1JEVA

Oligo-peptide binding protein (oppa) complexed with kwk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The role of water in sequence-independent ligand binding by an oligopeptide transporter protein.
pubmed doi rcsb
molecule tags Complex (peptide transport/peptide)
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1996-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1jevA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jevA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1jevA02
1XS5A 2B65A 3W9WA 2CZLA 4Z0IA 4H65A 2D3IA 5KCJA 4TQUQ 1XC1A 1QKAA 3KN3A 4Q0CA 1UQWA 4QFPA 1ZTYA 1B0LA 1M5EA 4G2ZA 1KWHA 1UTHA 4GXAA 1B4HA 5CMBA 1LBCA 3T9XB 4F3SA 1IXIA 1SDXA 2FYIA 3CSBA 4G77A 5ITOA 1R9LA 3G3IA 3IOUA 3A3CA 1FTKA 1R6ZA 5CMMA 4UA8A 1DTGA 2F5XA 4R6KA 4YU0A 5CRYA 2F97A 4DXUA 4OMBA 3TQLA 1MQJA 5B7DA 2GHBA 1SYIA 3HV1A 1NNFA 3TTRA 1SW2A 4QRZA 3VLWA 4P0GA 5H8FA 4H0WA 1WVJA 3BFUA 1LCFA 1MY1A 1B3LA 2B3FA 3JV9A 3K6WA 3O66A 1FQCA 4FIMA 1MH3A 1PBQA 2QSXA 3N94A 2I4BA 4JWOA 3SDFA 4QFOA 3H6WA 3SEUA 1J1NA 3CFZA 2RC8A 4GQOA 4R9GA 3LSWA 3IOVA 3RTWB 2UYFA 4ZZAA 1RKMA 4PFUA 4HCYA 4NF5A 2OWSA 4IO3A 2HQ0A 4QFLA 3C36A 2ZNTA 3KSJA 3WAFA 4F29A 3DP8A 3B6WA 1ATGA 3FVGA 3K00A 3MJNA 5L9SA 1H3DA 3MAMA 2UXAA 3ILUB 1B3GA 3H6UA 1B7ZA 2YJPA 4Q8RA 2GHAA 2HCAA 3IB2A 3KG2A 1YPNA 4POWA 3K4UA 1ZLQA 3Q27A 3MC2A 5FHMA 1B3EA 3C32A 2BJJX 1IXGA 1LAHE 4F3GA 5A5XA 3LSXA 1ELJA 3MVWA 3OSQA 4YKIA 5DEXA 5J1DA 3DRIA 2ONSA 1B0HA 4RK2A 4U1ZA 3MVXA 4F39A 1LFHA 1JW4A 4OYVA 2QJEA 3TFLA 1I69A 1ZJLA 3OELA 3U94A 4NEDA 3MZ1A 2Q2CA 4OHNA 3DM0A 4ESXA 4BDQA 4JWYA 1BKAA 3RTFB 2ZYKA 3UP9A 2RC7A 5H8NB 3KJTA 2THIA 5IAIA 4U23A 1TFAA 4YB5A 4HW8A 2I6EA 2O6AA 3FXUA 5H8NA 1Y1MA 2O51A 3TUSA 4FEBA 1O64A 4KYEA 3MW0A 1N0TA 3BBRA 1IXHA 3ZS6A 3FASA 4RPOA 1OVTA 5CMCA 4NF4B 4BDRA 4I9DA 2F78A 3MUQA 2Y7IA 4MF3A 4R72A 4H8IA 2WOLA 1N3WA 1FQEA 3I3VA 2M8CA 4BDOA 5A5XB 4F22A 3MQ9A 1R1NA 4R6YA 2UVGA 3IOTA 2I4CA 4MLQA 4RXLA 4YMAA 1Z7ME 4LZ8A 4LZ7A 1VE4A 2UVHA 3QUFA 1F9BA 3TTMA 1DOTA 3V5AA 5KCJB 5EHMA 2P1SA 4PETA 3MVZA 2ONRA 1FTOA 1SI0A 2I3VA 5TPAB 1FQBA 1FTJA 1PDAA 4N07A 4MFIA 4EDPA 1B58A 4NWCA 4OXVA 3GXAA 1YCJA 3ILTB 4H5GA 3DP6A 3TZAA 1EH3A 3GZGA 3MPKA 3VXCA 2P0SA 1MXWA 5F1QA 2XXIA 5I2KB 2V3UA 4F3BA 4YKPA 1Y4TA 3CIJA 3OMBA 1LAFE 5I84A 4LZ5A 2XXYA 3CFLA 4OERA 2DWIA 2XX8A 3EHSA 2XD3A 1POTA 3IJXB 3K0VA 4EQBA 3OO6A 5EHSA 3HHGA 1XOCA 2R71A 3KSXA 3LSFB 2F36A 3E3KA 2AL5A 1SW5A 3TEPA 1B1HA 4ZEKA 4ZEDA 5I56B 2PMSA 1RYOA 5K2XA 4NF6A 4X1BA 4ISUA 1VFDA 2O69A 5TU0A 3SETA 2HFBA 4DZ1A 3O6HA 5I56A 1B3FA 4GLIA 3MZBA 2OCUA 1OQGA 3EN3A 4GWOA 1A40A 3OO7A 4G68B 4F2QA 3O6PA 4XKRA 5M2VA 4OEVA 1UTBA 3QAXA 5ELVA 4PE5B 4XIGQ 1IXCA 3IAZA 5ICTA 2DOJA 4IO2A 2ZYMA 3ECRA 3PU5A 1URDA 1Y3QA 2FA7A 4ESWA 1GTKA 2RINA 5I2NB 2VP1A 1DTZA 3S9MC 1ZU0A 2B4MA 3KN8A 1FTMA 4NMYA 2XXWA 4IY6A 4UACA 4F3PA 3V8XB 4EXKA 1NMUA 2Y84A 3E4RA 3JYRA 2DXRA 1US4A 3ODBA 4GIZA 1GVCA 1OIBA 4U4SA 1Z7NE 5ISUA 2D5WA 2XXXA 4GD5A 3MWBA 5AA2A 1PB9A 5AA4A 1XVYA 4BLAA 1MDQA 2G29A 1Q1KA 3M3LA 3RGYA 4ZS9A 4KPTA 5DEXB 4F1YA 2WKYA 1URSA 4DLDA 4M4GA 4XXUA 1B51A 1O7TA 3IO6A 4GOTA 1MM6A 3O6IA 2XXPA 2ZNSA 5DYHA 3H3GA 3MP6A 4OFJA 2O1LA 1MY2A 1URGA 2VD2A 4I1DA 1P1UA 4OQOA 1FW0A 3DRHA 3PPRA 3K01A 2DVZA 4GF8A 4U1OA 1M5FA 2NUVA 4JDFA 1XVXA 4U21A 1ANFA 3QIMA 5IKBA 3CSGA 3N5LA 3TCHA 2DSFA 4FEDA 3EQ1A 4IO4A 3R6UA 1A8EA 5ICQA 4WKMA 5FTIA 4N13A 5H8FB 3MZ9A 1OLCA 1QW0A 3VLUA 5ITPA 1H43A 3MVYA 5I59B 5KDTB 3UK4A 1AIVA 3KN7A 4EQ9A 1MXXA 4GL0A 3U72A 1MXYA 2RC9A 3O28A 4DDDA 3FD3A 2Q89A 1LGBC 5CM6A 3V83A 3ONMA 4OEUA 2Z22A 1LSTA 1B46A 2X7PA 5CI5A 3RT6B 3T22A 2YLNA 4O3CA 1SW4A 3VLVA 1USYE 4O3BA 3KZGA 4OWDA 4RPNA 1WODA 4NTLA 2R9JA 1MPCA 3T9HB 4YAHX 3UN6A 2Z8FA 3TQWA 3B7DA 2O1MA 2F7CA 3CFXA 1A8FA 2DP8A 3FTOA 2OBGA 4FE8A 3VVEA 1Y1ZA 1MY4A 1H44A 3DRGA 1MH4A 3SEVA 1MXVA 4C0RA 3A3UA 4OFLA 2XHDA 4ZEFA 3HSTA 4TLLB 4WXJA 1ZIUA 2O7UA 4LQ5A 1Y9UA 2A5TA 2V84A 2UYEA 3H7MA 4ELOA 1JVXA 1FCKA 1BIYA 1I6QA 1LFGA 4ZDMA 5AA2D 4IB2A 3USDA 4XKQA 1BLFA 3O29A 1FQFA 3F11A 3TCGA 2I58A 3VVDA 2NVUB 1P1WA 4OETA 4M1VA 1FQAA 1NL5A 3OXNA 5B70A 1NFTA 2PT1A 5DVJA 1JVYA 2PYYA 2ZYOA 3VFJA 4BDNA 3M3FA 3G7WA 2QS3A 2XXHA 3C34A 3G3JA 4IY5A 5F7VA 4C1UA 3H03A 4G8HA 4FAJA 4JWXA 4QSCA 1IZ1A 1UTHB 2ANJA 1LAXA 1XT8A 4IO5A 4R2BA 1B6HA 4R6HA 3DELB 4ND9A 3OENA 4QHQA 4R75A 2A5TB 1IITA 2ONKE 5DTBA 3S4UA 2QPQA 2ALUA 4H5FA 5HPQA 1N04A 2UVIA 1TXFA 3RQTA 3LVUA 3JZJA 4POXA 4YB6A 1LCTA 3SEYA 2ZYNA 4GFRA 1NH8A 4DCYA 4RYAA 3SEXA 2XX9A 2H9BA 2V25A 3TTLA 5AA4B 3FJ7A 4NF6B 5CMKA 1JW1A 2DS9A 2AL4A 3M8UA 2HZKA 4EF2A 4RK9A 4QFKA 1Q35A 4P11A 3O9PA 2CMOA 3RPWA 2PVUA 2Q2AA 2F6PA 3QK6A 1R9QA 3TMGA 2XXTA 4C1TA 1AMFA 4X1DA 5I2NA 3Q26A 4MH5A 1SQYA 2H98A 4K3FA 1SVXB 2W7YA 3PUYE 4I62A 4LUBA 4OZ9A 2DE3A 4WEDA 2DWHA 2VD3A 3TTKA 2RCBA 2Z8DA 4ELRA 2ZMBA 2B4LA 2V3QA 5AA1A 3UORA 5I57B 2R6GE 4KYDA 3IORA 1NKXA 4PFYA 3T66A 1QKBA 4PP0A 4GL8A 1II5A 1H45A 3TAJA 3OO8A 5I57A 2AYSA 4WEPA 1BTJA 1MG1A 1GR2A 3OEMA 1ZKBA 3OD7A 5L8DA 3PAMA 3DRFA 1OQHA 3CG1A 2GFEA 2QMWA 3CHGA 3K1PA 4LATA 4DE8A 3UGWA 2X7QA 2F7BA 2E1SA 3EHUA 3I5OA 1O63A 2Y7RA 4MLVA 5AA3A 2I3WA 3U92A 2Y7WA 3DLNA 1Y4CA 2DE2A 3FGSA 3GBAA 4F18A 4G4PA 5L9OA 3IOWA 2KLFA 3SEWA 3DRKA 3IK6B 5FHNA 4EF1A 3VE1B 3QUJA 5AE4A 2NXOA 1TFDA 1JW5A 4OESA 3E9XA 2VOZA 1LFIA 3K1NA 5BWJA 1Y3PA 1YTVA 2V93A 2REJA 3HN0A 2QRYA 4KQPA 3IB1A 3U93A 1N84A 1B3HA 2ZXTA 1ZMGA 1VR5A 3OEKA 5TP9A 3CI8A 4AB6A 3MPLA 3G3GA 3D4GA 5BUUA 4R2FA 1UIVA 2I0BA 5JTYA 3O97A 1NH7A 1US5A 3D4CA 3PUXE 4KR5A 2X26A 3LBSA 4BDLA 4ELPA 4F1UA 4F31B 4RNSA 1P1QA 4XTCQ 1LBBA 2QS1A 3T96B 1OMPA 3PMXA 3S2VA 1DMBA 3R26A 5H8QB 3ZKKA 1A54A 4ECFA 4DXBA 4Z7EA 5I58A 3QXMA 1B05A 2B3BA 5H8HB 2DQVA 3FXQA 1JETA 1JQFA 3R7XA 3U8QA 3C35A 3PUZE 4JB7A 1DPPA 2VGQA 1QJMA 1MXUA 1LAGE 2H5YA 1CE2A 3LUYA 3RY3A 3E13X 1L5TA 4E0XA 3K2DA 3AXFA 1AH5A 2PX1A 3FVKA 4FORA 3RYAA 2IEEA 2Q8JA 3HPIA 1EU8A 3TODA 4OENA 2Q88A 1N3XA 2V3TA 1ZBMA 1N76A 3PMVA 1MDP1 4LVQA 4O3AA 1PEBA 2Y7KA 3TCFA 3T9UA 2NOOA 2O7IA 4JSDA 1IIWA 1NNKA 4GRKA 3B6TA 4G8NA 3CVGA 4I8CA 3PPNA 3U1OA 3S9LC 2GH9A 3O6GA 3G3KA 1P99A 1PC3A 1B5HA 4ZEIA 3FATA 3L6GA 4AB5A 3C31A 3VXBA 4ZEBA 2DWJA 2OWTA 1BP5A 3Q28A 4L17A 5L9MA 1PBPA 5K2YA 1UTBB 4E0WA 2RF1A 4EXLA 3IO4A 1MQIA 3K6XA 3SERA 3O2AA 2AIXA 4PFWA 1P1NA 3CR9A 3KOSA 5JTYB 4OFOA 5HM4B 1MPBA 3IX1A 3KJ7A 4H1XA 4RJZA 1IQ7A 1I6AA 3MP8A 4X9TA 4NE4A 4YKKA 1VSOA 4GVOA 4ZE8A 1N7WA 1YAEA 1SYHA 3N6TA 2QS4A 3PV0E 3T9VA 3KFMA 1B7UA 1MPDA 3CRBA 4LA9A 3KOTA 5H8SA 3WAEA 5KZTA 4JBZA 5LOMA 5DVIA 2OZZA 1B9JA 4YMBA 5JEIA 3HO7A 2ABHA 4LP2B 4YICA 2PT2A 1IUDA 2F7AA 4R9FA 1QUIA 1USYH 2PBWA 4IO6A 1GV8A 3FXRA 3FZVA 2G93A 3H6TA 4OTEA 4DCXA 3IB0A 4MBPA 3FV1A 3OSRA 1B40A 2QL3A 2Z23A 1TT1A 2F8DA 3DP4A 1B5IA 4JSOA 4U2RA 1GGGA 4FECA 1P1OA 4LQ2A 2XD2A 3LR1A 3TELA 1PB8A 4H6DA 4KCDA 4KHZE 2REGA 4X48A 1QVSA 3C9HA 4YKJA 3UIFA 1OVBA 4ONYA 2DYXA 5DT6A 2XXVA 3FJGA 1SBPA 1FTLA 3PD9A 2F34A 4BDMA 3RT8A 1MQGA 1Y20A 1H76A 1M5DA 1MY3A 2I0CA 3KBRA 3PPQA 3FVOA 4F2OA 3PUVE 5TP9B 5AA2B 2A5SA 1HSEA 5I59A 3FVNA 3GLBA 5KDTA 1I6BA 1B4ZA 1UIUA 1MS7A 2F6GA 3EHTA 3FIRA 3P7IA 4FJPA 1QULA 3FV2A 4KD5A 2HAUA 4NF5B 3THIA 1B32A 4F19A 4EQ7A 3RUMA 3TKDA 3PGFA 3IR1A 2QMXA 4H8JA 2NWJA 2F35A 3MBPA 4IGTA 3S9NC 1S9TA 1EZOA 2WOKA 3N26A 5EYFA 1B2HA 3UA8A 1A99A 3VVFA 3G3HA 3VV5A 3S9EA 2GRVA 3IL1B 1EZPA 1B7HA 1NNTA 5CC2A 1B1XA 1MY0A 3V89B 1QUJA 3BKIB 4XKNA 3HCQA 2OLBA 2OK2A 3KEIA 4FATA 1AOVA 2VHAA 3CG3A 5CBRA 2LAOA 3TPAA 2Q9TA 4YB7A 3T93B 3FUZA 2XXQA 3SKPA 4AQ4A 3DRJA 2XXRA 4N6PA 2XXUA 4XKPA 1A7LA 3K02A 1MRPA 4IO7A 4ZE9A 4G8MA 4TLMB 3TTNA 4DIGA 1T0KA 1EZ9A 3Q29A 5HBCA 2DE4A 1JNFA 2ESNA 1JEVA 3TYHA 1HSJA 3TDJA 3N6UA 3W15C 4GXSB 2XX7A 4HCWA 1CB6A 2D21A 3A09A 3K1MA 4YZZA 4F1VA 2P2AA 2DXYA 4R73A 3BFTA 4KFQA 4U4XA 3GBBA 5FHOA 3PPOA 1Y3NA 1HSLA 1LB8A 5I2KA 4OVJA 3ZSFA 3FJMA 1VFEA 4ZZEA 4ELQA 3QSLA 1S7YA 3OOAA 3RNNA 3K6UA 4DXCA 5CBSA 1WDNA 3W9VA 2HEUA 1D4NA 2OJTA 1B52A 3G3FA 2RCAA 2IA4A 4JXIA 2UVJA 4EUOA 2H4IA 3QYTA 2WOPA 1DSNA 4HTGA 3HHFA 1IEJA 5FTHA 4QSEA 1N7XA 2I49A 3B6QA 4ZECA 3L6HA 4KYSA 5TPAA 2Y7PA 2HXWA 2FNCA 3RN8A 4PQJA 4QF9A 1D9VA 1LB9A 1MQDA 1B5JA 3C33A 3OO9A 4IGRA 2ZNUA 3PUWE 4R74A 1MXZA 5H8QA 5DVFA 5H8HA 3M3KA 2HZLA 4QFNA 4NF8B 4G68A 3H06B 4KI0E 3EF7A 3ZKLA 2RKMA 2DVCA 1D9YA 1SI1A 4NF4A 1AL3A 3SESA 1M5BA 4Q5TA 3C4MA 2YPNA 2H25A 4KCCA 2E0SA 1D3KA 3PD8A 1QUKA 4LONB 1NNPA 1A55A 1SD3A 2HAVA 3PPPA 1POY1 4RY1A 2H99A 3EPEA 3RYBA 3Q25A 4HS7A 4RA1A 1JEUA 1RYXA 4Q30B 3VDFA 5JK4A 3I6VA 1TWYA 3LSLA 2DWAA 3PMWA 2I48A 3H6VA 4TOZA 1SW1A 1XHYA 4H67A 2O84X 4NWDA 3H4ZA 1OLAA 3LC8A 1S50A 2Z8EA 3MP1A 4QSDA 2O68A 3RLFE 3KGCA 5I58B 1M5CA 1LLSA 4U22A 3IJOB 3K6VA 4NF8A 4THIA 1MQHA 4G68C 1MM7A 1PB7A 1FQDA 4PFTA 1DPEA 2QS2A 4P0IA
chains in the Genus database with same CATH superfamily
1XS5A 2CZLA 4Z0IA 4H65A 1FBCA 1FSAA 4QFPA 1B0LA 1B4HA 1LBCA 1IXIA 1SDXA 4G77A 3CSBA 5CMMA 1FTKA 1FPBA 5CRYA 4DXUA 4PFIA 1MQJA 2GHBA 4QRZA 1WVJA 1LCFA 5ESYA 2QSXA 3SDFA 2HHMA 3IOVA 4PFUA 4HCYA 4NF5A 2OWSA 4IO3A 2HQ0A 3WAFA 2ZNTA 3DP8A 2UXAA 2YJPA 2HCAA 3IB2A 3KG2A 4POWA 3K4UA 3Q27A 1FJ6A 2BJJX 1IXGA 1ELJA 3MVWA 5DEXA 4RK2A 4U1ZA 4I40A 4N4UA 3OELA 1EYJA 3DM0A 2ZYKA 4PF8A 4YB5A 3FXUA 2O51A 1NV5A 5T3JA 4GWYA 3ZS6A 3FASA 1NV7A 3MUQA 1N3WA 2F3DA 2OX3A 3NOHA 4YMAA 1FPKA 1Z7ME 1FPDA 1VE4A 2UVHA 4N15A 1F9BA 1DOTA 2ONRA 1SI0A 1PDAA 1B58A 3GXAA 1XI6A 1YCJA 4H5GA 3MPKA 2P0SA 1MXWA 5F1QA 5I2KB 4F3BA 4YKPA 1Y4TA 3OMBA 3CFLA 3D1RA 3K0VA 3OO6A 3LSFB 3KSXA 2AL5A 1SW5A 3TEPA 4ZEKA 5I56B 3SETA 1VFDA 2O69A 5TU0A 3MZBA 3QAXA 2DOJA 3PU5A 4ESWA 2RINA 1ZU0A 2B4MA 3V8XB 5ET8A 2DXRA 4GIZA 1GVCA 3M3LA 3RGYA 4M4GA 4XXUA 4GOTA 3O6IA 4GWWA 4OFJA 1MY2A 2VD2A 4QBAA 1IMFA 4U1OA 3R6UA 5FTIA 1QW0A 5ITPA 3UK4A 4DDDA 2Q89A 4OEUA 5CI5A 2YLNA 4O3CA 2P3VA 4OWDA 2R9JA 3BIGA 4FE8A 2OBGA 1MH4A 1NV0A 4C0RA 4ZEFA 2A5TA 1FCKA 4ZDMA 3O29A 1FQFA 2V4CA 3E78A 1NL5A 1JVYA 3VFJA 2ZYOA 1KZ8A 4BDNA 3G7WA 2XXHA 3C34A 4IY5A 3H03A 4G8HA 4QSCA 1IZ1A 1UTHB 3E79A 2ANJA 1LAXA 4MMPA 4ND9A 3OENA 4QHQA 2A5TB 2ONKE 5DTBA 2ALUA 4MEVA 3JZJA 4POXA 3RQTA 3LVUA 3SEYA 2ZYNA 1NH8A 3SEXA 3B8BA 4NF6B 2DS9A 1R9QA 3TMGA 2XXTA 4C1TA 4GWZA 4MH5A 2H98A 1SVXB 4LUBA 2DE3A 4WEDA 3RYDA 4ELRA 2V3QA 4KYDA 4PFYA 4GL8A 2AYSA 4XEQA 1MG1A 3OEMA 1DBZA 3CG1A 2GFEA 4PAIA 3K1PA 4LATA 3I5OA 2Y7RA 2I3WA 4F18A 4G4PA 3SEWA 5FHNA 2NXOA 1TFDA 1JW5A 2VOZA 1Y3PA 5EQ7A 1YTVA 3IB1A 1VR5A 1UIVA 1NH7A 3PUXE 2QVRA 3LBSA 1P1QA 2QS1A 1OMPA 3PMXA 4ECFA 1JQFA 3U8QA 4MAGA 2VGQA 2H5YA 1K9ZA 4E0XA 3K2DA 1AH5A 2PX1A 3TKDA 2Y7KA 3CVGA 3U1OA 2GH9A 3O6GA 3G3KA 3VXBA 2DWJA 2AIXA 4PFWA 1P1NA 3CR9A 4OFOA 4RJZA 3IX1A 4YKKA 3KJ7A 1FBHA 4H1XA 5B7DA 3MP8A 4NE4A 1N7WA 1YAEA 1SYHA 3T9VA 3KFMA 1B7UA 1VDWA 4GBWA 3KC0A 3HO7A 2PCRA 2PBWA 3H6TA 4OTEA 2XWVA 3ROJA 4P56A 2QL3A 4LQ2A 4KHZE 2REGA 5I57B 5DT6A 1SBPA 2PFYA 2XWKA 3LUZA 1MQGA 2I0CA 1H76A 5AA2B 3PUVE 5I59A 4NGUA 1MS7A 2F6GA 2JJKA 3EHTA 4FJPA 4KD5A 4NF5B 2P3NA 3PGFA 4H8JA 2NWJA 3MBPA 1EZOA 2WOKA 1B2HA 3VVFA 3IL1B 1B7HA 1MY0A 3BKIB 4XKNA 4FATA 1AOVA 5CBRA 3FUZA 4AQ4A 4N6PA 2OWZA 3Q29A 2Q8MA 4GXSB 4HCWA 3BFTA 4U4XA 1Y3NA 4N81A 1HSLA 5I2KA 4F39A 4ZZEA 4ELQA 1WDNA 4H45A 2HEUA 1D4NA 2H4IA 3QYTA 2WOPA 3HHFA 3L6HA 4ZECA 1KA0A 4PQJA 4QF9A 5I5PA 1B5JA 4R74A 2ZNUA 5DVFA 2HZLA 4QFNA 3EF7A 4H46A 1D9YA 4PAFA 4Q5TA 2E0SA 3PD8A 1QUKA 4LONB 3ISPA 4RY1A 4HS7A 4P9KA 3LSLA 4H67A 3H6VA 2O84X 3LC8A 2O68A 1M5CA 4U22A 1FQDA 3LUYA 2D3IA 1QKAA 4Q0CA 4GXAA 3T9XB 3SZPA 1R9LA 3A3CA 1R6ZA 4UA8A 2F5XA 2FBPA 4OMBA 2BJIA 3TTRA 1FPEA 1SW2A 5EQ9A 2B3FA 3JV9A 4FIMA 1MH3A 4QFOA 1NUZA 1AWBA 2RC8A 4I3YA 4QFLA 3C36A 3KSJA 4F29A 3FVGA 3K00A 3MJNA 4MNIA 3H6UA 1KA1A 2GHAA 5FHMA 3LSXA 5J1DA 3DRIA 3MVXA 3TFLA 4OYVA 3U94A 4NEDA 3MZ1A 2Q2CA 4OHNA 4BDQA 3UP9A 1TFAA 4HW8A 1Y1MA 3TUSA 4NX1A 2HPGA 4RPOA 4NF4B 2KR0A 4H8IA 1FQEA 2M8CA 4BDOA 4F22A 1R1NA 4X04A 3TTMA 5KCJB 1FBPA 2I3VA 5TPAB 4EDPA 4OXVA 3DP6A 3TZAA 1EH3A 2XXIA 2V3UA 1LAFE 2DWIA 3EHSA 1POTA 4EQBA 5EHSA 1XOCA 2F36A 4LN5A 1LBYA 3IFAA 5ET5A 5K2XA 4NF6A 4X1BA 2HFBA 4PC9A 5I56A 2OCUA 4G68B 4F2QA 4XKRA 4P3LA 5M2VA 1LBVA 4IO2A 2ZYMA 2FA7A 4HE1A 1GTKA 4UACA 4IY6A 2Y84A 5EYGA 1OIBA 4U4SA 3B50A 2D5WA 4GD5A 1PB9A 1MDQA 1Q1KA 1URSA 1B51A 1O7TA 1MM6A 3LV0A 5DYHA 2XWIA 2O1LA 1P1UA 3PPRA 3K01A 2DVZA 4JDFA 1XVXA 4WKMA 4N13A 5H8FB 1OLCA 1H43A 2CZKA 2DDKA 5KDTB 4EQ9A 3MSTA 3FD3A 5CM6A 1USYE 4O3BA 3KZGA 4GX6A 4YAHX 3UN6A 3B7DA 2F7CA 1A8FA 1Y1ZA 1MY4A 1H44A 3SEVA 3A3UA 4OFLA 2XHDA 1Y9UA 2UYEA 1JVXA 1BIYA 1I6QA 4XKQA 3TCGA 2I58A 4M1VA 3M3FA 4NN3A 1XT8A 4IO5A 1FBEA 2WYKA 1N04A 1LCTA 4RYAA 2XX9A 2V25A 1JW1A 2HZKA 3M8UA 4EF2A 4RK9A 4HXVA 2PVUA 2Q2AA 4X1DA 5I2NA 1SQYA 4I62A 4OZ9A 2DWHA 2RCBA 3T0JA 3UORA 2R6GE 1QKBA 4PP0A 1II5A 2VT5A 4WEPA 1GR2A 3OD7A 5L8DA 3PAMA 2QMWA 5FBPA 3UGWA 2F7BA 4MLVA 5AA3A 4KXPA 3FGSA 3GBAA 3IOWA 3IK6B 4P47A 3QUJA 5AE4A 3E9XA 1LFIA 2REJA 4KQPA 1B3HA 3MPLA 3D4GA 5BUUA 4R2FA 4GWUA 3O97A 3PTYA 4KR5A 2X26A 4BDLA 4F31B 4XTCQ 1LBBA 3ZKKA 3R26A 4DXBA 4Z7EA 1SPIA 1B05A 2WBBA 3C35A 1LAGE 1L5TA 1CE2A 3E13X 5IM2A 3AXFA 3FVKA 1NV2A 2IEEA 3HPIA 1EU8A 2Q88A 3PMVA 4LVQA 1PEBA 4PF6A 3T9UA 1IIWA 3B6TA 1YZ0A 4I8CA 3PPNA 3U65A 2CEYA 3FATA 1B5HA 3C31A 1BP5A 5L9MA 4E0WA 2RF1A 3SERA 3A29A 1MPBA 3ZKLA 2HXRA 4GVOA 2L5VA 4NG7A 4JVCA 3KOTA 4PTKA 4JBZA 5LDZA 5DVIA 1B9JA 4YICA 2F7AA 1GV8A 4MBPA 1B40A 2F8DA 4X8RA 4U2RA 4JSOA 1GGGA 4H6DA 2KQZA 3C9HA 2F34A 3RT8A 1IMDA 4F2OA 2A5SA 3RPLA 1HSEA 3FVNA 3GLBA 4MIJA 1I6BA 5JTYB 3THIA 4F19A 4XF5A 3S9NC 1S9TA 3N26A 3T1BA 1A99A 3G3HA 5CC2A 3V89B 1QUJA 3KEIA 2OK2A 4OVPA 3TPAA 3T93B 3SKPA 1JP4A 2XXQA 3DRJA 2XXUA 4XKPA 1A7LA 3BIHA 5HBCA 1JEVA 1HSJA 3N6UA 3A09A 3S9EA 4YZZA 3QMFA 2P2AA 4R73A 4NF0A 5FHOA 3PPOA 3EKIA 4OVJA 1S7YA 3K6UA 3W9VA 2OJTA 1B52A 4JXIA 2UVJA 2CZHA 1IEJA 3B6QA 5I7IA 1INPA 5TPAA 3RN8A 3OO9A 5H8QA 1MXZA 5H8HA 3M3KA 4NF8B 4G68A 2RKMA 4NF4A 3SESA 2ZZWA 1D3KA 1SD3A 3PPPA 5IGAA 3EPEA 3RYBA 1JEUA 4Q30B 3VDFA 5JK4A 2I48A 4NWDA 4TOZA 3MP1A 1S50A 4QSDA 1D9QA 3RLFE 3KGCA 4NF8A 4THIA 1MQHA 4PFTA 3K6WA 2QS2A 4P0IA 4P8BA 1XC1A 5CMBA 4PDHA 5ITOA 1DTGA 4R6KA 1FTAA 1NNFA 3VLWA 5H8FA 4P0GA 4H0WA 4MCOA 3N94A 2I4BA 1RDYA 3H6WA 3SEUA 1J1NA 3RTWB 4ZZAA 4OVSA 1ATGA 3MAMA 3ILUB 4Q8RA 1B7ZA 1YPNA 4F3GA 1B3EA 5A5XA 1LAHE 4YKIA 1JW4A 1EZPA 4JWYA 3RTFB 5H8NB 2RC7A 3KJTA 2THIA 2I6EA 2O6AA 1FRPA 5F24A 3BBRA 5CMCA 1OVTA 2F78A 4MF3A 2Y7IA 2WOLA 5A5XB 4I3EA 4PDDA 4R6YA 2UVGA 2I4CA 4MLQA 4LZ7A 3V5AA 5EHMA 4PETA 3MVZA 4P1EA 3VXCA 4N6KA 4OERA 2XD3A 3MYUA 3E3KA 1B1HA 4ZEDA 2WBDA 4UABA 3O6HA 1EYIA 1OQGA 3EN3A 4GWOA 1A40A 1IMBA 3O6PA 1UTBA 4PE5B 4XIGQ 1URDA 1Y3QA 2VP1A 4F3PA 3KN8A 4NMYA 2XXWA 1NMUA 3E4RA 3ODBA 2XXXA 3MWBA 5AA2A 4BLAA 4F1YA 1LBZA 3IO6A 1FBFA 3H3GA 3MP6A 4NAPA 1FW0A 4MNCA 4U21A 1ANFA 2DSFA 4FEDA 3EQ1A 2F3BA 5ICQA 1NV4A 3VLUA 3MVYA 3KN7A 4GL0A 1MXYA 2GQ1A 2RC9A 3O28A 3V83A 3ONMA 1B46A 3RT6B 1WODA 4NTLA 2O1MA 4NHBA 1MXVA 3HSTA 4TLLB 2O7UA 4OANA 4ELOA 4O8MA 5AA2D 1LFGA 1BK4A 4IB2A 3USDA 3F11A 2NVUB 1P1WA 5B70A 1FQAA 3OXNA 1NFTA 2QS3A 3FXBA 2Q74A 2CZIA 4R75A 3S4UA 2QPQA 4H5FA 2FIEA 2UVIA 1TXFA 4DCYA 4HE0A 5AA4B 3FJ7A 4OVQA 5CMKA 2AL4A 2CMOA 4OVTA 4K3FA 3PUYE 1FPLA 4IR8A 2Z8DA 2ZMBA 4P1LA 2B4LA 4GWXA 4G61A 1NKXA 5I57A 4AS4A 3RPLB 1FPFA 2PFZA 3DRFA 4MNPA 1NI9A 2X7QA 2E1SA 3EHUA 1O63A 3U92A 2QVVA 3DLNA 1Y4CA 4NQ8A 3DRKA 3K1NA 2V93A 3HN0A 4MX6A 3U93A 2QRYA 1IMAA 1N84A 2ZXTA 1YXIA 4AB6A 3CI8A 5JTYA 4ELPA 1US5A 2WEFA 3D4CA 5KCJA 3T96B 1DMBA 5H8QB 3QXMA 2B3BA 5H8HB 3FXQA 1JETA 3R7XA 4JB7A 1MXUA 1NV3A 3TODA 4JVIA 4OENA 2V3TA 1N3XA 1N76A 4O3AA 1MDP1 2NOOA 4O7MA 1NNKA 4G8NA 3S9LC 1G0HA 1P99A 4AB5A 3Q28A 4L17A 4EXLA 5EQ8A 3K6XA 3KOSA 4HE2A 5HM4B 1I6AA 2CEXA 4ZE8A 2XWOA 3N6TA 3PV0E 4GX4A 1MPDA 4LA9A 1YYZA 5KZTA 1RDXA 2OZZA 4YMBA 5JEIA 2ABHA 1QUIA 1USYH 4IO6A 3FZVA 2G93A 4DCXA 3IB0A 3OSRA 2Z23A 1K9YA 1P1OA 2XD2A 3LR1A 5L9OA 4KCDA 4O94A 1QVSA 2DYXA 3PD9A 1Y20A 1MY3A 1M5DA 3KBRA 3PPQA 3FVOA 5TP9B 5KDTA 3GYYA 1B4ZA 3FIRA 1QULA 2HAUA 1B32A 4EQ7A 3RUMA 4PCDA 2QMXA 4IGTA 3FBPA 5EYFA 2WYPA 3UA8A 3VV5A 2GRVA 2OLBA 2ZZXA 3CG3A 2Q9TA 4YB7A 4GX3A 2Y5LA 4IO7A 4ZE9A 3TTNA 1JNFA 4OVRA 4F1VA 3K1MA 2D21A 4GBVA 2DXYA 4KFQA 3GBBA 1LB8A 3ZSFA 4DXCA 3RNNA 2RCAA 1DSNA 4HTGA 5FTHA 1N7XA 4QXDA 2Y7PA 2HXWA 2FNCA 1D9VA 1LB9A 3C33A 5I58B 4KI0E 5ET7A 1AL3A 1M5BA 3C4MA 1A55A 2HAVA 4RA1A 1RYXA 1TWYA 3PMWA 2DWAA 1XHYA 4MHFA 3H4ZA 1OLAA 2Z8EA 1LLSA 3K6VA 4G68C 1DPEA 2B65A 3W9WA 4TQUQ 3KN3A 1UQWA 1ZTYA 1M5EA 4G2ZA 1KWHA 1UTHA 4F3SA 2FYIA 3G3IA 3IOUA 4YU0A 2F97A 2FVZA 3TQLA 4PFRA 3HV1A 1SYIA 3BFUA 1MY1A 1B3LA 3O66A 1FQCA 1PBQA 4JWOA 3CFZA 4GQOA 4R9GA 3LSWA 2UYFA 1RKMA 3B6WA 1H3DA 2XXKA 1B3GA 1ZLQA 3MC2A 3C32A 3OSQA 1T0KA 2ONSA 1B0HA 2VPNA 1LFHA 2QJEA 1I69A 1ZJLA 4OA4A 4ESXA 1BKAA 1IMCA 4U23A 5H8NA 4FEBA 1O64A 4KYEA 3MW0A 4N6DA 1N0TA 2VPOA 1IXHA 4BDRA 4I9DA 4R72A 3I3VA 3MQ9A 3IOTA 4RXLA 1NUXA 4LZ8A 3QUFA 1FPGA 1CNQA 2P1SA 1FTOA 1FQBA 1FTJA 4N07A 4MFIA 4NWCA 3ILTB 3GZGA 3CIJA 5I84A 4LZ5A 2XXYA 1NV1A 2XX8A 3IJXB 3HHGA 2R71A 2PMSA 1RYOA 4O7IA 4DZ1A 4ISUA 4GLIA 3OO7A 2FIXA 4OEVA 5ELVA 1IXCA 3IAZA 5ICTA 3ECRA 5I2NB 1DTZA 3S9MC 1FTMA 1NUWA 4EXKA 3JYRA 1US4A 1Z7NE 5ISUA 5AA4A 1XVYA 2G29A 4ZS9A 4KPTA 5DEXB 2WKYA 4DLDA 5IZ1A 2XXPA 2ZNSA 4AS5A 1URGA 4I1DA 4OQOA 3DRHA 4GF8A 1M5FA 2NUVA 3QIMA 5IKBA 3CSGA 3N5LA 3TCHA 4IO4A 1A8EA 3MZ9A 5I59B 1AIVA 1NV6A 1MXXA 4PAKA 3U72A 1LGBC 5A5LA 2QFLA 2Z22A 1LSTA 2X7PA 3T22A 1SW4A 3VLVA 4RPNA 4N17A 1MPCA 3T9HB 2Z8FA 3TQWA 3CFXA 2DP8A 3FTOA 3VVEA 2WX9A 3DRGA 1FPJA 4WXJA 1ZIUA 4LQ5A 4PGNA 2V84A 3H7MA 1BLFA 1DK4A 3VVDA 5EQAA 4OETA 2PT1A 5DVJA 2PYYA 4PGPA 3G3JA 5F7VA 4C1UA 4JWXA 4FAJA 4R2BA 1B6HA 4R6HA 3DELB 1IITA 5HPQA 4YB6A 1RDZA 4GFRA 2H9BA 3TTLA 4QFKA 1Q35A 4P11A 3O9PA 3RPWA 4PFBA 3QK6A 2F6PA 1AMFA 3Q26A 2W7YA 4N91A 2VD3A 3TTKA 2MKZA 5AA1A 1EYKA 3IORA 3T66A 1FBGA 3TAJA 1H45A 3OO8A 1FJ9A 1BTJA 4FBPA 1ZKBA 1NUYA 1OQHA 1IMEA 3CHGA 4DE8A 3IFCA 2Y7WA 2DE2A 4PE3A 2KLFA 2XA5A 4EF1A 3VE1B 4OESA 5BWJA 5IZZA 1ZMGA 3OEKA 5TP9A 3G3GA 2ZZVA 2I0BA 4N8YA 4F1UA 4RNSA 3S2VA 2FHYA 5I58A 1A54A 5I3SA 2DQVA 3PUZE 1DPPA 1QJMA 3RY3A 4FORA 3RYAA 2Q8JA 1ZBMA 4MJOA 3TCFA 2O7IA 4JSDA 5J16A 4GRKA 1PC3A 4ZEIA 3L6GA 4ZEBA 2OWTA 1PBPA 5K2YA 1UTBB 1LBXA 3IO4A 1MQIA 3O2AA 1LEVA 4X9TA 1IQ7A 1VSOA 4DI4B 2QS4A 4N8GA 3CRBA 5H8SA 3WAEA 5LOMA 5EYHA 4LP2B 2PT2A 1IUDA 4R9FA 3FXRA 3FV1A 1TT1A 3DP4A 1B5IA 4FECA 5DW8A 3TELA 1PB8A 4YKJA 4X48A 1DCUA 1FPIA 4JVDA 1G0IA 3UIFA 1OVBA 4ONYA 3KC1A 2XXVA 3FJGA 1QGXA 1FTLA 4BDMA 4PBQA 1UIUA 3P7IA 3FV2A 4DI3D 3IR1A 4GWSA 2F35A 1NNTA 1B1XA 2Y5KA 3HCQA 2VHAA 2QVUA 2LAOA 2XXRA 3K02A 1MRPA 4TLMB 3HFUA 4G8MA 4DIGA 1EZ9A 2DE4A 5LTCA 2ESNA 3TYHA 3W15C 5IAIA 3TDJA 2XX7A 1CB6A 3FJMA 1VFEA 5L9SA 3QSLA 3OOAA 5CBSA 5IZ3B 3G3FA 2IA4A 4EUOA 4QSEA 2I49A 4KYSA 1Q9DA 1FBDA 4IGRA 1MQDA 3PUWE 4XFEA 4PBHA 3H06B 2DVCA 1SI1A 1LBWA 3KBZA 2YPNA 2H25A 4KCCA 1NNPA 5IZ3A 1POY1 2R8TA 2H99A 3Q25A 3I6VA 1SW1A 3IJOB 5ET6A 1MM7A 1PB7A 1B3FA
chains in the Genus database with same CATH topology
1XS5A 2B65A 3W9WA 2CZLA 4Z0IA 4H65A 2D3IA 5KCJA 4TQUQ 1XC1A 1QKAA 3KN3A 4Q0CA 1UQWA 4QFPA 1ZTYA 1B0LA 1M5EA 4G2ZA 1KWHA 1UTHA 4GXAA 1B4HA 5CMBA 1LBCA 3T9XB 4F3SA 1IXIA 1SDXA 2FYIA 3CSBA 4G77A 5ITOA 1R9LA 3G3IA 3IOUA 3A3CA 1FTKA 1R6ZA 5CMMA 4UA8A 1DTGA 2F5XA 4R6KA 4YU0A 5CRYA 2F97A 4DXUA 4OMBA 3TQLA 1MQJA 5B7DA 2GHBA 1SYIA 3HV1A 1NNFA 3TTRA 1SW2A 4QRZA 3VLWA 4P0GA 5H8FA 4H0WA 1WVJA 3BFUA 1LCFA 1MY1A 1B3LA 2B3FA 3JV9A 3K6WA 3O66A 1FQCA 4FIMA 1MH3A 1PBQA 2QSXA 3N94A 2I4BA 4JWOA 3SDFA 4QFOA 3H6WA 3SEUA 1J1NA 3CFZA 2RC8A 4GQOA 4R9GA 3LSWA 3IOVA 3RTWB 2UYFA 4ZZAA 1RKMA 4PFUA 4HCYA 4NF5A 2OWSA 4IO3A 2HQ0A 4QFLA 3C36A 2ZNTA 3KSJA 3WAFA 4F29A 3DP8A 3B6WA 1ATGA 3FVGA 3K00A 3MJNA 5L9SA 1H3DA 3MAMA 2UXAA 3ILUB 1B3GA 3H6UA 1B7ZA 2YJPA 4Q8RA 2GHAA 2HCAA 3IB2A 3KG2A 1YPNA 4POWA 3K4UA 1ZLQA 3Q27A 3MC2A 5FHMA 1B3EA 3C32A 2BJJX 1IXGA 1LAHE 4F3GA 5A5XA 3LSXA 1ELJA 3MVWA 3OSQA 4YKIA 5DEXA 5J1DA 3DRIA 2ONSA 1B0HA 4RK2A 4U1ZA 3MVXA 4F39A 1LFHA 1JW4A 4OYVA 2QJEA 3TFLA 1I69A 1ZJLA 3OELA 3U94A 4NEDA 3MZ1A 2Q2CA 4OHNA 3DM0A 4ESXA 4BDQA 4JWYA 1BKAA 3RTFB 2ZYKA 3UP9A 2RC7A 5H8NB 3KJTA 2THIA 5IAIA 4U23A 1TFAA 4YB5A 4HW8A 2I6EA 2O6AA 3FXUA 5H8NA 1Y1MA 2O51A 3TUSA 4FEBA 1O64A 4KYEA 3MW0A 1N0TA 3BBRA 1IXHA 3ZS6A 3FASA 4RPOA 1OVTA 5CMCA 4NF4B 4BDRA 4I9DA 2F78A 3MUQA 2Y7IA 4MF3A 4R72A 4H8IA 2WOLA 1N3WA 1FQEA 3I3VA 2M8CA 4BDOA 5A5XB 4F22A 3MQ9A 1R1NA 4R6YA 2UVGA 3IOTA 2I4CA 4MLQA 4RXLA 4YMAA 1Z7ME 4LZ8A 4LZ7A 1VE4A 2UVHA 3QUFA 1F9BA 3TTMA 1DOTA 3V5AA 5KCJB 5EHMA 2P1SA 4PETA 3MVZA 2ONRA 1FTOA 1SI0A 2I3VA 5TPAB 1FQBA 1FTJA 1PDAA 4N07A 4MFIA 4EDPA 1B58A 4NWCA 4OXVA 3GXAA 1YCJA 3ILTB 4H5GA 3DP6A 3TZAA 1EH3A 3GZGA 3MPKA 3VXCA 2P0SA 1MXWA 5F1QA 2XXIA 5I2KB 2V3UA 4F3BA 4YKPA 1Y4TA 3CIJA 3OMBA 1LAFE 5I84A 4LZ5A 2XXYA 3CFLA 4OERA 2DWIA 2XX8A 3EHSA 2XD3A 1POTA 3IJXB 3K0VA 4EQBA 3OO6A 5EHSA 3HHGA 1XOCA 2R71A 3KSXA 3LSFB 2F36A 3E3KA 2AL5A 1SW5A 3TEPA 1B1HA 4ZEKA 4ZEDA 5I56B 2PMSA 1RYOA 5K2XA 4NF6A 4X1BA 4ISUA 1VFDA 2O69A 5TU0A 3SETA 2HFBA 4DZ1A 3O6HA 5I56A 1B3FA 4GLIA 3MZBA 2OCUA 1OQGA 3EN3A 4GWOA 1A40A 3OO7A 4G68B 4F2QA 3O6PA 4XKRA 5M2VA 4OEVA 1UTBA 3QAXA 5ELVA 4PE5B 4XIGQ 1IXCA 3IAZA 5ICTA 2DOJA 4IO2A 2ZYMA 3ECRA 3PU5A 1URDA 1Y3QA 2FA7A 4ESWA 1GTKA 2RINA 5I2NB 2VP1A 1DTZA 3S9MC 1ZU0A 2B4MA 3KN8A 1FTMA 4NMYA 2XXWA 4IY6A 4UACA 4F3PA 3V8XB 4EXKA 1NMUA 2Y84A 3E4RA 3JYRA 2DXRA 1US4A 3ODBA 4GIZA 1GVCA 1OIBA 4U4SA 1Z7NE 5ISUA 2D5WA 2XXXA 4GD5A 3MWBA 5AA2A 1PB9A 5AA4A 1XVYA 4BLAA 1MDQA 2G29A 1Q1KA 3M3LA 3RGYA 4ZS9A 4KPTA 5DEXB 4F1YA 2WKYA 1URSA 4DLDA 4M4GA 4XXUA 1B51A 1O7TA 3IO6A 4GOTA 1MM6A 3O6IA 2XXPA 2ZNSA 5DYHA 3H3GA 3MP6A 4OFJA 2O1LA 1MY2A 1URGA 2VD2A 4I1DA 1P1UA 4OQOA 1FW0A 3DRHA 3PPRA 3K01A 2DVZA 4GF8A 4U1OA 1M5FA 2NUVA 4JDFA 1XVXA 4U21A 1ANFA 3QIMA 5IKBA 3CSGA 3N5LA 3TCHA 2DSFA 4FEDA 3EQ1A 4IO4A 3R6UA 1A8EA 5ICQA 4WKMA 5FTIA 4N13A 5H8FB 3MZ9A 1OLCA 1QW0A 3VLUA 5ITPA 1H43A 3MVYA 5I59B 5KDTB 3UK4A 1AIVA 3KN7A 4EQ9A 1MXXA 4GL0A 3U72A 1MXYA 2RC9A 3O28A 4DDDA 3FD3A 2Q89A 1LGBC 5CM6A 3V83A 3ONMA 4OEUA 2Z22A 1LSTA 1B46A 2X7PA 5CI5A 3RT6B 3T22A 2YLNA 4O3CA 1SW4A 3VLVA 1USYE 4O3BA 3KZGA 4OWDA 4RPNA 1WODA 4NTLA 2R9JA 1MPCA 3T9HB 4YAHX 3UN6A 2Z8FA 3TQWA 3B7DA 2O1MA 2F7CA 3CFXA 1A8FA 2DP8A 3FTOA 2OBGA 4FE8A 3VVEA 1Y1ZA 1MY4A 1H44A 3DRGA 1MH4A 3SEVA 1MXVA 4C0RA 3A3UA 4OFLA 2XHDA 4ZEFA 3HSTA 4TLLB 4WXJA 1ZIUA 2O7UA 4LQ5A 1Y9UA 2A5TA 2V84A 2UYEA 3H7MA 4ELOA 1JVXA 1FCKA 1BIYA 1I6QA 1LFGA 4ZDMA 5AA2D 4IB2A 3USDA 4XKQA 1BLFA 3O29A 1FQFA 3F11A 3TCGA 2I58A 3VVDA 2NVUB 1P1WA 4OETA 4M1VA 1FQAA 1NL5A 3OXNA 5B70A 1NFTA 2PT1A 5DVJA 1JVYA 2PYYA 2ZYOA 3VFJA 4BDNA 3M3FA 3G7WA 2QS3A 2XXHA 3C34A 3G3JA 4IY5A 5F7VA 4C1UA 3H03A 4G8HA 4FAJA 4JWXA 4QSCA 1IZ1A 1UTHB 2ANJA 1LAXA 1XT8A 4IO5A 4R2BA 1B6HA 4R6HA 3DELB 4ND9A 3OENA 4QHQA 4R75A 2A5TB 1IITA 2ONKE 5DTBA 3S4UA 2QPQA 2ALUA 4H5FA 5HPQA 1N04A 2UVIA 1TXFA 3RQTA 3LVUA 3JZJA 4POXA 4YB6A 1LCTA 3SEYA 2ZYNA 4GFRA 1NH8A 4DCYA 4RYAA 3SEXA 2XX9A 2H9BA 2V25A 3TTLA 5AA4B 3FJ7A 4NF6B 5CMKA 1JW1A 2DS9A 2AL4A 3M8UA 2HZKA 4EF2A 4RK9A 4QFKA 1Q35A 4P11A 3O9PA 2CMOA 3RPWA 2PVUA 2Q2AA 2F6PA 3QK6A 1R9QA 3TMGA 2XXTA 4C1TA 1AMFA 4X1DA 5I2NA 3Q26A 4MH5A 1SQYA 2H98A 4K3FA 1SVXB 2W7YA 3PUYE 4I62A 4LUBA 4OZ9A 2DE3A 4WEDA 2DWHA 2VD3A 3TTKA 2RCBA 2Z8DA 4ELRA 2ZMBA 2B4LA 2V3QA 5AA1A 3UORA 5I57B 2R6GE 4KYDA 3IORA 1NKXA 4PFYA 3T66A 1QKBA 4PP0A 4GL8A 1II5A 1H45A 3TAJA 3OO8A 5I57A 2AYSA 4WEPA 1BTJA 1MG1A 1GR2A 3OEMA 1ZKBA 3OD7A 5L8DA 3PAMA 3DRFA 1OQHA 3CG1A 2GFEA 2QMWA 3CHGA 3K1PA 4LATA 4DE8A 3UGWA 2X7QA 2F7BA 2E1SA 3EHUA 3I5OA 1O63A 2Y7RA 4MLVA 5AA3A 2I3WA 3U92A 2Y7WA 3DLNA 1Y4CA 2DE2A 3FGSA 3GBAA 4F18A 4G4PA 5L9OA 3IOWA 2KLFA 3SEWA 3DRKA 3IK6B 5FHNA 4EF1A 3VE1B 3QUJA 5AE4A 2NXOA 1TFDA 1JW5A 4OESA 3E9XA 2VOZA 1LFIA 3K1NA 5BWJA 1Y3PA 1YTVA 2V93A 2REJA 3HN0A 2QRYA 4KQPA 3IB1A 3U93A 1N84A 1B3HA 2ZXTA 1ZMGA 1VR5A 3OEKA 5TP9A 3CI8A 4AB6A 3MPLA 3G3GA 3D4GA 5BUUA 4R2FA 1UIVA 2I0BA 5JTYA 3O97A 1NH7A 1US5A 3D4CA 3PUXE 4KR5A 2X26A 3LBSA 4BDLA 4ELPA 4F1UA 4F31B 4RNSA 1P1QA 4XTCQ 1LBBA 2QS1A 3T96B 1OMPA 3PMXA 3S2VA 1DMBA 3R26A 5H8QB 3ZKKA 1A54A 4ECFA 4DXBA 4Z7EA 5I58A 3QXMA 1B05A 2B3BA 5H8HB 2DQVA 3FXQA 1JETA 1JQFA 3R7XA 3U8QA 3C35A 3PUZE 4JB7A 1DPPA 2VGQA 1QJMA 1MXUA 1LAGE 2H5YA 1CE2A 3LUYA 3RY3A 3E13X 1L5TA 4E0XA 3K2DA 3AXFA 1AH5A 2PX1A 3FVKA 4FORA 3RYAA 2IEEA 2Q8JA 3HPIA 1EU8A 3TODA 4OENA 2Q88A 1N3XA 2V3TA 1ZBMA 1N76A 3PMVA 1MDP1 4LVQA 4O3AA 1PEBA 2Y7KA 3TCFA 3T9UA 2NOOA 2O7IA 4JSDA 1IIWA 1NNKA 4GRKA 3B6TA 4G8NA 3CVGA 4I8CA 3PPNA 3U1OA 3S9LC 2GH9A 3O6GA 3G3KA 1P99A 1PC3A 1B5HA 4ZEIA 3FATA 3L6GA 4AB5A 3C31A 3VXBA 4ZEBA 2DWJA 2OWTA 1BP5A 3Q28A 4L17A 5L9MA 1PBPA 5K2YA 1UTBB 4E0WA 2RF1A 4EXLA 3IO4A 1MQIA 3K6XA 3SERA 3O2AA 2AIXA 4PFWA 1P1NA 3CR9A 3KOSA 5JTYB 4OFOA 5HM4B 1MPBA 3IX1A 3KJ7A 4H1XA 4RJZA 1IQ7A 1I6AA 3MP8A 4X9TA 4NE4A 4YKKA 1VSOA 4GVOA 4ZE8A 1N7WA 1YAEA 1SYHA 3N6TA 2QS4A 3PV0E 3T9VA 3KFMA 1B7UA 1MPDA 3CRBA 4LA9A 3KOTA 5H8SA 3WAEA 5KZTA 4JBZA 5LOMA 5DVIA 2OZZA 1B9JA 4YMBA 5JEIA 3HO7A 2ABHA 4LP2B 4YICA 2PT2A 1IUDA 2F7AA 4R9FA 1QUIA 1USYH 2PBWA 4IO6A 1GV8A 3FXRA 3FZVA 2G93A 3H6TA 4OTEA 4DCXA 3IB0A 4MBPA 3FV1A 3OSRA 1B40A 2QL3A 2Z23A 1TT1A 2F8DA 3DP4A 1B5IA 4JSOA 4U2RA 1GGGA 4FECA 1P1OA 4LQ2A 2XD2A 3LR1A 3TELA 1PB8A 4H6DA 4KCDA 4KHZE 2REGA 4X48A 1QVSA 3C9HA 4YKJA 3UIFA 1OVBA 4ONYA 2DYXA 5DT6A 2XXVA 3FJGA 1SBPA 1FTLA 3PD9A 2F34A 4BDMA 3RT8A 1MQGA 1Y20A 1H76A 1M5DA 1MY3A 2I0CA 3KBRA 3PPQA 3FVOA 4F2OA 3PUVE 5TP9B 5AA2B 2A5SA 1HSEA 5I59A 3FVNA 3GLBA 5KDTA 1I6BA 1B4ZA 1UIUA 1MS7A 2F6GA 3EHTA 3FIRA 3P7IA 4FJPA 1QULA 3FV2A 4KD5A 2HAUA 4NF5B 3THIA 1B32A 4F19A 4EQ7A 3RUMA 3TKDA 3PGFA 3IR1A 2QMXA 4H8JA 2NWJA 2F35A 3MBPA 4IGTA 3S9NC 1S9TA 1EZOA 2WOKA 3N26A 5EYFA 1B2HA 3UA8A 1A99A 3VVFA 3G3HA 3VV5A 3S9EA 2GRVA 3IL1B 1EZPA 1B7HA 1NNTA 5CC2A 1B1XA 1MY0A 3V89B 1QUJA 3BKIB 4XKNA 3HCQA 2OLBA 2OK2A 3KEIA 4FATA 1AOVA 2VHAA 3CG3A 5CBRA 2LAOA 3TPAA 2Q9TA 4YB7A 3T93B 3FUZA 2XXQA 3SKPA 4AQ4A 3DRJA 2XXRA 4N6PA 2XXUA 4XKPA 1A7LA 3K02A 1MRPA 4IO7A 4ZE9A 4G8MA 4TLMB 3TTNA 4DIGA 1T0KA 1EZ9A 3Q29A 5HBCA 2DE4A 1JNFA 2ESNA 1JEVA 3TYHA 1HSJA 3TDJA 3N6UA 3W15C 4GXSB 2XX7A 4HCWA 1CB6A 2D21A 3A09A 3K1MA 4YZZA 4F1VA 2P2AA 2DXYA 4R73A 3BFTA 4KFQA 4U4XA 3GBBA 5FHOA 3PPOA 1Y3NA 1HSLA 1LB8A 5I2KA 4OVJA 3ZSFA 3FJMA 1VFEA 4ZZEA 4ELQA 3QSLA 1S7YA 3OOAA 3RNNA 3K6UA 4DXCA 5CBSA 1WDNA 3W9VA 2HEUA 1D4NA 2OJTA 1B52A 3G3FA 2RCAA 2IA4A 4JXIA 2UVJA 4EUOA 2H4IA 3QYTA 2WOPA 1DSNA 4HTGA 3HHFA 1IEJA 5FTHA 4QSEA 1N7XA 2I49A 3B6QA 4ZECA 3L6HA 4KYSA 5TPAA 2Y7PA 2HXWA 2FNCA 3RN8A 4PQJA 4QF9A 1D9VA 1LB9A 1MQDA 1B5JA 3C33A 3OO9A 4IGRA 2ZNUA 3PUWE 4R74A 1MXZA 5H8QA 5DVFA 5H8HA 3M3KA 2HZLA 4QFNA 4NF8B 4G68A 3H06B 4KI0E 3EF7A 3ZKLA 2RKMA 2DVCA 1D9YA 1SI1A 4NF4A 1AL3A 3SESA 1M5BA 4Q5TA 3C4MA 2YPNA 2H25A 4KCCA 2E0SA 1D3KA 3PD8A 1QUKA 4LONB 1NNPA 1A55A 1SD3A 2HAVA 3PPPA 1POY1 4RY1A 2H99A 3EPEA 3RYBA 3Q25A 4HS7A 4RA1A 1JEUA 1RYXA 4Q30B 3VDFA 5JK4A 3I6VA 1TWYA 3LSLA 2DWAA 3PMWA 2I48A 3H6VA 4TOZA 1SW1A 1XHYA 4H67A 2O84X 4NWDA 3H4ZA 1OLAA 3LC8A 1S50A 2Z8EA 3MP1A 4QSDA 2O68A 3RLFE 3KGCA 5I58B 1M5CA 1LLSA 4U22A 3IJOB 3K6VA 4NF8A 4THIA 1MQHA 4G68C 1MM7A 1PB7A 1FQDA 4PFTA 1DPEA 2QS2A 4P0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XS5 A;  2B65 A;  3W9W A;  2CZL A;  4Z0I A;  4H65 A;  2D3I A;  5KCJ A;  4TQU Q;  1XC1 A;  1QKA A;  3KN3 A;  4Q0C A;  1UQW A;  4QFP A;  1ZTY A;  1B0L A;  1M5E A;  4G2Z A;  1KWH A;  1UTH A;  4GXA A;  1B4H A;  5CMB A;  1LBC A;  3T9X B;  4F3S A;  1IXI A;  1SDX A;  2FYI A;  3CSB A;  4G77 A;  5ITO A;  1R9L A;  3G3I A;  3IOU A;  3A3C A;  1FTK A;  1R6Z A;  5CMM A;  4UA8 A;  1DTG A;  2F5X A;  4R6K A;  4YU0 A;  5CRY A;  2F97 A;  4DXU A;  4OMB A;  3TQL A;  1MQJ A;  5B7D A;  2GHB A;  1SYI A;  3HV1 A;  1NNF A;  3TTR A;  1SW2 A;  4QRZ A;  3VLW A;  4P0G A;  5H8F A;  4H0W A;  1WVJ A;  3BFU A;  1LCF A;  1MY1 A;  1B3L A;  2B3F A;  3JV9 A;  3K6W A;  3O66 A;  1FQC A;  4FIM A;  1MH3 A;  1PBQ A;  2QSX A;  3N94 A;  2I4B A;  4JWO A;  3SDF A;  4QFO A;  3H6W A;  3SEU A;  1J1N A;  3CFZ A;  2RC8 A;  4GQO A;  4R9G A;  3LSW A;  3IOV A;  3RTW B;  2UYF A;  4ZZA A;  1RKM A;  4PFU A;  4HCY A;  4NF5 A;  2OWS A;  4IO3 A;  2HQ0 A;  4QFL A;  3C36 A;  2ZNT A;  3KSJ A;  3WAF A;  4F29 A;  3DP8 A;  3B6W A;  1ATG A;  3FVG A;  3K00 A;  3MJN A;  5L9S A;  1H3D A;  3MAM A;  2UXA A;  3ILU B;  1B3G A;  3H6U A;  1B7Z A;  2YJP A;  4Q8R A;  2GHA A;  2HCA A;  3IB2 A;  3KG2 A;  1YPN A;  4POW A;  3K4U A;  1ZLQ A;  3Q27 A;  3MC2 A;  5FHM A;  1B3E A;  3C32 A;  2BJJ X;  1IXG A;  1LAH E;  4F3G A;  5A5X A;  3LSX A;  1ELJ A;  3MVW A;  3OSQ A;  4YKI A;  5DEX A;  5J1D A;  3DRI A;  2ONS A;  1B0H A;  4RK2 A;  4U1Z A;  3MVX A;  4F39 A;  1LFH A;  1JW4 A;  4OYV A;  2QJE A;  3TFL A;  1I69 A;  1ZJL A;  3OEL A;  3U94 A;  4NED A;  3MZ1 A;  2Q2C A;  4OHN A;  3DM0 A;  4ESX A;  4BDQ A;  4JWY A;  1BKA A;  3RTF B;  2ZYK A;  3UP9 A;  2RC7 A;  5H8N B;  3KJT A;  2THI A;  5IAI A;  4U23 A;  1TFA A;  4YB5 A;  4HW8 A;  2I6E A;  2O6A A;  3FXU A;  5H8N A;  1Y1M A;  2O51 A;  3TUS A;  4FEB A;  1O64 A;  4KYE A;  3MW0 A;  1N0T A;  3BBR A;  1IXH A;  3ZS6 A;  3FAS A;  4RPO A;  1OVT A;  5CMC A;  4NF4 B;  4BDR A;  4I9D A;  2F78 A;  3MUQ A;  2Y7I A;  4MF3 A;  4R72 A;  4H8I A;  2WOL A;  1N3W A;  1FQE A;  3I3V A;  2M8C A;  4BDO A;  5A5X B;  4F22 A;  3MQ9 A;  1R1N A;  4R6Y A;  2UVG A;  3IOT A;  2I4C A;  4MLQ A;  4RXL A;  4YMA A;  1Z7M E;  4LZ8 A;  4LZ7 A;  1VE4 A;  2UVH A;  3QUF A;  1F9B A;  3TTM A;  1DOT A;  3V5A A;  5KCJ B;  5EHM A;  2P1S A;  4PET A;  3MVZ A;  2ONR A;  1FTO A;  1SI0 A;  2I3V A;  5TPA B;  1FQB A;  1FTJ A;  1PDA A;  4N07 A;  4MFI A;  4EDP A;  1B58 A;  4NWC A;  4OXV A;  3GXA A;  1YCJ A;  3ILT B;  4H5G A;  3DP6 A;  3TZA A;  1EH3 A;  3GZG A;  3MPK A;  3VXC A;  2P0S A;  1MXW A;  5F1Q A;  2XXI A;  5I2K B;  2V3U A;  4F3B A;  4YKP A;  1Y4T A;  3CIJ A;  3OMB A;  1LAF E;  5I84 A;  4LZ5 A;  2XXY A;  3CFL A;  4OER A;  2DWI A;  2XX8 A;  3EHS A;  2XD3 A;  1POT A;  3IJX B;  3K0V A;  4EQB A;  3OO6 A;  5EHS A;  3HHG A;  1XOC A;  2R71 A;  3KSX A;  3LSF B;  2F36 A;  3E3K A;  2AL5 A;  1SW5 A;  3TEP A;  1B1H A;  4ZEK A;  4ZED A;  5I56 B;  2PMS A;  1RYO A;  5K2X A;  4NF6 A;  4X1B A;  4ISU A;  1VFD A;  2O69 A;  5TU0 A;  3SET A;  2HFB A;  4DZ1 A;  3O6H A;  5I56 A;  1B3F A;  4GLI A;  3MZB A;  2OCU A;  1OQG A;  3EN3 A;  4GWO A;  1A40 A;  3OO7 A;  4G68 B;  4F2Q A;  3O6P A;  4XKR A;  5M2V A;  4OEV A;  1UTB A;  3QAX A;  5ELV A;  4PE5 B;  4XIG Q;  1IXC A;  3IAZ A;  5ICT A;  2DOJ A;  4IO2 A;  2ZYM A;  3ECR A;  3PU5 A;  1URD A;  1Y3Q A;  2FA7 A;  4ESW A;  1GTK A;  2RIN A;  5I2N B;  2VP1 A;  1DTZ A;  3S9M C;  1ZU0 A;  2B4M A;  3KN8 A;  1FTM A;  4NMY A;  2XXW A;  4IY6 A;  4UAC A;  4F3P A;  3V8X B;  4EXK A;  1NMU A;  2Y84 A;  3E4R A;  3JYR A;  2DXR A;  1US4 A;  3ODB A;  4GIZ A;  1GVC A;  1OIB A;  4U4S A;  1Z7N E;  5ISU A;  2D5W A;  2XXX A;  4GD5 A;  3MWB A;  5AA2 A;  1PB9 A;  5AA4 A;  1XVY A;  4BLA A;  1MDQ A;  2G29 A;  1Q1K A;  3M3L A;  3RGY A;  4ZS9 A;  4KPT A;  5DEX B;  4F1Y A;  2WKY A;  1URS A;  4DLD A;  4M4G A;  4XXU A;  1B51 A;  1O7T A;  3IO6 A;  4GOT A;  1MM6 A;  3O6I A;  2XXP A;  2ZNS A;  5DYH A;  3H3G A;  3MP6 A;  4OFJ A;  2O1L A;  1MY2 A;  1URG A;  2VD2 A;  4I1D A;  1P1U A;  4OQO A;  1FW0 A;  3DRH A;  3PPR A;  3K01 A;  2DVZ A;  4GF8 A;  4U1O A;  1M5F A;  2NUV A;  4JDF A;  1XVX A;  4U21 A;  1ANF A;  3QIM A;  5IKB A;  3CSG A;  3N5L A;  3TCH A;  2DSF A;  4FED A;  3EQ1 A;  4IO4 A;  3R6U A;  1A8E A;  5ICQ A;  4WKM A;  5FTI A;  4N13 A;  5H8F B;  3MZ9 A;  1OLC A;  1QW0 A;  3VLU A;  5ITP A;  1H43 A;  3MVY A;  5I59 B;  5KDT B;  3UK4 A;  1AIV A;  3KN7 A;  4EQ9 A;  1MXX A;  4GL0 A;  3U72 A;  1MXY A;  2RC9 A;  3O28 A;  4DDD A;  3FD3 A;  2Q89 A;  1LGB C;  5CM6 A;  3V83 A;  3ONM A;  4OEU A;  2Z22 A;  1LST A;  1B46 A;  2X7P A;  5CI5 A;  3RT6 B;  3T22 A;  2YLN A;  4O3C A;  1SW4 A;  3VLV A;  1USY E;  4O3B A;  3KZG A;  4OWD A;  4RPN A;  1WOD A;  4NTL A;  2R9J A;  1MPC A;  3T9H B;  4YAH X;  3UN6 A;  2Z8F A;  3TQW A;  3B7D A;  2O1M A;  2F7C A;  3CFX A;  1A8F A;  2DP8 A;  3FTO A;  2OBG A;  4FE8 A;  3VVE A;  1Y1Z A;  1MY4 A;  1H44 A;  3DRG A;  1MH4 A;  3SEV A;  1MXV A;  4C0R A;  3A3U A;  4OFL A;  2XHD A;  4ZEF A;  3HST A;  4TLL B;  4WXJ A;  1ZIU A;  2O7U A;  4LQ5 A;  1Y9U A;  2A5T A;  2V84 A;  2UYE A;  3H7M A;  4ELO A;  1JVX A;  1FCK A;  1BIY A;  1I6Q A;  1LFG A;  4ZDM A;  5AA2 D;  4IB2 A;  3USD A;  4XKQ A;  1BLF A;  3O29 A;  1FQF A;  3F11 A;  3TCG A;  2I58 A;  3VVD A;  2NVU B;  1P1W A;  4OET A;  4M1V A;  1FQA A;  1NL5 A;  3OXN A;  5B70 A;  1NFT A;  2PT1 A;  5DVJ A;  1JVY A;  2PYY A;  2ZYO A;  3VFJ A;  4BDN A;  3M3F A;  3G7W A;  2QS3 A;  2XXH A;  3C34 A;  3G3J A;  4IY5 A;  5F7V A;  4C1U A;  3H03 A;  4G8H A;  4FAJ A;  4JWX A;  4QSC A;  1IZ1 A;  1UTH B;  2ANJ A;  1LAX A;  1XT8 A;  4IO5 A;  4R2B A;  1B6H A;  4R6H A;  3DEL B;  4ND9 A;  3OEN A;  4QHQ A;  4R75 A;  2A5T B;  1IIT A;  2ONK E;  5DTB A;  3S4U A;  2QPQ A;  2ALU A;  4H5F A;  5HPQ A;  1N04 A;  2UVI A;  1TXF A;  3RQT A;  3LVU A;  3JZJ A;  4POX A;  4YB6 A;  1LCT A;  3SEY A;  2ZYN A;  4GFR A;  1NH8 A;  4DCY A;  4RYA A;  3SEX A;  2XX9 A;  2H9B A;  2V25 A;  3TTL A;  5AA4 B;  3FJ7 A;  4NF6 B;  5CMK A;  1JW1 A;  2DS9 A;  2AL4 A;  3M8U A;  2HZK A;  4EF2 A;  4RK9 A;  4QFK A;  1Q35 A;  4P11 A;  3O9P A;  2CMO A;  3RPW A;  2PVU A;  2Q2A A;  2F6P A;  3QK6 A;  1R9Q A;  3TMG A;  2XXT A;  4C1T A;  1AMF A;  4X1D A;  5I2N A;  3Q26 A;  4MH5 A;  1SQY A;  2H98 A;  4K3F A;  1SVX B;  2W7Y A;  3PUY E;  4I62 A;  4LUB A;  4OZ9 A;  2DE3 A;  4WED A;  2DWH A;  2VD3 A;  3TTK A;  2RCB A;  2Z8D A;  4ELR A;  2ZMB A;  2B4L A;  2V3Q A;  5AA1 A;  3UOR A;  5I57 B;  2R6G E;  4KYD A;  3IOR A;  1NKX A;  4PFY A;  3T66 A;  1QKB A;  4PP0 A;  4GL8 A;  1II5 A;  1H45 A;  3TAJ A;  3OO8 A;  5I57 A;  2AYS A;  4WEP A;  1BTJ A;  1MG1 A;  1GR2 A;  3OEM A;  1ZKB A;  3OD7 A;  5L8D A;  3PAM A;  3DRF A;  1OQH A;  3CG1 A;  2GFE A;  2QMW A;  3CHG A;  3K1P A;  4LAT A;  4DE8 A;  3UGW A;  2X7Q A;  2F7B A;  2E1S A;  3EHU A;  3I5O A;  1O63 A;  2Y7R A;  4MLV A;  5AA3 A;  2I3W A;  3U92 A;  2Y7W A;  3DLN A;  1Y4C A;  2DE2 A;  3FGS A;  3GBA A;  4F18 A;  4G4P A;  5L9O A;  3IOW A;  2KLF A;  3SEW A;  3DRK A;  3IK6 B;  5FHN A;  4EF1 A;  3VE1 B;  3QUJ A;  5AE4 A;  2NXO A;  1TFD A;  1JW5 A;  4OES A;  3E9X A;  2VOZ A;  1LFI A;  3K1N A;  5BWJ A;  1Y3P A;  1YTV A;  2V93 A;  2REJ A;  3HN0 A;  2QRY A;  4KQP A;  3IB1 A;  3U93 A;  1N84 A;  1B3H A;  2ZXT A;  1ZMG A;  1VR5 A;  3OEK A;  5TP9 A;  3CI8 A;  4AB6 A;  3MPL A;  3G3G A;  3D4G A;  5BUU A;  4R2F A;  1UIV A;  2I0B A;  5JTY A;  3O97 A;  1NH7 A;  1US5 A;  3D4C A;  3PUX E;  4KR5 A;  2X26 A;  3LBS A;  4BDL A;  4ELP A;  4F1U A;  4F31 B;  4RNS A;  1P1Q A;  4XTC Q;  1LBB A;  2QS1 A;  3T96 B;  1OMP A;  3PMX A;  3S2V A;  1DMB A;  3R26 A;  5H8Q B;  3ZKK A;  1A54 A;  4ECF A;  4DXB A;  4Z7E A;  5I58 A;  3QXM A;  1B05 A;  2B3B A;  5H8H B;  2DQV A;  3FXQ A;  1JET A;  1JQF A;  3R7X A;  3U8Q A;  3C35 A;  3PUZ E;  4JB7 A;  1DPP A;  2VGQ A;  1QJM A;  1MXU A;  1LAG E;  2H5Y A;  1CE2 A;  3LUY A;  3RY3 A;  3E13 X;  1L5T A;  4E0X A;  3K2D A;  3AXF A;  1AH5 A;  2PX1 A;  3FVK A;  4FOR A;  3RYA A;  2IEE A;  2Q8J A;  3HPI A;  1EU8 A;  3TOD A;  4OEN A;  2Q88 A;  1N3X A;  2V3T A;  1ZBM A;  1N76 A;  3PMV A;  1MDP 1;  4LVQ A;  4O3A A;  1PEB A;  2Y7K A;  3TCF A;  3T9U A;  2NOO A;  2O7I A;  4JSD A;  1IIW A;  1NNK A;  4GRK A;  3B6T A;  4G8N A;  3CVG A;  4I8C A;  3PPN A;  3U1O A;  3S9L C;  2GH9 A;  3O6G A;  3G3K A;  1P99 A;  1PC3 A;  1B5H A;  4ZEI A;  3FAT A;  3L6G A;  4AB5 A;  3C31 A;  3VXB A;  4ZEB A;  2DWJ A;  2OWT A;  1BP5 A;  3Q28 A;  4L17 A;  5L9M A;  1PBP A;  5K2Y A;  1UTB B;  4E0W A;  2RF1 A;  4EXL A;  3IO4 A;  1MQI A;  3K6X A;  3SER A;  3O2A A;  2AIX A;  4PFW A;  1P1N A;  3CR9 A;  3KOS A;  5JTY B;  4OFO A;  5HM4 B;  1MPB A;  3IX1 A;  3KJ7 A;  4H1X A;  4RJZ A;  1IQ7 A;  1I6A A;  3MP8 A;  4X9T A;  4NE4 A;  4YKK A;  1VSO A;  4GVO A;  4ZE8 A;  1N7W A;  1YAE A;  1SYH A;  3N6T A;  2QS4 A;  3PV0 E;  3T9V A;  3KFM A;  1B7U A;  1MPD A;  3CRB A;  4LA9 A;  3KOT A;  5H8S A;  3WAE A;  5KZT A;  4JBZ A;  5LOM A;  5DVI A;  2OZZ A;  1B9J A;  4YMB A;  5JEI A;  3HO7 A;  2ABH A;  4LP2 B;  4YIC A;  2PT2 A;  1IUD A;  2F7A A;  4R9F A;  1QUI A;  1USY H;  2PBW A;  4IO6 A;  1GV8 A;  3FXR A;  3FZV A;  2G93 A;  3H6T A;  4OTE A;  4DCX A;  3IB0 A;  4MBP A;  3FV1 A;  3OSR A;  1B40 A;  2QL3 A;  2Z23 A;  1TT1 A;  2F8D A;  3DP4 A;  1B5I A;  4JSO A;  4U2R A;  1GGG A;  4FEC A;  1P1O A;  4LQ2 A;  2XD2 A;  3LR1 A;  3TEL A;  1PB8 A;  4H6D A;  4KCD A;  4KHZ E;  2REG A;  4X48 A;  1QVS A;  3C9H A;  4YKJ A;  3UIF A;  1OVB A;  4ONY A;  2DYX A;  5DT6 A;  2XXV A;  3FJG A;  1SBP A;  1FTL A;  3PD9 A;  2F34 A;  4BDM A;  3RT8 A;  1MQG A;  1Y20 A;  1H76 A;  1M5D A;  1MY3 A;  2I0C A;  3KBR A;  3PPQ A;  3FVO A;  4F2O A;  3PUV E;  5TP9 B;  5AA2 B;  2A5S A;  1HSE A;  5I59 A;  3FVN A;  3GLB A;  5KDT A;  1I6B A;  1B4Z A;  1UIU A;  1MS7 A;  2F6G A;  3EHT A;  3FIR A;  3P7I A;  4FJP A;  1QUL A;  3FV2 A;  4KD5 A;  2HAU A;  4NF5 B;  3THI A;  1B32 A;  4F19 A;  4EQ7 A;  3RUM A;  3TKD A;  3PGF A;  3IR1 A;  2QMX A;  4H8J A;  2NWJ A;  2F35 A;  3MBP A;  4IGT A;  3S9N C;  1S9T A;  1EZO A;  2WOK A;  3N26 A;  5EYF A;  1B2H A;  3UA8 A;  1A99 A;  3VVF A;  3G3H A;  3VV5 A;  3S9E A;  2GRV A;  3IL1 B;  1EZP A;  1B7H A;  1NNT A;  5CC2 A;  1B1X A;  1MY0 A;  3V89 B;  1QUJ A;  3BKI B;  4XKN A;  3HCQ A;  2OLB A;  2OK2 A;  3KEI A;  4FAT A;  1AOV A;  2VHA A;  3CG3 A;  5CBR A;  2LAO A;  3TPA A;  2Q9T A;  4YB7 A;  3T93 B;  3FUZ A;  2XXQ A;  3SKP A;  4AQ4 A;  3DRJ A;  2XXR A;  4N6P A;  2XXU A;  4XKP A;  1A7L A;  3K02 A;  1MRP A;  4IO7 A;  4ZE9 A;  4G8M A;  4TLM B;  3TTN A;  4DIG A;  1T0K A;  1EZ9 A;  3Q29 A;  5HBC A;  2DE4 A;  1JNF A;  2ESN A;  1JEV A;  3TYH A;  1HSJ A;  3TDJ A;  3N6U A;  3W15 C;  4GXS B;  2XX7 A;  4HCW A;  1CB6 A;  2D21 A;  3A09 A;  3K1M A;  4YZZ A;  4F1V A;  2P2A A;  2DXY A;  4R73 A;  3BFT A;  4KFQ A;  4U4X A;  3GBB A;  5FHO A;  3PPO A;  1Y3N A;  1HSL A;  1LB8 A;  5I2K A;  4OVJ A;  3ZSF A;  3FJM A;  1VFE A;  4ZZE A;  4ELQ A;  3QSL A;  1S7Y A;  3OOA A;  3RNN A;  3K6U A;  4DXC A;  5CBS A;  1WDN A;  3W9V A;  2HEU A;  1D4N A;  2OJT A;  1B52 A;  3G3F A;  2RCA A;  2IA4 A;  4JXI A;  2UVJ A;  4EUO A;  2H4I A;  3QYT A;  2WOP A;  1DSN A;  4HTG A;  3HHF A;  1IEJ A;  5FTH A;  4QSE A;  1N7X A;  2I49 A;  3B6Q A;  4ZEC A;  3L6H A;  4KYS A;  5TPA A;  2Y7P A;  2HXW A;  2FNC A;  3RN8 A;  4PQJ A;  4QF9 A;  1D9V A;  1LB9 A;  1MQD A;  1B5J A;  3C33 A;  3OO9 A;  4IGR A;  2ZNU A;  3PUW E;  4R74 A;  1MXZ A;  5H8Q A;  5DVF A;  5H8H A;  3M3K A;  2HZL A;  4QFN A;  4NF8 B;  4G68 A;  3H06 B;  4KI0 E;  3EF7 A;  3ZKL A;  2RKM A;  2DVC A;  1D9Y A;  1SI1 A;  4NF4 A;  1AL3 A;  3SES A;  1M5B A;  4Q5T A;  3C4M A;  2YPN A;  2H25 A;  4KCC A;  2E0S A;  1D3K A;  3PD8 A;  1QUK A;  4LON B;  1NNP A;  1A55 A;  1SD3 A;  2HAV A;  3PPP A;  1POY 1;  4RY1 A;  2H99 A;  3EPE A;  3RYB A;  3Q25 A;  4HS7 A;  4RA1 A;  1JEU A;  1RYX A;  4Q30 B;  3VDF A;  5JK4 A;  3I6V A;  1TWY A;  3LSL A;  2DWA A;  3PMW A;  2I48 A;  3H6V A;  4TOZ A;  1SW1 A;  1XHY A;  4H67 A;  2O84 X;  4NWD A;  3H4Z A;  1OLA A;  3LC8 A;  1S50 A;  2Z8E A;  3MP1 A;  4QSD A;  2O68 A;  3RLF E;  3KGC A;  5I58 B;  1M5C A;  1LLS A;  4U22 A;  3IJO B;  3K6V A;  4NF8 A;  4THI A;  1MQH A;  4G68 C;  1MM7 A;  1PB7 A;  1FQD A;  4PFT A;  1DPE A;  2QS2 A;  4P0I A; 
#chains in the Genus database with same CATH topology
 1XS5 A;  2CZL A;  4Z0I A;  4H65 A;  1FBC A;  1FSA A;  4QFP A;  1B0L A;  1B4H A;  1LBC A;  1IXI A;  1SDX A;  4G77 A;  3CSB A;  5CMM A;  1FTK A;  1FPB A;  5CRY A;  4DXU A;  4PFI A;  1MQJ A;  2GHB A;  4QRZ A;  1WVJ A;  1LCF A;  5ESY A;  2QSX A;  3SDF A;  2HHM A;  3IOV A;  4PFU A;  4HCY A;  4NF5 A;  2OWS A;  4IO3 A;  2HQ0 A;  3WAF A;  2ZNT A;  3DP8 A;  2UXA A;  2YJP A;  2HCA A;  3IB2 A;  3KG2 A;  4POW A;  3K4U A;  3Q27 A;  1FJ6 A;  2BJJ X;  1IXG A;  1ELJ A;  3MVW A;  5DEX A;  4RK2 A;  4U1Z A;  4I40 A;  4N4U A;  3OEL A;  1EYJ A;  3DM0 A;  2ZYK A;  4PF8 A;  4YB5 A;  3FXU A;  2O51 A;  1NV5 A;  5T3J A;  4GWY A;  3ZS6 A;  3FAS A;  1NV7 A;  3MUQ A;  1N3W A;  2F3D A;  2OX3 A;  3NOH A;  4YMA A;  1FPK A;  1Z7M E;  1FPD A;  1VE4 A;  2UVH A;  4N15 A;  1F9B A;  1DOT A;  2ONR A;  1SI0 A;  1PDA A;  1B58 A;  3GXA A;  1XI6 A;  1YCJ A;  4H5G A;  3MPK A;  2P0S A;  1MXW A;  5F1Q A;  5I2K B;  4F3B A;  4YKP A;  1Y4T A;  3OMB A;  3CFL A;  3D1R A;  3K0V A;  3OO6 A;  3LSF B;  3KSX A;  2AL5 A;  1SW5 A;  3TEP A;  4ZEK A;  5I56 B;  3SET A;  1VFD A;  2O69 A;  5TU0 A;  3MZB A;  3QAX A;  2DOJ A;  3PU5 A;  4ESW A;  2RIN A;  1ZU0 A;  2B4M A;  3V8X B;  5ET8 A;  2DXR A;  4GIZ A;  1GVC A;  3M3L A;  3RGY A;  4M4G A;  4XXU A;  4GOT A;  3O6I A;  4GWW A;  4OFJ A;  1MY2 A;  2VD2 A;  4QBA A;  1IMF A;  4U1O A;  3R6U A;  5FTI A;  1QW0 A;  5ITP A;  3UK4 A;  4DDD A;  2Q89 A;  4OEU A;  5CI5 A;  2YLN A;  4O3C A;  2P3V A;  4OWD A;  2R9J A;  3BIG A;  4FE8 A;  2OBG A;  1MH4 A;  1NV0 A;  4C0R A;  4ZEF A;  2A5T A;  1FCK A;  4ZDM A;  3O29 A;  1FQF A;  2V4C A;  3E78 A;  1NL5 A;  1JVY A;  3VFJ A;  2ZYO A;  1KZ8 A;  4BDN A;  3G7W A;  2XXH A;  3C34 A;  4IY5 A;  3H03 A;  4G8H A;  4QSC A;  1IZ1 A;  1UTH B;  3E79 A;  2ANJ A;  1LAX A;  4MMP A;  4ND9 A;  3OEN A;  4QHQ A;  2A5T B;  2ONK E;  5DTB A;  2ALU A;  4MEV A;  3JZJ A;  4POX A;  3RQT A;  3LVU A;  3SEY A;  2ZYN A;  1NH8 A;  3SEX A;  3B8B A;  4NF6 B;  2DS9 A;  1R9Q A;  3TMG A;  2XXT A;  4C1T A;  4GWZ A;  4MH5 A;  2H98 A;  1SVX B;  4LUB A;  2DE3 A;  4WED A;  3RYD A;  4ELR A;  2V3Q A;  4KYD A;  4PFY A;  4GL8 A;  2AYS A;  4XEQ A;  1MG1 A;  3OEM A;  1DBZ A;  3CG1 A;  2GFE A;  4PAI A;  3K1P A;  4LAT A;  3I5O A;  2Y7R A;  2I3W A;  4F18 A;  4G4P A;  3SEW A;  5FHN A;  2NXO A;  1TFD A;  1JW5 A;  2VOZ A;  1Y3P A;  5EQ7 A;  1YTV A;  3IB1 A;  1VR5 A;  1UIV A;  1NH7 A;  3PUX E;  2QVR A;  3LBS A;  1P1Q A;  2QS1 A;  1OMP A;  3PMX A;  4ECF A;  1JQF A;  3U8Q A;  4MAG A;  2VGQ A;  2H5Y A;  1K9Z A;  4E0X A;  3K2D A;  1AH5 A;  2PX1 A;  3TKD A;  2Y7K A;  3CVG A;  3U1O A;  2GH9 A;  3O6G A;  3G3K A;  3VXB A;  2DWJ A;  2AIX A;  4PFW A;  1P1N A;  3CR9 A;  4OFO A;  4RJZ A;  3IX1 A;  4YKK A;  3KJ7 A;  1FBH A;  4H1X A;  5B7D A;  3MP8 A;  4NE4 A;  1N7W A;  1YAE A;  1SYH A;  3T9V A;  3KFM A;  1B7U A;  1VDW A;  4GBW A;  3KC0 A;  3HO7 A;  2PCR A;  2PBW A;  3H6T A;  4OTE A;  2XWV A;  3ROJ A;  4P56 A;  2QL3 A;  4LQ2 A;  4KHZ E;  2REG A;  5I57 B;  5DT6 A;  1SBP A;  2PFY A;  2XWK A;  3LUZ A;  1MQG A;  2I0C A;  1H76 A;  5AA2 B;  3PUV E;  5I59 A;  4NGU A;  1MS7 A;  2F6G A;  2JJK A;  3EHT A;  4FJP A;  4KD5 A;  4NF5 B;  2P3N A;  3PGF A;  4H8J A;  2NWJ A;  3MBP A;  1EZO A;  2WOK A;  1B2H A;  3VVF A;  3IL1 B;  1B7H A;  1MY0 A;  3BKI B;  4XKN A;  4FAT A;  1AOV A;  5CBR A;  3FUZ A;  4AQ4 A;  4N6P A;  2OWZ A;  3Q29 A;  2Q8M A;  4GXS B;  4HCW A;  3BFT A;  4U4X A;  1Y3N A;  4N81 A;  1HSL A;  5I2K A;  4F39 A;  4ZZE A;  4ELQ A;  1WDN A;  4H45 A;  2HEU A;  1D4N A;  2H4I A;  3QYT A;  2WOP A;  3HHF A;  3L6H A;  4ZEC A;  1KA0 A;  4PQJ A;  4QF9 A;  5I5P A;  1B5J A;  4R74 A;  2ZNU A;  5DVF A;  2HZL A;  4QFN A;  3EF7 A;  4H46 A;  1D9Y A;  4PAF A;  4Q5T A;  2E0S A;  3PD8 A;  1QUK A;  4LON B;  3ISP A;  4RY1 A;  4HS7 A;  4P9K A;  3LSL A;  4H67 A;  3H6V A;  2O84 X;  3LC8 A;  2O68 A;  1M5C A;  4U22 A;  1FQD A;  3LUY A;  2D3I A;  1QKA A;  4Q0C A;  4GXA A;  3T9X B;  3SZP A;  1R9L A;  3A3C A;  1R6Z A;  4UA8 A;  2F5X A;  2FBP A;  4OMB A;  2BJI A;  3TTR A;  1FPE A;  1SW2 A;  5EQ9 A;  2B3F A;  3JV9 A;  4FIM A;  1MH3 A;  4QFO A;  1NUZ A;  1AWB A;  2RC8 A;  4I3Y A;  4QFL A;  3C36 A;  3KSJ A;  4F29 A;  3FVG A;  3K00 A;  3MJN A;  4MNI A;  3H6U A;  1KA1 A;  2GHA A;  5FHM A;  3LSX A;  5J1D A;  3DRI A;  3MVX A;  3TFL A;  4OYV A;  3U94 A;  4NED A;  3MZ1 A;  2Q2C A;  4OHN A;  4BDQ A;  3UP9 A;  1TFA A;  4HW8 A;  1Y1M A;  3TUS A;  4NX1 A;  2HPG A;  4RPO A;  4NF4 B;  2KR0 A;  4H8I A;  1FQE A;  2M8C A;  4BDO A;  4F22 A;  1R1N A;  4X04 A;  3TTM A;  5KCJ B;  1FBP A;  2I3V A;  5TPA B;  4EDP A;  4OXV A;  3DP6 A;  3TZA A;  1EH3 A;  2XXI A;  2V3U A;  1LAF E;  2DWI A;  3EHS A;  1POT A;  4EQB A;  5EHS A;  1XOC A;  2F36 A;  4LN5 A;  1LBY A;  3IFA A;  5ET5 A;  5K2X A;  4NF6 A;  4X1B A;  2HFB A;  4PC9 A;  5I56 A;  2OCU A;  4G68 B;  4F2Q A;  4XKR A;  4P3L A;  5M2V A;  1LBV A;  4IO2 A;  2ZYM A;  2FA7 A;  4HE1 A;  1GTK A;  4UAC A;  4IY6 A;  2Y84 A;  5EYG A;  1OIB A;  4U4S A;  3B50 A;  2D5W A;  4GD5 A;  1PB9 A;  1MDQ A;  1Q1K A;  1URS A;  1B51 A;  1O7T A;  1MM6 A;  3LV0 A;  5DYH A;  2XWI A;  2O1L A;  1P1U A;  3PPR A;  3K01 A;  2DVZ A;  4JDF A;  1XVX A;  4WKM A;  4N13 A;  5H8F B;  1OLC A;  1H43 A;  2CZK A;  2DDK A;  5KDT B;  4EQ9 A;  3MST A;  3FD3 A;  5CM6 A;  1USY E;  4O3B A;  3KZG A;  4GX6 A;  4YAH X;  3UN6 A;  3B7D A;  2F7C A;  1A8F A;  1Y1Z A;  1MY4 A;  1H44 A;  3SEV A;  3A3U A;  4OFL A;  2XHD A;  1Y9U A;  2UYE A;  1JVX A;  1BIY A;  1I6Q A;  4XKQ A;  3TCG A;  2I58 A;  4M1V A;  3M3F A;  4NN3 A;  1XT8 A;  4IO5 A;  1FBE A;  2WYK A;  1N04 A;  1LCT A;  4RYA A;  2XX9 A;  2V25 A;  1JW1 A;  2HZK A;  3M8U A;  4EF2 A;  4RK9 A;  4HXV A;  2PVU A;  2Q2A A;  4X1D A;  5I2N A;  1SQY A;  4I62 A;  4OZ9 A;  2DWH A;  2RCB A;  3T0J A;  3UOR A;  2R6G E;  1QKB A;  4PP0 A;  1II5 A;  2VT5 A;  4WEP A;  1GR2 A;  3OD7 A;  5L8D A;  3PAM A;  2QMW A;  5FBP A;  3UGW A;  2F7B A;  4MLV A;  5AA3 A;  4KXP A;  3FGS A;  3GBA A;  3IOW A;  3IK6 B;  4P47 A;  3QUJ A;  5AE4 A;  3E9X A;  1LFI A;  2REJ A;  4KQP A;  1B3H A;  3MPL A;  3D4G A;  5BUU A;  4R2F A;  4GWU A;  3O97 A;  3PTY A;  4KR5 A;  2X26 A;  4BDL A;  4F31 B;  4XTC Q;  1LBB A;  3ZKK A;  3R26 A;  4DXB A;  4Z7E A;  1SPI A;  1B05 A;  2WBB A;  3C35 A;  1LAG E;  1L5T A;  1CE2 A;  3E13 X;  5IM2 A;  3AXF A;  3FVK A;  1NV2 A;  2IEE A;  3HPI A;  1EU8 A;  2Q88 A;  3PMV A;  4LVQ A;  1PEB A;  4PF6 A;  3T9U A;  1IIW A;  3B6T A;  1YZ0 A;  4I8C A;  3PPN A;  3U65 A;  2CEY A;  3FAT A;  1B5H A;  3C31 A;  1BP5 A;  5L9M A;  4E0W A;  2RF1 A;  3SER A;  3A29 A;  1MPB A;  3ZKL A;  2HXR A;  4GVO A;  2L5V A;  4NG7 A;  4JVC A;  3KOT A;  4PTK A;  4JBZ A;  5LDZ A;  5DVI A;  1B9J A;  4YIC A;  2F7A A;  1GV8 A;  4MBP A;  1B40 A;  2F8D A;  4X8R A;  4U2R A;  4JSO A;  1GGG A;  4H6D A;  2KQZ A;  3C9H A;  2F34 A;  3RT8 A;  1IMD A;  4F2O A;  2A5S A;  3RPL A;  1HSE A;  3FVN A;  3GLB A;  4MIJ A;  1I6B A;  5JTY B;  3THI A;  4F19 A;  4XF5 A;  3S9N C;  1S9T A;  3N26 A;  3T1B A;  1A99 A;  3G3H A;  5CC2 A;  3V89 B;  1QUJ A;  3KEI A;  2OK2 A;  4OVP A;  3TPA A;  3T93 B;  3SKP A;  1JP4 A;  2XXQ A;  3DRJ A;  2XXU A;  4XKP A;  1A7L A;  3BIH A;  5HBC A;  1JEV A;  1HSJ A;  3N6U A;  3A09 A;  3S9E A;  4YZZ A;  3QMF A;  2P2A A;  4R73 A;  4NF0 A;  5FHO A;  3PPO A;  3EKI A;  4OVJ A;  1S7Y A;  3K6U A;  3W9V A;  2OJT A;  1B52 A;  4JXI A;  2UVJ A;  2CZH A;  1IEJ A;  3B6Q A;  5I7I A;  1INP A;  5TPA A;  3RN8 A;  3OO9 A;  5H8Q A;  1MXZ A;  5H8H A;  3M3K A;  4NF8 B;  4G68 A;  2RKM A;  4NF4 A;  3SES A;  2ZZW A;  1D3K A;  1SD3 A;  3PPP A;  5IGA A;  3EPE A;  3RYB A;  1JEU A;  4Q30 B;  3VDF A;  5JK4 A;  2I48 A;  4NWD A;  4TOZ A;  3MP1 A;  1S50 A;  4QSD A;  1D9Q A;  3RLF E;  3KGC A;  4NF8 A;  4THI A;  1MQH A;  4PFT A;  3K6W A;  2QS2 A;  4P0I A;  4P8B A;  1XC1 A;  5CMB A;  4PDH A;  5ITO A;  1DTG A;  4R6K A;  1FTA A;  1NNF A;  3VLW A;  5H8F A;  4P0G A;  4H0W A;  4MCO A;  3N94 A;  2I4B A;  1RDY A;  3H6W A;  3SEU A;  1J1N A;  3RTW B;  4ZZA A;  4OVS A;  1ATG A;  3MAM A;  3ILU B;  4Q8R A;  1B7Z A;  1YPN A;  4F3G A;  1B3E A;  5A5X A;  1LAH E;  4YKI A;  1JW4 A;  1EZP A;  4JWY A;  3RTF B;  5H8N B;  2RC7 A;  3KJT A;  2THI A;  2I6E A;  2O6A A;  1FRP A;  5F24 A;  3BBR A;  5CMC A;  1OVT A;  2F78 A;  4MF3 A;  2Y7I A;  2WOL A;  5A5X B;  4I3E A;  4PDD A;  4R6Y A;  2UVG A;  2I4C A;  4MLQ A;  4LZ7 A;  3V5A A;  5EHM A;  4PET A;  3MVZ A;  4P1E A;  3VXC A;  4N6K A;  4OER A;  2XD3 A;  3MYU A;  3E3K A;  1B1H A;  4ZED A;  2WBD A;  4UAB A;  3O6H A;  1EYI A;  1OQG A;  3EN3 A;  4GWO A;  1A40 A;  1IMB A;  3O6P A;  1UTB A;  4PE5 B;  4XIG Q;  1URD A;  1Y3Q A;  2VP1 A;  4F3P A;  3KN8 A;  4NMY A;  2XXW A;  1NMU A;  3E4R A;  3ODB A;  2XXX A;  3MWB A;  5AA2 A;  4BLA A;  4F1Y A;  1LBZ A;  3IO6 A;  1FBF A;  3H3G A;  3MP6 A;  4NAP A;  1FW0 A;  4MNC A;  4U21 A;  1ANF A;  2DSF A;  4FED A;  3EQ1 A;  2F3B A;  5ICQ A;  1NV4 A;  3VLU A;  3MVY A;  3KN7 A;  4GL0 A;  1MXY A;  2GQ1 A;  2RC9 A;  3O28 A;  3V83 A;  3ONM A;  1B46 A;  3RT6 B;  1WOD A;  4NTL A;  2O1M A;  4NHB A;  1MXV A;  3HST A;  4TLL B;  2O7U A;  4OAN A;  4ELO A;  4O8M A;  5AA2 D;  1LFG A;  1BK4 A;  4IB2 A;  3USD A;  3F11 A;  2NVU B;  1P1W A;  5B70 A;  1FQA A;  3OXN A;  1NFT A;  2QS3 A;  3FXB A;  2Q74 A;  2CZI A;  4R75 A;  3S4U A;  2QPQ A;  4H5F A;  2FIE A;  2UVI A;  1TXF A;  4DCY A;  4HE0 A;  5AA4 B;  3FJ7 A;  4OVQ A;  5CMK A;  2AL4 A;  2CMO A;  4OVT A;  4K3F A;  3PUY E;  1FPL A;  4IR8 A;  2Z8D A;  2ZMB A;  4P1L A;  2B4L A;  4GWX A;  4G61 A;  1NKX A;  5I57 A;  4AS4 A;  3RPL B;  1FPF A;  2PFZ A;  3DRF A;  4MNP A;  1NI9 A;  2X7Q A;  2E1S A;  3EHU A;  1O63 A;  3U92 A;  2QVV A;  3DLN A;  1Y4C A;  4NQ8 A;  3DRK A;  3K1N A;  2V93 A;  3HN0 A;  4MX6 A;  3U93 A;  2QRY A;  1IMA A;  1N84 A;  2ZXT A;  1YXI A;  4AB6 A;  3CI8 A;  5JTY A;  4ELP A;  1US5 A;  2WEF A;  3D4C A;  5KCJ A;  3T96 B;  1DMB A;  5H8Q B;  3QXM A;  2B3B A;  5H8H B;  3FXQ A;  1JET A;  3R7X A;  4JB7 A;  1MXU A;  1NV3 A;  3TOD A;  4JVI A;  4OEN A;  2V3T A;  1N3X A;  1N76 A;  4O3A A;  1MDP 1;  2NOO A;  4O7M A;  1NNK A;  4G8N A;  3S9L C;  1G0H A;  1P99 A;  4AB5 A;  3Q28 A;  4L17 A;  4EXL A;  5EQ8 A;  3K6X A;  3KOS A;  4HE2 A;  5HM4 B;  1I6A A;  2CEX A;  4ZE8 A;  2XWO A;  3N6T A;  3PV0 E;  4GX4 A;  1MPD A;  4LA9 A;  1YYZ A;  5KZT A;  1RDX A;  2OZZ A;  4YMB A;  5JEI A;  2ABH A;  1QUI A;  1USY H;  4IO6 A;  3FZV A;  2G93 A;  4DCX A;  3IB0 A;  3OSR A;  2Z23 A;  1K9Y A;  1P1O A;  2XD2 A;  3LR1 A;  5L9O A;  4KCD A;  4O94 A;  1QVS A;  2DYX A;  3PD9 A;  1Y20 A;  1MY3 A;  1M5D A;  3KBR A;  3PPQ A;  3FVO A;  5TP9 B;  5KDT A;  3GYY A;  1B4Z A;  3FIR A;  1QUL A;  2HAU A;  1B32 A;  4EQ7 A;  3RUM A;  4PCD A;  2QMX A;  4IGT A;  3FBP A;  5EYF A;  2WYP A;  3UA8 A;  3VV5 A;  2GRV A;  2OLB A;  2ZZX A;  3CG3 A;  2Q9T A;  4YB7 A;  4GX3 A;  2Y5L A;  4IO7 A;  4ZE9 A;  3TTN A;  1JNF A;  4OVR A;  4F1V A;  3K1M A;  2D21 A;  4GBV A;  2DXY A;  4KFQ A;  3GBB A;  1LB8 A;  3ZSF A;  4DXC A;  3RNN A;  2RCA A;  1DSN A;  4HTG A;  5FTH A;  1N7X A;  4QXD A;  2Y7P A;  2HXW A;  2FNC A;  1D9V A;  1LB9 A;  3C33 A;  5I58 B;  4KI0 E;  5ET7 A;  1AL3 A;  1M5B A;  3C4M A;  1A55 A;  2HAV A;  4RA1 A;  1RYX A;  1TWY A;  3PMW A;  2DWA A;  1XHY A;  4MHF A;  3H4Z A;  1OLA A;  2Z8E A;  1LLS A;  3K6V A;  4G68 C;  1DPE A;  2B65 A;  3W9W A;  4TQU Q;  3KN3 A;  1UQW A;  1ZTY A;  1M5E A;  4G2Z A;  1KWH A;  1UTH A;  4F3S A;  2FYI A;  3G3I A;  3IOU A;  4YU0 A;  2F97 A;  2FVZ A;  3TQL A;  4PFR A;  3HV1 A;  1SYI A;  3BFU A;  1MY1 A;  1B3L A;  3O66 A;  1FQC A;  1PBQ A;  4JWO A;  3CFZ A;  4GQO A;  4R9G A;  3LSW A;  2UYF A;  1RKM A;  3B6W A;  1H3D A;  2XXK A;  1B3G A;  1ZLQ A;  3MC2 A;  3C32 A;  3OSQ A;  1T0K A;  2ONS A;  1B0H A;  2VPN A;  1LFH A;  2QJE A;  1I69 A;  1ZJL A;  4OA4 A;  4ESX A;  1BKA A;  1IMC A;  4U23 A;  5H8N A;  4FEB A;  1O64 A;  4KYE A;  3MW0 A;  4N6D A;  1N0T A;  2VPO A;  1IXH A;  4BDR A;  4I9D A;  4R72 A;  3I3V A;  3MQ9 A;  3IOT A;  4RXL A;  1NUX A;  4LZ8 A;  3QUF A;  1FPG A;  1CNQ A;  2P1S A;  1FTO A;  1FQB A;  1FTJ A;  4N07 A;  4MFI A;  4NWC A;  3ILT B;  3GZG A;  3CIJ A;  5I84 A;  4LZ5 A;  2XXY A;  1NV1 A;  2XX8 A;  3IJX B;  3HHG A;  2R71 A;  2PMS A;  1RYO A;  4O7I A;  4DZ1 A;  4ISU A;  4GLI A;  3OO7 A;  2FIX A;  4OEV A;  5ELV A;  1IXC A;  3IAZ A;  5ICT A;  3ECR A;  5I2N B;  1DTZ A;  3S9M C;  1FTM A;  1NUW A;  4EXK A;  3JYR A;  1US4 A;  1Z7N E;  5ISU A;  5AA4 A;  1XVY A;  2G29 A;  4ZS9 A;  4KPT A;  5DEX B;  2WKY A;  4DLD A;  5IZ1 A;  2XXP A;  2ZNS A;  4AS5 A;  1URG A;  4I1D A;  4OQO A;  3DRH A;  4GF8 A;  1M5F A;  2NUV A;  3QIM A;  5IKB A;  3CSG A;  3N5L A;  3TCH A;  4IO4 A;  1A8E A;  3MZ9 A;  5I59 B;  1AIV A;  1NV6 A;  1MXX A;  4PAK A;  3U72 A;  1LGB C;  5A5L A;  2QFL A;  2Z22 A;  1LST A;  2X7P A;  3T22 A;  1SW4 A;  3VLV A;  4RPN A;  4N17 A;  1MPC A;  3T9H B;  2Z8F A;  3TQW A;  3CFX A;  2DP8 A;  3FTO A;  3VVE A;  2WX9 A;  3DRG A;  1FPJ A;  4WXJ A;  1ZIU A;  4LQ5 A;  4PGN A;  2V84 A;  3H7M A;  1BLF A;  1DK4 A;  3VVD A;  5EQA A;  4OET A;  2PT1 A;  5DVJ A;  2PYY A;  4PGP A;  3G3J A;  5F7V A;  4C1U A;  4JWX A;  4FAJ A;  4R2B A;  1B6H A;  4R6H A;  3DEL B;  1IIT A;  5HPQ A;  4YB6 A;  1RDZ A;  4GFR A;  2H9B A;  3TTL A;  4QFK A;  1Q35 A;  4P11 A;  3O9P A;  3RPW A;  4PFB A;  3QK6 A;  2F6P A;  1AMF A;  3Q26 A;  2W7Y A;  4N91 A;  2VD3 A;  3TTK A;  2MKZ A;  5AA1 A;  1EYK A;  3IOR A;  3T66 A;  1FBG A;  3TAJ A;  1H45 A;  3OO8 A;  1FJ9 A;  1BTJ A;  4FBP A;  1ZKB A;  1NUY A;  1OQH A;  1IME A;  3CHG A;  4DE8 A;  3IFC A;  2Y7W A;  2DE2 A;  4PE3 A;  2KLF A;  2XA5 A;  4EF1 A;  3VE1 B;  4OES A;  5BWJ A;  5IZZ A;  1ZMG A;  3OEK A;  5TP9 A;  3G3G A;  2ZZV A;  2I0B A;  4N8Y A;  4F1U A;  4RNS A;  3S2V A;  2FHY A;  5I58 A;  1A54 A;  5I3S A;  2DQV A;  3PUZ E;  1DPP A;  1QJM A;  3RY3 A;  4FOR A;  3RYA A;  2Q8J A;  1ZBM A;  4MJO A;  3TCF A;  2O7I A;  4JSD A;  5J16 A;  4GRK A;  1PC3 A;  4ZEI A;  3L6G A;  4ZEB A;  2OWT A;  1PBP A;  5K2Y A;  1UTB B;  1LBX A;  3IO4 A;  1MQI A;  3O2A A;  1LEV A;  4X9T A;  1IQ7 A;  1VSO A;  4DI4 B;  2QS4 A;  4N8G A;  3CRB A;  5H8S A;  3WAE A;  5LOM A;  5EYH A;  4LP2 B;  2PT2 A;  1IUD A;  4R9F A;  3FXR A;  3FV1 A;  1TT1 A;  3DP4 A;  1B5I A;  4FEC A;  5DW8 A;  3TEL A;  1PB8 A;  4YKJ A;  4X48 A;  1DCU A;  1FPI A;  4JVD A;  1G0I A;  3UIF A;  1OVB A;  4ONY A;  3KC1 A;  2XXV A;  3FJG A;  1QGX A;  1FTL A;  4BDM A;  4PBQ A;  1UIU A;  3P7I A;  3FV2 A;  4DI3 D;  3IR1 A;  4GWS A;  2F35 A;  1NNT A;  1B1X A;  2Y5K A;  3HCQ A;  2VHA A;  2QVU A;  2LAO A;  2XXR A;  3K02 A;  1MRP A;  4TLM B;  3HFU A;  4G8M A;  4DIG A;  1EZ9 A;  2DE4 A;  5LTC A;  2ESN A;  3TYH A;  3W15 C;  5IAI A;  3TDJ A;  2XX7 A;  1CB6 A;  3FJM A;  1VFE A;  5L9S A;  3QSL A;  3OOA A;  5CBS A;  5IZ3 B;  3G3F A;  2IA4 A;  4EUO A;  4QSE A;  2I49 A;  4KYS A;  1Q9D A;  1FBD A;  4IGR A;  1MQD A;  3PUW E;  4XFE A;  4PBH A;  3H06 B;  2DVC A;  1SI1 A;  1LBW A;  3KBZ A;  2YPN A;  2H25 A;  4KCC A;  1NNP A;  5IZ3 A;  1POY 1;  2R8T A;  2H99 A;  3Q25 A;  3I6V A;  1SW1 A;  3IJO B;  5ET6 A;  1MM7 A;  1PB7 A;  1B3F A; 
#chains in the Genus database with same CATH homology
 1XS5 A;  2B65 A;  3W9W A;  2CZL A;  4Z0I A;  4H65 A;  2D3I A;  5KCJ A;  4TQU Q;  1XC1 A;  1QKA A;  3KN3 A;  4Q0C A;  1UQW A;  4QFP A;  1ZTY A;  1B0L A;  1M5E A;  4G2Z A;  1KWH A;  1UTH A;  4GXA A;  1B4H A;  5CMB A;  1LBC A;  3T9X B;  4F3S A;  1IXI A;  1SDX A;  2FYI A;  3CSB A;  4G77 A;  5ITO A;  1R9L A;  3G3I A;  3IOU A;  3A3C A;  1FTK A;  1R6Z A;  5CMM A;  4UA8 A;  1DTG A;  2F5X A;  4R6K A;  4YU0 A;  5CRY A;  2F97 A;  4DXU A;  4OMB A;  3TQL A;  1MQJ A;  5B7D A;  2GHB A;  1SYI A;  3HV1 A;  1NNF A;  3TTR A;  1SW2 A;  4QRZ A;  3VLW A;  4P0G A;  5H8F A;  4H0W A;  1WVJ A;  3BFU A;  1LCF A;  1MY1 A;  1B3L A;  2B3F A;  3JV9 A;  3K6W A;  3O66 A;  1FQC A;  4FIM A;  1MH3 A;  1PBQ A;  2QSX A;  3N94 A;  2I4B A;  4JWO A;  3SDF A;  4QFO A;  3H6W A;  3SEU A;  1J1N A;  3CFZ A;  2RC8 A;  4GQO A;  4R9G A;  3LSW A;  3IOV A;  3RTW B;  2UYF A;  4ZZA A;  1RKM A;  4PFU A;  4HCY A;  4NF5 A;  2OWS A;  4IO3 A;  2HQ0 A;  4QFL A;  3C36 A;  2ZNT A;  3KSJ A;  3WAF A;  4F29 A;  3DP8 A;  3B6W A;  1ATG A;  3FVG A;  3K00 A;  3MJN A;  5L9S A;  1H3D A;  3MAM A;  2UXA A;  3ILU B;  1B3G A;  3H6U A;  1B7Z A;  2YJP A;  4Q8R A;  2GHA A;  2HCA A;  3IB2 A;  3KG2 A;  1YPN A;  4POW A;  3K4U A;  1ZLQ A;  3Q27 A;  3MC2 A;  5FHM A;  1B3E A;  3C32 A;  2BJJ X;  1IXG A;  1LAH E;  4F3G A;  5A5X A;  3LSX A;  1ELJ A;  3MVW A;  3OSQ A;  4YKI A;  5DEX A;  5J1D A;  3DRI A;  2ONS A;  1B0H A;  4RK2 A;  4U1Z A;  3MVX A;  4F39 A;  1LFH A;  1JW4 A;  4OYV A;  2QJE A;  3TFL A;  1I69 A;  1ZJL A;  3OEL A;  3U94 A;  4NED A;  3MZ1 A;  2Q2C A;  4OHN A;  3DM0 A;  4ESX A;  4BDQ A;  4JWY A;  1BKA A;  3RTF B;  2ZYK A;  3UP9 A;  2RC7 A;  5H8N B;  3KJT A;  2THI A;  5IAI A;  4U23 A;  1TFA A;  4YB5 A;  4HW8 A;  2I6E A;  2O6A A;  3FXU A;  5H8N A;  1Y1M A;  2O51 A;  3TUS A;  4FEB A;  1O64 A;  4KYE A;  3MW0 A;  1N0T A;  3BBR A;  1IXH A;  3ZS6 A;  3FAS A;  4RPO A;  1OVT A;  5CMC A;  4NF4 B;  4BDR A;  4I9D A;  2F78 A;  3MUQ A;  2Y7I A;  4MF3 A;  4R72 A;  4H8I A;  2WOL A;  1N3W A;  1FQE A;  3I3V A;  2M8C A;  4BDO A;  5A5X B;  4F22 A;  3MQ9 A;  1R1N A;  4R6Y A;  2UVG A;  3IOT A;  2I4C A;  4MLQ A;  4RXL A;  4YMA A;  1Z7M E;  4LZ8 A;  4LZ7 A;  1VE4 A;  2UVH A;  3QUF A;  1F9B A;  3TTM A;  1DOT A;  3V5A A;  5KCJ B;  5EHM A;  2P1S A;  4PET A;  3MVZ A;  2ONR A;  1FTO A;  1SI0 A;  2I3V A;  5TPA B;  1FQB A;  1FTJ A;  1PDA A;  4N07 A;  4MFI A;  4EDP A;  1B58 A;  4NWC A;  4OXV A;  3GXA A;  1YCJ A;  3ILT B;  4H5G A;  3DP6 A;  3TZA A;  1EH3 A;  3GZG A;  3MPK A;  3VXC A;  2P0S A;  1MXW A;  5F1Q A;  2XXI A;  5I2K B;  2V3U A;  4F3B A;  4YKP A;  1Y4T A;  3CIJ A;  3OMB A;  1LAF E;  5I84 A;  4LZ5 A;  2XXY A;  3CFL A;  4OER A;  2DWI A;  2XX8 A;  3EHS A;  2XD3 A;  1POT A;  3IJX B;  3K0V A;  4EQB A;  3OO6 A;  5EHS A;  3HHG A;  1XOC A;  2R71 A;  3KSX A;  3LSF B;  2F36 A;  3E3K A;  2AL5 A;  1SW5 A;  3TEP A;  1B1H A;  4ZEK A;  4ZED A;  5I56 B;  2PMS A;  1RYO A;  5K2X A;  4NF6 A;  4X1B A;  4ISU A;  1VFD A;  2O69 A;  5TU0 A;  3SET A;  2HFB A;  4DZ1 A;  3O6H A;  5I56 A;  1B3F A;  4GLI A;  3MZB A;  2OCU A;  1OQG A;  3EN3 A;  4GWO A;  1A40 A;  3OO7 A;  4G68 B;  4F2Q A;  3O6P A;  4XKR A;  5M2V A;  4OEV A;  1UTB A;  3QAX A;  5ELV A;  4PE5 B;  4XIG Q;  1IXC A;  3IAZ A;  5ICT A;  2DOJ A;  4IO2 A;  2ZYM A;  3ECR A;  3PU5 A;  1URD A;  1Y3Q A;  2FA7 A;  4ESW A;  1GTK A;  2RIN A;  5I2N B;  2VP1 A;  1DTZ A;  3S9M C;  1ZU0 A;  2B4M A;  3KN8 A;  1FTM A;  4NMY A;  2XXW A;  4IY6 A;  4UAC A;  4F3P A;  3V8X B;  4EXK A;  1NMU A;  2Y84 A;  3E4R A;  3JYR A;  2DXR A;  1US4 A;  3ODB A;  4GIZ A;  1GVC A;  1OIB A;  4U4S A;  1Z7N E;  5ISU A;  2D5W A;  2XXX A;  4GD5 A;  3MWB A;  5AA2 A;  1PB9 A;  5AA4 A;  1XVY A;  4BLA A;  1MDQ A;  2G29 A;  1Q1K A;  3M3L A;  3RGY A;  4ZS9 A;  4KPT A;  5DEX B;  4F1Y A;  2WKY A;  1URS A;  4DLD A;  4M4G A;  4XXU A;  1B51 A;  1O7T A;  3IO6 A;  4GOT A;  1MM6 A;  3O6I A;  2XXP A;  2ZNS A;  5DYH A;  3H3G A;  3MP6 A;  4OFJ A;  2O1L A;  1MY2 A;  1URG A;  2VD2 A;  4I1D A;  1P1U A;  4OQO A;  1FW0 A;  3DRH A;  3PPR A;  3K01 A;  2DVZ A;  4GF8 A;  4U1O A;  1M5F A;  2NUV A;  4JDF A;  1XVX A;  4U21 A;  1ANF A;  3QIM A;  5IKB A;  3CSG A;  3N5L A;  3TCH A;  2DSF A;  4FED A;  3EQ1 A;  4IO4 A;  3R6U A;  1A8E A;  5ICQ A;  4WKM A;  5FTI A;  4N13 A;  5H8F B;  3MZ9 A;  1OLC A;  1QW0 A;  3VLU A;  5ITP A;  1H43 A;  3MVY A;  5I59 B;  5KDT B;  3UK4 A;  1AIV A;  3KN7 A;  4EQ9 A;  1MXX A;  4GL0 A;  3U72 A;  1MXY A;  2RC9 A;  3O28 A;  4DDD A;  3FD3 A;  2Q89 A;  1LGB C;  5CM6 A;  3V83 A;  3ONM A;  4OEU A;  2Z22 A;  1LST A;  1B46 A;  2X7P A;  5CI5 A;  3RT6 B;  3T22 A;  2YLN A;  4O3C A;  1SW4 A;  3VLV A;  1USY E;  4O3B A;  3KZG A;  4OWD A;  4RPN A;  1WOD A;  4NTL A;  2R9J A;  1MPC A;  3T9H B;  4YAH X;  3UN6 A;  2Z8F A;  3TQW A;  3B7D A;  2O1M A;  2F7C A;  3CFX A;  1A8F A;  2DP8 A;  3FTO A;  2OBG A;  4FE8 A;  3VVE A;  1Y1Z A;  1MY4 A;  1H44 A;  3DRG A;  1MH4 A;  3SEV A;  1MXV A;  4C0R A;  3A3U A;  4OFL A;  2XHD A;  4ZEF A;  3HST A;  4TLL B;  4WXJ A;  1ZIU A;  2O7U A;  4LQ5 A;  1Y9U A;  2A5T A;  2V84 A;  2UYE A;  3H7M A;  4ELO A;  1JVX A;  1FCK A;  1BIY A;  1I6Q A;  1LFG A;  4ZDM A;  5AA2 D;  4IB2 A;  3USD A;  4XKQ A;  1BLF A;  3O29 A;  1FQF A;  3F11 A;  3TCG A;  2I58 A;  3VVD A;  2NVU B;  1P1W A;  4OET A;  4M1V A;  1FQA A;  1NL5 A;  3OXN A;  5B70 A;  1NFT A;  2PT1 A;  5DVJ A;  1JVY A;  2PYY A;  2ZYO A;  3VFJ A;  4BDN A;  3M3F A;  3G7W A;  2QS3 A;  2XXH A;  3C34 A;  3G3J A;  4IY5 A;  5F7V A;  4C1U A;  3H03 A;  4G8H A;  4FAJ A;  4JWX A;  4QSC A;  1IZ1 A;  1UTH B;  2ANJ A;  1LAX A;  1XT8 A;  4IO5 A;  4R2B A;  1B6H A;  4R6H A;  3DEL B;  4ND9 A;  3OEN A;  4QHQ A;  4R75 A;  2A5T B;  1IIT A;  2ONK E;  5DTB A;  3S4U A;  2QPQ A;  2ALU A;  4H5F A;  5HPQ A;  1N04 A;  2UVI A;  1TXF A;  3RQT A;  3LVU A;  3JZJ A;  4POX A;  4YB6 A;  1LCT A;  3SEY A;  2ZYN A;  4GFR A;  1NH8 A;  4DCY A;  4RYA A;  3SEX A;  2XX9 A;  2H9B A;  2V25 A;  3TTL A;  5AA4 B;  3FJ7 A;  4NF6 B;  5CMK A;  1JW1 A;  2DS9 A;  2AL4 A;  3M8U A;  2HZK A;  4EF2 A;  4RK9 A;  4QFK A;  1Q35 A;  4P11 A;  3O9P A;  2CMO A;  3RPW A;  2PVU A;  2Q2A A;  2F6P A;  3QK6 A;  1R9Q A;  3TMG A;  2XXT A;  4C1T A;  1AMF A;  4X1D A;  5I2N A;  3Q26 A;  4MH5 A;  1SQY A;  2H98 A;  4K3F A;  1SVX B;  2W7Y A;  3PUY E;  4I62 A;  4LUB A;  4OZ9 A;  2DE3 A;  4WED A;  2DWH A;  2VD3 A;  3TTK A;  2RCB A;  2Z8D A;  4ELR A;  2ZMB A;  2B4L A;  2V3Q A;  5AA1 A;  3UOR A;  5I57 B;  2R6G E;  4KYD A;  3IOR A;  1NKX A;  4PFY A;  3T66 A;  1QKB A;  4PP0 A;  4GL8 A;  1II5 A;  1H45 A;  3TAJ A;  3OO8 A;  5I57 A;  2AYS A;  4WEP A;  1BTJ A;  1MG1 A;  1GR2 A;  3OEM A;  1ZKB A;  3OD7 A;  5L8D A;  3PAM A;  3DRF A;  1OQH A;  3CG1 A;  2GFE A;  2QMW A;  3CHG A;  3K1P A;  4LAT A;  4DE8 A;  3UGW A;  2X7Q A;  2F7B A;  2E1S A;  3EHU A;  3I5O A;  1O63 A;  2Y7R A;  4MLV A;  5AA3 A;  2I3W A;  3U92 A;  2Y7W A;  3DLN A;  1Y4C A;  2DE2 A;  3FGS A;  3GBA A;  4F18 A;  4G4P A;  5L9O A;  3IOW A;  2KLF A;  3SEW A;  3DRK A;  3IK6 B;  5FHN A;  4EF1 A;  3VE1 B;  3QUJ A;  5AE4 A;  2NXO A;  1TFD A;  1JW5 A;  4OES A;  3E9X A;  2VOZ A;  1LFI A;  3K1N A;  5BWJ A;  1Y3P A;  1YTV A;  2V93 A;  2REJ A;  3HN0 A;  2QRY A;  4KQP A;  3IB1 A;  3U93 A;  1N84 A;  1B3H A;  2ZXT A;  1ZMG A;  1VR5 A;  3OEK A;  5TP9 A;  3CI8 A;  4AB6 A;  3MPL A;  3G3G A;  3D4G A;  5BUU A;  4R2F A;  1UIV A;  2I0B A;  5JTY A;  3O97 A;  1NH7 A;  1US5 A;  3D4C A;  3PUX E;  4KR5 A;  2X26 A;  3LBS A;  4BDL A;  4ELP A;  4F1U A;  4F31 B;  4RNS A;  1P1Q A;  4XTC Q;  1LBB A;  2QS1 A;  3T96 B;  1OMP A;  3PMX A;  3S2V A;  1DMB A;  3R26 A;  5H8Q B;  3ZKK A;  1A54 A;  4ECF A;  4DXB A;  4Z7E A;  5I58 A;  3QXM A;  1B05 A;  2B3B A;  5H8H B;  2DQV A;  3FXQ A;  1JET A;  1JQF A;  3R7X A;  3U8Q A;  3C35 A;  3PUZ E;  4JB7 A;  1DPP A;  2VGQ A;  1QJM A;  1MXU A;  1LAG E;  2H5Y A;  1CE2 A;  3LUY A;  3RY3 A;  3E13 X;  1L5T A;  4E0X A;  3K2D A;  3AXF A;  1AH5 A;  2PX1 A;  3FVK A;  4FOR A;  3RYA A;  2IEE A;  2Q8J A;  3HPI A;  1EU8 A;  3TOD A;  4OEN A;  2Q88 A;  1N3X A;  2V3T A;  1ZBM A;  1N76 A;  3PMV A;  1MDP 1;  4LVQ A;  4O3A A;  1PEB A;  2Y7K A;  3TCF A;  3T9U A;  2NOO A;  2O7I A;  4JSD A;  1IIW A;  1NNK A;  4GRK A;  3B6T A;  4G8N A;  3CVG A;  4I8C A;  3PPN A;  3U1O A;  3S9L C;  2GH9 A;  3O6G A;  3G3K A;  1P99 A;  1PC3 A;  1B5H A;  4ZEI A;  3FAT A;  3L6G A;  4AB5 A;  3C31 A;  3VXB A;  4ZEB A;  2DWJ A;  2OWT A;  1BP5 A;  3Q28 A;  4L17 A;  5L9M A;  1PBP A;  5K2Y A;  1UTB B;  4E0W A;  2RF1 A;  4EXL A;  3IO4 A;  1MQI A;  3K6X A;  3SER A;  3O2A A;  2AIX A;  4PFW A;  1P1N A;  3CR9 A;  3KOS A;  5JTY B;  4OFO A;  5HM4 B;  1MPB A;  3IX1 A;  3KJ7 A;  4H1X A;  4RJZ A;  1IQ7 A;  1I6A A;  3MP8 A;  4X9T A;  4NE4 A;  4YKK A;  1VSO A;  4GVO A;  4ZE8 A;  1N7W A;  1YAE A;  1SYH A;  3N6T A;  2QS4 A;  3PV0 E;  3T9V A;  3KFM A;  1B7U A;  1MPD A;  3CRB A;  4LA9 A;  3KOT A;  5H8S A;  3WAE A;  5KZT A;  4JBZ A;  5LOM A;  5DVI A;  2OZZ A;  1B9J A;  4YMB A;  5JEI A;  3HO7 A;  2ABH A;  4LP2 B;  4YIC A;  2PT2 A;  1IUD A;  2F7A A;  4R9F A;  1QUI A;  1USY H;  2PBW A;  4IO6 A;  1GV8 A;  3FXR A;  3FZV A;  2G93 A;  3H6T A;  4OTE A;  4DCX A;  3IB0 A;  4MBP A;  3FV1 A;  3OSR A;  1B40 A;  2QL3 A;  2Z23 A;  1TT1 A;  2F8D A;  3DP4 A;  1B5I A;  4JSO A;  4U2R A;  1GGG A;  4FEC A;  1P1O A;  4LQ2 A;  2XD2 A;  3LR1 A;  3TEL A;  1PB8 A;  4H6D A;  4KCD A;  4KHZ E;  2REG A;  4X48 A;  1QVS A;  3C9H A;  4YKJ A;  3UIF A;  1OVB A;  4ONY A;  2DYX A;  5DT6 A;  2XXV A;  3FJG A;  1SBP A;  1FTL A;  3PD9 A;  2F34 A;  4BDM A;  3RT8 A;  1MQG A;  1Y20 A;  1H76 A;  1M5D A;  1MY3 A;  2I0C A;  3KBR A;  3PPQ A;  3FVO A;  4F2O A;  3PUV E;  5TP9 B;  5AA2 B;  2A5S A;  1HSE A;  5I59 A;  3FVN A;  3GLB A;  5KDT A;  1I6B A;  1B4Z A;  1UIU A;  1MS7 A;  2F6G A;  3EHT A;  3FIR A;  3P7I A;  4FJP A;  1QUL A;  3FV2 A;  4KD5 A;  2HAU A;  4NF5 B;  3THI A;  1B32 A;  4F19 A;  4EQ7 A;  3RUM A;  3TKD A;  3PGF A;  3IR1 A;  2QMX A;  4H8J A;  2NWJ A;  2F35 A;  3MBP A;  4IGT A;  3S9N C;  1S9T A;  1EZO A;  2WOK A;  3N26 A;  5EYF A;  1B2H A;  3UA8 A;  1A99 A;  3VVF A;  3G3H A;  3VV5 A;  3S9E A;  2GRV A;  3IL1 B;  1EZP A;  1B7H A;  1NNT A;  5CC2 A;  1B1X A;  1MY0 A;  3V89 B;  1QUJ A;  3BKI B;  4XKN A;  3HCQ A;  2OLB A;  2OK2 A;  3KEI A;  4FAT A;  1AOV A;  2VHA A;  3CG3 A;  5CBR A;  2LAO A;  3TPA A;  2Q9T A;  4YB7 A;  3T93 B;  3FUZ A;  2XXQ A;  3SKP A;  4AQ4 A;  3DRJ A;  2XXR A;  4N6P A;  2XXU A;  4XKP A;  1A7L A;  3K02 A;  1MRP A;  4IO7 A;  4ZE9 A;  4G8M A;  4TLM B;  3TTN A;  4DIG A;  1T0K A;  1EZ9 A;  3Q29 A;  5HBC A;  2DE4 A;  1JNF A;  2ESN A;  1JEV A;  3TYH A;  1HSJ A;  3TDJ A;  3N6U A;  3W15 C;  4GXS B;  2XX7 A;  4HCW A;  1CB6 A;  2D21 A;  3A09 A;  3K1M A;  4YZZ A;  4F1V A;  2P2A A;  2DXY A;  4R73 A;  3BFT A;  4KFQ A;  4U4X A;  3GBB A;  5FHO A;  3PPO A;  1Y3N A;  1HSL A;  1LB8 A;  5I2K A;  4OVJ A;  3ZSF A;  3FJM A;  1VFE A;  4ZZE A;  4ELQ A;  3QSL A;  1S7Y A;  3OOA A;  3RNN A;  3K6U A;  4DXC A;  5CBS A;  1WDN A;  3W9V A;  2HEU A;  1D4N A;  2OJT A;  1B52 A;  3G3F A;  2RCA A;  2IA4 A;  4JXI A;  2UVJ A;  4EUO A;  2H4I A;  3QYT A;  2WOP A;  1DSN A;  4HTG A;  3HHF A;  1IEJ A;  5FTH A;  4QSE A;  1N7X A;  2I49 A;  3B6Q A;  4ZEC A;  3L6H A;  4KYS A;  5TPA A;  2Y7P A;  2HXW A;  2FNC A;  3RN8 A;  4PQJ A;  4QF9 A;  1D9V A;  1LB9 A;  1MQD A;  1B5J A;  3C33 A;  3OO9 A;  4IGR A;  2ZNU A;  3PUW E;  4R74 A;  1MXZ A;  5H8Q A;  5DVF A;  5H8H A;  3M3K A;  2HZL A;  4QFN A;  4NF8 B;  4G68 A;  3H06 B;  4KI0 E;  3EF7 A;  3ZKL A;  2RKM A;  2DVC A;  1D9Y A;  1SI1 A;  4NF4 A;  1AL3 A;  3SES A;  1M5B A;  4Q5T A;  3C4M A;  2YPN A;  2H25 A;  4KCC A;  2E0S A;  1D3K A;  3PD8 A;  1QUK A;  4LON B;  1NNP A;  1A55 A;  1SD3 A;  2HAV A;  3PPP A;  1POY 1;  4RY1 A;  2H99 A;  3EPE A;  3RYB A;  3Q25 A;  4HS7 A;  4RA1 A;  1JEU A;  1RYX A;  4Q30 B;  3VDF A;  5JK4 A;  3I6V A;  1TWY A;  3LSL A;  2DWA A;  3PMW A;  2I48 A;  3H6V A;  4TOZ A;  1SW1 A;  1XHY A;  4H67 A;  2O84 X;  4NWD A;  3H4Z A;  1OLA A;  3LC8 A;  1S50 A;  2Z8E A;  3MP1 A;  4QSD A;  2O68 A;  3RLF E;  3KGC A;  5I58 B;  1M5C A;  1LLS A;  4U22 A;  3IJO B;  3K6V A;  4NF8 A;  4THI A;  1MQH A;  4G68 C;  1MM7 A;  1PB7 A;  1FQD A;  4PFT A;  1DPE A;  2QS2 A;  4P0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...