1JEVA

Oligo-peptide binding protein (oppa) complexed with kwk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (peptide transport/peptide)
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title The role of water in sequence-independent ligand binding by an oligopeptide transporter protein.
pubmed doi rcsb
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1996-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1jevA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jevA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1jevA02
2GHBA 1MH4A 1OQHA 1II5A 3PD9A 2DSFA 5AA2A 2PMSA 1Y3QA 3HO7A 3KEIA 1Y9UA 3K6UA 3H6WA 3VLVA 1OLCA 3PPPA 1JEVA 1SDXA 2LAOA 1NNPA 1US4A 4EQBA 2XXUA 3TELA 4NF8B 1PEBA 2PVUA 3KFMA 2Q88A 2OK2A 1EU8A 1Z7ME 4R9FA 4NF5B 3R7XA 2ZNSA 5I58A 3RPWA 3ILUB 3M3KA 3SEUA 2DP8A 1SW5A 1OLAA 4G68C 3G3GA 4GVOA 4JB7A 3RNNA 1IXGA 3RYBA 5CBSA 3K1MA 1D4NA 3AXFA 1ELJA 3GZGA 4PQJA 3KN8A 2I0CA 2X7QA 2FNCA 1HSJA 3S9NC 4UA8A 1N3WA 3OO9A 3V5AA 1N0TA 5ITOA 3K01A 1LCTA 2ANJA 4DXBA 3K6VA 2VHAA 1OQGA 2THIA 3E9XA 3SEVA 4GF8A 1M5EA 2ABHA 2DXRA 1SD3A 4YICA 3TTRA 1B5JA 3HN0A 3U93A 3GBBA 1R9QA 3WAFA 1I6BA 4BDMA 1B2HA 2DS9A 2DWJA 1B3HA 2E1SA 1SW2A 3P7IA 1FQAA 5CMKA 4OETA 3U92A 3HHFA 2FYIA 2Y7IA 1MG1A 1B9JA 2O51A 3FD3A 4QFPA 4ND9A 1USYH 2HEUA 5I59B 4QRZA 1LFGA 3U1OA 1B5HA 1UTHB 3M3FA 2QL3A 3PPQA 4U23A 1A7LA 3SEXA 4ELRA 4ZZAA 1A54A 4KFQA 1RYXA 3HPIA 4BDQA 3PGFA 4YMBA 4FJPA 4ZECA 4ELQA 1SI0A 2I48A 4KD5A 1GR2A 4R73A 3IB1A 1MQJA 1TT1A 4C1TA 1B4ZA 3TEPA 3RT8A 3KOSA 3K1PA 4RNSA 5CC2A 3E4RA 1URGA 4H67A 1QULA 4G68A 1O64A 2G93A 3OSRA 2P1SA 4MLVA 1D9VA 1MQDA 5H8QA 3A3UA 1D9YA 3FJ7A 3N6TA 3T22A 3OEMA 1FCKA 2D3IA 4ZE8A 4H5GA 3DP8A 4P0IA 1JW5A 2B4MA 3MJNA 1PDAA 2GH9A 1QUIA 3OMBA 3H3GA 4FE8A 3IB2A 5I57A 4R6YA 1YPNA 4UACA 4FIMA 3PD8A 2A5TA 4DZ1A 4F39A 5KCJB 3B6WA 4N13A 4M4GA 3UGWA 2ONSA 5H8NB 2ZXTA 3OO7A 4QFKA 3SERA 4EQ7A 2PBWA 3DRFA 3IAZA 1Z7NE 4NF6A 2DWAA 4DDDA 2YLNA 3D4CA 1MPDA 4U1OA 2QS1A 2HZKA 3TCFA 2XXVA 4XKRA 4XXUA 1AOVA 1FQBA 1Y3PA 3B7DA 5DEXA 4ZEKA 5FTHA 3VVFA 4OQOA 5A5XB 4OESA 5TU0A 2REGA 2UXAA 2XXQA 1LBCA 3I3VA 4FEDA 1LB9A 3ONMA 4E0WA 1QJMA 3FVKA 2VGQA 5AA3A 3FZVA 1MRPA 1LBBA 5JEIA 4HCYA 4TLMB 3RGYA 3VXCA 5TPAB 3RN8A 3RUMA 2E0SA 2A5SA 2XXHA 2B3FA 4MLQA 3IL1B 3TUSA 3O28A 1B7UA 5J1DA 2UVIA 2WOPA 4R2FA 4QFOA 3C33A 3TTNA 4R6KA 2Z8DA 2I6EA 4EF2A 5BWJA 3BKIB 2H4IA 3RT6B 2X26A 3FV1A 2PYYA 3C9HA 4XKNA 4EXKA 1DMBA 3VFJA 4X1BA 4RY1A 5M2VA 1IXCA 2DVCA 4M1VA 1O63A 1IXIA 3CFLA 3HV1A 2V84A 1P99A 3FGSA 3U8QA 1MDQA 1B6HA 4BDNA 3OO6A 1IITA 1Y1MA 3GXAA 1HSLA 1AMFA 1TFAA 4KCDA 4NWCA 1YCJA 2YJPA 1QW0A 4YMAA 1IZ1A 1FQEA 1KWHA 4IY5A 2QMXA 2AL5A 1OIBA 3V89B 3KOTA 4LQ5A 3IJOB 4F3PA 3CSGA 3SKPA 2ZNTA 2P2AA 3CI8A 3S9LC 3GBAA 4BLAA 4QSEA 4DE8A 4DXUA 3OELA 5K2YA 4I62A 2FA7A 4OYVA 1NL5A 3MP6A 4KYDA 4R2BA 1DTGA 4ZEDA 3C32A 4RK2A 3U94A 5F1QA 2X7PA 3PAMA 2I3WA 3JZJA 4ISUA 1JVXA 2DWHA 1AL3A 3KJTA 1CE2A 3TYHA 4DXCA 4THIA 2ALUA 2XXIA 4I8CA 3BBRA 5CMMA 2NUVA 2RC7A 1MY3A 4IGTA 5DT6A 3Q25A 3VVEA 4QFLA 4OVJA 2OLBA 4NF4A 2PT1A 2QS3A 3MZ9A 5KDTA 1EZ9A 4BDRA 1XC1A 5DTBA 4PFWA 2QPQA 4ONYA 2XXTA 4IO3A 1N7XA 1B3LA 4OERA 3PMXA 2UVHA 4RXLA 1JETA 1A99A 1MY2A 1POTA 4JBZA 2I4CA 4LP2B 4FECA 1FTKA 3IOUA 1MXVA 3KBRA 4OFLA 2B3BA 4U2RA 1ZU0A 4G8NA 3FJMA 4ECFA 2IEEA 1BP5A 2H98A 4WEPA 1XOCA 3QK6A 4Z7EA 3KN3A 5FHNA 4EQ9A 5ITPA 2XXPA 3O9PA 4EXLA 1NNKA 4FATA 5L9MA 2F5XA 5ISUA 1M5BA 2HZLA 2VD3A 3RTWB 4F29A 4XIGQ 4U4XA 3O6HA 4H6DA 4OMBA 3FXRA 5F7VA 4OXVA 3PPNA 1TWYA 4IO4A 4NF8A 2NXOA 3QAXA 4QSDA 4MBPA 3MPKA 3E13X 1B46A 1LGBC 3FVNA 1NFTA 3MW0A 1N04A 5JTYB 4ZZEA 3SESA 4GFRA 5DYHA 2VD2A 3T9XB 2WOKA 1B3GA 4QHQA 5LOMA 1SQYA 1FQDA 1FTLA 2QRYA 1MXXA 4GD5A 5CI5A 5I2NB 1MQHA 4AQ4A 4X48A 1D3KA 4ZE9A 2AIXA 1MXYA 1LAXA 1MY0A 2R6GE 3DRJA 4G8MA 5I84A 4G4PA 4JWXA 3S9MC 3O29A 2XXRA 3LSFB 3SETA 2HFBA 3DRIA 3F11A 3TCHA 3DELB 1LLSA 3THIA 1ANFA 4P11A 1VFEA 3OXNA 3DRGA 3S4UA 1N3XA 1FW0A 2F8DA 1S7YA 4NTLA 1OVBA 3H4ZA 3PUXE 1MDP1 3G3KA 4DCXA 3UP9A 1RKMA 3G3HA 3B6QA 3FVOA 4IB2A 3PUWE 4YU0A 3MZ1A 4OEUA 5L9OA 3BFTA 4YAHX 2XX7A 4EUOA 5I56B 1A8EA 5K2XA 5I59A 1LFIA 4U1ZA 3K4UA 3H6UA 3O66A 1UTHA 2HAVA 5ICQA 3LVUA 4PFTA 1LAGE 1OVTA 1VSOA 4DIGA 2V25A 4F1YA 3UN6A 4DLDA 1H3DA 2VP1A 3IK6B 4AB5A 3IOTA 2F6PA 3FIRA 5H8HB 1ZKBA 4TLLB 4PE5B 1QUKA 3PUVE 4JWYA 3MVYA 4OFJA 5AA1A 1H43A 4JSOA 1Y1ZA 3VXBA 1VFDA 5HBCA 1POY1 3KSJA 4GIZA 5CBRA 2AL4A 4R74A 3CHGA 2H5YA 5EHSA 1SBPA 3IX1A 3IO6A 3K0VA 1LFHA 4GL0A 2H9BA 3CG1A 2Z23A 2YPNA 2Q2CA 3USDA 3I6VA 3TPAA 3RYAA 1FQCA 2OJTA 2WKYA 4F3SA 4IY6A 4R72A 2XX8A 5CMBA 3CSBA 4RPOA 1M5FA 5B7DA 2CMOA 4Z0IA 4C1UA 1XS5A 3RQTA 3SEWA 3K2DA 1FQFA 1L5TA 4H5FA 4KHZE 2V3UA 5KCJA 5AA4B 1MS7A 4ZEIA 4IO2A 3O6GA 2O1LA 1LB8A 2I0BA 1NNFA 3KSXA 3RTFB 1F9BA 3FASA 1IXHA 3K00A 3I5OA 3VLUA 1MM6A 2F7CA 4U4SA 3O6PA 1JVYA 2GHAA 4F22A 3R6UA 2RINA 3EN3A 1OMPA 2Z22A 4Q0CA 3MUQA 5H8FB 2F7BA 3K1NA 4N6PA 3VDFA 4QSCA 5CMCA 1Y20A 2R71A 5A5XA 3C31A 5TP9B 4YKPA 3RLFE 3H06B 2QS2A 3S9EA 1ZIUA 5DVIA 3UIFA 2HCAA 1Q1KA 5I2KB 1B0HA 2O69A 3HCQA 4O3CA 5AA2D 1IUDA 2DWIA 1XVXA 4F19A 2F6GA 4G8HA 3EHUA 1PBPA 5TPAA 1J1NA 4OWDA 2NWJA 4NMYA 2DQVA 3O97A 2GRVA 1O7TA 1VR5A 3FV2A 4FEBA 3T9UA 2Y84A 3B6TA 1VE4A 3Q27A 2DVZA 2I4BA 4U22A 1BTJA 3PUYE 2RF1A 5EHMA 3V83A 1B58A 4YB6A 1WDNA 3MZBA 3KN7A 2G29A 4KR5A 4ELOA 2F35A 2V3TA 4TOZA 3UK4A 3OOAA 4DCYA 2O84X 5HM4B 2F34A 4K3FA 3T96B 4ZEFA 2H99A 3E3KA 1GGGA 3EQ1A 4KYEA 2O1MA 3HSTA 3JYRA 4Q5TA 1PBQA 2ZYKA 3LR1A 2H25A 1P1WA 3QYTA 5CRYA 1YAEA 5ELVA 2O6AA 3H03A 2UVGA 2V3QA 2I58A 3TAJA 4F1UA 4L17A 1CB6A 3FXUA 1LAFE 3IOWA 3PUZE 1N84A 2DE3A 4XKPA 2UVJA 3KZGA 3SEYA 5DVFA 1DTZA 1NMUA 4YKKA 1R1NA 2W7YA 1H45A 4HS7A 4F31B 1ZBMA 3OEKA 2CZLA 1N7WA 3RY3A 3TFLA 4OZ9A 4POXA 1PB9A 2DE4A 2F7AA 3TZAA 2ONRA 4GXAA 3TTMA 1ATGA 4GQOA 4XKQA 4LA9A 3QIMA 3T66A 4RA1A 1LAHE 1A40A 1P1NA 3MVXA 4ZS9A 3M8UA 5KDTB 5L9SA 4OHNA 3MBPA 1B7HA 2DE2A 1UTBB 2RC8A 4JDFA 2O7UA 4OFOA 2XHDA 2QS4A 3FJGA 2F97A 4H8IA 2ZYNA 3D4GA 4ESWA 3QUFA 1FTOA 3DRHA 2XD3A 2B65A 4R9GA 2UYEA 4GRKA 5AA2B 2AYSA 1IEJA 1A8FA 4IGRA 1DPEA 3ZKLA 1M5DA 4F18A 4RK9A 3IO4A 3KJ7A 4GXSB 3T9VA 2DOJA 4R75A 2R9JA 4YB7A 1PB7A 1SYIA 2D21A 3LSLA 2KLFA 2DYXA 1DOTA 4POWA 3L6GA 3DLNA 3BFUA 1US5A 1N76A 3UA8A 5HPQA 4LATA 4FORA 3DP4A 1HSEA 2O68A 4ZDMA 4G2ZA 4LZ5A 3M3LA 1QKBA 5I58B 3TDJA 3TMGA 3IB0A 1GTKA 4F2OA 3O2AA 4H0WA 2XXYA 3VE1B 3W9WA 5CM6A 4NF5A 3TKDA 3CR9A 3MC2A 5JK4A 4O3BA 1MY4A 1SI1A 3Q28A 1BIYA 3PMWA 1MXWA 5KZTA 2RKMA 4PETA 2ZYOA 3EF7A 2NOOA 1H76A 3IJXB 1YTVA 3C34A 1JEUA 3MQ9A 3ZSFA 4KQPA 1R9LA 4NE4A 2I49A 3A09A 1SW1A 1URSA 2OBGA 4O3AA 2ZNUA 5JTYA 4KPTA 4F3GA 1EH3A 1R6ZA 5FHOA 4N07A 4YZZA 2BJJX 1MXZA 2UYFA 3LUYA 3PV0E 5FHMA 4GL8A 2Y7KA 2QMWA 5IKBA 4PFUA 4NEDA 5I2NA 1B32A 4WEDA 3VV5A 5AE4A 3L6HA 2M8CA 3K02A 1B05A 3KGCA 2HAUA 3G7WA 2PX1A 3EHTA 1LSTA 1JW4A 4YKIA 4QFNA 3K6XA 3IR1A 4RPNA 1H44A 4LQ2A 4X9TA 4YKJA 1AH5A 2Q8JA 3FATA 1A55A 1RYOA 2HXWA 4IO5A 1I6AA 3U72A 2IA4A 1MY1A 2OCUA 4P0GA 3LC8A 2Q89A 2Q2AA 2RCBA 1UIVA 4Q8RA 5I56A 4OEVA 3MPLA 1DSNA 3OSQA 3T9HB 3O6IA 4G68B 2V93A 3FVGA 3HHGA 3G3JA 3CVGA 1QVSA 5H8QB 1Y4CA 2QSXA 3PPOA 3QUJA 5H8HA 4RJZA 5EYFA 3TODA 2RCAA 1B0LA 4RYAA 3PPRA 2REJA 3G3IA 2O7IA 3MAMA 3QXMA 2Z8EA 4WKMA 4G77A 5I57B 3OO8A 1JQFA 1T0KA 5L8DA 3TCGA 1Y4TA 3JV9A 4I9DA 3OENA 1JNFA 1ZMGA 3T93B 2A5TB 3ODBA 3LSXA 3H6TA 1SYHA 1MM7A 3ZKKA 5DVJA 4ESXA 3ILTB 3SDFA 4MFIA 4LZ7A 3A3CA 2D5WA 3DP6A 3Q26A 1QUJA 1MXUA 3N94A 4NF6B 1MH3A 4C0RA 4AB6A 1I69A 3H7MA 1GVCA 2B4LA 2OZZA 3EHSA 2RC9A 5H8NA 1USYE 4BDLA 3FXQA 1FTMA 3MP8A 4F1VA 1WVJA 5DEXB 4F2QA 3N5LA 2Q9TA 5AA4A 3GLBA 3ZS6A 3G3FA 1MQIA 1P1QA 3QSLA 4IO7A 2P0SA 2ONKE 3CG3A 1PB8A 5BUUA 3Q29A 2Y7PA 1QKAA 3DRKA 4KCCA 4MF3A 3C36A 3N6UA 4JWOA 2ZMBA 4HCWA 3KG2A 2F36A 4H1XA 1SVXB 5H8FA 4KYSA 2XXXA 1B3FA 2XD2A 4I1DA 4WXJA 1ZJLA 4GLIA 3LBSA 4IO6A 5TP9A 2XX9A 1LCFA 1NH8A 3CFXA 5B70A 3N26A 5I2KA 1B7ZA 3EPEA 3MVWA 3FUZA 3TQWA 1ZTYA 2WOLA 4Q30B 2GFEA 5FTIA 4LZ8A 3VVDA 1B40A 3ECRA 2NVUB 4LVQA 4XTCQ 1UQWA 4PFYA 1EZOA 3C35A 1B4HA 3DM0A 3VLWA 4MH5A 1BKAA 3PMVA 1MPBA 2F78A 4H65A 3CIJA 1NH7A 1B1XA 2OWSA 2ZYMA 3OD7A 5IAIA 3UORA 1XVYA 4X1DA 1DPPA 1P1UA 4QF9A 4JSDA 3MVZA 2XXWA 4GOTA 1Q35A 3W15C 4KI0E 1IIWA 1M5CA 4NWDA 4EDPA 1TFDA 4LUBA 1BLFA 1Y3NA 3CFZA 3MP1A 4F3BA 4FAJA 3W9VA 3K6WA 1NNTA 1I6QA 2ESNA 2DXYA 4E0XA 1JW1A 4HW8A 5H8SA 1ZLQA 1MQGA 3IOVA 1P1OA 4JXIA 3FTOA 4YB5A 3LSWA 4R6HA 2PT2A 1EZPA 4LONB 1URDA 4BDOA 2Y7RA 3PU5A 1FTJA 4NF4B 1B51A 3C4MA 1XT8A 4OTEA 1S9TA 3CRBA 3R26A 3TTLA 2VOZA 1B5IA 3IORA 1S50A 3H6VA 1IQ7A 1B52A 1GV8A 5ICTA 1B3EA 3V8XB 1NKXA 1UTBA 4PP0A 4HTGA 1SW4A 1UIUA 1PC3A 4H8JA 2OWTA 3S2VA 4ZEBA 3TTKA 4U21A 1TXFA 2QJEA 2HQ0A 1AIVA 2I3VA 4GWOA 3WAEA 3MWBA 1XHYA 1WODA 1MPCA 4OENA 1B1HA 4ELPA 2Y7WA 4TQUQ 2Z8FA 4EF1A 3TQLA
chains in the Genus database with same CATH superfamily
2GHBA 1MH4A 1OQHA 1II5A 3PD9A 2DSFA 5AA2A 2PMSA 1Y3QA 4NAPA 4NN3A 3HO7A 3KEIA 1Y9UA 3K6UA 3H6WA 3VLVA 1OLCA 3PPPA 4OVPA 1JEVA 1SDXA 4PGPA 2LAOA 4H45A 2ZZXA 1NNPA 1US4A 3BIGA 4EQBA 2XXUA 3TELA 4NF8B 1PEBA 2PVUA 3KFMA 4FBPA 2Q88A 2OK2A 1EU8A 2WYPA 4MMPA 1Z7ME 4R9FA 4NF5B 3R7XA 2ZNSA 4I3EA 5I58A 3D1RA 3RPWA 3ILUB 3M3KA 3SEUA 2DP8A 1SW5A 1OLAA 1RDXA 4G68C 3G3GA 1FBFA 4GVOA 4JB7A 3RNNA 1IXGA 3RYBA 5CBSA 3K1MA 1NV6A 2V4CA 1D4NA 3AXFA 1ELJA 3GZGA 4PQJA 3KN8A 4X04A 1LEVA 2I0CA 2X7QA 2FNCA 1YZ0A 1HSJA 3S9NC 1K9YA 4UA8A 2ZZVA 1N3WA 3OO9A 3V5AA 1N0TA 5ITOA 3K01A 1LCTA 2ANJA 4DXBA 3K6VA 2VHAA 1OQGA 2THIA 3E9XA 3B50A 3SEVA 4GF8A 2PFYA 1M5EA 1FBHA 2ABHA 2DXRA 1LBYA 1SD3A 4YICA 1IMAA 3TTRA 1B5JA 3HN0A 3U93A 4O8MA 3GBBA 1R9QA 1FBGA 3WAFA 2ZZWA 1I6BA 4BDMA 1B2HA 4GWZA 2DS9A 1G0HA 2DWJA 1B3HA 2E1SA 1SW2A 3P7IA 2DDKA 1FQAA 4PGNA 5ET7A 5CMKA 4OETA 3U92A 4MEVA 2PCRA 3HHFA 2FYIA 2Y7IA 1MG1A 1B9JA 2O51A 3FD3A 4XFEA 4QFPA 2CZKA 1USYH 4ND9A 2HEUA 5I59B 4QRZA 1LFGA 3U1OA 4LN5A 1B5HA 1UTHB 3M3FA 2QL3A 3PPQA 4U23A 1A7LA 1NV1A 3SEXA 4ELRA 4ZZAA 1A54A 4KFQA 1RYXA 3HPIA 4BDQA 3PGFA 4YMBA 4FJPA 4ZECA 3PTYA 4ELQA 1SI0A 2I48A 4KD5A 1GR2A 4R73A 3IB1A 1MQJA 1TT1A 4C1TA 1B4ZA 3TEPA 1G0IA 3RT8A 3KOSA 3K1PA 1JP4A 4RNSA 3E79A 4NF0A 5CC2A 1NV3A 3E4RA 1URGA 4H67A 1QULA 4G68A 4DI3D 1AWBA 1O64A 2G93A 3OSRA 2P1SA 4MLVA 2HHMA 1D9VA 1MQDA 5H8QA 3A3UA 1D9YA 3FJ7A 4OVSA 3N6TA 3T22A 3OEMA 1FCKA 2D3IA 4ZE8A 4H5GA 3DP8A 4P0IA 1JW5A 2B4MA 3MJNA 1PDAA 4N6KA 2GH9A 1QUIA 3OMBA 1IMEA 4PTKA 3H3GA 4FE8A 3IB2A 5I57A 4R6YA 1SPIA 1YPNA 4UACA 4P3LA 2WYKA 4IR8A 4FIMA 4PAFA 3PD8A 1IMCA 2A5TA 4DZ1A 4F39A 4N91A 5KCJB 1FRPA 3B6WA 4N13A 4M4GA 3UGWA 2ONSA 5H8NB 2ZXTA 3OO7A 4QFKA 3SERA 4EQ7A 2PBWA 3DRFA 3IAZA 5EQ9A 1Z7NE 4NF6A 2DWAA 2WX9A 4DDDA 2YLNA 2QVRA 3D4CA 1MPDA 4U1OA 2QS1A 2HZKA 3TCFA 2XXVA 4MX6A 4XKRA 1LBXA 4XXUA 1AOVA 1FQBA 1Y3PA 3B7DA 5DEXA 4ZEKA 5FTHA 3VVFA 4OQOA 5A5XB 4OESA 5TU0A 2REGA 2UXAA 2XXQA 3FXBA 4GBWA 1LBCA 2WBBA 4GBVA 3I3VA 4FEDA 1LB9A 3ONMA 1FTAA 4E0WA 1QJMA 2KR0A 3FVKA 2VGQA 5AA3A 3FZVA 1MRPA 1LBBA 5JEIA 3KC1A 4HCYA 4TLMB 3RGYA 2P3NA 3VXCA 3SZPA 5TPAB 3RN8A 1EYKA 3RUMA 2VPOA 2E0SA 2A5SA 2QVUA 2XXHA 2B3FA 4MLQA 2FHYA 4PAKA 3IL1B 3TUSA 3O28A 1B7UA 5J1DA 2UVIA 1FJ6A 2WOPA 4R2FA 4QFOA 3C33A 3TTNA 4R6KA 2Z8DA 2I6EA 4EF2A 5BWJA 3BKIB 4OVRA 2H4IA 3RT6B 4P56A 2X26A 3FV1A 2PYYA 3C9HA 4XKNA 4EXKA 1DMBA 3VFJA 1FBPA 4X1BA 4RY1A 5M2VA 1IXCA 4PDHA 5A5LA 2Q8MA 2DVCA 4M1VA 1O63A 1IXIA 3CFLA 3HV1A 2V84A 1P99A 3FGSA 3U8QA 1MDQA 4AS5A 1B6HA 4BDNA 2Y5LA 3OO6A 1IITA 1Y1MA 3GXAA 1HSLA 1AMFA 1XI6A 1TFAA 4KCDA 4NWCA 1YCJA 2YJPA 1QW0A 4YMAA 1IZ1A 1FQEA 1KWHA 4GWYA 4IY5A 2QMXA 2AL5A 1OIBA 3V89B 3KOTA 4LQ5A 3IJOB 1NV7A 4F3PA 3CSGA 3SKPA 2ZNTA 2P2AA 3CI8A 3S9LC 3GBAA 4BLAA 4QSEA 4DE8A 4DXUA 3OELA 5K2YA 4I62A 2FA7A 4OYVA 1NL5A 2PFZA 3MP6A 4KYDA 4R2BA 3LUZA 1DTGA 4ZEDA 3C32A 4RK2A 3U94A 5F1QA 2X7PA 3PAMA 2I3WA 3JZJA 4ISUA 1JVXA 2DWHA 1AL3A 3KJTA 1CE2A 3TYHA 4DXCA 4THIA 2ALUA 2XXIA 4I8CA 3BBRA 5CMMA 2NUVA 2RC7A 1MY3A 2FIEA 4IGTA 5DT6A 3Q25A 3VVEA 4QFLA 4OVJA 2OLBA 4NF4A 2PT1A 2QS3A 3MZ9A 5KDTA 1EZ9A 4BDRA 1XC1A 5DTBA 4PFWA 2QPQA 4ONYA 2XXTA 4IO3A 1N7XA 1B3LA 4OERA 3PMXA 2UVHA 4RXLA 1JETA 1A99A 1MY2A 3QMFA 2XWOA 1POTA 4JBZA 2I4CA 2XWIA 5IZZA 4LP2B 4FECA 4P47A 1FTKA 3NOHA 1INPA 4N8GA 3IOUA 1MXVA 3KBRA 4OFLA 4NQ8A 2B3BA 4U2RA 4OANA 1ZU0A 4G8NA 3FJMA 4ECFA 2IEEA 1BP5A 2QFLA 2H98A 4WEPA 1XOCA 3QK6A 4Z7EA 3KN3A 5FHNA 4EQ9A 5ITPA 2XXPA 3O9PA 4EXLA 1NNKA 4FATA 5L9MA 2F5XA 5ISUA 1M5BA 2HZLA 2VD3A 3RTWB 5LTCA 4F29A 4XIGQ 4U4XA 3O6HA 4H6DA 4OMBA 3FXRA 1BK4A 5F7VA 3U65A 1KA0A 4OXVA 1FPDA 3PPNA 1TWYA 4IO4A 1DBZA 4NF8A 2NXOA 1NV2A 3QAXA 5EYHA 4QSDA 4MBPA 3MPKA 3E13X 1B46A 1LGBC 3FVNA 1NFTA 3MW0A 1N04A 5JTYB 4ZZEA 3SESA 4GFRA 5DYHA 2VD2A 4PAIA 3T9XB 2WOKA 1B3GA 4MNIA 4QHQA 2XWVA 4PDDA 5LOMA 1SQYA 1FQDA 1FTLA 2QRYA 1MXXA 4GD5A 5CI5A 5I2NB 1MQHA 4AQ4A 2FIXA 4X48A 1D3KA 4ZE9A 2AIXA 1MXYA 1LAXA 4PFBA 1MY0A 2R6GE 3DRJA 4G8MA 5I84A 4G4PA 4JWXA 3S9MC 3O29A 2XXRA 3LSFB 3SETA 2HFBA 3DRIA 3F11A 3TCHA 3RPLB 3DELB 1LLSA 3THIA 1ANFA 4OVQA 4P11A 1VFEA 3OXNA 3DRGA 3S4UA 1N3XA 2KQZA 1FW0A 1NUWA 4MNPA 2F8DA 3KBZA 1S7YA 4NTLA 1OVBA 1DCUA 5ESYA 3H4ZA 3PUXE 1MDP1 3G3KA 4MJOA 4DCXA 3UP9A 1RKMA 3G3HA 3B6QA 3FVOA 4IB2A 3PUWE 4YU0A 3MZ1A 1FPJA 4OEUA 4KXPA 5L9OA 3BFTA 5T3JA 4YAHX 2XX7A 4EUOA 5I56B 1A8EA 5K2XA 5I59A 1LFIA 4U1ZA 3K4UA 4GWUA 3H6UA 3O66A 3RYDA 1UTHA 2HAVA 5ICQA 3LVUA 4PFTA 1LAGE 1OVTA 1VSOA 4DIGA 2V25A 4F1YA 3UN6A 4DLDA 1H3DA 2VP1A 3IK6B 4AB5A 3IOTA 2F6PA 3FIRA 5H8HB 2L5VA 1ZKBA 4TLLB 4PE5B 1QUKA 2CEYA 3PUVE 4JWYA 3MVYA 4OFJA 1FPFA 5AA1A 1H43A 4I3YA 4JSOA 1Y1ZA 3VXBA 1VFDA 1KZ8A 5HBCA 1POY1 3KSJA 4GIZA 5CBRA 4PCDA 2AL4A 4R74A 3CHGA 2H5YA 5EHSA 1SBPA 3IX1A 3IO6A 3K0VA 2GQ1A 1NI9A 1LFHA 4GL0A 2H9BA 3CG1A 2Z23A 2YPNA 2Q2CA 3USDA 3I6VA 3TPAA 3RYAA 1FQCA 2OJTA 2WKYA 1FPLA 4F3SA 4IY6A 1FPBA 4PBHA 4R72A 2XX8A 5CMBA 3CSBA 4RPOA 1M5FA 5B7DA 2CMOA 4Z0IA 4C1UA 1XS5A 3RQTA 3SEWA 3GYYA 3K2DA 1FQFA 2JJKA 1L5TA 4H5FA 4KHZE 2V3UA 5KCJA 5AA4B 1MS7A 3A29A 4G61A 4ZEIA 4IO2A 2HXRA 3O6GA 2O1LA 1LB8A 2I0BA 1NNFA 3KSXA 3RTFB 1F9BA 3FASA 1IXHA 3K00A 3I5OA 1FBDA 2WEFA 3VLUA 1MM6A 2F7CA 4U4SA 2F3BA 3O6PA 1JVYA 2GHAA 4F22A 4PBQA 3R6UA 2RINA 3EN3A 1OMPA 2Z22A 4Q0CA 3MUQA 5H8FB 5I3SA 2F7BA 3K1NA 4N6PA 3VDFA 4QSCA 5CMCA 4X8RA 1Y20A 2R71A 5A5XA 3C31A 5TP9B 4YKPA 3RLFE 3ROJA 3H06B 2QS2A 3S9EA 1ZIUA 5DVIA 3UIFA 2HCAA 1Q1KA 5I2KB 1B0HA 2O69A 3HCQA 4O3CA 5AA2D 1IUDA 2DWIA 1XVXA 4F19A 2F6GA 4G8HA 3EHUA 1PBPA 5TPAA 1J1NA 4OWDA 2NWJA 4NMYA 2DQVA 3O97A 2GRVA 1O7TA 3MSTA 4UABA 1VR5A 3FV2A 4FEBA 3T9UA 2Y84A 3B6TA 4XEQA 1VE4A 3Q27A 2DVZA 2I4BA 4U22A 1BTJA 3PUYE 1RDYA 2RF1A 5EHMA 3V83A 1B58A 4YB6A 1WDNA 3MZBA 3KN7A 2G29A 4KR5A 4ELOA 2F35A 2V3TA 4P8BA 4TOZA 3UK4A 2XXKA 3OOAA 3T1BA 4DCYA 2O84X 5HM4B 2F34A 4K3FA 3T96B 4ZEFA 2H99A 3E3KA 1GGGA 3EQ1A 4KYEA 3IFCA 4DI4B 2O1MA 3HSTA 3JYRA 4Q5TA 1PBQA 2ZYKA 3LR1A 2H25A 1P1WA 3QYTA 5CRYA 1YAEA 5ELVA 2CZIA 2O6AA 3H03A 2UVGA 2V3QA 2I58A 3TAJA 4F1UA 4L17A 1CB6A 3FXUA 1LAFE 3IOWA 3PUZE 1N84A 2DE3A 3KC0A 4XKPA 2UVJA 3KZGA 3SEYA 5DVFA 1DTZA 1NMUA 4YKKA 1R1NA 2W7YA 1H45A 1QGXA 4HS7A 4F31B 3LV0A 1ZBMA 3OEKA 2CZLA 3EKIA 1N7WA 3RY3A 3TFLA 4MHFA 4OZ9A 4POXA 1PB9A 2OWZA 2DE4A 4AS4A 2F7AA 1NV0A 3TZAA 2ONRA 4GXAA 1LBWA 3TTMA 5IZ3B 1ATGA 4GQOA 4XKQA 1LBVA 4LA9A 3QIMA 3T66A 4RA1A 1Q9DA 1LAHE 1A40A 1P1NA 3MVXA 4ZS9A 5IM2A 3M8UA 1CNQA 5KDTB 5L9SA 4OHNA 3MBPA 1B7HA 2DE2A 1UTBB 4GWXA 2RC8A 4JDFA 2O7UA 4OFOA 2XHDA 2QS4A 3FJGA 2F97A 4H8IA 2ZYNA 3D4GA 1NUYA 4ESWA 3QUFA 4PF8A 4GWWA 1FTOA 3DRHA 2XD3A 2B65A 4R9GA 1NUZA 2UYEA 4GRKA 5ET5A 4PE3A 5AA2B 2AYSA 1IEJA 1A8FA 4IGRA 1DPEA 3HFUA 4N4UA 3ZKLA 5EQ7A 1M5DA 4F18A 4RK9A 3IO4A 3KJ7A 4GXSB 3T9VA 2DOJA 4R75A 1EYJA 2R9JA 4YB7A 5IGAA 1PB7A 1SYIA 2D21A 3LSLA 4PC9A 2KLFA 2DYXA 1DOTA 2VT5A 4POWA 3L6GA 3DLNA 3BFUA 4MCOA 1US5A 1N76A 3UA8A 5HPQA 4LATA 4H46A 1LBZA 1RDZA 4FORA 3DP4A 1HSEA 2O68A 4ZDMA 1NV4A 4G2ZA 4LZ5A 4HE0A 3M3LA 1QKBA 5I58B 3E78A 4P1LA 3TDJA 3TMGA 3IB0A 1GTKA 4F2OA 3O2AA 4JVDA 4H0WA 4JVIA 1YXIA 5ET6A 2XXYA 3VE1B 3W9WA 5CM6A 4NF5A 3TKDA 3CR9A 3MC2A 5JK4A 4O3BA 1MY4A 1SI1A 3Q28A 1BIYA 3PMWA 1MXWA 5KZTA 2RKMA 4PETA 2ZYOA 3EF7A 2NOOA 1H76A 3IJXB 1YTVA 3C34A 1JEUA 3MQ9A 3ZSFA 4KQPA 1R9LA 4NE4A 2I49A 3A09A 1SW1A 1URSA 1VDWA 5DW8A 2OBGA 4O3AA 2ZNUA 5JTYA 4KPTA 4F3GA 1EH3A 4P9KA 1R6ZA 5FHOA 4N07A 4PFRA 1YYZA 1FSAA 4YZZA 2BJJX 1MXZA 2UYFA 3LUYA 3PV0E 5FHMA 4GL8A 2Y7KA 2QMWA 5IKBA 4PFUA 4GWSA 4NEDA 5I2NA 1B32A 4WEDA 3ISPA 4N81A 3VV5A 5AE4A 4GX6A 3L6HA 1FJ9A 2M8CA 3B8BA 3K02A 1B05A 3KGCA 5EQAA 2HAUA 3G7WA 5FBPA 2PX1A 3EHTA 1LSTA 3RPLA 1JW4A 4YKIA 4QFNA 3K6XA 1FPIA 3IR1A 4N15A 4RPNA 1H44A 4LQ2A 4X9TA 4YKJA 3MYUA 1AH5A 2Q8JA 3FATA 5ET8A 1A55A 1RYOA 2HXWA 2QVVA 4IO5A 1I6AA 3U72A 2IA4A 1MY1A 2OCUA 4P0GA 3LC8A 2Q89A 2Q2AA 2Q74A 4N6DA 5I7IA 2FBPA 2RCBA 4PF6A 1UIVA 4Q8RA 2P3VA 1IMDA 5I56A 4OEVA 3MPLA 1DSNA 3OSQA 3T9HB 3O6IA 4G68B 2V93A 3FVGA 3HHGA 3G3JA 3CVGA 1QVSA 5H8QB 1Y4CA 2QSXA 4MAGA 1DK4A 3PPOA 3QUJA 5H8HA 4RJZA 5EYFA 3TODA 2RCAA 1B0LA 4RYAA 3PPRA 2REJA 3G3IA 2O7IA 2CEXA 3MAMA 3QXMA 2Z8EA 2HPGA 1NV5A 4WKMA 4G77A 5I57B 3OO8A 1JQFA 1T0KA 5L8DA 3TCGA 1Y4TA 3JV9A 4I9DA 3OENA 1JNFA 1ZMGA 3T93B 2A5TB 3ODBA 3LSXA 3H6TA 4O7IA 1SYHA 3IFAA 1MM7A 3ZKKA 4OA4A 5DVJA 2F3DA 4ESXA 3ILTB 4N17A 4NX1A 3SDFA 4MFIA 4HXVA 4LZ7A 3A3CA 2D5WA 3DP6A 3Q26A 1QUJA 1MXUA 3N94A 4NF6B 1MH3A 1FPGA 1KA1A 4C0RA 4AB6A 1I69A 3H7MA 1GVCA 2B4LA 2OZZA 3EHSA 2RC9A 5H8NA 2R8TA 2BJIA 1USYE 4BDLA 3FXQA 5I5PA 1FTMA 3MP8A 4F1VA 1WVJA 1IMBA 5DEXB 4F2QA 4P1EA 3N5LA 2Q9TA 5AA4A 3GLBA 3ZS6A 3T0JA 3G3FA 1MQIA 1P1QA 3QSLA 1D9QA 4IO7A 2P0SA 2ONKE 3CG3A 1PB8A 4GX3A 5BUUA 3Q29A 1FBEA 2Y7PA 1QKAA 3DRKA 4KCCA 4MF3A 1FPKA 3C36A 3N6UA 4JWOA 2ZMBA 4HCWA 3KG2A 2VPNA 5EYGA 2F36A 4O7MA 4H1XA 5LDZA 1SVXB 4OVTA 5H8FA 4KYSA 2XXXA 1B3FA 2XD2A 4I1DA 4WXJA 1ZJLA 4GLIA 4PFIA 3LBSA 4IO6A 5TP9A 2XX9A 1LCFA 1FBCA 3FBPA 1NH8A 3CFXA 5B70A 4GX4A 4NGUA 3N26A 5I2KA 1B7ZA 3EPEA 3MVWA 1FPEA 3FUZA 3TQWA 1ZTYA 2WOLA 4Q30B 5F24A 2GFEA 5FTIA 1K9ZA 4LZ8A 3VVDA 1B40A 2Y5KA 3ECRA 4QXDA 2NVUB 4LVQA 4XTCQ 1UQWA 4PFYA 1IMFA 1EZOA 3C35A 1B4HA 3DM0A 5EQ8A 3VLWA 4MH5A 1BKAA 3PMVA 1MPBA 2F78A 4H65A 3CIJA 5J16A 1NH7A 1B1XA 2OWSA 2OX3A 2ZYMA 3OD7A 4JVCA 5IAIA 3UORA 1XVYA 4X1DA 1DPPA 4QBAA 1P1UA 4QF9A 4JSDA 3MVZA 2XXWA 4GOTA 1Q35A 3W15C 4KI0E 1IIWA 1M5CA 4NWDA 4EDPA 1TFDA 4LUBA 1BLFA 1Y3NA 3CFZA 3MP1A 4F3BA 4FAJA 3K6WA 3W9VA 1NNTA 1I6QA 4I40A 1NUXA 4O94A 2ESNA 4XF5A 2DXYA 4E0XA 1JW1A 2WBDA 4HW8A 5H8SA 1ZLQA 1MQGA 3IOVA 1P1OA 4JXIA 4MNCA 3FTOA 4YB5A 3LSWA 4R6HA 2PT2A 1EZPA 4LONB 1URDA 4BDOA 2Y7RA 3PU5A 3BIHA 1FTJA 4NF4B 1B51A 3C4MA 1XT8A 4HE2A 4OTEA 2XWKA 1S9TA 3CRBA 4HE1A 3R26A 3TTLA 2VOZA 1B5IA 3IORA 5IZ3A 1S50A 3H6VA 1IQ7A 4NHBA 1B52A 1GV8A 5ICTA 1B3EA 4NG7A 3V8XB 1NKXA 1UTBA 4PP0A 4HTGA 1SW4A 1UIUA 1PC3A 4H8JA 2OWTA 3S2VA 4ZEBA 4N8YA 3TTKA 5IZ1A 4U21A 1TXFA 2QJEA 2HQ0A 1AIVA 2CZHA 4MIJA 2I3VA 4GWOA 3WAEA 1EYIA 3MWBA 1XHYA 1WODA 1MPCA 4OENA 1B1HA 2XA5A 4ELPA 2Y7WA 4TQUQ 2FVZA 2Z8FA 4EF1A 2MKZA 3TQLA
chains in the Genus database with same CATH topology
2GHBA 1MH4A 1OQHA 1II5A 3PD9A 2DSFA 5AA2A 2PMSA 1Y3QA 3HO7A 3KEIA 1Y9UA 3K6UA 3H6WA 3VLVA 1OLCA 3PPPA 1JEVA 1SDXA 2LAOA 1NNPA 1US4A 4EQBA 2XXUA 3TELA 4NF8B 1PEBA 2PVUA 3KFMA 2Q88A 2OK2A 1EU8A 1Z7ME 4R9FA 4NF5B 3R7XA 2ZNSA 5I58A 3RPWA 3ILUB 3M3KA 3SEUA 2DP8A 1SW5A 1OLAA 4G68C 3G3GA 4GVOA 4JB7A 3RNNA 1IXGA 3RYBA 5CBSA 3K1MA 1D4NA 3AXFA 1ELJA 3GZGA 4PQJA 3KN8A 2I0CA 2X7QA 2FNCA 1HSJA 3S9NC 4UA8A 1N3WA 3OO9A 3V5AA 1N0TA 5ITOA 3K01A 1LCTA 2ANJA 4DXBA 3K6VA 2VHAA 1OQGA 2THIA 3E9XA 3SEVA 4GF8A 1M5EA 2ABHA 2DXRA 1SD3A 4YICA 3TTRA 1B5JA 3HN0A 3U93A 3GBBA 1R9QA 3WAFA 1I6BA 4BDMA 1B2HA 2DS9A 2DWJA 1B3HA 2E1SA 1SW2A 3P7IA 1FQAA 5CMKA 4OETA 3U92A 3HHFA 2FYIA 2Y7IA 1MG1A 1B9JA 2O51A 3FD3A 4QFPA 4ND9A 1USYH 2HEUA 5I59B 4QRZA 1LFGA 3U1OA 1B5HA 1UTHB 3M3FA 2QL3A 3PPQA 4U23A 1A7LA 3SEXA 4ELRA 4ZZAA 1A54A 4KFQA 1RYXA 3HPIA 4BDQA 3PGFA 4YMBA 4FJPA 4ZECA 4ELQA 1SI0A 2I48A 4KD5A 1GR2A 4R73A 3IB1A 1MQJA 1TT1A 4C1TA 1B4ZA 3TEPA 3RT8A 3KOSA 3K1PA 4RNSA 5CC2A 3E4RA 1URGA 4H67A 1QULA 4G68A 1O64A 2G93A 3OSRA 2P1SA 4MLVA 1D9VA 1MQDA 5H8QA 3A3UA 1D9YA 3FJ7A 3N6TA 3T22A 3OEMA 1FCKA 2D3IA 4ZE8A 4H5GA 3DP8A 4P0IA 1JW5A 2B4MA 3MJNA 1PDAA 2GH9A 1QUIA 3OMBA 3H3GA 4FE8A 3IB2A 5I57A 4R6YA 1YPNA 4UACA 4FIMA 3PD8A 2A5TA 4DZ1A 4F39A 5KCJB 3B6WA 4N13A 4M4GA 3UGWA 2ONSA 5H8NB 2ZXTA 3OO7A 4QFKA 3SERA 4EQ7A 2PBWA 3DRFA 3IAZA 1Z7NE 4NF6A 2DWAA 4DDDA 2YLNA 3D4CA 1MPDA 4U1OA 2QS1A 2HZKA 3TCFA 2XXVA 4XKRA 4XXUA 1AOVA 1FQBA 1Y3PA 3B7DA 5DEXA 4ZEKA 5FTHA 3VVFA 4OQOA 5A5XB 4OESA 5TU0A 2REGA 2UXAA 2XXQA 1LBCA 3I3VA 4FEDA 1LB9A 3ONMA 4E0WA 1QJMA 3FVKA 2VGQA 5AA3A 3FZVA 1MRPA 1LBBA 5JEIA 4HCYA 4TLMB 3RGYA 3VXCA 5TPAB 3RN8A 3RUMA 2E0SA 2A5SA 2XXHA 2B3FA 4MLQA 3IL1B 3TUSA 3O28A 1B7UA 5J1DA 2UVIA 2WOPA 4R2FA 4QFOA 3C33A 3TTNA 4R6KA 2Z8DA 2I6EA 4EF2A 5BWJA 3BKIB 2H4IA 3RT6B 2X26A 3FV1A 2PYYA 3C9HA 4XKNA 4EXKA 1DMBA 3VFJA 4X1BA 4RY1A 5M2VA 1IXCA 2DVCA 4M1VA 1O63A 1IXIA 3CFLA 3HV1A 2V84A 1P99A 3FGSA 3U8QA 1MDQA 1B6HA 4BDNA 3OO6A 1IITA 1Y1MA 3GXAA 1HSLA 1AMFA 1TFAA 4KCDA 4NWCA 1YCJA 2YJPA 1QW0A 4YMAA 1IZ1A 1FQEA 1KWHA 4IY5A 2QMXA 2AL5A 1OIBA 3V89B 3KOTA 4LQ5A 3IJOB 4F3PA 3CSGA 3SKPA 2ZNTA 2P2AA 3CI8A 3S9LC 3GBAA 4BLAA 4QSEA 4DE8A 4DXUA 3OELA 5K2YA 4I62A 2FA7A 4OYVA 1NL5A 3MP6A 4KYDA 4R2BA 1DTGA 4ZEDA 3C32A 4RK2A 3U94A 5F1QA 2X7PA 3PAMA 2I3WA 3JZJA 4ISUA 1JVXA 2DWHA 1AL3A 3KJTA 1CE2A 3TYHA 4DXCA 4THIA 2ALUA 2XXIA 4I8CA 3BBRA 5CMMA 2NUVA 2RC7A 1MY3A 4IGTA 5DT6A 3Q25A 3VVEA 4QFLA 4OVJA 2OLBA 4NF4A 2PT1A 2QS3A 3MZ9A 5KDTA 1EZ9A 4BDRA 1XC1A 5DTBA 4PFWA 2QPQA 4ONYA 2XXTA 4IO3A 1N7XA 1B3LA 4OERA 3PMXA 2UVHA 4RXLA 1JETA 1A99A 1MY2A 1POTA 4JBZA 2I4CA 4LP2B 4FECA 1FTKA 3IOUA 1MXVA 3KBRA 4OFLA 2B3BA 4U2RA 1ZU0A 4G8NA 3FJMA 4ECFA 2IEEA 1BP5A 2H98A 4WEPA 1XOCA 3QK6A 4Z7EA 3KN3A 5FHNA 4EQ9A 5ITPA 2XXPA 3O9PA 4EXLA 1NNKA 4FATA 5L9MA 2F5XA 5ISUA 1M5BA 2HZLA 2VD3A 3RTWB 4F29A 4XIGQ 4U4XA 3O6HA 4H6DA 4OMBA 3FXRA 5F7VA 4OXVA 3PPNA 1TWYA 4IO4A 4NF8A 2NXOA 3QAXA 4QSDA 4MBPA 3MPKA 3E13X 1B46A 1LGBC 3FVNA 1NFTA 3MW0A 1N04A 5JTYB 4ZZEA 3SESA 4GFRA 5DYHA 2VD2A 3T9XB 2WOKA 1B3GA 4QHQA 5LOMA 1SQYA 1FQDA 1FTLA 2QRYA 1MXXA 4GD5A 5CI5A 5I2NB 1MQHA 4AQ4A 4X48A 1D3KA 4ZE9A 2AIXA 1MXYA 1LAXA 1MY0A 2R6GE 3DRJA 4G8MA 5I84A 4G4PA 4JWXA 3S9MC 3O29A 2XXRA 3LSFB 3SETA 2HFBA 3DRIA 3F11A 3TCHA 3DELB 1LLSA 3THIA 1ANFA 4P11A 1VFEA 3OXNA 3DRGA 3S4UA 1N3XA 1FW0A 2F8DA 1S7YA 4NTLA 1OVBA 3H4ZA 3PUXE 1MDP1 3G3KA 4DCXA 3UP9A 1RKMA 3G3HA 3B6QA 3FVOA 4IB2A 3PUWE 4YU0A 3MZ1A 4OEUA 5L9OA 3BFTA 4YAHX 2XX7A 4EUOA 5I56B 1A8EA 5K2XA 5I59A 1LFIA 4U1ZA 3K4UA 3H6UA 3O66A 1UTHA 2HAVA 5ICQA 3LVUA 4PFTA 1LAGE 1OVTA 1VSOA 4DIGA 2V25A 4F1YA 3UN6A 4DLDA 1H3DA 2VP1A 3IK6B 4AB5A 3IOTA 2F6PA 3FIRA 5H8HB 1ZKBA 4TLLB 4PE5B 1QUKA 3PUVE 4JWYA 3MVYA 4OFJA 5AA1A 1H43A 4JSOA 1Y1ZA 3VXBA 1VFDA 5HBCA 1POY1 3KSJA 4GIZA 5CBRA 2AL4A 4R74A 3CHGA 2H5YA 5EHSA 1SBPA 3IX1A 3IO6A 3K0VA 1LFHA 4GL0A 2H9BA 3CG1A 2Z23A 2YPNA 2Q2CA 3USDA 3I6VA 3TPAA 3RYAA 1FQCA 2OJTA 2WKYA 4F3SA 4IY6A 4R72A 2XX8A 5CMBA 3CSBA 4RPOA 1M5FA 5B7DA 2CMOA 4Z0IA 4C1UA 1XS5A 3RQTA 3SEWA 3K2DA 1FQFA 1L5TA 4H5FA 4KHZE 2V3UA 5KCJA 5AA4B 1MS7A 4ZEIA 4IO2A 3O6GA 2O1LA 1LB8A 2I0BA 1NNFA 3KSXA 3RTFB 1F9BA 3FASA 1IXHA 3K00A 3I5OA 3VLUA 1MM6A 2F7CA 4U4SA 3O6PA 1JVYA 2GHAA 4F22A 3R6UA 2RINA 3EN3A 1OMPA 2Z22A 4Q0CA 3MUQA 5H8FB 2F7BA 3K1NA 4N6PA 3VDFA 4QSCA 5CMCA 1Y20A 2R71A 5A5XA 3C31A 5TP9B 4YKPA 3RLFE 3H06B 2QS2A 3S9EA 1ZIUA 5DVIA 3UIFA 2HCAA 1Q1KA 5I2KB 1B0HA 2O69A 3HCQA 4O3CA 5AA2D 1IUDA 2DWIA 1XVXA 4F19A 2F6GA 4G8HA 3EHUA 1PBPA 5TPAA 1J1NA 4OWDA 2NWJA 4NMYA 2DQVA 3O97A 2GRVA 1O7TA 1VR5A 3FV2A 4FEBA 3T9UA 2Y84A 3B6TA 1VE4A 3Q27A 2DVZA 2I4BA 4U22A 1BTJA 3PUYE 2RF1A 5EHMA 3V83A 1B58A 4YB6A 1WDNA 3MZBA 3KN7A 2G29A 4KR5A 4ELOA 2F35A 2V3TA 4TOZA 3UK4A 3OOAA 4DCYA 2O84X 5HM4B 2F34A 4K3FA 3T96B 4ZEFA 2H99A 3E3KA 1GGGA 3EQ1A 4KYEA 2O1MA 3HSTA 3JYRA 4Q5TA 1PBQA 2ZYKA 3LR1A 2H25A 1P1WA 3QYTA 5CRYA 1YAEA 5ELVA 2O6AA 3H03A 2UVGA 2V3QA 2I58A 3TAJA 4F1UA 4L17A 1CB6A 3FXUA 1LAFE 3IOWA 3PUZE 1N84A 2DE3A 4XKPA 2UVJA 3KZGA 3SEYA 5DVFA 1DTZA 1NMUA 4YKKA 1R1NA 2W7YA 1H45A 4HS7A 4F31B 1ZBMA 3OEKA 2CZLA 1N7WA 3RY3A 3TFLA 4OZ9A 4POXA 1PB9A 2DE4A 2F7AA 3TZAA 2ONRA 4GXAA 3TTMA 1ATGA 4GQOA 4XKQA 4LA9A 3QIMA 3T66A 4RA1A 1LAHE 1A40A 1P1NA 3MVXA 4ZS9A 3M8UA 5KDTB 5L9SA 4OHNA 3MBPA 1B7HA 2DE2A 1UTBB 2RC8A 4JDFA 2O7UA 4OFOA 2XHDA 2QS4A 3FJGA 2F97A 4H8IA 2ZYNA 3D4GA 4ESWA 3QUFA 1FTOA 3DRHA 2XD3A 2B65A 4R9GA 2UYEA 4GRKA 5AA2B 2AYSA 1IEJA 1A8FA 4IGRA 1DPEA 3ZKLA 1M5DA 4F18A 4RK9A 3IO4A 3KJ7A 4GXSB 3T9VA 2DOJA 4R75A 2R9JA 4YB7A 1PB7A 1SYIA 2D21A 3LSLA 2KLFA 2DYXA 1DOTA 4POWA 3L6GA 3DLNA 3BFUA 1US5A 1N76A 3UA8A 5HPQA 4LATA 4FORA 3DP4A 1HSEA 2O68A 4ZDMA 4G2ZA 4LZ5A 3M3LA 1QKBA 5I58B 3TDJA 3TMGA 3IB0A 1GTKA 4F2OA 3O2AA 4H0WA 2XXYA 3VE1B 3W9WA 5CM6A 4NF5A 3TKDA 3CR9A 3MC2A 5JK4A 4O3BA 1MY4A 1SI1A 3Q28A 1BIYA 3PMWA 1MXWA 5KZTA 2RKMA 4PETA 2ZYOA 3EF7A 2NOOA 1H76A 3IJXB 1YTVA 3C34A 1JEUA 3MQ9A 3ZSFA 4KQPA 1R9LA 4NE4A 2I49A 3A09A 1SW1A 1URSA 2OBGA 4O3AA 2ZNUA 5JTYA 4KPTA 4F3GA 1EH3A 1R6ZA 5FHOA 4N07A 4YZZA 2BJJX 1MXZA 2UYFA 3LUYA 3PV0E 5FHMA 4GL8A 2Y7KA 2QMWA 5IKBA 4PFUA 4NEDA 5I2NA 1B32A 4WEDA 3VV5A 5AE4A 3L6HA 2M8CA 3K02A 1B05A 3KGCA 2HAUA 3G7WA 2PX1A 3EHTA 1LSTA 1JW4A 4YKIA 4QFNA 3K6XA 3IR1A 4RPNA 1H44A 4LQ2A 4X9TA 4YKJA 1AH5A 2Q8JA 3FATA 1A55A 1RYOA 2HXWA 4IO5A 1I6AA 3U72A 2IA4A 1MY1A 2OCUA 4P0GA 3LC8A 2Q89A 2Q2AA 2RCBA 1UIVA 4Q8RA 5I56A 4OEVA 3MPLA 1DSNA 3OSQA 3T9HB 3O6IA 4G68B 2V93A 3FVGA 3HHGA 3G3JA 3CVGA 1QVSA 5H8QB 1Y4CA 2QSXA 3PPOA 3QUJA 5H8HA 4RJZA 5EYFA 3TODA 2RCAA 1B0LA 4RYAA 3PPRA 2REJA 3G3IA 2O7IA 3MAMA 3QXMA 2Z8EA 4WKMA 4G77A 5I57B 3OO8A 1JQFA 1T0KA 5L8DA 3TCGA 1Y4TA 3JV9A 4I9DA 3OENA 1JNFA 1ZMGA 3T93B 2A5TB 3ODBA 3LSXA 3H6TA 1SYHA 1MM7A 3ZKKA 5DVJA 4ESXA 3ILTB 3SDFA 4MFIA 4LZ7A 3A3CA 2D5WA 3DP6A 3Q26A 1QUJA 1MXUA 3N94A 4NF6B 1MH3A 4C0RA 4AB6A 1I69A 3H7MA 1GVCA 2B4LA 2OZZA 3EHSA 2RC9A 5H8NA 1USYE 4BDLA 3FXQA 1FTMA 3MP8A 4F1VA 1WVJA 5DEXB 4F2QA 3N5LA 2Q9TA 5AA4A 3GLBA 3ZS6A 3G3FA 1MQIA 1P1QA 3QSLA 4IO7A 2P0SA 2ONKE 3CG3A 1PB8A 5BUUA 3Q29A 2Y7PA 1QKAA 3DRKA 4KCCA 4MF3A 3C36A 3N6UA 4JWOA 2ZMBA 4HCWA 3KG2A 2F36A 4H1XA 1SVXB 5H8FA 4KYSA 2XXXA 1B3FA 2XD2A 4I1DA 4WXJA 1ZJLA 4GLIA 3LBSA 4IO6A 5TP9A 2XX9A 1LCFA 1NH8A 3CFXA 5B70A 3N26A 5I2KA 1B7ZA 3EPEA 3MVWA 3FUZA 3TQWA 1ZTYA 2WOLA 4Q30B 2GFEA 5FTIA 4LZ8A 3VVDA 1B40A 3ECRA 2NVUB 4LVQA 4XTCQ 1UQWA 4PFYA 1EZOA 3C35A 1B4HA 3DM0A 3VLWA 4MH5A 1BKAA 3PMVA 1MPBA 2F78A 4H65A 3CIJA 1NH7A 1B1XA 2OWSA 2ZYMA 3OD7A 5IAIA 3UORA 1XVYA 4X1DA 1DPPA 1P1UA 4QF9A 4JSDA 3MVZA 2XXWA 4GOTA 1Q35A 3W15C 4KI0E 1IIWA 1M5CA 4NWDA 4EDPA 1TFDA 4LUBA 1BLFA 1Y3NA 3CFZA 3MP1A 4F3BA 4FAJA 3W9VA 3K6WA 1NNTA 1I6QA 2ESNA 2DXYA 4E0XA 1JW1A 4HW8A 5H8SA 1ZLQA 1MQGA 3IOVA 1P1OA 4JXIA 3FTOA 4YB5A 3LSWA 4R6HA 2PT2A 1EZPA 4LONB 1URDA 4BDOA 2Y7RA 3PU5A 1FTJA 4NF4B 1B51A 3C4MA 1XT8A 4OTEA 1S9TA 3CRBA 3R26A 3TTLA 2VOZA 1B5IA 3IORA 1S50A 3H6VA 1IQ7A 1B52A 1GV8A 5ICTA 1B3EA 3V8XB 1NKXA 1UTBA 4PP0A 4HTGA 1SW4A 1UIUA 1PC3A 4H8JA 2OWTA 3S2VA 4ZEBA 3TTKA 4U21A 1TXFA 2QJEA 2HQ0A 1AIVA 2I3VA 4GWOA 3WAEA 3MWBA 1XHYA 1WODA 1MPCA 4OENA 1B1HA 4ELPA 2Y7WA 4TQUQ 2Z8FA 4EF1A 3TQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHB A;  1MH4 A;  1OQH A;  1II5 A;  3PD9 A;  2DSF A;  5AA2 A;  2PMS A;  1Y3Q A;  3HO7 A;  3KEI A;  1Y9U A;  3K6U A;  3H6W A;  3VLV A;  1OLC A;  3PPP A;  1JEV A;  1SDX A;  2LAO A;  1NNP A;  1US4 A;  4EQB A;  2XXU A;  3TEL A;  4NF8 B;  1PEB A;  2PVU A;  3KFM A;  2Q88 A;  2OK2 A;  1EU8 A;  1Z7M E;  4R9F A;  4NF5 B;  3R7X A;  2ZNS A;  5I58 A;  3RPW A;  3ILU B;  3M3K A;  3SEU A;  2DP8 A;  1SW5 A;  1OLA A;  4G68 C;  3G3G A;  4GVO A;  4JB7 A;  3RNN A;  1IXG A;  3RYB A;  5CBS A;  3K1M A;  1D4N A;  3AXF A;  1ELJ A;  3GZG A;  4PQJ A;  3KN8 A;  2I0C A;  2X7Q A;  2FNC A;  1HSJ A;  3S9N C;  4UA8 A;  1N3W A;  3OO9 A;  3V5A A;  1N0T A;  5ITO A;  3K01 A;  1LCT A;  2ANJ A;  4DXB A;  3K6V A;  2VHA A;  1OQG A;  2THI A;  3E9X A;  3SEV A;  4GF8 A;  1M5E A;  2ABH A;  2DXR A;  1SD3 A;  4YIC A;  3TTR A;  1B5J A;  3HN0 A;  3U93 A;  3GBB A;  1R9Q A;  3WAF A;  1I6B A;  4BDM A;  1B2H A;  2DS9 A;  2DWJ A;  1B3H A;  2E1S A;  1SW2 A;  3P7I A;  1FQA A;  5CMK A;  4OET A;  3U92 A;  3HHF A;  2FYI A;  2Y7I A;  1MG1 A;  1B9J A;  2O51 A;  3FD3 A;  4QFP A;  4ND9 A;  1USY H;  2HEU A;  5I59 B;  4QRZ A;  1LFG A;  3U1O A;  1B5H A;  1UTH B;  3M3F A;  2QL3 A;  3PPQ A;  4U23 A;  1A7L A;  3SEX A;  4ELR A;  4ZZA A;  1A54 A;  4KFQ A;  1RYX A;  3HPI A;  4BDQ A;  3PGF A;  4YMB A;  4FJP A;  4ZEC A;  4ELQ A;  1SI0 A;  2I48 A;  4KD5 A;  1GR2 A;  4R73 A;  3IB1 A;  1MQJ A;  1TT1 A;  4C1T A;  1B4Z A;  3TEP A;  3RT8 A;  3KOS A;  3K1P A;  4RNS A;  5CC2 A;  3E4R A;  1URG A;  4H67 A;  1QUL A;  4G68 A;  1O64 A;  2G93 A;  3OSR A;  2P1S A;  4MLV A;  1D9V A;  1MQD A;  5H8Q A;  3A3U A;  1D9Y A;  3FJ7 A;  3N6T A;  3T22 A;  3OEM A;  1FCK A;  2D3I A;  4ZE8 A;  4H5G A;  3DP8 A;  4P0I A;  1JW5 A;  2B4M A;  3MJN A;  1PDA A;  2GH9 A;  1QUI A;  3OMB A;  3H3G A;  4FE8 A;  3IB2 A;  5I57 A;  4R6Y A;  1YPN A;  4UAC A;  4FIM A;  3PD8 A;  2A5T A;  4DZ1 A;  4F39 A;  5KCJ B;  3B6W A;  4N13 A;  4M4G A;  3UGW A;  2ONS A;  5H8N B;  2ZXT A;  3OO7 A;  4QFK A;  3SER A;  4EQ7 A;  2PBW A;  3DRF A;  3IAZ A;  1Z7N E;  4NF6 A;  2DWA A;  4DDD A;  2YLN A;  3D4C A;  1MPD A;  4U1O A;  2QS1 A;  2HZK A;  3TCF A;  2XXV A;  4XKR A;  4XXU A;  1AOV A;  1FQB A;  1Y3P A;  3B7D A;  5DEX A;  4ZEK A;  5FTH A;  3VVF A;  4OQO A;  5A5X B;  4OES A;  5TU0 A;  2REG A;  2UXA A;  2XXQ A;  1LBC A;  3I3V A;  4FED A;  1LB9 A;  3ONM A;  4E0W A;  1QJM A;  3FVK A;  2VGQ A;  5AA3 A;  3FZV A;  1MRP A;  1LBB A;  5JEI A;  4HCY A;  4TLM B;  3RGY A;  3VXC A;  5TPA B;  3RN8 A;  3RUM A;  2E0S A;  2A5S A;  2XXH A;  2B3F A;  4MLQ A;  3IL1 B;  3TUS A;  3O28 A;  1B7U A;  5J1D A;  2UVI A;  2WOP A;  4R2F A;  4QFO A;  3C33 A;  3TTN A;  4R6K A;  2Z8D A;  2I6E A;  4EF2 A;  5BWJ A;  3BKI B;  2H4I A;  3RT6 B;  2X26 A;  3FV1 A;  2PYY A;  3C9H A;  4XKN A;  4EXK A;  1DMB A;  3VFJ A;  4X1B A;  4RY1 A;  5M2V A;  1IXC A;  2DVC A;  4M1V A;  1O63 A;  1IXI A;  3CFL A;  3HV1 A;  2V84 A;  1P99 A;  3FGS A;  3U8Q A;  1MDQ A;  1B6H A;  4BDN A;  3OO6 A;  1IIT A;  1Y1M A;  3GXA A;  1HSL A;  1AMF A;  1TFA A;  4KCD A;  4NWC A;  1YCJ A;  2YJP A;  1QW0 A;  4YMA A;  1IZ1 A;  1FQE A;  1KWH A;  4IY5 A;  2QMX A;  2AL5 A;  1OIB A;  3V89 B;  3KOT A;  4LQ5 A;  3IJO B;  4F3P A;  3CSG A;  3SKP A;  2ZNT A;  2P2A A;  3CI8 A;  3S9L C;  3GBA A;  4BLA A;  4QSE A;  4DE8 A;  4DXU A;  3OEL A;  5K2Y A;  4I62 A;  2FA7 A;  4OYV A;  1NL5 A;  3MP6 A;  4KYD A;  4R2B A;  1DTG A;  4ZED A;  3C32 A;  4RK2 A;  3U94 A;  5F1Q A;  2X7P A;  3PAM A;  2I3W A;  3JZJ A;  4ISU A;  1JVX A;  2DWH A;  1AL3 A;  3KJT A;  1CE2 A;  3TYH A;  4DXC A;  4THI A;  2ALU A;  2XXI A;  4I8C A;  3BBR A;  5CMM A;  2NUV A;  2RC7 A;  1MY3 A;  4IGT A;  5DT6 A;  3Q25 A;  3VVE A;  4QFL A;  4OVJ A;  2OLB A;  4NF4 A;  2PT1 A;  2QS3 A;  3MZ9 A;  5KDT A;  1EZ9 A;  4BDR A;  1XC1 A;  5DTB A;  4PFW A;  2QPQ A;  4ONY A;  2XXT A;  4IO3 A;  1N7X A;  1B3L A;  4OER A;  3PMX A;  2UVH A;  4RXL A;  1JET A;  1A99 A;  1MY2 A;  1POT A;  4JBZ A;  2I4C A;  4LP2 B;  4FEC A;  1FTK A;  3IOU A;  1MXV A;  3KBR A;  4OFL A;  2B3B A;  4U2R A;  1ZU0 A;  4G8N A;  3FJM A;  4ECF A;  2IEE A;  1BP5 A;  2H98 A;  4WEP A;  1XOC A;  3QK6 A;  4Z7E A;  3KN3 A;  5FHN A;  4EQ9 A;  5ITP A;  2XXP A;  3O9P A;  4EXL A;  1NNK A;  4FAT A;  5L9M A;  2F5X A;  5ISU A;  1M5B A;  2HZL A;  2VD3 A;  3RTW B;  4F29 A;  4XIG Q;  4U4X A;  3O6H A;  4H6D A;  4OMB A;  3FXR A;  5F7V A;  4OXV A;  3PPN A;  1TWY A;  4IO4 A;  4NF8 A;  2NXO A;  3QAX A;  4QSD A;  4MBP A;  3MPK A;  3E13 X;  1B46 A;  1LGB C;  3FVN A;  1NFT A;  3MW0 A;  1N04 A;  5JTY B;  4ZZE A;  3SES A;  4GFR A;  5DYH A;  2VD2 A;  3T9X B;  2WOK A;  1B3G A;  4QHQ A;  5LOM A;  1SQY A;  1FQD A;  1FTL A;  2QRY A;  1MXX A;  4GD5 A;  5CI5 A;  5I2N B;  1MQH A;  4AQ4 A;  4X48 A;  1D3K A;  4ZE9 A;  2AIX A;  1MXY A;  1LAX A;  1MY0 A;  2R6G E;  3DRJ A;  4G8M A;  5I84 A;  4G4P A;  4JWX A;  3S9M C;  3O29 A;  2XXR A;  3LSF B;  3SET A;  2HFB A;  3DRI A;  3F11 A;  3TCH A;  3DEL B;  1LLS A;  3THI A;  1ANF A;  4P11 A;  1VFE A;  3OXN A;  3DRG A;  3S4U A;  1N3X A;  1FW0 A;  2F8D A;  1S7Y A;  4NTL A;  1OVB A;  3H4Z A;  3PUX E;  1MDP 1;  3G3K A;  4DCX A;  3UP9 A;  1RKM A;  3G3H A;  3B6Q A;  3FVO A;  4IB2 A;  3PUW E;  4YU0 A;  3MZ1 A;  4OEU A;  5L9O A;  3BFT A;  4YAH X;  2XX7 A;  4EUO A;  5I56 B;  1A8E A;  5K2X A;  5I59 A;  1LFI A;  4U1Z A;  3K4U A;  3H6U A;  3O66 A;  1UTH A;  2HAV A;  5ICQ A;  3LVU A;  4PFT A;  1LAG E;  1OVT A;  1VSO A;  4DIG A;  2V25 A;  4F1Y A;  3UN6 A;  4DLD A;  1H3D A;  2VP1 A;  3IK6 B;  4AB5 A;  3IOT A;  2F6P A;  3FIR A;  5H8H B;  1ZKB A;  4TLL B;  4PE5 B;  1QUK A;  3PUV E;  4JWY A;  3MVY A;  4OFJ A;  5AA1 A;  1H43 A;  4JSO A;  1Y1Z A;  3VXB A;  1VFD A;  5HBC A;  1POY 1;  3KSJ A;  4GIZ A;  5CBR A;  2AL4 A;  4R74 A;  3CHG A;  2H5Y A;  5EHS A;  1SBP A;  3IX1 A;  3IO6 A;  3K0V A;  1LFH A;  4GL0 A;  2H9B A;  3CG1 A;  2Z23 A;  2YPN A;  2Q2C A;  3USD A;  3I6V A;  3TPA A;  3RYA A;  1FQC A;  2OJT A;  2WKY A;  4F3S A;  4IY6 A;  4R72 A;  2XX8 A;  5CMB A;  3CSB A;  4RPO A;  1M5F A;  5B7D A;  2CMO A;  4Z0I A;  4C1U A;  1XS5 A;  3RQT A;  3SEW A;  3K2D A;  1FQF A;  1L5T A;  4H5F A;  4KHZ E;  2V3U A;  5KCJ A;  5AA4 B;  1MS7 A;  4ZEI A;  4IO2 A;  3O6G A;  2O1L A;  1LB8 A;  2I0B A;  1NNF A;  3KSX A;  3RTF B;  1F9B A;  3FAS A;  1IXH A;  3K00 A;  3I5O A;  3VLU A;  1MM6 A;  2F7C A;  4U4S A;  3O6P A;  1JVY A;  2GHA A;  4F22 A;  3R6U A;  2RIN A;  3EN3 A;  1OMP A;  2Z22 A;  4Q0C A;  3MUQ A;  5H8F B;  2F7B A;  3K1N A;  4N6P A;  3VDF A;  4QSC A;  5CMC A;  1Y20 A;  2R71 A;  5A5X A;  3C31 A;  5TP9 B;  4YKP A;  3RLF E;  3H06 B;  2QS2 A;  3S9E A;  1ZIU A;  5DVI A;  3UIF A;  2HCA A;  1Q1K A;  5I2K B;  1B0H A;  2O69 A;  3HCQ A;  4O3C A;  5AA2 D;  1IUD A;  2DWI A;  1XVX A;  4F19 A;  2F6G A;  4G8H A;  3EHU A;  1PBP A;  5TPA A;  1J1N A;  4OWD A;  2NWJ A;  4NMY A;  2DQV A;  3O97 A;  2GRV A;  1O7T A;  1VR5 A;  3FV2 A;  4FEB A;  3T9U A;  2Y84 A;  3B6T A;  1VE4 A;  3Q27 A;  2DVZ A;  2I4B A;  4U22 A;  1BTJ A;  3PUY E;  2RF1 A;  5EHM A;  3V83 A;  1B58 A;  4YB6 A;  1WDN A;  3MZB A;  3KN7 A;  2G29 A;  4KR5 A;  4ELO A;  2F35 A;  2V3T A;  4TOZ A;  3UK4 A;  3OOA A;  4DCY A;  2O84 X;  5HM4 B;  2F34 A;  4K3F A;  3T96 B;  4ZEF A;  2H99 A;  3E3K A;  1GGG A;  3EQ1 A;  4KYE A;  2O1M A;  3HST A;  3JYR A;  4Q5T A;  1PBQ A;  2ZYK A;  3LR1 A;  2H25 A;  1P1W A;  3QYT A;  5CRY A;  1YAE A;  5ELV A;  2O6A A;  3H03 A;  2UVG A;  2V3Q A;  2I58 A;  3TAJ A;  4F1U A;  4L17 A;  1CB6 A;  3FXU A;  1LAF E;  3IOW A;  3PUZ E;  1N84 A;  2DE3 A;  4XKP A;  2UVJ A;  3KZG A;  3SEY A;  5DVF A;  1DTZ A;  1NMU A;  4YKK A;  1R1N A;  2W7Y A;  1H45 A;  4HS7 A;  4F31 B;  1ZBM A;  3OEK A;  2CZL A;  1N7W A;  3RY3 A;  3TFL A;  4OZ9 A;  4POX A;  1PB9 A;  2DE4 A;  2F7A A;  3TZA A;  2ONR A;  4GXA A;  3TTM A;  1ATG A;  4GQO A;  4XKQ A;  4LA9 A;  3QIM A;  3T66 A;  4RA1 A;  1LAH E;  1A40 A;  1P1N A;  3MVX A;  4ZS9 A;  3M8U A;  5KDT B;  5L9S A;  4OHN A;  3MBP A;  1B7H A;  2DE2 A;  1UTB B;  2RC8 A;  4JDF A;  2O7U A;  4OFO A;  2XHD A;  2QS4 A;  3FJG A;  2F97 A;  4H8I A;  2ZYN A;  3D4G A;  4ESW A;  3QUF A;  1FTO A;  3DRH A;  2XD3 A;  2B65 A;  4R9G A;  2UYE A;  4GRK A;  5AA2 B;  2AYS A;  1IEJ A;  1A8F A;  4IGR A;  1DPE A;  3ZKL A;  1M5D A;  4F18 A;  4RK9 A;  3IO4 A;  3KJ7 A;  4GXS B;  3T9V A;  2DOJ A;  4R75 A;  2R9J A;  4YB7 A;  1PB7 A;  1SYI A;  2D21 A;  3LSL A;  2KLF A;  2DYX A;  1DOT A;  4POW A;  3L6G A;  3DLN A;  3BFU A;  1US5 A;  1N76 A;  3UA8 A;  5HPQ A;  4LAT A;  4FOR A;  3DP4 A;  1HSE A;  2O68 A;  4ZDM A;  4G2Z A;  4LZ5 A;  3M3L A;  1QKB A;  5I58 B;  3TDJ A;  3TMG A;  3IB0 A;  1GTK A;  4F2O A;  3O2A A;  4H0W A;  2XXY A;  3VE1 B;  3W9W A;  5CM6 A;  4NF5 A;  3TKD A;  3CR9 A;  3MC2 A;  5JK4 A;  4O3B A;  1MY4 A;  1SI1 A;  3Q28 A;  1BIY A;  3PMW A;  1MXW A;  5KZT A;  2RKM A;  4PET A;  2ZYO A;  3EF7 A;  2NOO A;  1H76 A;  3IJX B;  1YTV A;  3C34 A;  1JEU A;  3MQ9 A;  3ZSF A;  4KQP A;  1R9L A;  4NE4 A;  2I49 A;  3A09 A;  1SW1 A;  1URS A;  2OBG A;  4O3A A;  2ZNU A;  5JTY A;  4KPT A;  4F3G A;  1EH3 A;  1R6Z A;  5FHO A;  4N07 A;  4YZZ A;  2BJJ X;  1MXZ A;  2UYF A;  3LUY A;  3PV0 E;  5FHM A;  4GL8 A;  2Y7K A;  2QMW A;  5IKB A;  4PFU A;  4NED A;  5I2N A;  1B32 A;  4WED A;  3VV5 A;  5AE4 A;  3L6H A;  2M8C A;  3K02 A;  1B05 A;  3KGC A;  2HAU A;  3G7W A;  2PX1 A;  3EHT A;  1LST A;  1JW4 A;  4YKI A;  4QFN A;  3K6X A;  3IR1 A;  4RPN A;  1H44 A;  4LQ2 A;  4X9T A;  4YKJ A;  1AH5 A;  2Q8J A;  3FAT A;  1A55 A;  1RYO A;  2HXW A;  4IO5 A;  1I6A A;  3U72 A;  2IA4 A;  1MY1 A;  2OCU A;  4P0G A;  3LC8 A;  2Q89 A;  2Q2A A;  2RCB A;  1UIV A;  4Q8R A;  5I56 A;  4OEV A;  3MPL A;  1DSN A;  3OSQ A;  3T9H B;  3O6I A;  4G68 B;  2V93 A;  3FVG A;  3HHG A;  3G3J A;  3CVG A;  1QVS A;  5H8Q B;  1Y4C A;  2QSX A;  3PPO A;  3QUJ A;  5H8H A;  4RJZ A;  5EYF A;  3TOD A;  2RCA A;  1B0L A;  4RYA A;  3PPR A;  2REJ A;  3G3I A;  2O7I A;  3MAM A;  3QXM A;  2Z8E A;  4WKM A;  4G77 A;  5I57 B;  3OO8 A;  1JQF A;  1T0K A;  5L8D A;  3TCG A;  1Y4T A;  3JV9 A;  4I9D A;  3OEN A;  1JNF A;  1ZMG A;  3T93 B;  2A5T B;  3ODB A;  3LSX A;  3H6T A;  1SYH A;  1MM7 A;  3ZKK A;  5DVJ A;  4ESX A;  3ILT B;  3SDF A;  4MFI A;  4LZ7 A;  3A3C A;  2D5W A;  3DP6 A;  3Q26 A;  1QUJ A;  1MXU A;  3N94 A;  4NF6 B;  1MH3 A;  4C0R A;  4AB6 A;  1I69 A;  3H7M A;  1GVC A;  2B4L A;  2OZZ A;  3EHS A;  2RC9 A;  5H8N A;  1USY E;  4BDL A;  3FXQ A;  1FTM A;  3MP8 A;  4F1V A;  1WVJ A;  5DEX B;  4F2Q A;  3N5L A;  2Q9T A;  5AA4 A;  3GLB A;  3ZS6 A;  3G3F A;  1MQI A;  1P1Q A;  3QSL A;  4IO7 A;  2P0S A;  2ONK E;  3CG3 A;  1PB8 A;  5BUU A;  3Q29 A;  2Y7P A;  1QKA A;  3DRK A;  4KCC A;  4MF3 A;  3C36 A;  3N6U A;  4JWO A;  2ZMB A;  4HCW A;  3KG2 A;  2F36 A;  4H1X A;  1SVX B;  5H8F A;  4KYS A;  2XXX A;  1B3F A;  2XD2 A;  4I1D A;  4WXJ A;  1ZJL A;  4GLI A;  3LBS A;  4IO6 A;  5TP9 A;  2XX9 A;  1LCF A;  1NH8 A;  3CFX A;  5B70 A;  3N26 A;  5I2K A;  1B7Z A;  3EPE A;  3MVW A;  3FUZ A;  3TQW A;  1ZTY A;  2WOL A;  4Q30 B;  2GFE A;  5FTI A;  4LZ8 A;  3VVD A;  1B40 A;  3ECR A;  2NVU B;  4LVQ A;  4XTC Q;  1UQW A;  4PFY A;  1EZO A;  3C35 A;  1B4H A;  3DM0 A;  3VLW A;  4MH5 A;  1BKA A;  3PMV A;  1MPB A;  2F78 A;  4H65 A;  3CIJ A;  1NH7 A;  1B1X A;  2OWS A;  2ZYM A;  3OD7 A;  5IAI A;  3UOR A;  1XVY A;  4X1D A;  1DPP A;  1P1U A;  4QF9 A;  4JSD A;  3MVZ A;  2XXW A;  4GOT A;  1Q35 A;  3W15 C;  4KI0 E;  1IIW A;  1M5C A;  4NWD A;  4EDP A;  1TFD A;  4LUB A;  1BLF A;  1Y3N A;  3CFZ A;  3MP1 A;  4F3B A;  4FAJ A;  3W9V A;  3K6W A;  1NNT A;  1I6Q A;  2ESN A;  2DXY A;  4E0X A;  1JW1 A;  4HW8 A;  5H8S A;  1ZLQ A;  1MQG A;  3IOV A;  1P1O A;  4JXI A;  3FTO A;  4YB5 A;  3LSW A;  4R6H A;  2PT2 A;  1EZP A;  4LON B;  1URD A;  4BDO A;  2Y7R A;  3PU5 A;  1FTJ A;  4NF4 B;  1B51 A;  3C4M A;  1XT8 A;  4OTE A;  1S9T A;  3CRB A;  3R26 A;  3TTL A;  2VOZ A;  1B5I A;  3IOR A;  1S50 A;  3H6V A;  1IQ7 A;  1B52 A;  1GV8 A;  5ICT A;  1B3E A;  3V8X B;  1NKX A;  1UTB A;  4PP0 A;  4HTG A;  1SW4 A;  1UIU A;  1PC3 A;  4H8J A;  2OWT A;  3S2V A;  4ZEB A;  3TTK A;  4U21 A;  1TXF A;  2QJE A;  2HQ0 A;  1AIV A;  2I3V A;  4GWO A;  3WAE A;  3MWB A;  1XHY A;  1WOD A;  1MPC A;  4OEN A;  1B1H A;  4ELP A;  2Y7W A;  4TQU Q;  2Z8F A;  4EF1 A;  3TQL A; 
#chains in the Genus database with same CATH topology
 2GHB A;  1MH4 A;  1OQH A;  1II5 A;  3PD9 A;  2DSF A;  5AA2 A;  2PMS A;  1Y3Q A;  4NAP A;  4NN3 A;  3HO7 A;  3KEI A;  1Y9U A;  3K6U A;  3H6W A;  3VLV A;  1OLC A;  3PPP A;  4OVP A;  1JEV A;  1SDX A;  4PGP A;  2LAO A;  4H45 A;  2ZZX A;  1NNP A;  1US4 A;  3BIG A;  4EQB A;  2XXU A;  3TEL A;  4NF8 B;  1PEB A;  2PVU A;  3KFM A;  4FBP A;  2Q88 A;  2OK2 A;  1EU8 A;  2WYP A;  4MMP A;  1Z7M E;  4R9F A;  4NF5 B;  3R7X A;  2ZNS A;  4I3E A;  5I58 A;  3D1R A;  3RPW A;  3ILU B;  3M3K A;  3SEU A;  2DP8 A;  1SW5 A;  1OLA A;  1RDX A;  4G68 C;  3G3G A;  1FBF A;  4GVO A;  4JB7 A;  3RNN A;  1IXG A;  3RYB A;  5CBS A;  3K1M A;  1NV6 A;  2V4C A;  1D4N A;  3AXF A;  1ELJ A;  3GZG A;  4PQJ A;  3KN8 A;  4X04 A;  1LEV A;  2I0C A;  2X7Q A;  2FNC A;  1YZ0 A;  1HSJ A;  3S9N C;  1K9Y A;  4UA8 A;  2ZZV A;  1N3W A;  3OO9 A;  3V5A A;  1N0T A;  5ITO A;  3K01 A;  1LCT A;  2ANJ A;  4DXB A;  3K6V A;  2VHA A;  1OQG A;  2THI A;  3E9X A;  3B50 A;  3SEV A;  4GF8 A;  2PFY A;  1M5E A;  1FBH A;  2ABH A;  2DXR A;  1LBY A;  1SD3 A;  4YIC A;  1IMA A;  3TTR A;  1B5J A;  3HN0 A;  3U93 A;  4O8M A;  3GBB A;  1R9Q A;  1FBG A;  3WAF A;  2ZZW A;  1I6B A;  4BDM A;  1B2H A;  4GWZ A;  2DS9 A;  1G0H A;  2DWJ A;  1B3H A;  2E1S A;  1SW2 A;  3P7I A;  2DDK A;  1FQA A;  4PGN A;  5ET7 A;  5CMK A;  4OET A;  3U92 A;  4MEV A;  2PCR A;  3HHF A;  2FYI A;  2Y7I A;  1MG1 A;  1B9J A;  2O51 A;  3FD3 A;  4XFE A;  4QFP A;  2CZK A;  1USY H;  4ND9 A;  2HEU A;  5I59 B;  4QRZ A;  1LFG A;  3U1O A;  4LN5 A;  1B5H A;  1UTH B;  3M3F A;  2QL3 A;  3PPQ A;  4U23 A;  1A7L A;  1NV1 A;  3SEX A;  4ELR A;  4ZZA A;  1A54 A;  4KFQ A;  1RYX A;  3HPI A;  4BDQ A;  3PGF A;  4YMB A;  4FJP A;  4ZEC A;  3PTY A;  4ELQ A;  1SI0 A;  2I48 A;  4KD5 A;  1GR2 A;  4R73 A;  3IB1 A;  1MQJ A;  1TT1 A;  4C1T A;  1B4Z A;  3TEP A;  1G0I A;  3RT8 A;  3KOS A;  3K1P A;  1JP4 A;  4RNS A;  3E79 A;  4NF0 A;  5CC2 A;  1NV3 A;  3E4R A;  1URG A;  4H67 A;  1QUL A;  4G68 A;  4DI3 D;  1AWB A;  1O64 A;  2G93 A;  3OSR A;  2P1S A;  4MLV A;  2HHM A;  1D9V A;  1MQD A;  5H8Q A;  3A3U A;  1D9Y A;  3FJ7 A;  4OVS A;  3N6T A;  3T22 A;  3OEM A;  1FCK A;  2D3I A;  4ZE8 A;  4H5G A;  3DP8 A;  4P0I A;  1JW5 A;  2B4M A;  3MJN A;  1PDA A;  4N6K A;  2GH9 A;  1QUI A;  3OMB A;  1IME A;  4PTK A;  3H3G A;  4FE8 A;  3IB2 A;  5I57 A;  4R6Y A;  1SPI A;  1YPN A;  4UAC A;  4P3L A;  2WYK A;  4IR8 A;  4FIM A;  4PAF A;  3PD8 A;  1IMC A;  2A5T A;  4DZ1 A;  4F39 A;  4N91 A;  5KCJ B;  1FRP A;  3B6W A;  4N13 A;  4M4G A;  3UGW A;  2ONS A;  5H8N B;  2ZXT A;  3OO7 A;  4QFK A;  3SER A;  4EQ7 A;  2PBW A;  3DRF A;  3IAZ A;  5EQ9 A;  1Z7N E;  4NF6 A;  2DWA A;  2WX9 A;  4DDD A;  2YLN A;  2QVR A;  3D4C A;  1MPD A;  4U1O A;  2QS1 A;  2HZK A;  3TCF A;  2XXV A;  4MX6 A;  4XKR A;  1LBX A;  4XXU A;  1AOV A;  1FQB A;  1Y3P A;  3B7D A;  5DEX A;  4ZEK A;  5FTH A;  3VVF A;  4OQO A;  5A5X B;  4OES A;  5TU0 A;  2REG A;  2UXA A;  2XXQ A;  3FXB A;  4GBW A;  1LBC A;  2WBB A;  4GBV A;  3I3V A;  4FED A;  1LB9 A;  3ONM A;  1FTA A;  4E0W A;  1QJM A;  2KR0 A;  3FVK A;  2VGQ A;  5AA3 A;  3FZV A;  1MRP A;  1LBB A;  5JEI A;  3KC1 A;  4HCY A;  4TLM B;  3RGY A;  2P3N A;  3VXC A;  3SZP A;  5TPA B;  3RN8 A;  1EYK A;  3RUM A;  2VPO A;  2E0S A;  2A5S A;  2QVU A;  2XXH A;  2B3F A;  4MLQ A;  2FHY A;  4PAK A;  3IL1 B;  3TUS A;  3O28 A;  1B7U A;  5J1D A;  2UVI A;  1FJ6 A;  2WOP A;  4R2F A;  4QFO A;  3C33 A;  3TTN A;  4R6K A;  2Z8D A;  2I6E A;  4EF2 A;  5BWJ A;  3BKI B;  4OVR A;  2H4I A;  3RT6 B;  4P56 A;  2X26 A;  3FV1 A;  2PYY A;  3C9H A;  4XKN A;  4EXK A;  1DMB A;  3VFJ A;  1FBP A;  4X1B A;  4RY1 A;  5M2V A;  1IXC A;  4PDH A;  5A5L A;  2Q8M A;  2DVC A;  4M1V A;  1O63 A;  1IXI A;  3CFL A;  3HV1 A;  2V84 A;  1P99 A;  3FGS A;  3U8Q A;  1MDQ A;  4AS5 A;  1B6H A;  4BDN A;  2Y5L A;  3OO6 A;  1IIT A;  1Y1M A;  3GXA A;  1HSL A;  1AMF A;  1XI6 A;  1TFA A;  4KCD A;  4NWC A;  1YCJ A;  2YJP A;  1QW0 A;  4YMA A;  1IZ1 A;  1FQE A;  1KWH A;  4GWY A;  4IY5 A;  2QMX A;  2AL5 A;  1OIB A;  3V89 B;  3KOT A;  4LQ5 A;  3IJO B;  1NV7 A;  4F3P A;  3CSG A;  3SKP A;  2ZNT A;  2P2A A;  3CI8 A;  3S9L C;  3GBA A;  4BLA A;  4QSE A;  4DE8 A;  4DXU A;  3OEL A;  5K2Y A;  4I62 A;  2FA7 A;  4OYV A;  1NL5 A;  2PFZ A;  3MP6 A;  4KYD A;  4R2B A;  3LUZ A;  1DTG A;  4ZED A;  3C32 A;  4RK2 A;  3U94 A;  5F1Q A;  2X7P A;  3PAM A;  2I3W A;  3JZJ A;  4ISU A;  1JVX A;  2DWH A;  1AL3 A;  3KJT A;  1CE2 A;  3TYH A;  4DXC A;  4THI A;  2ALU A;  2XXI A;  4I8C A;  3BBR A;  5CMM A;  2NUV A;  2RC7 A;  1MY3 A;  2FIE A;  4IGT A;  5DT6 A;  3Q25 A;  3VVE A;  4QFL A;  4OVJ A;  2OLB A;  4NF4 A;  2PT1 A;  2QS3 A;  3MZ9 A;  5KDT A;  1EZ9 A;  4BDR A;  1XC1 A;  5DTB A;  4PFW A;  2QPQ A;  4ONY A;  2XXT A;  4IO3 A;  1N7X A;  1B3L A;  4OER A;  3PMX A;  2UVH A;  4RXL A;  1JET A;  1A99 A;  1MY2 A;  3QMF A;  2XWO A;  1POT A;  4JBZ A;  2I4C A;  2XWI A;  5IZZ A;  4LP2 B;  4FEC A;  4P47 A;  1FTK A;  3NOH A;  1INP A;  4N8G A;  3IOU A;  1MXV A;  3KBR A;  4OFL A;  4NQ8 A;  2B3B A;  4U2R A;  4OAN A;  1ZU0 A;  4G8N A;  3FJM A;  4ECF A;  2IEE A;  1BP5 A;  2QFL A;  2H98 A;  4WEP A;  1XOC A;  3QK6 A;  4Z7E A;  3KN3 A;  5FHN A;  4EQ9 A;  5ITP A;  2XXP A;  3O9P A;  4EXL A;  1NNK A;  4FAT A;  5L9M A;  2F5X A;  5ISU A;  1M5B A;  2HZL A;  2VD3 A;  3RTW B;  5LTC A;  4F29 A;  4XIG Q;  4U4X A;  3O6H A;  4H6D A;  4OMB A;  3FXR A;  1BK4 A;  5F7V A;  3U65 A;  1KA0 A;  4OXV A;  1FPD A;  3PPN A;  1TWY A;  4IO4 A;  1DBZ A;  4NF8 A;  2NXO A;  1NV2 A;  3QAX A;  5EYH A;  4QSD A;  4MBP A;  3MPK A;  3E13 X;  1B46 A;  1LGB C;  3FVN A;  1NFT A;  3MW0 A;  1N04 A;  5JTY B;  4ZZE A;  3SES A;  4GFR A;  5DYH A;  2VD2 A;  4PAI A;  3T9X B;  2WOK A;  1B3G A;  4MNI A;  4QHQ A;  2XWV A;  4PDD A;  5LOM A;  1SQY A;  1FQD A;  1FTL A;  2QRY A;  1MXX A;  4GD5 A;  5CI5 A;  5I2N B;  1MQH A;  4AQ4 A;  2FIX A;  4X48 A;  1D3K A;  4ZE9 A;  2AIX A;  1MXY A;  1LAX A;  4PFB A;  1MY0 A;  2R6G E;  3DRJ A;  4G8M A;  5I84 A;  4G4P A;  4JWX A;  3S9M C;  3O29 A;  2XXR A;  3LSF B;  3SET A;  2HFB A;  3DRI A;  3F11 A;  3TCH A;  3RPL B;  3DEL B;  1LLS A;  3THI A;  1ANF A;  4OVQ A;  4P11 A;  1VFE A;  3OXN A;  3DRG A;  3S4U A;  1N3X A;  2KQZ A;  1FW0 A;  1NUW A;  4MNP A;  2F8D A;  3KBZ A;  1S7Y A;  4NTL A;  1OVB A;  1DCU A;  5ESY A;  3H4Z A;  3PUX E;  1MDP 1;  3G3K A;  4MJO A;  4DCX A;  3UP9 A;  1RKM A;  3G3H A;  3B6Q A;  3FVO A;  4IB2 A;  3PUW E;  4YU0 A;  3MZ1 A;  1FPJ A;  4OEU A;  4KXP A;  5L9O A;  3BFT A;  5T3J A;  4YAH X;  2XX7 A;  4EUO A;  5I56 B;  1A8E A;  5K2X A;  5I59 A;  1LFI A;  4U1Z A;  3K4U A;  4GWU A;  3H6U A;  3O66 A;  3RYD A;  1UTH A;  2HAV A;  5ICQ A;  3LVU A;  4PFT A;  1LAG E;  1OVT A;  1VSO A;  4DIG A;  2V25 A;  4F1Y A;  3UN6 A;  4DLD A;  1H3D A;  2VP1 A;  3IK6 B;  4AB5 A;  3IOT A;  2F6P A;  3FIR A;  5H8H B;  2L5V A;  1ZKB A;  4TLL B;  4PE5 B;  1QUK A;  2CEY A;  3PUV E;  4JWY A;  3MVY A;  4OFJ A;  1FPF A;  5AA1 A;  1H43 A;  4I3Y A;  4JSO A;  1Y1Z A;  3VXB A;  1VFD A;  1KZ8 A;  5HBC A;  1POY 1;  3KSJ A;  4GIZ A;  5CBR A;  4PCD A;  2AL4 A;  4R74 A;  3CHG A;  2H5Y A;  5EHS A;  1SBP A;  3IX1 A;  3IO6 A;  3K0V A;  2GQ1 A;  1NI9 A;  1LFH A;  4GL0 A;  2H9B A;  3CG1 A;  2Z23 A;  2YPN A;  2Q2C A;  3USD A;  3I6V A;  3TPA A;  3RYA A;  1FQC A;  2OJT A;  2WKY A;  1FPL A;  4F3S A;  4IY6 A;  1FPB A;  4PBH A;  4R72 A;  2XX8 A;  5CMB A;  3CSB A;  4RPO A;  1M5F A;  5B7D A;  2CMO A;  4Z0I A;  4C1U A;  1XS5 A;  3RQT A;  3SEW A;  3GYY A;  3K2D A;  1FQF A;  2JJK A;  1L5T A;  4H5F A;  4KHZ E;  2V3U A;  5KCJ A;  5AA4 B;  1MS7 A;  3A29 A;  4G61 A;  4ZEI A;  4IO2 A;  2HXR A;  3O6G A;  2O1L A;  1LB8 A;  2I0B A;  1NNF A;  3KSX A;  3RTF B;  1F9B A;  3FAS A;  1IXH A;  3K00 A;  3I5O A;  1FBD A;  2WEF A;  3VLU A;  1MM6 A;  2F7C A;  4U4S A;  2F3B A;  3O6P A;  1JVY A;  2GHA A;  4F22 A;  4PBQ A;  3R6U A;  2RIN A;  3EN3 A;  1OMP A;  2Z22 A;  4Q0C A;  3MUQ A;  5H8F B;  5I3S A;  2F7B A;  3K1N A;  4N6P A;  3VDF A;  4QSC A;  5CMC A;  4X8R A;  1Y20 A;  2R71 A;  5A5X A;  3C31 A;  5TP9 B;  4YKP A;  3RLF E;  3ROJ A;  3H06 B;  2QS2 A;  3S9E A;  1ZIU A;  5DVI A;  3UIF A;  2HCA A;  1Q1K A;  5I2K B;  1B0H A;  2O69 A;  3HCQ A;  4O3C A;  5AA2 D;  1IUD A;  2DWI A;  1XVX A;  4F19 A;  2F6G A;  4G8H A;  3EHU A;  1PBP A;  5TPA A;  1J1N A;  4OWD A;  2NWJ A;  4NMY A;  2DQV A;  3O97 A;  2GRV A;  1O7T A;  3MST A;  4UAB A;  1VR5 A;  3FV2 A;  4FEB A;  3T9U A;  2Y84 A;  3B6T A;  4XEQ A;  1VE4 A;  3Q27 A;  2DVZ A;  2I4B A;  4U22 A;  1BTJ A;  3PUY E;  1RDY A;  2RF1 A;  5EHM A;  3V83 A;  1B58 A;  4YB6 A;  1WDN A;  3MZB A;  3KN7 A;  2G29 A;  4KR5 A;  4ELO A;  2F35 A;  2V3T A;  4P8B A;  4TOZ A;  3UK4 A;  2XXK A;  3OOA A;  3T1B A;  4DCY A;  2O84 X;  5HM4 B;  2F34 A;  4K3F A;  3T96 B;  4ZEF A;  2H99 A;  3E3K A;  1GGG A;  3EQ1 A;  4KYE A;  3IFC A;  4DI4 B;  2O1M A;  3HST A;  3JYR A;  4Q5T A;  1PBQ A;  2ZYK A;  3LR1 A;  2H25 A;  1P1W A;  3QYT A;  5CRY A;  1YAE A;  5ELV A;  2CZI A;  2O6A A;  3H03 A;  2UVG A;  2V3Q A;  2I58 A;  3TAJ A;  4F1U A;  4L17 A;  1CB6 A;  3FXU A;  1LAF E;  3IOW A;  3PUZ E;  1N84 A;  2DE3 A;  3KC0 A;  4XKP A;  2UVJ A;  3KZG A;  3SEY A;  5DVF A;  1DTZ A;  1NMU A;  4YKK A;  1R1N A;  2W7Y A;  1H45 A;  1QGX A;  4HS7 A;  4F31 B;  3LV0 A;  1ZBM A;  3OEK A;  2CZL A;  3EKI A;  1N7W A;  3RY3 A;  3TFL A;  4MHF A;  4OZ9 A;  4POX A;  1PB9 A;  2OWZ A;  2DE4 A;  4AS4 A;  2F7A A;  1NV0 A;  3TZA A;  2ONR A;  4GXA A;  1LBW A;  3TTM A;  5IZ3 B;  1ATG A;  4GQO A;  4XKQ A;  1LBV A;  4LA9 A;  3QIM A;  3T66 A;  4RA1 A;  1Q9D A;  1LAH E;  1A40 A;  1P1N A;  3MVX A;  4ZS9 A;  5IM2 A;  3M8U A;  1CNQ A;  5KDT B;  5L9S A;  4OHN A;  3MBP A;  1B7H A;  2DE2 A;  1UTB B;  4GWX A;  2RC8 A;  4JDF A;  2O7U A;  4OFO A;  2XHD A;  2QS4 A;  3FJG A;  2F97 A;  4H8I A;  2ZYN A;  3D4G A;  1NUY A;  4ESW A;  3QUF A;  4PF8 A;  4GWW A;  1FTO A;  3DRH A;  2XD3 A;  2B65 A;  4R9G A;  1NUZ A;  2UYE A;  4GRK A;  5ET5 A;  4PE3 A;  5AA2 B;  2AYS A;  1IEJ A;  1A8F A;  4IGR A;  1DPE A;  3HFU A;  4N4U A;  3ZKL A;  5EQ7 A;  1M5D A;  4F18 A;  4RK9 A;  3IO4 A;  3KJ7 A;  4GXS B;  3T9V A;  2DOJ A;  4R75 A;  1EYJ A;  2R9J A;  4YB7 A;  5IGA A;  1PB7 A;  1SYI A;  2D21 A;  3LSL A;  4PC9 A;  2KLF A;  2DYX A;  1DOT A;  2VT5 A;  4POW A;  3L6G A;  3DLN A;  3BFU A;  4MCO A;  1US5 A;  1N76 A;  3UA8 A;  5HPQ A;  4LAT A;  4H46 A;  1LBZ A;  1RDZ A;  4FOR A;  3DP4 A;  1HSE A;  2O68 A;  4ZDM A;  1NV4 A;  4G2Z A;  4LZ5 A;  4HE0 A;  3M3L A;  1QKB A;  5I58 B;  3E78 A;  4P1L A;  3TDJ A;  3TMG A;  3IB0 A;  1GTK A;  4F2O A;  3O2A A;  4JVD A;  4H0W A;  4JVI A;  1YXI A;  5ET6 A;  2XXY A;  3VE1 B;  3W9W A;  5CM6 A;  4NF5 A;  3TKD A;  3CR9 A;  3MC2 A;  5JK4 A;  4O3B A;  1MY4 A;  1SI1 A;  3Q28 A;  1BIY A;  3PMW A;  1MXW A;  5KZT A;  2RKM A;  4PET A;  2ZYO A;  3EF7 A;  2NOO A;  1H76 A;  3IJX B;  1YTV A;  3C34 A;  1JEU A;  3MQ9 A;  3ZSF A;  4KQP A;  1R9L A;  4NE4 A;  2I49 A;  3A09 A;  1SW1 A;  1URS A;  1VDW A;  5DW8 A;  2OBG A;  4O3A A;  2ZNU A;  5JTY A;  4KPT A;  4F3G A;  1EH3 A;  4P9K A;  1R6Z A;  5FHO A;  4N07 A;  4PFR A;  1YYZ A;  1FSA A;  4YZZ A;  2BJJ X;  1MXZ A;  2UYF A;  3LUY A;  3PV0 E;  5FHM A;  4GL8 A;  2Y7K A;  2QMW A;  5IKB A;  4PFU A;  4GWS A;  4NED A;  5I2N A;  1B32 A;  4WED A;  3ISP A;  4N81 A;  3VV5 A;  5AE4 A;  4GX6 A;  3L6H A;  1FJ9 A;  2M8C A;  3B8B A;  3K02 A;  1B05 A;  3KGC A;  5EQA A;  2HAU A;  3G7W A;  5FBP A;  2PX1 A;  3EHT A;  1LST A;  3RPL A;  1JW4 A;  4YKI A;  4QFN A;  3K6X A;  1FPI A;  3IR1 A;  4N15 A;  4RPN A;  1H44 A;  4LQ2 A;  4X9T A;  4YKJ A;  3MYU A;  1AH5 A;  2Q8J A;  3FAT A;  5ET8 A;  1A55 A;  1RYO A;  2HXW A;  2QVV A;  4IO5 A;  1I6A A;  3U72 A;  2IA4 A;  1MY1 A;  2OCU A;  4P0G A;  3LC8 A;  2Q89 A;  2Q2A A;  2Q74 A;  4N6D A;  5I7I A;  2FBP A;  2RCB A;  4PF6 A;  1UIV A;  4Q8R A;  2P3V A;  1IMD A;  5I56 A;  4OEV A;  3MPL A;  1DSN A;  3OSQ A;  3T9H B;  3O6I A;  4G68 B;  2V93 A;  3FVG A;  3HHG A;  3G3J A;  3CVG A;  1QVS A;  5H8Q B;  1Y4C A;  2QSX A;  4MAG A;  1DK4 A;  3PPO A;  3QUJ A;  5H8H A;  4RJZ A;  5EYF A;  3TOD A;  2RCA A;  1B0L A;  4RYA A;  3PPR A;  2REJ A;  3G3I A;  2O7I A;  2CEX A;  3MAM A;  3QXM A;  2Z8E A;  2HPG A;  1NV5 A;  4WKM A;  4G77 A;  5I57 B;  3OO8 A;  1JQF A;  1T0K A;  5L8D A;  3TCG A;  1Y4T A;  3JV9 A;  4I9D A;  3OEN A;  1JNF A;  1ZMG A;  3T93 B;  2A5T B;  3ODB A;  3LSX A;  3H6T A;  4O7I A;  1SYH A;  3IFA A;  1MM7 A;  3ZKK A;  4OA4 A;  5DVJ A;  2F3D A;  4ESX A;  3ILT B;  4N17 A;  4NX1 A;  3SDF A;  4MFI A;  4HXV A;  4LZ7 A;  3A3C A;  2D5W A;  3DP6 A;  3Q26 A;  1QUJ A;  1MXU A;  3N94 A;  4NF6 B;  1MH3 A;  1FPG A;  1KA1 A;  4C0R A;  4AB6 A;  1I69 A;  3H7M A;  1GVC A;  2B4L A;  2OZZ A;  3EHS A;  2RC9 A;  5H8N A;  2R8T A;  2BJI A;  1USY E;  4BDL A;  3FXQ A;  5I5P A;  1FTM A;  3MP8 A;  4F1V A;  1WVJ A;  1IMB A;  5DEX B;  4F2Q A;  4P1E A;  3N5L A;  2Q9T A;  5AA4 A;  3GLB A;  3ZS6 A;  3T0J A;  3G3F A;  1MQI A;  1P1Q A;  3QSL A;  1D9Q A;  4IO7 A;  2P0S A;  2ONK E;  3CG3 A;  1PB8 A;  4GX3 A;  5BUU A;  3Q29 A;  1FBE A;  2Y7P A;  1QKA A;  3DRK A;  4KCC A;  4MF3 A;  1FPK A;  3C36 A;  3N6U A;  4JWO A;  2ZMB A;  4HCW A;  3KG2 A;  2VPN A;  5EYG A;  2F36 A;  4O7M A;  4H1X A;  5LDZ A;  1SVX B;  4OVT A;  5H8F A;  4KYS A;  2XXX A;  1B3F A;  2XD2 A;  4I1D A;  4WXJ A;  1ZJL A;  4GLI A;  4PFI A;  3LBS A;  4IO6 A;  5TP9 A;  2XX9 A;  1LCF A;  1FBC A;  3FBP A;  1NH8 A;  3CFX A;  5B70 A;  4GX4 A;  4NGU A;  3N26 A;  5I2K A;  1B7Z A;  3EPE A;  3MVW A;  1FPE A;  3FUZ A;  3TQW A;  1ZTY A;  2WOL A;  4Q30 B;  5F24 A;  2GFE A;  5FTI A;  1K9Z A;  4LZ8 A;  3VVD A;  1B40 A;  2Y5K A;  3ECR A;  4QXD A;  2NVU B;  4LVQ A;  4XTC Q;  1UQW A;  4PFY A;  1IMF A;  1EZO A;  3C35 A;  1B4H A;  3DM0 A;  5EQ8 A;  3VLW A;  4MH5 A;  1BKA A;  3PMV A;  1MPB A;  2F78 A;  4H65 A;  3CIJ A;  5J16 A;  1NH7 A;  1B1X A;  2OWS A;  2OX3 A;  2ZYM A;  3OD7 A;  4JVC A;  5IAI A;  3UOR A;  1XVY A;  4X1D A;  1DPP A;  4QBA A;  1P1U A;  4QF9 A;  4JSD A;  3MVZ A;  2XXW A;  4GOT A;  1Q35 A;  3W15 C;  4KI0 E;  1IIW A;  1M5C A;  4NWD A;  4EDP A;  1TFD A;  4LUB A;  1BLF A;  1Y3N A;  3CFZ A;  3MP1 A;  4F3B A;  4FAJ A;  3K6W A;  3W9V A;  1NNT A;  1I6Q A;  4I40 A;  1NUX A;  4O94 A;  2ESN A;  4XF5 A;  2DXY A;  4E0X A;  1JW1 A;  2WBD A;  4HW8 A;  5H8S A;  1ZLQ A;  1MQG A;  3IOV A;  1P1O A;  4JXI A;  4MNC A;  3FTO A;  4YB5 A;  3LSW A;  4R6H A;  2PT2 A;  1EZP A;  4LON B;  1URD A;  4BDO A;  2Y7R A;  3PU5 A;  3BIH A;  1FTJ A;  4NF4 B;  1B51 A;  3C4M A;  1XT8 A;  4HE2 A;  4OTE A;  2XWK A;  1S9T A;  3CRB A;  4HE1 A;  3R26 A;  3TTL A;  2VOZ A;  1B5I A;  3IOR A;  5IZ3 A;  1S50 A;  3H6V A;  1IQ7 A;  4NHB A;  1B52 A;  1GV8 A;  5ICT A;  1B3E A;  4NG7 A;  3V8X B;  1NKX A;  1UTB A;  4PP0 A;  4HTG A;  1SW4 A;  1UIU A;  1PC3 A;  4H8J A;  2OWT A;  3S2V A;  4ZEB A;  4N8Y A;  3TTK A;  5IZ1 A;  4U21 A;  1TXF A;  2QJE A;  2HQ0 A;  1AIV A;  2CZH A;  4MIJ A;  2I3V A;  4GWO A;  3WAE A;  1EYI A;  3MWB A;  1XHY A;  1WOD A;  1MPC A;  4OEN A;  1B1H A;  2XA5 A;  4ELP A;  2Y7W A;  4TQU Q;  2FVZ A;  2Z8F A;  4EF1 A;  2MKZ A;  3TQL A; 
#chains in the Genus database with same CATH homology
 2GHB A;  1MH4 A;  1OQH A;  1II5 A;  3PD9 A;  2DSF A;  5AA2 A;  2PMS A;  1Y3Q A;  3HO7 A;  3KEI A;  1Y9U A;  3K6U A;  3H6W A;  3VLV A;  1OLC A;  3PPP A;  1JEV A;  1SDX A;  2LAO A;  1NNP A;  1US4 A;  4EQB A;  2XXU A;  3TEL A;  4NF8 B;  1PEB A;  2PVU A;  3KFM A;  2Q88 A;  2OK2 A;  1EU8 A;  1Z7M E;  4R9F A;  4NF5 B;  3R7X A;  2ZNS A;  5I58 A;  3RPW A;  3ILU B;  3M3K A;  3SEU A;  2DP8 A;  1SW5 A;  1OLA A;  4G68 C;  3G3G A;  4GVO A;  4JB7 A;  3RNN A;  1IXG A;  3RYB A;  5CBS A;  3K1M A;  1D4N A;  3AXF A;  1ELJ A;  3GZG A;  4PQJ A;  3KN8 A;  2I0C A;  2X7Q A;  2FNC A;  1HSJ A;  3S9N C;  4UA8 A;  1N3W A;  3OO9 A;  3V5A A;  1N0T A;  5ITO A;  3K01 A;  1LCT A;  2ANJ A;  4DXB A;  3K6V A;  2VHA A;  1OQG A;  2THI A;  3E9X A;  3SEV A;  4GF8 A;  1M5E A;  2ABH A;  2DXR A;  1SD3 A;  4YIC A;  3TTR A;  1B5J A;  3HN0 A;  3U93 A;  3GBB A;  1R9Q A;  3WAF A;  1I6B A;  4BDM A;  1B2H A;  2DS9 A;  2DWJ A;  1B3H A;  2E1S A;  1SW2 A;  3P7I A;  1FQA A;  5CMK A;  4OET A;  3U92 A;  3HHF A;  2FYI A;  2Y7I A;  1MG1 A;  1B9J A;  2O51 A;  3FD3 A;  4QFP A;  4ND9 A;  1USY H;  2HEU A;  5I59 B;  4QRZ A;  1LFG A;  3U1O A;  1B5H A;  1UTH B;  3M3F A;  2QL3 A;  3PPQ A;  4U23 A;  1A7L A;  3SEX A;  4ELR A;  4ZZA A;  1A54 A;  4KFQ A;  1RYX A;  3HPI A;  4BDQ A;  3PGF A;  4YMB A;  4FJP A;  4ZEC A;  4ELQ A;  1SI0 A;  2I48 A;  4KD5 A;  1GR2 A;  4R73 A;  3IB1 A;  1MQJ A;  1TT1 A;  4C1T A;  1B4Z A;  3TEP A;  3RT8 A;  3KOS A;  3K1P A;  4RNS A;  5CC2 A;  3E4R A;  1URG A;  4H67 A;  1QUL A;  4G68 A;  1O64 A;  2G93 A;  3OSR A;  2P1S A;  4MLV A;  1D9V A;  1MQD A;  5H8Q A;  3A3U A;  1D9Y A;  3FJ7 A;  3N6T A;  3T22 A;  3OEM A;  1FCK A;  2D3I A;  4ZE8 A;  4H5G A;  3DP8 A;  4P0I A;  1JW5 A;  2B4M A;  3MJN A;  1PDA A;  2GH9 A;  1QUI A;  3OMB A;  3H3G A;  4FE8 A;  3IB2 A;  5I57 A;  4R6Y A;  1YPN A;  4UAC A;  4FIM A;  3PD8 A;  2A5T A;  4DZ1 A;  4F39 A;  5KCJ B;  3B6W A;  4N13 A;  4M4G A;  3UGW A;  2ONS A;  5H8N B;  2ZXT A;  3OO7 A;  4QFK A;  3SER A;  4EQ7 A;  2PBW A;  3DRF A;  3IAZ A;  1Z7N E;  4NF6 A;  2DWA A;  4DDD A;  2YLN A;  3D4C A;  1MPD A;  4U1O A;  2QS1 A;  2HZK A;  3TCF A;  2XXV A;  4XKR A;  4XXU A;  1AOV A;  1FQB A;  1Y3P A;  3B7D A;  5DEX A;  4ZEK A;  5FTH A;  3VVF A;  4OQO A;  5A5X B;  4OES A;  5TU0 A;  2REG A;  2UXA A;  2XXQ A;  1LBC A;  3I3V A;  4FED A;  1LB9 A;  3ONM A;  4E0W A;  1QJM A;  3FVK A;  2VGQ A;  5AA3 A;  3FZV A;  1MRP A;  1LBB A;  5JEI A;  4HCY A;  4TLM B;  3RGY A;  3VXC A;  5TPA B;  3RN8 A;  3RUM A;  2E0S A;  2A5S A;  2XXH A;  2B3F A;  4MLQ A;  3IL1 B;  3TUS A;  3O28 A;  1B7U A;  5J1D A;  2UVI A;  2WOP A;  4R2F A;  4QFO A;  3C33 A;  3TTN A;  4R6K A;  2Z8D A;  2I6E A;  4EF2 A;  5BWJ A;  3BKI B;  2H4I A;  3RT6 B;  2X26 A;  3FV1 A;  2PYY A;  3C9H A;  4XKN A;  4EXK A;  1DMB A;  3VFJ A;  4X1B A;  4RY1 A;  5M2V A;  1IXC A;  2DVC A;  4M1V A;  1O63 A;  1IXI A;  3CFL A;  3HV1 A;  2V84 A;  1P99 A;  3FGS A;  3U8Q A;  1MDQ A;  1B6H A;  4BDN A;  3OO6 A;  1IIT A;  1Y1M A;  3GXA A;  1HSL A;  1AMF A;  1TFA A;  4KCD A;  4NWC A;  1YCJ A;  2YJP A;  1QW0 A;  4YMA A;  1IZ1 A;  1FQE A;  1KWH A;  4IY5 A;  2QMX A;  2AL5 A;  1OIB A;  3V89 B;  3KOT A;  4LQ5 A;  3IJO B;  4F3P A;  3CSG A;  3SKP A;  2ZNT A;  2P2A A;  3CI8 A;  3S9L C;  3GBA A;  4BLA A;  4QSE A;  4DE8 A;  4DXU A;  3OEL A;  5K2Y A;  4I62 A;  2FA7 A;  4OYV A;  1NL5 A;  3MP6 A;  4KYD A;  4R2B A;  1DTG A;  4ZED A;  3C32 A;  4RK2 A;  3U94 A;  5F1Q A;  2X7P A;  3PAM A;  2I3W A;  3JZJ A;  4ISU A;  1JVX A;  2DWH A;  1AL3 A;  3KJT A;  1CE2 A;  3TYH A;  4DXC A;  4THI A;  2ALU A;  2XXI A;  4I8C A;  3BBR A;  5CMM A;  2NUV A;  2RC7 A;  1MY3 A;  4IGT A;  5DT6 A;  3Q25 A;  3VVE A;  4QFL A;  4OVJ A;  2OLB A;  4NF4 A;  2PT1 A;  2QS3 A;  3MZ9 A;  5KDT A;  1EZ9 A;  4BDR A;  1XC1 A;  5DTB A;  4PFW A;  2QPQ A;  4ONY A;  2XXT A;  4IO3 A;  1N7X A;  1B3L A;  4OER A;  3PMX A;  2UVH A;  4RXL A;  1JET A;  1A99 A;  1MY2 A;  1POT A;  4JBZ A;  2I4C A;  4LP2 B;  4FEC A;  1FTK A;  3IOU A;  1MXV A;  3KBR A;  4OFL A;  2B3B A;  4U2R A;  1ZU0 A;  4G8N A;  3FJM A;  4ECF A;  2IEE A;  1BP5 A;  2H98 A;  4WEP A;  1XOC A;  3QK6 A;  4Z7E A;  3KN3 A;  5FHN A;  4EQ9 A;  5ITP A;  2XXP A;  3O9P A;  4EXL A;  1NNK A;  4FAT A;  5L9M A;  2F5X A;  5ISU A;  1M5B A;  2HZL A;  2VD3 A;  3RTW B;  4F29 A;  4XIG Q;  4U4X A;  3O6H A;  4H6D A;  4OMB A;  3FXR A;  5F7V A;  4OXV A;  3PPN A;  1TWY A;  4IO4 A;  4NF8 A;  2NXO A;  3QAX A;  4QSD A;  4MBP A;  3MPK A;  3E13 X;  1B46 A;  1LGB C;  3FVN A;  1NFT A;  3MW0 A;  1N04 A;  5JTY B;  4ZZE A;  3SES A;  4GFR A;  5DYH A;  2VD2 A;  3T9X B;  2WOK A;  1B3G A;  4QHQ A;  5LOM A;  1SQY A;  1FQD A;  1FTL A;  2QRY A;  1MXX A;  4GD5 A;  5CI5 A;  5I2N B;  1MQH A;  4AQ4 A;  4X48 A;  1D3K A;  4ZE9 A;  2AIX A;  1MXY A;  1LAX A;  1MY0 A;  2R6G E;  3DRJ A;  4G8M A;  5I84 A;  4G4P A;  4JWX A;  3S9M C;  3O29 A;  2XXR A;  3LSF B;  3SET A;  2HFB A;  3DRI A;  3F11 A;  3TCH A;  3DEL B;  1LLS A;  3THI A;  1ANF A;  4P11 A;  1VFE A;  3OXN A;  3DRG A;  3S4U A;  1N3X A;  1FW0 A;  2F8D A;  1S7Y A;  4NTL A;  1OVB A;  3H4Z A;  3PUX E;  1MDP 1;  3G3K A;  4DCX A;  3UP9 A;  1RKM A;  3G3H A;  3B6Q A;  3FVO A;  4IB2 A;  3PUW E;  4YU0 A;  3MZ1 A;  4OEU A;  5L9O A;  3BFT A;  4YAH X;  2XX7 A;  4EUO A;  5I56 B;  1A8E A;  5K2X A;  5I59 A;  1LFI A;  4U1Z A;  3K4U A;  3H6U A;  3O66 A;  1UTH A;  2HAV A;  5ICQ A;  3LVU A;  4PFT A;  1LAG E;  1OVT A;  1VSO A;  4DIG A;  2V25 A;  4F1Y A;  3UN6 A;  4DLD A;  1H3D A;  2VP1 A;  3IK6 B;  4AB5 A;  3IOT A;  2F6P A;  3FIR A;  5H8H B;  1ZKB A;  4TLL B;  4PE5 B;  1QUK A;  3PUV E;  4JWY A;  3MVY A;  4OFJ A;  5AA1 A;  1H43 A;  4JSO A;  1Y1Z A;  3VXB A;  1VFD A;  5HBC A;  1POY 1;  3KSJ A;  4GIZ A;  5CBR A;  2AL4 A;  4R74 A;  3CHG A;  2H5Y A;  5EHS A;  1SBP A;  3IX1 A;  3IO6 A;  3K0V A;  1LFH A;  4GL0 A;  2H9B A;  3CG1 A;  2Z23 A;  2YPN A;  2Q2C A;  3USD A;  3I6V A;  3TPA A;  3RYA A;  1FQC A;  2OJT A;  2WKY A;  4F3S A;  4IY6 A;  4R72 A;  2XX8 A;  5CMB A;  3CSB A;  4RPO A;  1M5F A;  5B7D A;  2CMO A;  4Z0I A;  4C1U A;  1XS5 A;  3RQT A;  3SEW A;  3K2D A;  1FQF A;  1L5T A;  4H5F A;  4KHZ E;  2V3U A;  5KCJ A;  5AA4 B;  1MS7 A;  4ZEI A;  4IO2 A;  3O6G A;  2O1L A;  1LB8 A;  2I0B A;  1NNF A;  3KSX A;  3RTF B;  1F9B A;  3FAS A;  1IXH A;  3K00 A;  3I5O A;  3VLU A;  1MM6 A;  2F7C A;  4U4S A;  3O6P A;  1JVY A;  2GHA A;  4F22 A;  3R6U A;  2RIN A;  3EN3 A;  1OMP A;  2Z22 A;  4Q0C A;  3MUQ A;  5H8F B;  2F7B A;  3K1N A;  4N6P A;  3VDF A;  4QSC A;  5CMC A;  1Y20 A;  2R71 A;  5A5X A;  3C31 A;  5TP9 B;  4YKP A;  3RLF E;  3H06 B;  2QS2 A;  3S9E A;  1ZIU A;  5DVI A;  3UIF A;  2HCA A;  1Q1K A;  5I2K B;  1B0H A;  2O69 A;  3HCQ A;  4O3C A;  5AA2 D;  1IUD A;  2DWI A;  1XVX A;  4F19 A;  2F6G A;  4G8H A;  3EHU A;  1PBP A;  5TPA A;  1J1N A;  4OWD A;  2NWJ A;  4NMY A;  2DQV A;  3O97 A;  2GRV A;  1O7T A;  1VR5 A;  3FV2 A;  4FEB A;  3T9U A;  2Y84 A;  3B6T A;  1VE4 A;  3Q27 A;  2DVZ A;  2I4B A;  4U22 A;  1BTJ A;  3PUY E;  2RF1 A;  5EHM A;  3V83 A;  1B58 A;  4YB6 A;  1WDN A;  3MZB A;  3KN7 A;  2G29 A;  4KR5 A;  4ELO A;  2F35 A;  2V3T A;  4TOZ A;  3UK4 A;  3OOA A;  4DCY A;  2O84 X;  5HM4 B;  2F34 A;  4K3F A;  3T96 B;  4ZEF A;  2H99 A;  3E3K A;  1GGG A;  3EQ1 A;  4KYE A;  2O1M A;  3HST A;  3JYR A;  4Q5T A;  1PBQ A;  2ZYK A;  3LR1 A;  2H25 A;  1P1W A;  3QYT A;  5CRY A;  1YAE A;  5ELV A;  2O6A A;  3H03 A;  2UVG A;  2V3Q A;  2I58 A;  3TAJ A;  4F1U A;  4L17 A;  1CB6 A;  3FXU A;  1LAF E;  3IOW A;  3PUZ E;  1N84 A;  2DE3 A;  4XKP A;  2UVJ A;  3KZG A;  3SEY A;  5DVF A;  1DTZ A;  1NMU A;  4YKK A;  1R1N A;  2W7Y A;  1H45 A;  4HS7 A;  4F31 B;  1ZBM A;  3OEK A;  2CZL A;  1N7W A;  3RY3 A;  3TFL A;  4OZ9 A;  4POX A;  1PB9 A;  2DE4 A;  2F7A A;  3TZA A;  2ONR A;  4GXA A;  3TTM A;  1ATG A;  4GQO A;  4XKQ A;  4LA9 A;  3QIM A;  3T66 A;  4RA1 A;  1LAH E;  1A40 A;  1P1N A;  3MVX A;  4ZS9 A;  3M8U A;  5KDT B;  5L9S A;  4OHN A;  3MBP A;  1B7H A;  2DE2 A;  1UTB B;  2RC8 A;  4JDF A;  2O7U A;  4OFO A;  2XHD A;  2QS4 A;  3FJG A;  2F97 A;  4H8I A;  2ZYN A;  3D4G A;  4ESW A;  3QUF A;  1FTO A;  3DRH A;  2XD3 A;  2B65 A;  4R9G A;  2UYE A;  4GRK A;  5AA2 B;  2AYS A;  1IEJ A;  1A8F A;  4IGR A;  1DPE A;  3ZKL A;  1M5D A;  4F18 A;  4RK9 A;  3IO4 A;  3KJ7 A;  4GXS B;  3T9V A;  2DOJ A;  4R75 A;  2R9J A;  4YB7 A;  1PB7 A;  1SYI A;  2D21 A;  3LSL A;  2KLF A;  2DYX A;  1DOT A;  4POW A;  3L6G A;  3DLN A;  3BFU A;  1US5 A;  1N76 A;  3UA8 A;  5HPQ A;  4LAT A;  4FOR A;  3DP4 A;  1HSE A;  2O68 A;  4ZDM A;  4G2Z A;  4LZ5 A;  3M3L A;  1QKB A;  5I58 B;  3TDJ A;  3TMG A;  3IB0 A;  1GTK A;  4F2O A;  3O2A A;  4H0W A;  2XXY A;  3VE1 B;  3W9W A;  5CM6 A;  4NF5 A;  3TKD A;  3CR9 A;  3MC2 A;  5JK4 A;  4O3B A;  1MY4 A;  1SI1 A;  3Q28 A;  1BIY A;  3PMW A;  1MXW A;  5KZT A;  2RKM A;  4PET A;  2ZYO A;  3EF7 A;  2NOO A;  1H76 A;  3IJX B;  1YTV A;  3C34 A;  1JEU A;  3MQ9 A;  3ZSF A;  4KQP A;  1R9L A;  4NE4 A;  2I49 A;  3A09 A;  1SW1 A;  1URS A;  2OBG A;  4O3A A;  2ZNU A;  5JTY A;  4KPT A;  4F3G A;  1EH3 A;  1R6Z A;  5FHO A;  4N07 A;  4YZZ A;  2BJJ X;  1MXZ A;  2UYF A;  3LUY A;  3PV0 E;  5FHM A;  4GL8 A;  2Y7K A;  2QMW A;  5IKB A;  4PFU A;  4NED A;  5I2N A;  1B32 A;  4WED A;  3VV5 A;  5AE4 A;  3L6H A;  2M8C A;  3K02 A;  1B05 A;  3KGC A;  2HAU A;  3G7W A;  2PX1 A;  3EHT A;  1LST A;  1JW4 A;  4YKI A;  4QFN A;  3K6X A;  3IR1 A;  4RPN A;  1H44 A;  4LQ2 A;  4X9T A;  4YKJ A;  1AH5 A;  2Q8J A;  3FAT A;  1A55 A;  1RYO A;  2HXW A;  4IO5 A;  1I6A A;  3U72 A;  2IA4 A;  1MY1 A;  2OCU A;  4P0G A;  3LC8 A;  2Q89 A;  2Q2A A;  2RCB A;  1UIV A;  4Q8R A;  5I56 A;  4OEV A;  3MPL A;  1DSN A;  3OSQ A;  3T9H B;  3O6I A;  4G68 B;  2V93 A;  3FVG A;  3HHG A;  3G3J A;  3CVG A;  1QVS A;  5H8Q B;  1Y4C A;  2QSX A;  3PPO A;  3QUJ A;  5H8H A;  4RJZ A;  5EYF A;  3TOD A;  2RCA A;  1B0L A;  4RYA A;  3PPR A;  2REJ A;  3G3I A;  2O7I A;  3MAM A;  3QXM A;  2Z8E A;  4WKM A;  4G77 A;  5I57 B;  3OO8 A;  1JQF A;  1T0K A;  5L8D A;  3TCG A;  1Y4T A;  3JV9 A;  4I9D A;  3OEN A;  1JNF A;  1ZMG A;  3T93 B;  2A5T B;  3ODB A;  3LSX A;  3H6T A;  1SYH A;  1MM7 A;  3ZKK A;  5DVJ A;  4ESX A;  3ILT B;  3SDF A;  4MFI A;  4LZ7 A;  3A3C A;  2D5W A;  3DP6 A;  3Q26 A;  1QUJ A;  1MXU A;  3N94 A;  4NF6 B;  1MH3 A;  4C0R A;  4AB6 A;  1I69 A;  3H7M A;  1GVC A;  2B4L A;  2OZZ A;  3EHS A;  2RC9 A;  5H8N A;  1USY E;  4BDL A;  3FXQ A;  1FTM A;  3MP8 A;  4F1V A;  1WVJ A;  5DEX B;  4F2Q A;  3N5L A;  2Q9T A;  5AA4 A;  3GLB A;  3ZS6 A;  3G3F A;  1MQI A;  1P1Q A;  3QSL A;  4IO7 A;  2P0S A;  2ONK E;  3CG3 A;  1PB8 A;  5BUU A;  3Q29 A;  2Y7P A;  1QKA A;  3DRK A;  4KCC A;  4MF3 A;  3C36 A;  3N6U A;  4JWO A;  2ZMB A;  4HCW A;  3KG2 A;  2F36 A;  4H1X A;  1SVX B;  5H8F A;  4KYS A;  2XXX A;  1B3F A;  2XD2 A;  4I1D A;  4WXJ A;  1ZJL A;  4GLI A;  3LBS A;  4IO6 A;  5TP9 A;  2XX9 A;  1LCF A;  1NH8 A;  3CFX A;  5B70 A;  3N26 A;  5I2K A;  1B7Z A;  3EPE A;  3MVW A;  3FUZ A;  3TQW A;  1ZTY A;  2WOL A;  4Q30 B;  2GFE A;  5FTI A;  4LZ8 A;  3VVD A;  1B40 A;  3ECR A;  2NVU B;  4LVQ A;  4XTC Q;  1UQW A;  4PFY A;  1EZO A;  3C35 A;  1B4H A;  3DM0 A;  3VLW A;  4MH5 A;  1BKA A;  3PMV A;  1MPB A;  2F78 A;  4H65 A;  3CIJ A;  1NH7 A;  1B1X A;  2OWS A;  2ZYM A;  3OD7 A;  5IAI A;  3UOR A;  1XVY A;  4X1D A;  1DPP A;  1P1U A;  4QF9 A;  4JSD A;  3MVZ A;  2XXW A;  4GOT A;  1Q35 A;  3W15 C;  4KI0 E;  1IIW A;  1M5C A;  4NWD A;  4EDP A;  1TFD A;  4LUB A;  1BLF A;  1Y3N A;  3CFZ A;  3MP1 A;  4F3B A;  4FAJ A;  3W9V A;  3K6W A;  1NNT A;  1I6Q A;  2ESN A;  2DXY A;  4E0X A;  1JW1 A;  4HW8 A;  5H8S A;  1ZLQ A;  1MQG A;  3IOV A;  1P1O A;  4JXI A;  3FTO A;  4YB5 A;  3LSW A;  4R6H A;  2PT2 A;  1EZP A;  4LON B;  1URD A;  4BDO A;  2Y7R A;  3PU5 A;  1FTJ A;  4NF4 B;  1B51 A;  3C4M A;  1XT8 A;  4OTE A;  1S9T A;  3CRB A;  3R26 A;  3TTL A;  2VOZ A;  1B5I A;  3IOR A;  1S50 A;  3H6V A;  1IQ7 A;  1B52 A;  1GV8 A;  5ICT A;  1B3E A;  3V8X B;  1NKX A;  1UTB A;  4PP0 A;  4HTG A;  1SW4 A;  1UIU A;  1PC3 A;  4H8J A;  2OWT A;  3S2V A;  4ZEB A;  3TTK A;  4U21 A;  1TXF A;  2QJE A;  2HQ0 A;  1AIV A;  2I3V A;  4GWO A;  3WAE A;  3MWB A;  1XHY A;  1WOD A;  1MPC A;  4OEN A;  1B1H A;  4ELP A;  2Y7W A;  4TQU Q;  2Z8F A;  4EF1 A;  3TQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...