV A;  4R74 A;  1JNF A;  2I4B A;  4QSE A;  2I0B A;  4NWC A;  3ZSF A;  1S50 A;  2X26 A;  1NH8 A;  1DPP A;  3AXF A;  4R6K A;  1OQG A;  3OMB A;  2IA4 A;  5ISU A;  3IK6 B;  1I6Q A;  3LVU A;  4IGR A;  2WOL A;  3TTR A;  4AQ4 A;  4QF9 A;  2NUV A;  3EQ1 A;  3O29 A;  1A40 A;  3H06 B;  3P7I A;  3CG1 A;  1B05 A;  3Q28 A;  2QRY A;  4M1V A;  4U2R A;  1EZ9 A;  4GXS B;  3A3C A;  3QAX A;  3UK4 A;  2ZYO A;  1NKX A;  3FIR A;  1LCT A;  3IOT A;  3PUY E;  3CVG A;  3MVX A;  2QS3 A;  5DT6 A;  4MBP A;  3KG2 A;  4HTG A;  5DVI A;  1ZKB A;  3EPE A;  1NMU A;  5DVF A;  5AA2 A;  3H6V A;  2XXH A;  2Y7P A;  5I58 A;  3B6Q A;  5DEX B;  2V3T A;  4TQU Q;  4ELP A;  2OWS A;  4XKP A;  2R6G E;  1FTO A;  2VGQ A;  3G3G A;  3U72 A;  3ONM A;  3Q26 A;  2B3F A;  4G8N A;  3E4R A;  3DM0 A;  4XXU A;  4OHN A;  1B3F A;  1B58 A;  3SES A;  1ANF A;  3TYH A;  4GL8 A;  3LBS A;  2DS9 A;  4U23 A;  3DRG A;  3E9X A;  2OLB A;  3WAE A;  2P1S A;  1IIT A;  2Y7K A;  5ITO A;  3S4U A;  3OO8 A;  5H8H A;  4RXL A;  4NF6 B;  3VE1 B;  5BWJ A;  1M5F A;  4LP2 B;  1PBQ A;  4OFL A;  4XKQ A;  4F3B A;  3M3F A;  5H8F A;  3TCG A;  1B7U A;  1CB6 A;  4NF5 A;  1Y1M A;  2HQ0 A;  2Z8E A;  4XIG Q;  5L9S A;  1MQH A;  3B6W A;  4OMB A;  1LB9 A;  3K6X A;  3N26 A;  1RYX A;  4EQB A;  3FXR A;  1QW0 A;  4TOZ A;  1LST A;  3O9P A;  4R72 A;  1JET A;  3C31 A;  5AA4 B;  2I3W A;  2XHD A;  5CM6 A;  2RCA A;  4DCX A;  1QKA A;  4Q0C A;  1MPD A;  1MH3 A;  4Q5T A;  4MF3 A;  1PC3 A;  4GF8 A;  3G3F A;  1MXU A;  2DE3 A;  3K6V A;  3G3J A;  4X48 A;  1M5D A;  2Y7R A;  1J1N A;  1LLS A;  2V3U A;  2RF1 A;  4GVO A;  4KD5 A;  3CRB A;  4IO3 A;  1AMF A;  3TTL A;  4U1Z A;  3JZJ A;  3ZKK A;  4U4S A;  5CC2 A;  1MXX A;  4AB5 A;  1M5E A;  1POY 1;  3PUW E;  3U94 A;  3RTW B;  4DCY A;  2NOO A;  3FXQ A;  4F1U A;  1T0K A;  3C36 A;  4OER A;  2YLN A;  3UP9 A;  1B5J A;  1EZO A;  3TQL A;  4EDP A;  1MQI A;  1EH3 A;  1JEU A;  3PMV A;  3RGY A;  5K2X A;  4OQO A;  4N13 A;  1MRP A;  3IOU A;  4U22 A;  2UVG A;  2ZMB A;  1UIU A;  5AA2 B;  3TZA A;  2RC8 A;  1MQJ A;  5I58 B;  3WAF A;  4PFY A;  4YB7 A;  4XKR A;  1QKB A;  4QRZ A;  1QUJ A;  3UIF A;  3M3L A;  5H8S A;  4YKP A;  2O7U A;  2Z8F A;  3IJO B;  4MFI A;  4IB2 A;  4BDO A;  3OEL A;  3CFZ A;  3LSW A;  1SI1 A;  2I6E A;  3U8Q A;  1Q35 A;  1H44 A;  5KDT A;  3PPP A;  1MM7 A;  2PT2 A;  1FQA A;  1NFT A;  4JBZ A;  5I2K A;  5H8H B;  3O28 A;  4HCW A;  3IO6 A;  2F5X A;  3TEL A;  2RKM A;  1D3K A;  4IY5 A;  5H8F B;  4YKI A;  1MXV A;  1QUL A;  2DE4 A;  3K1N A;  4NF5 B;  1SDX A;  3ZKL A;  4WEP A;  3VV5 A;  1NH7 A;  4ZEC A;  4O3A A;  3FVN A;  1FTL A;  5CBS A;  2E1S A;  5CMM A;  3GBB A;  4H0W A;  1I69 A;  1IZ1 A;  1ZMG A;  4IY6 A;  4I9D A;  4H5G A;  2HZK A;  3RQT A;  2PYY A;  5EHM A;  2HXW A;  4PFU A;  3I5O A;  1FTM A;  4ELQ A;  2FYI A;  2H4I A;  3OXN A;  1IEJ A;  1VFD A;  2Q88 A;  2ONK E;  3EN3 A;  5KZT A;  4YAH X;  3O66 A;  2DVC A;  3KJT A;  1GGG A;  3VLV A;  1N84 A;  2FNC A;  2OK2 A;  1N3W A;  5CMK A;  4F1Y A;  3VXB A;  2YPN A;  3KSJ A;  5K2Y A;  1B4Z A;  1FQB A;  1JVY A;  3MP1 A;  5EYF A;  1ZTY A;  4LUB A;  1YPN A;  3PUZ E;  4OWD A;  3EHU A;  3FJM A;  4R2F A;  1I6A A;  1R1N A;  1XVX A;  5LOM A;  4N07 A;  5I84 A;  1FQD A;  1US5 A;  2DWJ A;  4G8M A;  1FQC A;  3G7W A;  4RNS A;  4EXK A;  2H99 A;  1LAH E;  3MC2 A;  3IB2 A;  2HZL A;  1OIB A;  4Z0I A;  1YTV A;  2D3I A;  2DSF A;  4G4P A;  3ODB A;  2Y7I A;  1B3E A;  3GLB A;  2ZYN A;  1H76 A;  4ZE8 A;  1LB8 A;  4ECF A;  1I6B A;  4KFQ A;  3H6W A;  3MQ9 A;  3PAM A;  2ABH A;  3QIM A;  1O63 A;  2ZNS A;  5CMC A;  2IEE A;  4DXB A;  1Q1K A;  3IOW A;  5KDT B;  2ZYK A;  1OLC A;  2QL3 A;  3KZG A;  4FJP A;  4KCC A;  3FVG A;  3T9U A;  5CRY A;  1QUI A;  5JEI A;  4QFL A;  4JB7 A;  5I2K B;  1VE4 A;  2WKY A;  2DVZ A;  2UVI A;  2R71 A;  2I0C A;  1LAX A;  4FE8 A;  4MLV A;  4ISU A;  1GV8 A;  2NWJ A;  5FTH A;  3KBR A;  4TLM B;  2HAU A;  4GOT A;  4KR5 A;  2OBG A;  3FD3 A;  1A55 A;  3Q27 A;  1D9Y A;  3KN8 A;  3MUQ A;  4ZE9 A;  5I57 A;  3T66 A;  5AE4 A;  3R26 A;  3IL1 B;  1EZP A;  4R6H A;  1D9V A;  4NF8 A;  1ZJL A;  2Z22 A;  4XKN A;  3PPN A;  2GFE A;  2PMS A;  1HSL A;  2ZXT A;  2WOK A;  2XD2 A;  2P2A A;  2F34 A;  3PPO A;  3DEL B;  4O3B A;  4LZ5 A;  1PDA A;  1N76 A;  2DP8 A;  4LZ8 A;  3S9L C;  4JXI A;  1LAF E;  2H5Y A;  3KEI A;  3RTF B;  3HHG A;  5BUU A;  4DDD A;  3QUJ A;  1IXG A;  4G2Z A;  2F36 A;  3H03 A;  5HPQ A;  5ICT A;  1NNK A;  5EHS A;  4LZ7 A;  2F78 A;  1H45 A;  2QS2 A;  5L8D A;  3CSG A;  5I59 A;  1P1U A;  4KCD A;  4ELO A;  3FJG A;  2F97 A;  3O2A A;  5DYH A;  4NMY A;  2O7I A;  3CFL A;  4NTL A;  4JWY A;  2XXP A;  4YKK A;  1PEB A;  5IAI A;  4POW A;  4IO4 A;  4F22 A;  1IQ7 A;  3PGF A;  2F6G A;  3LSF B;  2VD2 A;  4ZEK A;  2UYF A;  4OTE A;  3IB0 A;  1A99 A;  2DWI A;  1B5H A;  3IR1 A;  4F19 A;  1A7L A;  1N7X A;  3TTN A;  4KYD A;  4NWD A;  2F35 A;  3K6W A;  1P1N A;  5FTI A;  2B4L A;  3PUX E;  2A5T A;  4GLI A;  4F3G A;  4QFO A;  3TMG A;  1B2H A;  4OYV A;  3KFM A;  3RNN A;  2H9B A;  3D4G A;  1MH4 A;  3MAM A;  4ZED A;  5ITP A;  2ALU A;  5L9M A;  3SER A;  3KSX A;  3K01 A;  2QS1 A;  3PD8 A;  1MY4 A;  1MXZ A;  3PMX A;  5FHM A;  1TWY A;  4DIG A;  4U1O A;  4YMA A;  2D5W A;  2Q9T A;  3DRH A;  3H3G A;  1OQH A;  1PBP A;  2V3Q A;  3MZ1 A;  3N6T A;  1A8F A;  3BFT A;  4RPO A;  4U4X A;  4RA1 A;  1URS A;  3TPA A;  4RYA A;  3W15 C;  4F3P A;  4QHQ A;  2AIX A;  1AIV A;  1MXY A;  4LQ5 A;  1SI0 A;  3VFJ A;  4GFR A;  2XXW A;  4R9G A;  5H8Q A;  2XD3 A;  2Q8J A;  3TAJ A;  2FA7 A;  3KGC A;  1GTK A;  3FVK A;  2XXI A;  3A09 A;  3KOS A;  3OEN A;  2QMX A;  5KCJ A;  4G68 A;  5HM4 B;  1B46 A;  1TXF A;  2LAO A;  5I57 B;  1VR5 A;  5L9O A;  1B7H A;  3ECR A;  4Q30 B;  4NF8 B;  2ONR A;  2QPQ A;  3B7D A;  2M8C A;  3OO6 A;  2UYE A;  2O1M A;  1NNT A;  3CSB A;  1F9B A;  3TKD A;  2B3B A;  3RT6 B;  2O1L A;  4C1U A;  3D4C A;  4ND9 A;  1IIW A;  2VHA A;  2AYS A;  4PP0 A;  3E3K A;  2NXO A;  2DXY A;  2XXR A;  4DE8 A;  4LON B;  5B70 A;  1N04 A;  2QJE A;  2Y7W A;  4C0R A;  3MPL A;  4TLL B;  4OFJ A;  1MPC A;  3ZS6 A;  2G93 A;  1LFG A;  1Z7M E;  3OEM A;  4H8I A;  5AA2 D;  2DYX A;  3FAT A;  4EQ7 A;  5I59 B;  1MDQ A;  4OEN A;  3QK6 A;  3HO7 A;  4MLQ A;  1VFE A;  4X9T A;  3SET A;  4GD5 A;  5I2N A;  3G3I A;  1A8E A;  2XXY A;  3MP8 A;  5CI5 A;  3K1M A;  3W9V A;  2O51 A;  2RC9 A;  1N7W A;  1ZBM A;  5DTB A;  4KYE A;  2W7Y A;  4JDF A;  2G29 A;  5I56 A;  2HEU A;  3CR9 A;  1AH5 A;  3L6G A;  2A5T B;  1Y20 A;  3BBR A;  2XXV A;  3Q25 A;  3T22 A;  1B3L A;  4DLD A;  3DP6 A;  3TQW A;  1R6Z A;  1B4H A;  4NF4 A;  4R9F A;  2DOJ A;  2A5S A;  4O3C A;  4EF1 A;  3U93 A;  4QFN A;  4EXL A;  1MDP 1;  2I58 A;  4GWO A;  1ZU0 A;  2AL4 A;  1Y3N A;  2XX8 A;  2H25 A;  4R2B A;  2VD3 A;  3K2D A;  3SEW A;  1N0T A;  3K02 A;  3GBA A;  3ILU B;  3N94 A;  5ELV A;  2DQV A;  2O84 X;  1XT8 A;  5M2V A;  2PX1 A;  3C35 A;  5H8Q B;  1RKM A;  4H67 A;  4F1V A;  1H43 A;  3QSL A;  4GL0 A;  2ESN A;  3USD A;  1DPE A;  4EQ9 A;  4YB5 A;  4M4G A;  5KCJ B;  4G68 B;  4NE4 A;  1M5B A;  2O69 A;  1S9T A;  1MS7 A;  3FV1 A;  4OET A;  1MQD A;  3FVO A;  2DWA A;  3RY3 A;  1SW2 A;  1B52 A;  3MPK A;  1BP5 A;  2XXQ A;  3TCH A;  5FHO A;  1QJM A;  1DSN A;  3H6T A;  3H6U A;  4OVJ A;  3SEV A;  3CI8 A;  4P0I A;  3U1O A;  3JV9 A;  4F29 A;  3JYR A;  3EHS A;  2I3V A;  4H1X A;  1KWH A;  1ELJ A;  3OO7 A;  5JK4 A;  3HV1 A;  1Y9U A;  4K3F A;  1MG1 A;  1IXI A;  3C33 A;  2F7A A;  2XXT A;  5A5X A;  3MZ9 A;  1BIY A;  3DLN A;  5ICQ A;  1Y4T A;  3LUY A;  4ZZA A;  4HS7 A;  2UVH A;  4UA8 A;  1UTB A;  2O68 A;  3H7M A;  3SEY A;  3I6V A;  3L6H A;  2QMW A;  3GZG A;  1N3X A;  3BKI B;  5I2N B;  4G8H A;  3VDF A;  1B0L A;  5F7V A;  1B1X A;  2REG A;  3GXA A;  4WXJ A;  5H8N A;  3K1P A;  2Q2A A;  4GXA A;  1LCF A;  4GQO A;  2ZNT A;  1JVX A;  1FQE A;  1BLF A;  3R6U A;  1Y3P A;  3RPW A;  1OVB A;  1XOC A;  1P1O A;  4YB6 A;  1URG A;  4P0G A;  1O64 A;  5I56 B;  4EUO A;  3O6I A;  4BDN A;  3OSR A;  3DRK A;  3S9N C;  1B6H A;  4G77 A;  2PBW A;  3QXM A;  4DXU A;  3MW0 A;  3RYB A;  4ESX A;  4U21 A;  3TCF A;  4NF4 B;  2OCU A;  3G3K A;  4OFO A;  3K0V A;  4IGT A;  4I8C A;  4HCY A;  3CFX A;  3IO4 A;  2THI A;  1UTH B;  3C34 A;  1US4 A;  3I3V A;  4ELR A;  4ZEB A;  4QFP A;  4E0W A;  4KQP A;  4LQ2 A;  4KI0 E;  4P11 A;  4DXC A;  1MY2 A;  5TPA A;  2VP1 A;  4R75 A;  3M8U A;  3THI A;  3PPQ A;  3K00 A; 
#chains in the Genus database with same CATH topology
 2CEX A;  3F11 A;  3V5A A;  2F6P A;  2RIN A;  5TU0 A;  3IX1 A;  3SEX A;  1XHY A;  1TFA A;  1Y3Q A;  1MXW A;  4MH5 A;  3C32 A;  2Q89 A;  1EYJ A;  5F1Q A;  4EF2 A;  4OES A;  2HPG A;  1LBZ A;  1JP4 A;  3KN7 A;  5I5P A;  1PB7 A;  2Q74 A;  1AL3 A;  4E0X A;  4PC9 A;  3FGS A;  3GYY A;  5J16 A;  4O94 A;  4RK9 A;  4G68 C;  4ZDM A;  3BIH A;  4H5F A;  1P1W A;  4DZ1 A;  4XEQ A;  1SPI A;  3K4U A;  5IZ3 B;  3OSQ A;  3DRF A;  3UGW A;  3KBZ A;  4PET A;  4PGN A;  3PPR A;  5EQA A;  2F7C A;  4THI A;  4QSC A;  1A54 A;  2NVU B;  3FBP A;  1NUY A;  3MVW A;  1JQF A;  4GWW A;  4YKJ A;  1MY0 A;  4QFK A;  4NED A;  4P1L A;  4RPN A;  4ZS9 A;  4C1T A;  2D21 A;  5A5X B;  3KN3 A;  2REJ A;  3TTM A;  2H98 A;  2RC7 A;  1URD A;  1JEV A;  3VXC A;  1B7Z A;  4JSD A;  4FIM A;  1D9Q A;  4N8Y A;  4PBQ A;  1B40 A;  3S2V A;  3DRI A;  4WED A;  4BDR A;  2CMO A;  1UTB B;  4LVQ A;  3T9H B;  2WOP A;  2QSX A;  4Q8R A;  3FTO A;  4OEU A;  2O6A A;  4KYS A;  1NUW A;  2F8D A;  4FEB A;  2KR0 A;  2BJJ X;  4JWO A;  3MJN A;  5H8N B;  2XWO A;  3CIJ A;  1NNP A;  3MYU A;  1NNF A;  4PQJ A;  4FED A;  4R6Y A;  1DTG A;  5ET6 A;  4X1D A;  4FAT A;  1JW1 A;  3H4Z A;  3RT8 A;  2HAV A;  3VLW A;  4IO6 A;  3OD7 A;  2XXX A;  4NF0 A;  3T9X B;  1GVC A;  2OJT A;  2WEF A;  2GH9 A;  4XTC Q;  4F3S A;  1IXC A;  3OEK A;  3SEU A;  3O6H A;  3LR1 A;  4KPT A;  2AL5 A;  1BTJ A;  1YAE A;  3PV0 E;  1B0H A;  4P1E A;  1R9Q A;  1BKA A;  3T9V A;  1EU8 A;  1LBB A;  4KHZ E;  3UN6 A;  3PU5 A;  4WKM A;  1ZIU A;  4FAJ A;  1LFH A;  3IAZ A;  4ZEF A;  2YJP A;  1LBC A;  1LAG E;  2ZNU A;  3EKI A;  4N81 A;  3VVF A;  3FJ7 A;  2ANJ A;  1MQG A;  3IJX B;  4IO2 A;  1RYO A;  4I40 A;  2FBP A;  3RYD A;  4N8G A;  2UVJ A;  5HBC A;  2Y84 A;  3HPI A;  2P0S A;  3A3U A;  3SKP A;  4QXD A;  5JTY A;  5TPA B;  3MBP A;  1WOD A;  1ATG A;  3QYT A;  1L5T A;  3CHG A;  2V25 A;  5FHN A;  1FQF A;  3HFU A;  2DE2 A;  2I49 A;  4YZZ A;  4GWU A;  1OVT A;  4JWX A;  5J1D A;  4F2O A;  1MY1 A;  3B8B A;  2ZZV A;  3O97 A;  3RLF E;  3O6P A;  1NV0 A;  3MVZ A;  2P3V A;  1FTA A;  1WDN A;  1B1H A;  3MP6 A;  1RDX A;  4FEC A;  1TFD A;  3SDF A;  3FZV A;  2GHB A;  1D4N A;  2X7P A;  1IMC A;  4P47 A;  2PVU A;  1GR2 A;  1SBP A;  3RUM A;  2V4C A;  3LC8 A;  5IKB A;  3VVD A;  1POT A;  3OOA A;  4NN3 A;  3CG3 A;  2E0S A;  3V8X B;  2OZZ A;  2CEY A;  3VVE A;  4F31 B;  4UAC A;  1XVY A;  1LFI A;  4OA4 A;  4IO7 A;  3TUS A;  1FTK A;  3V83 A;  5TP9 A;  2PCR A;  4Z7E A;  4N17 A;  1AOV A;  1DTZ A;  3B6T A;  4PE5 B;  4MNI A;  1SQY A;  2HCA A;  3S9E A;  3IB1 A;  1XC1 A;  4ZEI A;  4LAT A;  1QUK A;  3MVY A;  4RY1 A;  3N6U A;  1SYI A;  2F7B A;  3HCQ A;  1SD3 A;  1YCJ A;  4P8B A;  4P3L A;  4BDL A;  4O8M A;  1UQW A;  1B3H A;  3KJ7 A;  1B3G A;  1OMP A;  1NV5 A;  1P99 A;  4OZ9 A;  4N4U A;  4LN5 A;  1FTJ A;  1PB8 A;  4AB6 A;  2X7Q A;  3DP4 A;  2CZL A;  3K6U A;  4G61 A;  2RCB A;  3HN0 A;  4PF6 A;  1USY H;  4H8J A;  1JW4 A;  1B51 A;  1ZLQ A;  1UTH A;  4PFW A;  2Z8D A;  1P1Q A;  3T93 B;  3R7X A;  3C4M A;  1USY E;  5CBR A;  1VSO A;  2QS4 A;  3QUF A;  1G0I A;  4L17 A;  3T96 B;  1FW0 A;  2PT1 A;  4QSD A;  2VOZ A;  4NAP A;  2Z23 A;  1HSJ A;  4YIC A;  3DP8 A;  2I4C A;  3TOD A;  3M3K A;  3PMW A;  1PB9 A;  3OO9 A;  3EHT A;  4ESW A;  1SYH A;  5DVJ A;  3TTK A;  3T1B A;  4R73 A;  2KLF A;  3MZB A;  2Q2C A;  4HW8 A;  1SW1 A;  3FUZ A;  4RJZ A;  5JTY B;  2V84 A;  2GQ1 A;  4LA9 A;  2Y5K A;  3PUV E;  3E13 X;  3LSL A;  4H45 A;  4ZZE A;  3E78 A;  3FXU A;  4GIZ A;  2GRV A;  4PCD A;  1JW5 A;  3C9H A;  2I48 A;  4BDQ A;  1YXI A;  1KA1 A;  1MM6 A;  4BLA A;  4H65 A;  1IUD A;  1SW5 A;  3U92 A;  2B65 A;  4N6P A;  1WVJ A;  4OVR A;  4YMB A;  3VLU A;  4POX A;  1MPB A;  2XX9 A;  1IXH A;  4PFT A;  3IOV A;  1NV2 A;  3DRJ A;  4I1D A;  5AA1 A;  3LSX A;  2OWZ A;  4MNC A;  4JSO A;  1HSE A;  2GHA A;  4BDM A;  1NL5 A;  1CE2 A;  3O6G A;  3V89 B;  3UA8 A;  5DEX A;  4IO5 A;  3TDJ A;  5I3S A;  1TT1 A;  1B5I A;  4X1B A;  3KOT A;  1II5 A;  3BFU A;  4ONY A;  2QVR A;  4GRK A;  5TP9 B;  2DWH A;  4H6D A;  3HHF A;  1SW4 A;  2WBB A;  2V93 A;  1S7Y A;  3TEP A;  3FAS A;  1OLA A;  2OWT A;  2XX7 A;  1H3D A;  2HFB A;  1Z7N E;  2ZYM A;  3HST A;  2KQZ A;  4RK2 A;  3EF7 A;  2XXU A;  5B7D A;  4NF6 A;  2B4M A;  1DK4 A;  4HE1 A;  1Y4C A;  2R8T A;  3B50 A;  1XI6 A;  1DMB A;  3PD9 A;  3FV2 A;  1B32 A;  5CMB A;  3Q29 A;  1B9J A;  1IME A;  1M5C A;  3RN8 A;  1LGB C;  1MY3 A;  3MWB A;  1QVS A;  4NGU A;  4YU0 A;  3G3H A;  1O7T A;  3ILT B;  4OXV A;  2ONS A;  4F39 A;  1XS5 A;  2JJK A;  3RYA A;  2UXA A;  1SVX B;  1DOT A;  1FCK A;  3TFL A;  4F18 A;  3S9M C;  4FOR A;  1Y1Z A;  4I62 A;  5AA4 A;  4QBA A;  2DXR A;  1NV6 A;  3UOR A;  1UIV A;  3N5L A;  2R9J A;  3W9W A;  5EYH A;  4F2Q A;  3IOR A;  5AA3 A;  1R9L A;  3IFC A;  4OEV A;  4R74 A;  1JNF A;  2I4B A;  4QSE A;  1LEV A;  2I0B A;  4NWC A;  3ZSF A;  1S50 A;  2X26 A;  1DCU A;  1NH8 A;  1DPP A;  3AXF A;  4R6K A;  1BK4 A;  1OQG A;  3OMB A;  2IA4 A;  4GWZ A;  5ISU A;  3IK6 B;  1I6Q A;  3LVU A;  4IGR A;  2WOL A;  3TTR A;  4AQ4 A;  4QF9 A;  2NUV A;  3EQ1 A;  3O29 A;  1A40 A;  2MKZ A;  3H06 B;  3P7I A;  3CG1 A;  1B05 A;  3Q28 A;  2QRY A;  4M1V A;  4U2R A;  1EZ9 A;  4GXS B;  1FPG A;  4GWY A;  3A3C A;  3QAX A;  3UK4 A;  2ZYO A;  1NKX A;  1IMB A;  3FIR A;  4X04 A;  2QVV A;  1LCT A;  3IOT A;  4PAK A;  3PUY E;  3CVG A;  3MVX A;  2QS3 A;  5DT6 A;  4MBP A;  3KG2 A;  4HTG A;  2VPO A;  5DVI A;  1ZKB A;  3EPE A;  1FBC A;  1NMU A;  5DVF A;  5AA2 A;  4HXV A;  3H6V A;  3U65 A;  2XXH A;  2Y7P A;  5I58 A;  3B6Q A;  5DEX B;  2V3T A;  4TQU Q;  4ELP A;  2OWS A;  4XKP A;  2R6G E;  4PFI A;  1FTO A;  2VGQ A;  2Q8M A;  3G3G A;  4N15 A;  3U72 A;  3ONM A;  3Q26 A;  2B3F A;  4G8N A;  3E4R A;  1RDY A;  2VT5 A;  3DM0 A;  4XXU A;  4OHN A;  1B3F A;  1B58 A;  3SES A;  1ANF A;  3TYH A;  4GL8 A;  3LBS A;  2DS9 A;  4U23 A;  3DRG A;  4I3Y A;  3E9X A;  4H46 A;  2OLB A;  3WAE A;  2P1S A;  1IIT A;  2Y7K A;  5ITO A;  3S4U A;  3OO8 A;  2CZH A;  1LBV A;  1NV7 A;  5H8H A;  5I7I A;  4RXL A;  4NF6 B;  3VE1 B;  1YYZ A;  5BWJ A;  1M5F A;  4LP2 B;  1PBQ A;  4OFL A;  4XKQ A;  4F3B A;  3M3F A;  4N91 A;  5H8F A;  3TCG A;  1B7U A;  1CB6 A;  4MMP A;  4NF5 A;  4AS5 A;  1Y1M A;  2HQ0 A;  5LDZ A;  2Z8E A;  1FPL A;  2WX9 A;  4XIG Q;  5L9S A;  1MQH A;  3B6W A;  4OMB A;  1LB9 A;  1NV3 A;  3K6X A;  3N26 A;  1RYX A;  4EQB A;  3FXR A;  4PE3 A;  3LV0 A;  1QW0 A;  1LST A;  4TOZ A;  3O9P A;  4R72 A;  1JET A;  3C31 A;  5AA4 B;  2I3W A;  2XHD A;  5CM6 A;  2HHM A;  2RCA A;  4DCX A;  1QKA A;  4Q0C A;  1MPD A;  1MH3 A;  4Q5T A;  4PTK A;  4MF3 A;  1PC3 A;  4GF8 A;  3G3F A;  1MXU A;  2DE3 A;  3K6V A;  2OX3 A;  3G3J A;  1RDZ A;  4X48 A;  1M5D A;  2Y7R A;  1J1N A;  1LLS A;  2V3U A;  2RF1 A;  4GVO A;  4KD5 A;  3CRB A;  4IO3 A;  1AMF A;  3TTL A;  2QVU A;  4U1Z A;  3JZJ A;  3ZKK A;  4U4S A;  5CC2 A;  1MXX A;  5T3J A;  4AB5 A;  1M5E A;  1POY 1;  3PUW E;  5ESY A;  4OVT A;  3U94 A;  3RTW B;  4DCY A;  2NOO A;  3FXQ A;  4GWS A;  2ZZW A;  4F1U A;  1T0K A;  3C36 A;  1FBH A;  4OER A;  2YLN A;  4OVP A;  3UP9 A;  1B5J A;  1EZO A;  3TQL A;  4EDP A;  1MQI A;  1EH3 A;  2FIX A;  3RPL A;  4PAF A;  1FPE A;  1JEU A;  1Q9D A;  3PMV A;  3RGY A;  5K2X A;  4OQO A;  4N13 A;  1MRP A;  3IOU A;  4U22 A;  2UVG A;  2ZMB A;  1UIU A;  5AA2 B;  3TZA A;  2RC8 A;  1MQJ A;  5I58 B;  3WAF A;  4PFY A;  4YB7 A;  4XKR A;  3ROJ A;  5DW8 A;  1QKB A;  4QRZ A;  1QUJ A;  3UIF A;  3M3L A;  5H8S A;  4YKP A;  2O7U A;  2Z8F A;  4MNP A;  2XWI A;  3IJO B;  4MFI A;  4NQ8 A;  4IB2 A;  4BDO A;  3OEL A;  3CFZ A;  3LSW A;  1SI1 A;  2I6E A;  3U8Q A;  1Q35 A;  1H44 A;  5KDT A;  3PPP A;  1FSA A;  1MM7 A;  2PT2 A;  4MIJ A;  1FQA A;  1NFT A;  4JBZ A;  2DDK A;  3ISP A;  1FBF A;  3MST A;  5H8H B;  3O28 A;  5I2K A;  4HCW A;  3IO6 A;  2F5X A;  4HE0 A;  5ET5 A;  3TEL A;  2RKM A;  1D3K A;  4IY5 A;  5H8F B;  4YKI A;  1MXV A;  4FBP A;  1QUL A;  2PFY A;  2DE4 A;  1AWB A;  3NOH A;  3K1N A;  4NF5 B;  1FPB A;  1SDX A;  3ZKL A;  4GWX A;  4WEP A;  3VV5 A;  2XWK A;  1NH7 A;  4ZEC A;  4O3A A;  3FVN A;  2WYP A;  1FTL A;  4HE2 A;  5CBS A;  2E1S A;  4PDH A;  5IZZ A;  5CMM A;  3GBB A;  4H0W A;  1I69 A;  1IZ1 A;  1ZMG A;  4IY6 A;  4I9D A;  4H5G A;  2ZZX A;  2HZK A;  3RQT A;  2PYY A;  1FJ9 A;  5EHM A;  2HXW A;  4PFU A;  5EQ9 A;  3I5O A;  1FTM A;  4ELQ A;  2FYI A;  2H4I A;  5ET8 A;  3OXN A;  1IEJ A;  1VFD A;  2Q88 A;  2ONK E;  3EN3 A;  5KZT A;  1FPF A;  4MCO A;  3O66 A;  4YAH X;  2DVC A;  3KJT A;  1GGG A;  3VLV A;  1N84 A;  2FNC A;  2OK2 A;  1N3W A;  5CMK A;  2PFZ A;  4F1Y A;  3VXB A;  2XA5 A;  2YPN A;  3SZP A;  3KSJ A;  5EQ8 A;  5K2Y A;  1B4Z A;  1FQB A;  4MHF A;  1JVY A;  3MP1 A;  5EYF A;  1ZTY A;  4LUB A;  1YPN A;  3PUZ E;  4OWD A;  3EHU A;  3FJM A;  4R2F A;  1I6A A;  1R1N A;  1XVX A;  5LOM A;  4N07 A;  5I84 A;  1FQD A;  1US5 A;  3RPL B;  2DWJ A;  4G8M A;  1FPI A;  1FQC A;  3G7W A;  4RNS A;  1YZ0 A;  4EXK A;  2H99 A;  1LAH E;  3MC2 A;  3IB2 A;  2HZL A;  1OIB A;  4Z0I A;  1IMF A;  1YTV A;  2D3I A;  5EYG A;  2DSF A;  4G4P A;  3ODB A;  2Y7I A;  1B3E A;  3GLB A;  2ZYN A;  1H76 A;  4ZE8 A;  1LB8 A;  4ECF A;  1I6B A;  1K9Y A;  4KFQ A;  3T0J A;  3H6W A;  3MQ9 A;  3PAM A;  2ABH A;  3QIM A;  1O63 A;  4GBV A;  2ZNS A;  3PTY A;  1K9Z A;  5CMC A;  2IEE A;  4DXB A;  1Q1K A;  4AS4 A;  3IOW A;  5KDT B;  2ZYK A;  1OLC A;  2QL3 A;  3LUZ A;  3KZG A;  4FJP A;  4KCC A;  3FVG A;  3T9U A;  5CRY A;  4OVQ A;  4NX1 A;  1QUI A;  5JEI A;  4QFL A;  4JB7 A;  5I2K B;  1VE4 A;  2WKY A;  2DVZ A;  2UVI A;  4XFE A;  2R71 A;  2I0C A;  1LAX A;  2L5V A;  4FE8 A;  4MLV A;  4ISU A;  1GV8 A;  2NWJ A;  4PGP A;  5FTH A;  3KBR A;  4TLM B;  2HAU A;  4GOT A;  4KR5 A;  2OBG A;  3FD3 A;  1A55 A;  3Q27 A;  1D9Y A;  3KN8 A;  3MUQ A;  4ZE9 A;  5I57 A;  3T66 A;  5AE4 A;  3R26 A;  3IL1 B;  1EZP A;  4R6H A;  1D9V A;  4NF8 A;  1ZJL A;  2Z22 A;  1FPD A;  4XKN A;  3PPN A;  2GFE A;  2CZK A;  2PMS A;  1HSL A;  2ZXT A;  2WOK A;  2XD2 A;  2P2A A;  2F34 A;  3PPO A;  3DEL B;  4O3B A;  4LZ5 A;  1PDA A;  1N76 A;  1IMD A;  2DP8 A;  4LZ8 A;  3S9L C;  4JXI A;  1LAF E;  2H5Y A;  3KEI A;  3RTF B;  3HHG A;  5BUU A;  4DDD A;  3QUJ A;  1IXG A;  4G2Z A;  2F36 A;  3H03 A;  5HPQ A;  5ICT A;  1NNK A;  2FIE A;  5EHS A;  4LZ7 A;  2F78 A;  1H45 A;  2QS2 A;  5L8D A;  3CSG A;  5I59 A;  3D1R A;  1P1U A;  4I3E A;  4KCD A;  4ELO A;  3FJG A;  4PDD A;  2F97 A;  3O2A A;  5DYH A;  4NMY A;  2O7I A;  3CFL A;  4NTL A;  4JWY A;  2XXP A;  1NUZ A;  4YKK A;  1PEB A;  5IAI A;  4MAG A;  4POW A;  4IO4 A;  4F22 A;  1IQ7 A;  3PGF A;  2F6G A;  3LSF B;  2VD2 A;  4ZEK A;  2UYF A;  4OTE A;  3IB0 A;  1A99 A;  1FBD A;  2DWI A;  1B5H A;  3IR1 A;  4F19 A;  2WBD A;  4IR8 A;  1A7L A;  1N7X A;  3TTN A;  4KYD A;  4NWD A;  2F35 A;  3K6W A;  1P1N A;  5FTI A;  2B4L A;  3PUX E;  3E79 A;  1IMA A;  2A5T A;  4GLI A;  4F3G A;  4QFO A;  3TMG A;  1B2H A;  4OYV A;  3BIG A;  3KFM A;  3RNN A;  2H9B A;  3D4G A;  1MH4 A;  3MAM A;  4ZED A;  5ITP A;  2ALU A;  5L9M A;  3SER A;  3KSX A;  3K01 A;  2QS1 A;  2QFL A;  4X8R A;  3PD8 A;  1MY4 A;  1MXZ A;  4N6D A;  3PMX A;  5FHM A;  1TWY A;  4DIG A;  4U1O A;  5IM2 A;  4YMA A;  2D5W A;  2Q9T A;  3DRH A;  2F3D A;  3H3G A;  1OQH A;  1PBP A;  2F3B A;  2V3Q A;  3MZ1 A;  3N6T A;  1A8F A;  3BFT A;  4RPO A;  4U4X A;  4RA1 A;  1URS A;  3TPA A;  4RYA A;  3IFA A;  3W15 C;  4F3P A;  4QHQ A;  2AIX A;  1AIV A;  1MXY A;  4LQ5 A;  1SI0 A;  3VFJ A;  4GFR A;  2XXW A;  4R9G A;  5H8Q A;  2XD3 A;  2Q8J A;  1VDW A;  3TAJ A;  1QGX A;  2FA7 A;  3KGC A;  1GTK A;  3FVK A;  2FVZ A;  2XXI A;  3A09 A;  3KOS A;  3OEN A;  2QMX A;  5KCJ A;  4G68 A;  5HM4 B;  1B46 A;  1TXF A;  2LAO A;  5I57 B;  1VR5 A;  5L9O A;  1B7H A;  4MX6 A;  3ECR A;  4Q30 B;  4NF8 B;  2ONR A;  4DI3 D;  3QMF A;  2QPQ A;  3B7D A;  2M8C A;  3OO6 A;  4PFB A;  2UYE A;  1NI9 A;  2O1M A;  1NNT A;  3CSB A;  3FXB A;  1F9B A;  3TKD A;  2B3B A;  3RT6 B;  2CZI A;  2O1L A;  4C1U A;  3D4C A;  4ND9 A;  1IIW A;  2VHA A;  2AYS A;  5IZ1 A;  4PP0 A;  3E3K A;  3KC1 A;  2NXO A;  2DXY A;  2XXR A;  4DE8 A;  4LON B;  1FBE A;  1LBY A;  5B70 A;  1N04 A;  2QJE A;  2Y7W A;  4MJO A;  4C0R A;  1KZ8 A;  3MPL A;  4TLL B;  4GX4 A;  4OFJ A;  1DBZ A;  1MPC A;  3ZS6 A;  1EYK A;  2G93 A;  1LFG A;  1Z7M E;  3OEM A;  4H8I A;  5AA2 D;  2DYX A;  3FAT A;  1NV4 A;  4EQ7 A;  5I59 B;  1MDQ A;  4OEN A;  3QK6 A;  3HO7 A;  4MLQ A;  1VFE A;  4X9T A;  3SET A;  2HXR A;  4GD5 A;  4NG7 A;  4GX6 A;  5I2N A;  3G3I A;  1A8E A;  5A5L A;  2XXY A;  3MP8 A;  5CI5 A;  3K1M A;  3W9V A;  4GBW A;  2O51 A;  2RC9 A;  5F24 A;  3KC0 A;  1N7W A;  4O7M A;  1NUX A;  1ZBM A;  5DTB A;  5EQ7 A;  4KYE A;  2W7Y A;  4JDF A;  2G29 A;  5I56 A;  2HEU A;  3CR9 A;  1AH5 A;  3L6G A;  2A5T B;  1Y20 A;  4MEV A;  3BBR A;  2XXV A;  3Q25 A;  3T22 A;  2P3N A;  1B3L A;  4DLD A;  3DP6 A;  1CNQ A;  3TQW A;  4NHB A;  1FPJ A;  1R6Z A;  1B4H A;  4NF4 A;  4R9F A;  2DOJ A;  2A5S A;  4O3C A;  4EF1 A;  3U93 A;  4QFN A;  4EXL A;  1MDP 1;  2I58 A;  4GWO A;  1ZU0 A;  2AL4 A;  1Y3N A;  1FRP A;  4PAI A;  2XX8 A;  1EYI A;  2H25 A;  4R2B A;  2VD3 A;  3K2D A;  3SEW A;  1N0T A;  3K02 A;  3GBA A;  3ILU B;  3N94 A;  5ELV A;  2DQV A;  2O84 X;  1XT8 A;  4GX3 A;  5M2V A;  2PX1 A;  1INP A;  3C35 A;  5H8Q B;  1RKM A;  5IGA A;  1FBP A;  2BJI A;  4H67 A;  4F1V A;  1H43 A;  3QSL A;  4GL0 A;  2ESN A;  3USD A;  1DPE A;  4EQ9 A;  4YB5 A;  4M4G A;  5KCJ B;  5FBP A;  4G68 B;  4NE4 A;  4PBH A;  1M5B A;  2O69 A;  1LBW A;  4JVI A;  1S9T A;  1MS7 A;  3FV1 A;  4OET A;  1MQD A;  3FVO A;  2XWV A;  4OAN A;  2DWA A;  3RY3 A;  2XXK A;  1SW2 A;  1B52 A;  3MPK A;  1BP5 A;  2XXQ A;  3TCH A;  5FHO A;  1QJM A;  1DSN A;  3H6T A;  3H6U A;  4OVJ A;  3SEV A;  5IZ3 A;  3CI8 A;  4P0I A;  3U1O A;  3JV9 A;  4JVD A;  4F29 A;  3JYR A;  3EHS A;  2I3V A;  4H1X A;  1KWH A;  2WYK A;  1ELJ A;  3OO7 A;  5JK4 A;  3HV1 A;  1Y9U A;  4K3F A;  1MG1 A;  1IXI A;  3C33 A;  2F7A A;  2XXT A;  4JVC A;  5A5X A;  3MZ9 A;  4UAB A;  1BIY A;  3DLN A;  5ICQ A;  1Y4T A;  3LUY A;  4ZZA A;  4HS7 A;  2UVH A;  4UA8 A;  4KXP A;  1UTB A;  2O68 A;  3H7M A;  3SEY A;  3I6V A;  3L6H A;  1FJ6 A;  2QMW A;  3GZG A;  1N3X A;  1NV1 A;  3BKI B;  5I2N B;  4G8H A;  3VDF A;  1B0L A;  5F7V A;  4P9K A;  1B1X A;  2REG A;  3GXA A;  4WXJ A;  5H8N A;  3K1P A;  2Q2A A;  4GXA A;  1LCF A;  4GQO A;  2ZNT A;  1JVX A;  1FQE A;  1BLF A;  4P56 A;  3R6U A;  1Y3P A;  3RPW A;  1OVB A;  1XOC A;  1FPK A;  1P1O A;  4YB6 A;  1LBX A;  4OVS A;  4DI4 B;  1URG A;  4P0G A;  2VPN A;  1O64 A;  1KA0 A;  5I56 B;  4EUO A;  3O6I A;  4PF8 A;  4BDN A;  3OSR A;  3DRK A;  3S9N C;  5LTC A;  1B6H A;  4G77 A;  2PBW A;  3QXM A;  4DXU A;  3MW0 A;  2Y5L A;  3RYB A;  4ESX A;  4U21 A;  3TCF A;  4NF4 B;  2OCU A;  3G3K A;  4OFO A;  3K0V A;  4IGT A;  4I8C A;  4HCY A;  1FBG A;  4PFR A;  4N6K A;  3CFX A;  3IO4 A;  2THI A;  1UTH B;  3C34 A;  1US4 A;  1G0H A;  2FHY A;  3I3V A;  3A29 A;  4ELR A;  4ZEB A;  4QFP A;  4E0W A;  4KQP A;  4LQ2 A;  4KI0 E;  4XF5 A;  4P11 A;  4DXC A;  1MY2 A;  5TPA A;  5ET7 A;  2VP1 A;  4R75 A;  3M8U A;  3THI A;  4O7I A;  3PPQ A;  3K00 A; 
#chains in the Genus database with same CATH homology
 3F11 A;  3V5A A;  2F6P A;  2RIN A;  5TU0 A;  3IX1 A;  3SEX A;  1XHY A;  1TFA A;  1Y3Q A;  1MXW A;  4MH5 A;  3C32 A;  2Q89 A;  5F1Q A;  4EF2 A;  4OES A;  3KN7 A;  1PB7 A;  1AL3 A;  4E0X A;  3FGS A;  4RK9 A;  4G68 C;  4ZDM A;  4H5F A;  1P1W A;  4DZ1 A;  3K4U A;  3OSQ A;  3DRF A;  3UGW A;  4PET A;  3PPR A;  2F7C A;  4THI A;  4QSC A;  1A54 A;  2NVU B;  3MVW A;  1JQF A;  4YKJ A;  1MY0 A;  4QFK A;  4NED A;  4RPN A;  4ZS9 A;  4C1T A;  2D21 A;  5A5X B;  3KN3 A;  2REJ A;  3TTM A;  2H98 A;  2RC7 A;  1URD A;  1JEV A;  3VXC A;  1B7Z A;  4JSD A;  4FIM A;  1B40 A;  3S2V A;  3DRI A;  4WED A;  4BDR A;  2CMO A;  1UTB B;  4LVQ A;  3T9H B;  2WOP A;  2QSX A;  4Q8R A;  3FTO A;  4OEU A;  2O6A A;  4KYS A;  2F8D A;  4FEB A;  2BJJ X;  4JWO A;  3MJN A;  5H8N B;  3CIJ A;  1NNP A;  1NNF A;  4PQJ A;  4FED A;  4R6Y A;  1DTG A;  4X1D A;  4FAT A;  1JW1 A;  3H4Z A;  3RT8 A;  2HAV A;  3VLW A;  4IO6 A;  3OD7 A;  2XXX A;  3T9X B;  1GVC A;  2OJT A;  2GH9 A;  4XTC Q;  4F3S A;  1IXC A;  3OEK A;  3SEU A;  3O6H A;  3LR1 A;  4KPT A;  2AL5 A;  1BTJ A;  1YAE A;  3PV0 E;  1B0H A;  1R9Q A;  1BKA A;  3T9V A;  1EU8 A;  1LBB A;  4KHZ E;  3UN6 A;  3PU5 A;  4WKM A;  1ZIU A;  4FAJ A;  1LFH A;  3IAZ A;  4ZEF A;  2YJP A;  1LBC A;  1LAG E;  2ZNU A;  3VVF A;  3FJ7 A;  2ANJ A;  1MQG A;  3IJX B;  4IO2 A;  1RYO A;  2UVJ A;  5HBC A;  2Y84 A;  3HPI A;  2P0S A;  3A3U A;  3SKP A;  5JTY A;  5TPA B;  3MBP A;  1WOD A;  1ATG A;  3QYT A;  1L5T A;  3CHG A;  2V25 A;  5FHN A;  1FQF A;  2DE2 A;  2I49 A;  4YZZ A;  1OVT A;  4JWX A;  5J1D A;  4F2O A;  1MY1 A;  3O97 A;  3RLF E;  3O6P A;  3MVZ A;  1WDN A;  1B1H A;  3MP6 A;  4FEC A;  1TFD A;  3SDF A;  3FZV A;  2GHB A;  1D4N A;  2X7P A;  2PVU A;  1GR2 A;  1SBP A;  3RUM A;  3LC8 A;  5IKB A;  3VVD A;  1POT A;  3OOA A;  3CG3 A;  3V8X B;  2E0S A;  4F31 B;  2OZZ A;  3VVE A;  4UAC A;  1XVY A;  1LFI A;  4IO7 A;  3TUS A;  1FTK A;  3V83 A;  5TP9 A;  4Z7E A;  1AOV A;  1DTZ A;  3B6T A;  4PE5 B;  1SQY A;  2HCA A;  3S9E A;  3IB1 A;  1XC1 A;  4ZEI A;  4LAT A;  1QUK A;  3MVY A;  4RY1 A;  3N6U A;  1SYI A;  2F7B A;  3HCQ A;  1SD3 A;  1YCJ A;  4BDL A;  1UQW A;  1B3H A;  3KJ7 A;  1B3G A;  1OMP A;  1P99 A;  4OZ9 A;  1FTJ A;  1PB8 A;  4AB6 A;  2X7Q A;  3DP4 A;  2CZL A;  3K6U A;  2RCB A;  3HN0 A;  1USY H;  4H8J A;  1JW4 A;  1B51 A;  1ZLQ A;  1UTH A;  4PFW A;  2Z8D A;  1P1Q A;  3T93 B;  3R7X A;  3C4M A;  1USY E;  5CBR A;  1VSO A;  2QS4 A;  3QUF A;  4L17 A;  3T96 B;  1FW0 A;  2PT1 A;  4QSD A;  2VOZ A;  2Z23 A;  1HSJ A;  4YIC A;  3DP8 A;  2I4C A;  3TOD A;  3M3K A;  3PMW A;  1PB9 A;  3OO9 A;  3EHT A;  4ESW A;  1SYH A;  5DVJ A;  3TTK A;  4R73 A;  2KLF A;  3MZB A;  2Q2C A;  4HW8 A;  1SW1 A;  3FUZ A;  4RJZ A;  5JTY B;  2V84 A;  4LA9 A;  3PUV E;  3E13 X;  3LSL A;  4ZZE A;  3FXU A;  4GIZ A;  2GRV A;  1JW5 A;  3C9H A;  2I48 A;  4BDQ A;  1MM6 A;  4BLA A;  4H65 A;  1IUD A;  1SW5 A;  3U92 A;  2B65 A;  4N6P A;  1WVJ A;  4YMB A;  3VLU A;  4POX A;  1MPB A;  2XX9 A;  1IXH A;  4PFT A;  3IOV A;  3DRJ A;  5AA1 A;  4I1D A;  3LSX A;  4JSO A;  1HSE A;  2GHA A;  4BDM A;  1NL5 A;  1CE2 A;  3O6G A;  3V89 B;  3UA8 A;  5DEX A;  4IO5 A;  3TDJ A;  1TT1 A;  1B5I A;  4X1B A;  3KOT A;  1II5 A;  3BFU A;  4ONY A;  4GRK A;  5TP9 B;  2DWH A;  4H6D A;  3HHF A;  1SW4 A;  2V93 A;  1S7Y A;  3TEP A;  3FAS A;  1OLA A;  2OWT A;  2XX7 A;  1H3D A;  2HFB A;  1Z7N E;  2ZYM A;  3HST A;  4RK2 A;  3EF7 A;  2XXU A;  5B7D A;  4NF6 A;  2B4M A;  1Y4C A;  1DMB A;  3PD9 A;  3FV2 A;  1B32 A;  5CMB A;  3Q29 A;  1B9J A;  1M5C A;  3RN8 A;  1LGB C;  1MY3 A;  3MWB A;  1QVS A;  4YU0 A;  3G3H A;  1O7T A;  3ILT B;  4OXV A;  2ONS A;  4F39 A;  1XS5 A;  3RYA A;  2UXA A;  1SVX B;  1DOT A;  1FCK A;  3TFL A;  4F18 A;  3S9M C;  4FOR A;  1Y1Z A;  4I62 A;  5AA4 A;  2DXR A;  3UOR A;  1UIV A;  3N5L A;  2R9J A;  3W9W A;  4F2Q A;  3IOR A;  5AA3 A;  1R9L A;  4OEV A;  4R74 A;  1JNF A;  2I4B A;  4QSE A;  2I0B A;  4NWC A;  3ZSF A;  1S50 A;  2X26 A;  1NH8 A;  1DPP A;  3AXF A;  4R6K A;  1OQG A;  3OMB A;  2IA4 A;  5ISU A;  3IK6 B;  1I6Q A;  3LVU A;  4IGR A;  2WOL A;  3TTR A;  4AQ4 A;  4QF9 A;  2NUV A;  3EQ1 A;  3O29 A;  1A40 A;  3H06 B;  3P7I A;  3CG1 A;  1B05 A;  3Q28 A;  2QRY A;  4M1V A;  4U2R A;  1EZ9 A;  4GXS B;  3A3C A;  3QAX A;  3UK4 A;  2ZYO A;  1NKX A;  3FIR A;  1LCT A;  3IOT A;  3PUY E;  3CVG A;  3MVX A;  2QS3 A;  5DT6 A;  4MBP A;  3KG2 A;  4HTG A;  5DVI A;  1ZKB A;  3EPE A;  1NMU A;  5DVF A;  5AA2 A;  3H6V A;  2XXH A;  2Y7P A;  5I58 A;  3B6Q A;  5DEX B;  2V3T A;  4TQU Q;  4ELP A;  2OWS A;  4XKP A;  2R6G E;  1FTO A;  2VGQ A;  3G3G A;  3U72 A;  3ONM A;  3Q26 A;  2B3F A;  4G8N A;  3E4R A;  3DM0 A;  4XXU A;  4OHN A;  1B3F A;  1B58 A;  3SES A;  1ANF A;  3TYH A;  4GL8 A;  3LBS A;  2DS9 A;  4U23 A;  3DRG A;  3E9X A;  2OLB A;  3WAE A;  2P1S A;  1IIT A;  2Y7K A;  5ITO A;  3S4U A;  3OO8 A;  5H8H A;  4RXL A;  4NF6 B;  3VE1 B;  5BWJ A;  1M5F A;  4LP2 B;  1PBQ A;  4OFL A;  4XKQ A;  4F3B A;  3M3F A;  5H8F A;  3TCG A;  1B7U A;  1CB6 A;  4NF5 A;  1Y1M A;  2HQ0 A;  2Z8E A;  4XIG Q;  5L9S A;  1MQH A;  3B6W A;  4OMB A;  1LB9 A;  3K6X A;  3N26 A;  1RYX A;  4EQB A;  3FXR A;  1QW0 A;  4TOZ A;  1LST A;  3O9P A;  4R72 A;  1JET A;  3C31 A;  5AA4 B;  2I3W A;  2XHD A;  5CM6 A;  2RCA A;  4DCX A;  1QKA A;  4Q0C A;  1MPD A;  1MH3 A;  4Q5T A;  4MF3 A;  1PC3 A;  4GF8 A;  3G3F A;  1MXU A;  2DE3 A;  3K6V A;  3G3J A;  4X48 A;  1M5D A;  2Y7R A;  1J1N A;  1LLS A;  2V3U A;  2RF1 A;  4GVO A;  4KD5 A;  3CRB A;  4IO3 A;  1AMF A;  3TTL A;  4U1Z A;  3JZJ A;  3ZKK A;  4U4S A;  5CC2 A;  1MXX A;  4AB5 A;  1M5E A;  1POY 1;  3PUW E;  3U94 A;  3RTW B;  4DCY A;  2NOO A;  3FXQ A;  4F1U A;  1T0K A;  3C36 A;  4OER A;  2YLN A;  3UP9 A;  1B5J A;  1EZO A;  3TQL A;  4EDP A;  1MQI A;  1EH3 A;  1JEU A;  3PMV A;  3RGY A;  5K2X A;  4OQO A;  4N13 A;  1MRP A;  3IOU A;  4U22 A;  2UVG A;  2ZMB A;  1UIU A;  5AA2 B;  3TZA A;  2RC8 A;  1MQJ A;  5I58 B;  3WAF A;  4PFY A;  4YB7 A;  4XKR A;  1QKB A;  4QRZ A;  1QUJ A;  3UIF A;  3M3L A;  5H8S A;  4YKP A;  2O7U A;  2Z8F A;  3IJO B;  4MFI A;  4IB2 A;  4BDO A;  3OEL A;  3CFZ A;  3LSW A;  1SI1 A;  2I6E A;  3U8Q A;  1Q35 A;  1H44 A;  5KDT A;  3PPP A;  1MM7 A;  2PT2 A;  1FQA A;  1NFT A;  4JBZ A;  5I2K A;  5H8H B;  3O28 A;  4HCW A;  3IO6 A;  2F5X A;  3TEL A;  2RKM A;  1D3K A;  4IY5 A;  5H8F B;  4YKI A;  1MXV A;  1QUL A;  2DE4 A;  3K1N A;  4NF5 B;  1SDX A;  3ZKL A;  4WEP A;  3VV5 A;  1NH7 A;  4ZEC A;  4O3A A;  3FVN A;  1FTL A;  5CBS A;  2E1S A;  5CMM A;  3GBB A;  4H0W A;  1I69 A;  1IZ1 A;  1ZMG A;  4IY6 A;  4I9D A;  4H5G A;  2HZK A;  3RQT A;  2PYY A;  5EHM A;  2HXW A;  4PFU A;  3I5O A;  1FTM A;  4ELQ A;  2FYI A;  2H4I A;  3OXN A;  1IEJ A;  1VFD A;  2Q88 A;  2ONK E;  3EN3 A;  5KZT A;  4YAH X;  3O66 A;  2DVC A;  3KJT A;  1GGG A;  3VLV A;  1N84 A;  2FNC A;  2OK2 A;  1N3W A;  5CMK A;  4F1Y A;  3VXB A;  2YPN A;  3KSJ A;  5K2Y A;  1B4Z A;  1FQB A;  1JVY A;  3MP1 A;  5EYF A;  1ZTY A;  4LUB A;  1YPN A;  3PUZ E;  4OWD A;  3EHU A;  3FJM A;  4R2F A;  1I6A A;  1R1N A;  1XVX A;  5LOM A;  4N07 A;  5I84 A;  1FQD A;  1US5 A;  2DWJ A;  4G8M A;  1FQC A;  3G7W A;  4RNS A;  4EXK A;  2H99 A;  1LAH E;  3MC2 A;  3IB2 A;  2HZL A;  1OIB A;  4Z0I A;  1YTV A;  2D3I A;  2DSF A;  4G4P A;  3ODB A;  2Y7I A;  1B3E A;  3GLB A;  2ZYN A;  1H76 A;  4ZE8 A;  1LB8 A;  4ECF A;  1I6B A;  4KFQ A;  3H6W A;  3MQ9 A;  3PAM A;  2ABH A;  3QIM A;  1O63 A;  2ZNS A;  5CMC A;  2IEE A;  4DXB A;  1Q1K A;  3IOW A;  5KDT B;  2ZYK A;  1OLC A;  2QL3 A;  3KZG A;  4FJP A;  4KCC A;  3FVG A;  3T9U A;  5CRY A;  1QUI A;  5JEI A;  4QFL A;  4JB7 A;  5I2K B;  1VE4 A;  2WKY A;  2DVZ A;  2UVI A;  2R71 A;  2I0C A;  1LAX A;  4FE8 A;  4MLV A;  4ISU A;  1GV8 A;  2NWJ A;  5FTH A;  3KBR A;  4TLM B;  2HAU A;  4GOT A;  4KR5 A;  2OBG A;  3FD3 A;  1A55 A;  3Q27 A;  1D9Y A;  3KN8 A;  3MUQ A;  4ZE9 A;  5I57 A;  3T66 A;  5AE4 A;  3R26 A;  3IL1 B;  1EZP A;  4R6H A;  1D9V A;  4NF8 A;  1ZJL A;  2Z22 A;  4XKN A;  3PPN A;  2GFE A;  2PMS A;  1HSL A;  2ZXT A;  2WOK A;  2XD2 A;  2P2A A;  2F34 A;  3PPO A;  3DEL B;  4O3B A;  4LZ5 A;  1PDA A;  1N76 A;  2DP8 A;  4LZ8 A;  3S9L C;  4JXI A;  1LAF E;  2H5Y A;  3KEI A;  3RTF B;  3HHG A;  5BUU A;  4DDD A;  3QUJ A;  1IXG A;  4G2Z A;  2F36 A;  3H03 A;  5HPQ A;  5ICT A;  1NNK A;  5EHS A;  4LZ7 A;  2F78 A;  1H45 A;  2QS2 A;  5L8D A;  3CSG A;  5I59 A;  1P1U A;  4KCD A;  4ELO A;  3FJG A;  2F97 A;  3O2A A;  5DYH A;  4NMY A;  2O7I A;  3CFL A;  4NTL A;  4JWY A;  2XXP A;  4YKK A;  1PEB A;  5IAI A;  4POW A;  4IO4 A;  4F22 A;  1IQ7 A;  3PGF A;  2F6G A;  3LSF B;  2VD2 A;  4ZEK A;  2UYF A;  4OTE A;  3IB0 A;  1A99 A;  2DWI A;  1B5H A;  3IR1 A;  4F19 A;  1A7L A;  1N7X A;  3TTN A;  4KYD A;  4NWD A;  2F35 A;  3K6W A;  1P1N A;  5FTI A;  2B4L A;  3PUX E;  2A5T A;  4GLI A;  4F3G A;  4QFO A;  3TMG A;  1B2H A;  4OYV A;  3KFM A;  3RNN A;  2H9B A;  3D4G A;  1MH4 A;  3MAM A;  4ZED A;  5ITP A;  2ALU A;  5L9M A;  3SER A;  3KSX A;  3K01 A;  2QS1 A;  3PD8 A;  1MY4 A;  1MXZ A;  3PMX A;  5FHM A;  1TWY A;  4DIG A;  4U1O A;  4YMA A;  2D5W A;  2Q9T A;  3DRH A;  3H3G A;  1OQH A;  1PBP A;  2V3Q A;  3MZ1 A;  3N6T A;  1A8F A;  3BFT A;  4RPO A;  4U4X A;  4RA1 A;  1URS A;  3TPA A;  4RYA A;  3W15 C;  4F3P A;  4QHQ A;  2AIX A;  1AIV A;  1MXY A;  4LQ5 A;  1SI0 A;  3VFJ A;  4GFR A;  2XXW A;  4R9G A;  5H8Q A;  2XD3 A;  2Q8J A;  3TAJ A;  2FA7 A;  3KGC A;  1GTK A;  3FVK A;  2XXI A;  3A09 A;  3KOS A;  3OEN A;  2QMX A;  5KCJ A;  4G68 A;  5HM4 B;  1B46 A;  1TXF A;  2LAO A;  5I57 B;  1VR5 A;  5L9O A;  1B7H A;  3ECR A;  4Q30 B;  4NF8 B;  2ONR A;  2QPQ A;  3B7D A;  2M8C A;  3OO6 A;  2UYE A;  2O1M A;  1NNT A;  3CSB A;  1F9B A;  3TKD A;  2B3B A;  3RT6 B;  2O1L A;  4C1U A;  3D4C A;  4ND9 A;  1IIW A;  2VHA A;  2AYS A;  4PP0 A;  3E3K A;  2NXO A;  2DXY A;  2XXR A;  4DE8 A;  4LON B;  5B70 A;  1N04 A;  2QJE A;  2Y7W A;  4C0R A;  3MPL A;  4TLL B;  4OFJ A;  1MPC A;  3ZS6 A;  2G93 A;  1LFG A;  1Z7M E;  3OEM A;  4H8I A;  5AA2 D;  2DYX A;  3FAT A;  4EQ7 A;  5I59 B;  1MDQ A;  4OEN A;  3QK6 A;  3HO7 A;  4MLQ A;  1VFE A;  4X9T A;  3SET A;  4GD5 A;  5I2N A;  3G3I A;  1A8E A;  2XXY A;  3MP8 A;  5CI5 A;  3K1M A;  3W9V A;  2O51 A;  2RC9 A;  1N7W A;  1ZBM A;  5DTB A;  4KYE A;  2W7Y A;  4JDF A;  2G29 A;  5I56 A;  2HEU A;  3CR9 A;  1AH5 A;  3L6G A;  2A5T B;  1Y20 A;  3BBR A;  2XXV A;  3Q25 A;  3T22 A;  1B3L A;  4DLD A;  3DP6 A;  3TQW A;  1R6Z A;  1B4H A;  4NF4 A;  4R9F A;  2DOJ A;  2A5S A;  4O3C A;  4EF1 A;  3U93 A;  4QFN A;  4EXL A;  1MDP 1;  2I58 A;  4GWO A;  1ZU0 A;  2AL4 A;  1Y3N A;  2XX8 A;  2H25 A;  4R2B A;  2VD3 A;  3K2D A;  3SEW A;  1N0T A;  3K02 A;  3GBA A;  3ILU B;  3N94 A;  5ELV A;  2DQV A;  2O84 X;  1XT8 A;  5M2V A;  2PX1 A;  3C35 A;  5H8Q B;  1RKM A;  4H67 A;  4F1V A;  1H43 A;  3QSL A;  4GL0 A;  2ESN A;  3USD A;  1DPE A;  4EQ9 A;  4YB5 A;  4M4G A;  5KCJ B;  4G68 B;  4NE4 A;  1M5B A;  2O69 A;  1S9T A;  1MS7 A;  3FV1 A;  4OET A;  1MQD A;  3FVO A;  2DWA A;  3RY3 A;  1SW2 A;  1B52 A;  3MPK A;  1BP5 A;  2XXQ A;  3TCH A;  5FHO A;  1QJM A;  1DSN A;  3H6T A;  3H6U A;  4OVJ A;  3SEV A;  3CI8 A;  4P0I A;  3U1O A;  3JV9 A;  4F29 A;  3JYR A;  3EHS A;  2I3V A;  4H1X A;  1KWH A;  1ELJ A;  3OO7 A;  5JK4 A;  3HV1 A;  1Y9U A;  4K3F A;  1MG1 A;  1IXI A;  3C33 A;  2F7A A;  2XXT A;  5A5X A;  3MZ9 A;  1BIY A;  3DLN A;  5ICQ A;  1Y4T A;  3LUY A;  4ZZA A;  4HS7 A;  2UVH A;  4UA8 A;  1UTB A;  2O68 A;  3H7M A;  3SEY A;  3I6V A;  3L6H A;  2QMW A;  3GZG A;  1N3X A;  3BKI B;  5I2N B;  4G8H A;  3VDF A;  1B0L A;  5F7V A;  1B1X A;  2REG A;  3GXA A;  4WXJ A;  5H8N A;  3K1P A;  2Q2A A;  4GXA A;  1LCF A;  4GQO A;  2ZNT A;  1JVX A;  1FQE A;  1BLF A;  3R6U A;  1Y3P A;  3RPW A;  1OVB A;  1XOC A;  1P1O A;  4YB6 A;  1URG A;  4P0G A;  1O64 A;  5I56 B;  4EUO A;  3O6I A;  4BDN A;  3OSR A;  3DRK A;  3S9N C;  1B6H A;  4G77 A;  2PBW A;  3QXM A;  4DXU A;  3MW0 A;  3RYB A;  4ESX A;  4U21 A;  3TCF A;  4NF4 B;  2OCU A;  3G3K A;  4OFO A;  3K0V A;  4IGT A;  4I8C A;  4HCY A;  3CFX A;  3IO4 A;  2THI A;  1UTH B;  3C34 A;  1US4 A;  3I3V A;  4ELR A;  4ZEB A;  4QFP A;  4E0W A;  4KQP A;  4LQ2 A;  4KI0 E;  4P11 A;  4DXC A;  1MY2 A;  5TPA A;  2VP1 A;  4R75 A;  3M8U A;  3THI A;  3PPQ A;  3K00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...