1QKAA

Oligo-peptide binding protein (oppa) complexed with krk
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
517
structure length
517
Chain Sequence
b'ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Crystallographic and Calorimetric Analysis of Peptide Binding to Oppa Protein
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Protein transport
total genus 189
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1qkaA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qkaA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1qkaA02
1B6HA 4QFLA 1H76A 3K00A 3PD8A 5HBCA 1AOVA 3DRFA 2X7PA 2HAUA 4DLDA 1A8EA 2PX1A 3V89B 1BKAA 3M3FA 4F22A 4N13A 3T93B 4Z0IA 2R9JA 3D4CA 3PUYE 1B3LA 3BFTA 4GIZA 4PFWA 3RTWB 4P0IA 4FEBA 4HCYA 3PPNA 4BDMA 2XXTA 3EPEA 4X9TA 3V8XB 3TCGA 3IL1B 3MUQA 2HAVA 2Q2CA 1P1NA 1B46A 3SEYA 2G29A 2IEEA 5FTHA 1LAGE 4OHNA 3IOTA 3OO7A 1M5FA 1GR2A 4Z7EA 1LFHA 3IOUA 1MPCA 1M5BA 4YAHX 2XX8A 5F1QA 1MXXA 4H65A 4U4SA 3TYHA 5KZTA 3U8QA 2BJJX 1QUIA 4IY6A 1EU8A 4GD5A 1FCKA 3TEPA 1ANFA 1B0LA 2XXRA 3SERA 1Q1KA 2QS3A 3CSBA 2F6PA 1M5DA 3R26A 4NF5B 1DPEA 4QSEA 2RCBA 4O3CA 5EHMA 1EZPA 1XT8A 4GVOA 3FATA 3DP4A 1XHYA 2DXYA 1MH4A 4MF3A 1GVCA 2VD2A 1A40A 1FQEA 1NNTA 2RC9A 3K1PA 4ND9A 3N94A 4HS7A 2THIA 1FQDA 1FTJA 4TLLB 3DM0A 4R9GA 1MY0A 1ZBMA 4MH5A 4MFIA 5AE4A 4UACA 1IUDA 3FZVA 3ODBA 4NF6B 3LR1A 4KR5A 3HO7A 3MPKA 2YPNA 5DT6A 4I1DA 2DYXA 5TP9B 1OQHA 2Q9TA 4C1TA 2RC7A 1H43A 5KCJB 5DTBA 4KD5A 2DE2A 3DP6A 1LGBC 3VFJA 2UVGA 3SESA 2OLBA 3VVFA 5A5XB 2OJTA 5H8NB 4OWDA 2XD3A 3TQLA 5CMCA 1Y9UA 1B1HA 1FW0A 4OMBA 2V3UA 2Y7IA 4RJZA 3T66A 1MM6A 2DSFA 3CFXA 3CHGA 4F29A 4QSDA 3FUZA 2E0SA 2I0BA 3SEXA 3TZAA 1MY4A 3OENA 3O29A 2OZZA 1ZIUA 2OBGA 4DZ1A 3K1NA 3M8UA 3U93A 1FTOA 3OOAA 4EF1A 3B6TA 2Y7WA 1MDQA 4KPTA 3DRHA 1RKMA 4OTEA 2VOZA 4R2FA 2ANJA 1O63A 5I59B 2AL4A 2Y7PA 1YTVA 3QUJA 1P1WA 3C4MA 3FVKA 4FAJA 2UXAA 4XTCQ 1Y4TA 2LAOA 3CVGA 1I6BA 3PUZE 3HN0A 1H3DA 3O6PA 3IX1A 3MVXA 2PMSA 3PUWE 2B3BA 1D3KA 1A8FA 4TLMB 1YPNA 2H98A 4HW8A 3QAXA 5DEXB 5ITPA 2QSXA 1N84A 5CMBA 3LSFB 5BWJA 4POWA 4PETA 1B9JA 3Q27A 4NF8B 3U1OA 4QFNA 1ZMGA 4X1DA 2FA7A 3MWBA 1FQAA 2ONKE 2NOOA 2DP8A 3T96B 3LSXA 4JWXA 1ZLQA 5FHOA 4DIGA 2ALUA 2V93A 1BLFA 2O1LA 4NF4B 3KFMA 1NNKA 3FVGA 3M3KA 5ITOA 3MQ9A 4AQ4A 3C34A 1FTMA 1FTLA 1RYXA 4NF6A 3MZ1A 4G8MA 3WAEA 4QFPA 4PFUA 5TP9A 4ELPA 4OEUA 5BUUA 3IOVA 5KCJA 1XOCA 2ZYNA 3HCQA 3MP1A 3KJ7A 4JSOA 4MLQA 1II5A 5H8NA 3KN3A 5L8DA 3VVDA 4Q30B 4FATA 4GLIA 3QUFA 3L6HA 4R72A 1OQGA 1ZKBA 2IA4A 1N7WA 2PT1A 4LZ8A 1IXHA 1D4NA 1Y1MA 3EHUA 2F36A 5TU0A 2ZXTA 3GBAA 4YKIA 4JSDA 4XKRA 1MRPA 3UK4A 4JBZA 4KI0E 3UA8A 3DRIA 1BTJA 3CFZA 1OVBA 3LSWA 5I59A 1POTA 2H99A 1MXWA 3UIFA 4DXBA 1MY2A 1I6AA 1R9LA 4PFYA 4U23A 1MQGA 4R75A 4DDDA 1HSLA 2DE3A 3A3CA 3TAJA 3TKDA 4YKPA 4DCYA 1SW2A 1NH8A 3K6XA 4NE4A 1A55A 2F6GA 2HFBA 2Z8FA 4GXSB 4EDPA 1PBPA 1UTBA 5KDTA 1NKXA 3CRBA 3VE1B 2P1SA 3QYTA 5DEXA 3A3UA 3L6GA 1SYHA 1VFDA 1B7HA 2F5XA 3G7WA 4LZ5A 5I2NB 1WDNA 1URGA 2O7UA 2WOKA 2Y84A 3FASA 1T0KA 3TUSA 3T22A 4H0WA 2XX7A 3O6GA 3OSQA 2ZNUA 3H4ZA 1M5CA 4NF4A 4R6HA 2GFEA 1PB7A 4NWCA 2D5WA 2ZNTA 3V5AA 4LATA 4WEPA 2XXUA 2PBWA 2HXWA 2Z23A 3QIMA 4GWOA 2CZLA 2QS2A 2PVUA 2P0SA 3PPRA 2RINA 2Z8DA 4R2BA 3O66A 2I3WA 3PUVE 4WXJA 3AXFA 1F9BA 1ZTYA 3G3FA 2B4LA 1JVYA 4E0WA 2I4CA 2XXXA 2VGQA 4F3BA 4UA8A 1EH3A 2H4IA 3H6WA 3K2DA 1FTKA 1HSEA 2PT2A 2XXWA 2DS9A 1EZOA 4R6YA 2VHAA 3ZKKA 4XIGQ 5JEIA 1LAXA 3PD9A 3USDA 3UORA 3RLFE 3I3VA 2WOLA 4OESA 4THIA 3T9UA 2WKYA 3C31A 3FJMA 4BDRA 4P0GA 4RNSA 3FXQA 3BBRA 3D4GA 2H9BA 3A09A 3TQWA 3O6HA 2XXYA 3IK6B 5F7VA 4AB6A 4YKKA 3DRJA 4ZEKA 2O1MA 1B52A 1IIWA 3JV9A 4EXLA 2UYFA 3FIRA 1SW1A 1RYOA 2F8DA 4F31B 5AA4A 3F11A 2DWJA 4ZECA 3HPIA 3MW0A 4H8IA 3VLUA 1LB9A 4H5GA 1Y3NA 2ESNA 1USYH 5I2NA 1I69A 3OEMA 4AB5A 1LCFA 4F18A 1MS7A 1N0TA 1B3HA 3TMGA 1B58A 3N26A 2DQVA 3FV1A 3RY3A 3MZBA 2QS4A 4QF9A 4IB2A 4YB6A 3C33A 5LOMA 4ELQA 1Y4CA 3S9NC 3ONMA 4U2RA 3PAMA 5ICQA 1OLCA 4EQBA 3JZJA 3OXNA 2HEUA 1GTKA 3G3HA 4PQJA 3VXCA 3EHTA 4O3BA 2CMOA 4YB7A 3MVYA 4I9DA 1IITA 3BFUA 4IO4A 4KYSA 4GFRA 1SBPA 3G3KA 4G77A 1MPBA 4NEDA 3O9PA 1N04A 4YU0A 3MVWA 1A54A 1LFIA 3IJOB 4QSCA 4I8CA 1TT1A 3KSXA 4OZ9A 2DWAA 1Y3QA 1NH7A 3K01A 5I84A 2H5YA 3KN7A 4ZE9A 3V83A 3CSGA 4KHZE 3RPWA 4IO6A 4F2OA 2I0CA 1JETA 3PUXE 5K2XA 2REGA 3SETA 5H8HB 4RPOA 3ZS6A 2NUVA 4YICA 3MAMA 4JWOA 3OO6A 4F2QA 5HM4B 1LB8A 3IB0A 4ZE8A 1VSOA 3MZ9A 3H7MA 3GBBA 5I58B 3TTRA 3N6UA 2O69A 1L5TA 1GGGA 1B5IA 1DTGA 4L17A 1IXGA 1LBCA 1LAHE 3RQTA 2AYSA 4OXVA 2DWHA 2O7IA 4OENA 4XKNA 1UTBB 5KDTB 3O28A 5HPQA 1QUKA 1CE2A 1PEBA 3K6VA 4H1XA 4F1UA 3PMXA 5CRYA 3CFLA 3W9VA 4TQUQ 3KOTA 4IGTA 3S2VA 3PPQA 4ZEBA 1DTZA 3LVUA 3E3KA 3TCFA 4GF8A 1WODA 5J1DA 2ZYKA 3H6VA 2I4BA 2DVCA 4U4XA 4LA9A 4LVQA 4PP0A 3SKPA 4C1UA 1B32A 4U1OA 3OELA 1R6ZA 3T9HB 4HCWA 3PPOA 3FJ7A 2XD2A 1M5EA 4OETA 2FYIA 4BDOA 4X1BA 1VR5A 2F7CA 4RK2A 3C35A 3HHGA 3RGYA 1VFEA 1PBQA 5H8SA 1MQJA 3I6VA 4F1YA 4O3AA 2F34A 4IO2A 4YKJA 3FXUA 3B6WA 3H6UA 4ZZAA 3LC8A 1ZU0A 4ZEDA 1A99A 1SI1A 2V3QA 1XC1A 3W9WA 1Y20A 2Y7RA 2D3IA 3RNNA 5AA3A 1MPDA 3CI8A 3O97A 2F97A 4K3FA 4LP2B 4U1ZA 1B40A 1SDXA 3O2AA 4YMBA 3DRKA 4F1VA 3TTLA 2DOJA 5H8HA 2AL5A 1IEJA 1PDAA 3K6UA 4EUOA 2HZLA 3E4RA 1I6QA 1UTHB 5I2KA 4QFOA 3H06B 5B70A 1AH5A 1H45A 3OMBA 3S9EA 3MC2A 1DPPA 2B65A 5FHMA 2RC8A 3Q26A 2ZYMA 1MQHA 5I58A 4IGRA 2REJA 2B4MA 4H8JA 3LSLA 2GH9A 1VE4A 4GOTA 1MQIA 1IQ7A 3R7XA 4OERA 4PFTA 4BDLA 3DP8A 2OK2A 4KCDA 1B3GA 5M2VA 2NXOA 3DRGA 1Y1ZA 2QRYA 4Q8RA 4FORA 3MJNA 1SW4A 2M8CA 1JQFA 3U94A 4ELOA 4MBPA 2Q88A 2ONRA 3N5LA 4GQOA 3TTKA 5AA4B 4ONYA 1AMFA 1QW0A 1US5A 2AIXA 1MXUA 3Q28A 4R74A 1Y3PA 1O7TA 3FGSA 4OYVA 5JTYA 3OSRA 1R1NA 3RT6B 2R6GE 5FTIA 1R9QA 4F3PA 4ISUA 2NVUB 2XHDA 1QKBA 1H44A 3VLWA 4R9FA 3PMWA 5ELVA 5IAIA 3FJGA 4G2ZA 4ZZEA 2I48A 3U72A 3VDFA 3RT8A 2Z8EA 4M1VA 4ZEFA 5AA2B 1DOTA 2HZKA 5H8QB 3TTMA 1N3WA 2DWIA 1US4A 3IJXB 4H6DA 3RYBA 2ONSA 2XXQA 4DCXA 2XXVA 4BLAA 3THIA 1Q35A 3EF7A 2O84X 4XKPA 3HSTA 4QRZA 4OFLA 1D9VA 3PMVA 2B3FA 5CM6A 1J1NA 4FE8A 2YLNA 1UIVA 4NMYA 4YZZA 3S4UA 4LUBA 3K0VA 3I5OA 2WOPA 1B4ZA 2OCUA 4DE8A 3IO4A 4JDFA 1N76A 1SQYA 3KGCA 2Z22A 2O6AA 1UTHA 2R71A 3QK6A 5DVFA 3OEKA 1B51A 3UP9A 3ILTB 2I3VA 1B5HA 3TELA 3E13X 3H6TA 3TFLA 3GLBA 3K6WA 3C32A 1FQFA 3SDFA 3FD3A 1B7UA 3FVOA 3PU5A 5DVIA 5EHSA 4M4GA 2G93A 4H5FA 1FQCA 1OMPA 3U92A 1PC3A 1P1QA 4RK9A 4C0RA 5I56B 3QXMA 2GRVA 3B6QA 5IKBA 1MM7A 4IY5A 3GXAA 2GHBA 3IAZA 3MP8A 2I49A 4H67A 1B4HA 3KSJA 3VV5A 4KYDA 5DYHA 2FNCA 2A5TB 4KFQA 4FIMA 5ISUA 4OFOA 1B3EA 1YAEA 3Q25A 1YCJA 3TPAA 4Q0CA 1TWYA 3KG2A 1NL5A 4R6KA 3SEWA 4JB7A 2DXRA 1XVXA 3Q29A 4RYAA 4G8NA 4NWDA 4IO5A 3DELB 3CR9A 1XS5A 4GRKA 3TTNA 1Z7ME 3CG1A 1MXZA 5TPAB 2Q8JA 2ZNSA 3JYRA 3FVNA 4OFJA 1MH3A 2XX9A 5AA2A 5CMKA 4XKQA 5H8QA 5B7DA 4XXUA 1NNFA 1P1UA 3EHSA 3DLNA 4LZ7A 1IZ1A 2F7BA 1AIVA 3IB1A 1URDA 4R73A 3T9XB 1B5JA 3OO9A 5CI5A 3PV0E 3KBRA 5I57B 4E0XA 4LQ5A 1IXCA 4Q5TA 1A7LA 5CMMA 2QL3A 3S9MC 1PB9A 3RTFB 1URSA 4WKMA 4RXLA 2QS1A 3KN8A 1P1OA 1S7YA 5H8FB 3ZKLA 5CC2A 5I2KB 2RKMA 1MXVA 1JW1A 3VVEA 1B3FA 1ATGA 4FECA 3B7DA 2H25A 2XXIA 3H03A 2XXHA 4EF2A 4GL0A 1BIYA 2X7QA 3KOSA 1MDP1 2QJEA 1SW5A 1EZ9A 1Z7NE 3EN3A 4IO7A 1LCTA 3ECRA 3R6UA 1N3XA 3E9XA 3LBSA 1AL3A 5I56A 1B7ZA 1XVYA 5JK4A 1OIBA 2I58A 1JEUA 3W15C 2V25A 1QJMA 4YB5A 2OWSA 4G68B 1QUJA 4TOZA 2A5TA 3C9HA 1DMBA 3VLVA 3MP6A 4N07A 2RF1A 5L9OA 3MVZA 3IORA 4U22A 3KZGA 3HV1A 1SD3A 2RCAA 5JTYB 4F19A 4EXKA 2UVIA 2NWJA 3VXBA 3GZGA 5TPAA 4F39A 2ABHA 1HSJA 4P11A 4NF5A 3C36A 1P99A 2P2AA 1JNFA 4RA1A 1S50A 3OO8A 1MG1A 3N6TA 1KWHA 4G4PA 3PGFA 4ZS9A 3KEIA 3K02A 1TFAA 1D9YA 1USYE 1NNPA 5AA2D 1O64A 5K2YA 4MLVA 3PPPA 1TXFA 2YJPA 2VD3A 2DE4A 3FV2A 4KYEA 3LUYA 1S9TA 5EYFA 5I57A 1OLAA 5CBRA 1MXYA 4PE5B 2I6EA 1TFDA 4WEDA 1MY3A 3BKIB 3TDJA 4HTGA 5FHNA 4BDQA 1N7XA 1ZJLA 3T9VA 1MQDA 4POXA 2OWTA 2E1SA 3P7IA 4LONB 4EQ7A 3HHFA 5A5XA 4DXCA 2A5SA 4OVJA 5L9SA 3ILUB 1LSTA 4ELRA 4FEDA 3FTOA 1ELJA 5H8FA 2XXPA 1UIUA 4GXAA 1B05A 4KCCA 2UYEA 2O68A 2Q2AA 1POY1 3FXRA 4DXUA 2GHAA 1IXIA 4OQOA 3G3IA 1LBBA 1JW5A 4ZEIA 1SVXB 5CBSA 4I62A 3O6IA 3RUMA 1B0HA 4BDNA 1FQBA 2QPQA 1JVXA 1QULA 1SYIA 4ZDMA 3ZSFA 4ESWA 4JWYA 3OD7A 5DVJA 1QKAA 4QHQA 3H3GA 4U21A 4ECFA 2ZMBA 4G8HA 2V3TA 1OVTA 4OEVA 4G68A 4G68C 4ESXA 4X48A 4KQPA 2UVJA 1QVSA 3M3LA 1JW4A 1GV8A 2O51A 3K1MA 3KJTA 2W7YA 2V84A 1WVJA 3MPLA 2KLFA 2D21A 4GL8A 1MY1A 1LAFE 2Q89A 1LLSA 2UVHA 3TCHA 4YMAA 3QSLA 3EQ1A 4LQ2A 2HCAA 4N6PA 2DVZA 3UN6A 4RY1A 1SI0A 3SEUA 4NF8A 3UGWA 4F3SA 2HQ0A 3G3JA 2QMXA 2VP1A 1CB6A 1NFTA 3K4UA 2PYYA 2F7AA 1LFGA 5L9MA 1DSNA 1JEVA 4EQ9A 1UQWA 3WAFA 3SEVA 4NTLA 1PB8A 3CIJA 3IO6A 3RYAA 3IR1A 4RPNA 3RN8A 1B1XA 5AA1A 3IB2A 2QMWA 4F3GA 2F78A 3IOWA 4FJPA 1BP5A 2F35A 4IO3A 3S9LC 4QFKA 2X26A 2ZYOA 3G3GA 2Y7KA 4JXIA 3TODA 5ICTA 1B2HA 3CG3A 3MBPA 1NMUA
chains in the Genus database with same CATH superfamily
1B6HA 4QFLA 1H76A 3K00A 3PD8A 2JJKA 5HBCA 1AOVA 3DRFA 2X7PA 2HAUA 4DLDA 1A8EA 2PX1A 2FIXA 3V89B 1BKAA 3M3FA 4NX1A 4GWYA 4F22A 4N13A 3T93B 4Z0IA 2R9JA 3D4CA 3PUYE 1B3LA 3BFTA 4GIZA 1XI6A 2XWVA 2ZZWA 4PFWA 3RTWB 4P0IA 4FEBA 4HCYA 3PPNA 4BDMA 2XXTA 3EPEA 4X9TA 3V8XB 3TCGA 3IL1B 3MUQA 2HAVA 2Q2CA 1P1NA 1B46A 3SEYA 2G29A 2IEEA 5FTHA 1LAGE 4OHNA 3IOTA 3OO7A 4NN3A 1M5FA 1GR2A 4Z7EA 1LFHA 3IOUA 3SZPA 1MPCA 1M5BA 4YAHX 2XX8A 5F1QA 4N6DA 1MXXA 4H65A 4N17A 4U4SA 3TYHA 5KZTA 3U8QA 2BJJX 1QUIA 4PDHA 3KC0A 4IY6A 1EU8A 2KR0A 4GD5A 1NV0A 1FCKA 4PBQA 3TEPA 1ANFA 4PAKA 5EYHA 1B0LA 2XXRA 3SERA 1Q1KA 2QS3A 3CSBA 2F6PA 1M5DA 1NV6A 3R26A 4NF5B 1DPEA 4PFIA 2WBDA 4QSEA 2RCBA 4O3CA 5EHMA 1EZPA 1XT8A 4GVOA 4IR8A 4NG7A 3FATA 3DP4A 1D9QA 1XHYA 2DXYA 1FBEA 2FHYA 4PCDA 1MH4A 2GQ1A 4MF3A 1GVCA 2VD2A 3B50A 1A40A 1FQEA 1NNTA 2WYPA 2RC9A 3K1PA 4ND9A 3N94A 4HS7A 2THIA 1FQDA 1FTJA 4TLLB 3DM0A 4R9GA 1MY0A 1ZBMA 3BIHA 4MH5A 4MFIA 5AE4A 4UACA 4MX6A 1IUDA 3FZVA 3ODBA 4NF6B 3LR1A 4KR5A 3HO7A 5I5PA 3MPKA 2YPNA 2BJIA 5DT6A 4I1DA 2DYXA 5TP9B 1OQHA 2Q9TA 4OANA 4C1TA 2RC7A 4JVDA 1H43A 5KCJB 5DTBA 4KD5A 2DE2A 3DP6A 1LGBC 2L5VA 3VFJA 2UVGA 3SESA 2OLBA 3VVFA 5A5XB 2OJTA 5H8NB 4OWDA 2XD3A 3TQLA 5CMCA 1Y9UA 1B1HA 1FW0A 4OMBA 2V3UA 2Y7IA 4RJZA 1MM6A 3T66A 2DSFA 3CFXA 3CHGA 4F29A 1FBDA 3EKIA 1G0HA 4QSDA 3FUZA 2E0SA 4H46A 2I0BA 3SEXA 3TZAA 3KC1A 1MY4A 3OENA 3O29A 2OZZA 4NAPA 2OWZA 1ZIUA 2OBGA 4DZ1A 3K1NA 3M8UA 3U93A 1FTOA 2FVZA 3OOAA 4EF1A 1FPJA 3B6TA 2Y7WA 1MDQA 4KPTA 3DRHA 1RKMA 4OTEA 2VOZA 4R2FA 2ANJA 1O63A 5I59B 4I3YA 2AL4A 2Y7PA 1YTVA 1Q9DA 1AWBA 3QUJA 1P1WA 3C4MA 4MHFA 3FVKA 4FAJA 4P47A 2UXAA 2OX3A 4XTCQ 1Y4TA 2LAOA 3CVGA 1I6BA 3PUZE 3HN0A 1H3DA 3O6PA 1KA0A 3IX1A 3MVXA 2PMSA 3PUWE 1LBVA 4PTKA 2B3BA 1D3KA 1A8FA 4TLMB 1YPNA 2H98A 4HW8A 3QAXA 4MAGA 5DEXB 5ITPA 3B8BA 2QSXA 1N84A 5CMBA 3LSFB 5BWJA 3E79A 4POWA 4PETA 1B9JA 3Q27A 4NF8B 3U1OA 4QFNA 1ZMGA 4X1DA 2FA7A 3MWBA 1FQAA 2ONKE 2XWKA 2NOOA 2DP8A 3T96B 3LSXA 4JWXA 1ZLQA 5FHOA 4DIGA 2P3NA 2ALUA 2V93A 5IM2A 1YYZA 1BLFA 2O1LA 4NF4B 3KFMA 1NNKA 3FVGA 3M3KA 5ITOA 3MQ9A 4AQ4A 3C34A 5F24A 1FTMA 1FTLA 1RYXA 4NF6A 3MZ1A 4G8MA 3WAEA 2DDKA 4OA4A 4QFPA 3LUZA 4PFUA 5TP9A 4ELPA 4OEUA 5BUUA 3IOVA 5KCJA 4P8BA 4PAIA 1XOCA 2ZYNA 3HCQA 3MP1A 1FJ6A 3KJ7A 4JSOA 4MLQA 4HE2A 1II5A 1LEVA 5H8NA 3KN3A 4PGPA 5L8DA 3VVDA 4Q30B 4FATA 4GLIA 1KZ8A 3QUFA 3L6HA 4R72A 3LV0A 1OQGA 1ZKBA 2IA4A 1N7WA 2PT1A 4LZ8A 1IXHA 4GX6A 1D4NA 1Y1MA 3E78A 3EHUA 2F36A 5TU0A 2ZXTA 3GBAA 4YKIA 4JSDA 4XKRA 1MRPA 2XWIA 4PGNA 3UK4A 4JBZA 4KI0E 3UA8A 3DRIA 1BTJA 3CFZA 1OVBA 3LSWA 5I59A 1POTA 2H99A 1MXWA 3UIFA 4DXBA 1MY2A 1I6AA 1R9LA 4PFYA 4U23A 1MQGA 4R75A 3T1BA 4DDDA 1HSLA 2DE3A 3A3CA 3TAJA 3TKDA 4YKPA 4DCYA 1SW2A 1NH8A 3K6XA 4NE4A 2HHMA 1A55A 2F6GA 2HFBA 2Z8FA 4GXSB 4N8GA 4EDPA 1DCUA 1NV3A 1PBPA 1UTBA 5KDTA 1NKXA 3CRBA 3VE1B 2P1SA 3QYTA 5DEXA 2KQZA 4UABA 3A3UA 3L6GA 1DK4A 1SYHA 1VFDA 1B7HA 2F5XA 4PDDA 3G7WA 4LZ5A 5I2NB 1WDNA 1URGA 2R8TA 2O7UA 5IGAA 2WOKA 2Y84A 3FASA 1T0KA 3TUSA 1RDZA 1NUXA 3T22A 4H0WA 2XX7A 3O6GA 4G61A 3OSQA 2ZNUA 3H4ZA 1M5CA 1LBZA 4NF4A 4DI3D 4R6HA 2GFEA 1PB7A 4NWCA 2D5WA 2ZNTA 3V5AA 4LATA 2PCRA 4WEPA 2XXUA 2PBWA 2HXWA 1IMFA 2Z23A 3QIMA 4GWOA 2CZLA 2QS2A 1YXIA 4MNPA 2PVUA 2P0SA 3PPRA 2MKZA 2RINA 2Z8DA 4R2BA 3O66A 2I3WA 3PUVE 4WXJA 3AXFA 1F9BA 1ZTYA 4JVCA 3G3FA 2B4LA 4MIJA 1JVYA 4E0WA 2PFZA 2I4CA 2XXXA 2VGQA 4F3BA 4UA8A 1EH3A 2VPOA 2H4IA 3H6WA 3K2DA 3D1RA 1FTKA 5IZZA 1HSEA 2PT2A 2XXWA 2DS9A 1EZOA 4R6YA 2VHAA 1JP4A 3ZKKA 4XIGQ 5JEIA 1LAXA 3PD9A 4N4UA 4NF0A 3USDA 3UORA 3RLFE 4HE1A 3I3VA 2WOLA 4OESA 4THIA 3T9UA 2WKYA 3C31A 3FJMA 1FRPA 4BDRA 4P0GA 4RNSA 3FXQA 3BBRA 3D4GA 2H9BA 3HFUA 3A09A 4NHBA 3TQWA 3O6HA 2XXYA 3IK6B 4O94A 5F7VA 4AB6A 4YKKA 3DRJA 4ZEKA 2O1MA 2QVUA 1B52A 1IIWA 3JV9A 4EXLA 2UYFA 3FIRA 4N6KA 1SW1A 1RYOA 2F8DA 4F31B 5AA4A 3F11A 2DWJA 4ZECA 3HPIA 3MW0A 4H8IA 1SPIA 3VLUA 1LB9A 4H5GA 1IMBA 1FPEA 1Y3NA 2ESNA 2XXKA 1USYH 5I2NA 1I69A 3OEMA 4AB5A 1LCFA 4F18A 1FPIA 2CZHA 1MS7A 1N0TA 1B3HA 1G0IA 3TMGA 1B58A 3N26A 2DQVA 3FV1A 3RY3A 1FPKA 3MZBA 2QS4A 4QF9A 4IB2A 4YB6A 3C33A 5LOMA 4ELQA 1Y4CA 3S9NC 3ONMA 4U2RA 3PAMA 5ICQA 1OLCA 4EQBA 3JZJA 3OXNA 2HEUA 1GTKA 2Y5KA 3G3HA 4PQJA 3VXCA 3EHTA 4O3BA 2CMOA 4YB7A 3MVYA 4I9DA 1IITA 4I3EA 3BFUA 4PF8A 4IO4A 4KYSA 4GFRA 1SBPA 3G3KA 4G77A 1MPBA 4NEDA 3O9PA 4FBPA 1N04A 4YU0A 3MVWA 1A54A 1LFIA 3IJOB 4QSCA 4I8CA 1TT1A 3KSXA 4OZ9A 2DWAA 1Y3QA 1NH7A 3K01A 5I84A 2H5YA 3KN7A 3PTYA 4ZE9A 3V83A 3CSGA 2PFYA 4KHZE 2CEXA 3RPWA 5ET8A 4IO6A 4MJOA 4F2OA 2I0CA 1JETA 3PUXE 5K2XA 2REGA 2XA5A 3SETA 5H8HB 4RPOA 3ZS6A 4OVPA 2NUVA 4YICA 2F3BA 3MAMA 4JWOA 3OO6A 5DW8A 5IZ1A 4F2QA 2ZZXA 5HM4B 1LB8A 3IB0A 4JVIA 3MSTA 4ZE8A 1VSOA 3MZ9A 4N81A 3H7MA 4GBVA 3GBBA 4MCOA 1LBWA 5I58B 3TTRA 5LTCA 4XFEA 3N6UA 2O69A 1L5TA 1GGGA 1B5IA 1DTGA 4L17A 1IXGA 1LBCA 1LAHE 3RQTA 2AYSA 4OXVA 2DWHA 2O7IA 4OENA 4XKNA 1UTBB 5KDTB 3O28A 5HPQA 1NV4A 1QUKA 1CE2A 1PEBA 3K6VA 1QGXA 1FPLA 4H1XA 4F1UA 3PMXA 5CRYA 1FPFA 3CFLA 3W9VA 2WBBA 2QVVA 4TQUQ 3KOTA 4IGTA 3S2VA 3PPQA 4ZEBA 1DTZA 2CZIA 3LVUA 3E3KA 3TCFA 4GF8A 2FIEA 5I7IA 1WODA 5J1DA 2ZYKA 5FBPA 1NV7A 3H6VA 1FSAA 2I4BA 2DVCA 4U4XA 4LA9A 4LVQA 4PP0A 3SKPA 4C1UA 1B32A 4U1OA 3OELA 1R6ZA 1INPA 4HCWA 3T9HB 3PPOA 3FJ7A 4H45A 3RPLB 2XD2A 1M5EA 4OETA 2FYIA 1LBXA 4BDOA 4X1BA 1VR5A 2F7CA 4RK2A 3C35A 3HHGA 3RGYA 1VFEA 1PBQA 5H8SA 1MQJA 3I6VA 4F1YA 4O3AA 2F34A 3GYYA 4IO2A 4YKJA 3FXUA 3B6WA 3H6UA 4X04A 4ZZAA 3LC8A 1ZU0A 4ZEDA 1A99A 1SI1A 2V3QA 1XC1A 3W9WA 1Y20A 2Y7RA 2D3IA 3RNNA 4P9KA 5AA3A 4N8YA 1MPDA 3KBZA 3CI8A 3O97A 2F97A 4K3FA 4LP2B 4U1ZA 1B40A 1FPBA 1SDXA 1NV5A 3O2AA 4YMBA 3DRKA 4F1VA 5T3JA 3TTLA 4MMPA 2DOJA 5H8HA 2AL5A 2CEYA 1IEJA 4MEVA 1PDAA 3K6UA 4EUOA 2HZLA 1EYJA 3E4RA 1I6QA 1UTHB 5ET7A 5I2KA 4QFOA 3H06B 5B70A 1AH5A 1H45A 3OMBA 3S9EA 3MC2A 1DPPA 2B65A 1FBCA 5FHMA 2RC8A 3Q26A 2ZYMA 1MQHA 5I58A 4IGRA 2REJA 2B4MA 4H8JA 3LSLA 2GH9A 4X8RA 1VE4A 4GOTA 1MQIA 1IQ7A 1FBGA 3R7XA 4OERA 4PFTA 4BDLA 3DP8A 4O7MA 2OK2A 4HE0A 4KCDA 1B3GA 5M2VA 2NXOA 3DRGA 1Y1ZA 2QRYA 4Q8RA 4FORA 3MJNA 3NOHA 1SW4A 3BIGA 2M8CA 4O8MA 1JQFA 3U94A 4ELOA 4MBPA 2Q88A 2ONRA 3N5LA 4GQOA 3TTKA 3T0JA 5AA4B 4ONYA 1AMFA 1QW0A 1EYKA 1US5A 2AIXA 1MXUA 3Q28A 4R74A 4O7IA 1Y3PA 1O7TA 3FGSA 4GWXA 4OYVA 5ET5A 5JTYA 3OSRA 3A29A 1R1NA 3RT6B 2R6GE 5FTIA 1R9QA 4F3PA 4ISUA 1FPGA 2NVUB 2XHDA 1NV2A 1QKBA 1H44A 3VLWA 4R9FA 1FBFA 3PMWA 5ELVA 5IAIA 3FJGA 4PC9A 4G2ZA 4ZZEA 2I48A 3U72A 3RPLA 3VDFA 3RT8A 2Z8EA 4M1VA 2WYKA 4ZEFA 5AA2B 1DOTA 2HZKA 5H8QB 1N3WA 3TTMA 2DWIA 1US4A 3IJXB 4H6DA 3RYBA 2ONSA 2XXQA 4DCXA 2XXVA 4BLAA 3THIA 1Q35A 3IFAA 4GWUA 3EF7A 2O84X 1BK4A 4XKPA 3HSTA 4QRZA 4OFLA 1D9VA 3PMVA 2WEFA 2B3FA 5EYGA 5CM6A 1IMDA 4P3LA 1J1NA 4FE8A 2YLNA 1UIVA 2V4CA 4NMYA 4YZZA 3S4UA 4LUBA 3K0VA 3I5OA 2WOPA 1B4ZA 2OCUA 4PE3A 4DE8A 3IO4A 4JDFA 1N76A 1SQYA 3KGCA 2Z22A 2O6AA 1UTHA 2R71A 3QK6A 5DVFA 3OEKA 1B51A 3UP9A 3ILTB 1RDXA 2I3VA 1B5HA 3TELA 3E13X 3H6TA 3IFCA 3TFLA 3GLBA 4PAFA 3K6WA 3C32A 1NUZA 1FQFA 3SDFA 3FD3A 1B7UA 3FVOA 3PU5A 4GWWA 5DVIA 5EHSA 4M4GA 2G93A 4P56A 4GX4A 4H5FA 4GBWA 2VPNA 1FQCA 1OMPA 3U92A 1PC3A 1P1QA 4RK9A 4C0RA 5I56B 3QXMA 2GRVA 3B6QA 5IKBA 1MM7A 4IY5A 3GXAA 5A5LA 2GHBA 3IAZA 3MP8A 3QMFA 2I49A 4H67A 1B4HA 3KSJA 3VV5A 4KYDA 5DYHA 2FNCA 2A5TB 4KFQA 1IMAA 4FIMA 5ISUA 1NUWA 4OFOA 1B3EA 1YAEA 1CNQA 3Q25A 1YCJA 3TPAA 4Q0CA 1TWYA 3KG2A 1NL5A 4R6KA 5IZ3B 3SEWA 4JB7A 2DXRA 1XVXA 3Q29A 4RYAA 4G8NA 4NWDA 4IO5A 3DELB 4GX3A 3CR9A 1XS5A 4GRKA 3TTNA 1Z7ME 3CG1A 1MXZA 5TPAB 2Q8JA 2ZNSA 3JYRA 4XEQA 3RYDA 3FXBA 3FVNA 4OFJA 1FTAA 1MH3A 2XX9A 5AA2A 5CMKA 4P1EA 4XKQA 5H8QA 5B7DA 4XXUA 1NNFA 1P1UA 3EHSA 4PBHA 1KA1A 3DLNA 4LZ7A 4XF5A 1IZ1A 1IMEA 2F7BA 1AIVA 3IB1A 1URDA 4R73A 3T9XB 1B5JA 3OO9A 3U65A 4NGUA 5CI5A 3PV0E 3KBRA 4N15A 5I57B 4E0XA 4LQ5A 4PF6A 1IXCA 4Q5TA 1A7LA 5CMMA 2QL3A 3S9MC 5ET6A 1PB9A 3RTFB 2Q8MA 1URSA 4WKMA 4RXLA 2QS1A 3KN8A 1EYIA 1P1OA 1S7YA 5H8FB 3ZKLA 5CC2A 5I2KB 2RKMA 1MXVA 4PFRA 1RDYA 1JW1A 4GWSA 3VVEA 1B3FA 3FBPA 1ATGA 4FECA 3B7DA 1VDWA 2H25A 2XXIA 3H03A 2XXHA 4EF2A 4GL0A 4MNCA 1BIYA 1K9ZA 2X7QA 3KOSA 4LN5A 1MDP1 2QJEA 1IMCA 1LBYA 1SW5A 1EZ9A 1Z7NE 3EN3A 4IO7A 1LCTA 2HXRA 3ECRA 3R6UA 1N3XA 3E9XA 3LBSA 3ROJA 1AL3A 5I56A 1B7ZA 1XVYA 2XWOA 2FBPA 5JK4A 1OIBA 2I58A 1JEUA 3W15C 2V25A 1QJMA 5EQ7A 4YB5A 2OWSA 4G68B 1QUJA 4TOZA 2A5TA 3C9HA 4QXDA 1DMBA 3VLVA 3MP6A 4N07A 2RF1A 5L9OA 4P1LA 3MVZA 3IORA 4U22A 3KZGA 3HV1A 5I3SA 1SD3A 2RCAA 5JTYB 4F19A 5IZ3A 4EXKA 2UVIA 2NWJA 3VXBA 3GZGA 5TPAA 4F39A 4N91A 2ABHA 1HSJA 4P11A 4NF5A 3C36A 1DBZA 1P99A 4QBAA 2P2AA 2QVRA 4KXPA 1JNFA 4RA1A 1NUYA 1S50A 3OO8A 1MG1A 3N6TA 1KWHA 4G4PA 3PGFA 4ZS9A 3KEIA 3K02A 1TFAA 1D9YA 1USYE 1NNPA 5AA2D 1O64A 5K2YA 4MLVA 3PPPA 1TXFA 2YJPA 2VD3A 2DE4A 3FV2A 4OVSA 4AS4A 4GWZA 4KYEA 4OVRA 3LUYA 1S9TA 5EYFA 1K9YA 5I57A 1OLAA 2QFLA 5CBRA 1MXYA 4PE5B 2I6EA 1TFDA 4WEDA 1MY3A 3BKIB 3TDJA 1NV1A 4HTGA 5FHNA 4BDQA 1N7XA 2HPGA 5EQ8A 1ZJLA 3T9VA 1MQDA 4POXA 2OWTA 2E1SA 3P7IA 4LONB 4EQ7A 3HHFA 5A5XA 4DXCA 2A5SA 4OVJA 5L9SA 3ILUB 1LSTA 4ELRA 4FEDA 3FTOA 1ELJA 1YZ0A 5H8FA 2XXPA 1UIUA 4GXAA 1B05A 4KCCA 4DI4B 2UYEA 2O68A 2Q2AA 1POY1 3FXRA 2CZKA 3ISPA 4DXUA 2GHAA 1IXIA 4OQOA 3G3IA 1LBBA 1JW5A 5ESYA 4ZEIA 1SVXB 5CBSA 4I62A 3O6IA 3RUMA 2P3VA 1B0HA 4BDNA 1FQBA 2QPQA 1JVXA 1QULA 1SYIA 4ZDMA 3ZSFA 4ESWA 4JWYA 3OD7A 5DVJA 1QKAA 4QHQA 3H3GA 4U21A 4ECFA 2ZMBA 4G8HA 3MYUA 2V3TA 1OVTA 4OEVA 4G68A 4G68C 1NI9A 4ESXA 4X48A 5J16A 4KQPA 2UVJA 1QVSA 3M3LA 1JW4A 1GV8A 2O51A 4HXVA 3K1MA 3KJTA 1FPDA 2W7YA 2V84A 1WVJA 3MPLA 4I40A 2KLFA 2D21A 4GL8A 1MY1A 1LAFE 2Q89A 1LLSA 2UVHA 3TCHA 4YMAA 3QSLA 3EQ1A 4LQ2A 2HCAA 4N6PA 2DVZA 5EQAA 2F3DA 3UN6A 4RY1A 1SI0A 3SEUA 4NF8A 2ZZVA 3UGWA 4F3SA 2HQ0A 3G3JA 2QMXA 2VP1A 1CB6A 1NFTA 3K4UA 2PYYA 2F7AA 1LFGA 2VT5A 5L9MA 2WX9A 1DSNA 1JEVA 1FJ9A 4PFBA 4NQ8A 4EQ9A 1UQWA 3WAFA 4MNIA 3SEVA 4NTLA 1PB8A 3CIJA 3IO6A 3RYAA 5LDZA 3IR1A 4RPNA 3RN8A 1FBPA 1FBHA 1B1XA 5AA1A 3IB2A 2QMWA 4F3GA 2Q74A 2F78A 3IOWA 4OVTA 4FJPA 1BP5A 2F35A 4IO3A 3S9LC 4QFKA 2X26A 2ZYOA 3G3GA 2Y7KA 2Y5LA 4OVQA 4JXIA 3TODA 5ICTA 1B2HA 3CG3A 3MBPA 4AS5A 5EQ9A 1NMUA
chains in the Genus database with same CATH topology
1B6HA 4QFLA 1H76A 3K00A 3PD8A 5HBCA 1AOVA 3DRFA 2X7PA 2HAUA 4DLDA 1A8EA 2PX1A 3V89B 1BKAA 3M3FA 4F22A 4N13A 3T93B 4Z0IA 2R9JA 3D4CA 3PUYE 1B3LA 3BFTA 4GIZA 4PFWA 3RTWB 4P0IA 4FEBA 4HCYA 3PPNA 4BDMA 2XXTA 3EPEA 4X9TA 3V8XB 3TCGA 3IL1B 3MUQA 2HAVA 2Q2CA 1P1NA 1B46A 3SEYA 2G29A 2IEEA 5FTHA 1LAGE 4OHNA 3IOTA 3OO7A 1M5FA 1GR2A 4Z7EA 1LFHA 3IOUA 1MPCA 1M5BA 4YAHX 2XX8A 5F1QA 1MXXA 4H65A 4U4SA 3TYHA 5KZTA 3U8QA 2BJJX 1QUIA 4IY6A 1EU8A 4GD5A 1FCKA 3TEPA 1ANFA 1B0LA 2XXRA 3SERA 1Q1KA 2QS3A 3CSBA 2F6PA 1M5DA 3R26A 4NF5B 1DPEA 4QSEA 2RCBA 4O3CA 5EHMA 1EZPA 1XT8A 4GVOA 3FATA 3DP4A 1XHYA 2DXYA 1MH4A 4MF3A 1GVCA 2VD2A 1A40A 1FQEA 1NNTA 2RC9A 3K1PA 4ND9A 3N94A 4HS7A 2THIA 1FQDA 1FTJA 4TLLB 3DM0A 4R9GA 1MY0A 1ZBMA 4MH5A 4MFIA 5AE4A 4UACA 1IUDA 3FZVA 3ODBA 4NF6B 3LR1A 4KR5A 3HO7A 3MPKA 2YPNA 5DT6A 4I1DA 2DYXA 5TP9B 1OQHA 2Q9TA 4C1TA 2RC7A 1H43A 5KCJB 5DTBA 4KD5A 2DE2A 3DP6A 1LGBC 3VFJA 2UVGA 3SESA 2OLBA 3VVFA 5A5XB 2OJTA 5H8NB 4OWDA 2XD3A 3TQLA 5CMCA 1Y9UA 1B1HA 1FW0A 4OMBA 2V3UA 2Y7IA 4RJZA 3T66A 1MM6A 2DSFA 3CFXA 3CHGA 4F29A 4QSDA 3FUZA 2E0SA 2I0BA 3SEXA 3TZAA 1MY4A 3OENA 3O29A 2OZZA 1ZIUA 2OBGA 4DZ1A 3K1NA 3M8UA 3U93A 1FTOA 3OOAA 4EF1A 3B6TA 2Y7WA 1MDQA 4KPTA 3DRHA 1RKMA 4OTEA 2VOZA 4R2FA 2ANJA 1O63A 5I59B 2AL4A 2Y7PA 1YTVA 3QUJA 1P1WA 3C4MA 3FVKA 4FAJA 2UXAA 4XTCQ 1Y4TA 2LAOA 3CVGA 1I6BA 3PUZE 3HN0A 1H3DA 3O6PA 3IX1A 3MVXA 2PMSA 3PUWE 2B3BA 1D3KA 1A8FA 4TLMB 1YPNA 2H98A 4HW8A 3QAXA 5DEXB 5ITPA 2QSXA 1N84A 5CMBA 3LSFB 5BWJA 4POWA 4PETA 1B9JA 3Q27A 4NF8B 3U1OA 4QFNA 1ZMGA 4X1DA 2FA7A 3MWBA 1FQAA 2ONKE 2NOOA 2DP8A 3T96B 3LSXA 4JWXA 1ZLQA 5FHOA 4DIGA 2ALUA 2V93A 1BLFA 2O1LA 4NF4B 3KFMA 1NNKA 3FVGA 3M3KA 5ITOA 3MQ9A 4AQ4A 3C34A 1FTMA 1FTLA 1RYXA 4NF6A 3MZ1A 4G8MA 3WAEA 4QFPA 4PFUA 5TP9A 4ELPA 4OEUA 5BUUA 3IOVA 5KCJA 1XOCA 2ZYNA 3HCQA 3MP1A 3KJ7A 4JSOA 4MLQA 1II5A 5H8NA 3KN3A 5L8DA 3VVDA 4Q30B 4FATA 4GLIA 3QUFA 3L6HA 4R72A 1OQGA 1ZKBA 2IA4A 1N7WA 2PT1A 4LZ8A 1IXHA 1D4NA 1Y1MA 3EHUA 2F36A 5TU0A 2ZXTA 3GBAA 4YKIA 4JSDA 4XKRA 1MRPA 3UK4A 4JBZA 4KI0E 3UA8A 3DRIA 1BTJA 3CFZA 1OVBA 3LSWA 5I59A 1POTA 2H99A 1MXWA 3UIFA 4DXBA 1MY2A 1I6AA 1R9LA 4PFYA 4U23A 1MQGA 4R75A 4DDDA 1HSLA 2DE3A 3A3CA 3TAJA 3TKDA 4YKPA 4DCYA 1SW2A 1NH8A 3K6XA 4NE4A 1A55A 2F6GA 2HFBA 2Z8FA 4GXSB 4EDPA 1PBPA 1UTBA 5KDTA 1NKXA 3CRBA 3VE1B 2P1SA 3QYTA 5DEXA 3A3UA 3L6GA 1SYHA 1VFDA 1B7HA 2F5XA 3G7WA 4LZ5A 5I2NB 1WDNA 1URGA 2O7UA 2WOKA 2Y84A 3FASA 1T0KA 3TUSA 3T22A 4H0WA 2XX7A 3O6GA 3OSQA 2ZNUA 3H4ZA 1M5CA 4NF4A 4R6HA 2GFEA 1PB7A 4NWCA 2D5WA 2ZNTA 3V5AA 4LATA 4WEPA 2XXUA 2PBWA 2HXWA 2Z23A 3QIMA 4GWOA 2CZLA 2QS2A 2PVUA 2P0SA 3PPRA 2RINA 2Z8DA 4R2BA 3O66A 2I3WA 3PUVE 4WXJA 3AXFA 1F9BA 1ZTYA 3G3FA 2B4LA 1JVYA 4E0WA 2I4CA 2XXXA 2VGQA 4F3BA 4UA8A 1EH3A 2H4IA 3H6WA 3K2DA 1FTKA 1HSEA 2PT2A 2XXWA 2DS9A 1EZOA 4R6YA 2VHAA 3ZKKA 4XIGQ 5JEIA 1LAXA 3PD9A 3USDA 3UORA 3RLFE 3I3VA 2WOLA 4OESA 4THIA 3T9UA 2WKYA 3C31A 3FJMA 4BDRA 4P0GA 4RNSA 3FXQA 3BBRA 3D4GA 2H9BA 3A09A 3TQWA 3O6HA 2XXYA 3IK6B 5F7VA 4AB6A 4YKKA 3DRJA 4ZEKA 2O1MA 1B52A 1IIWA 3JV9A 4EXLA 2UYFA 3FIRA 1SW1A 1RYOA 2F8DA 4F31B 5AA4A 3F11A 2DWJA 4ZECA 3HPIA 3MW0A 4H8IA 3VLUA 1LB9A 4H5GA 1Y3NA 2ESNA 1USYH 5I2NA 1I69A 3OEMA 4AB5A 1LCFA 4F18A 1MS7A 1N0TA 1B3HA 3TMGA 1B58A 3N26A 2DQVA 3FV1A 3RY3A 3MZBA 2QS4A 4QF9A 4IB2A 4YB6A 3C33A 5LOMA 4ELQA 1Y4CA 3S9NC 3ONMA 4U2RA 3PAMA 5ICQA 1OLCA 4EQBA 3JZJA 3OXNA 2HEUA 1GTKA 3G3HA 4PQJA 3VXCA 3EHTA 4O3BA 2CMOA 4YB7A 3MVYA 4I9DA 1IITA 3BFUA 4IO4A 4KYSA 4GFRA 1SBPA 3G3KA 4G77A 1MPBA 4NEDA 3O9PA 1N04A 4YU0A 3MVWA 1A54A 1LFIA 3IJOB 4QSCA 4I8CA 1TT1A 3KSXA 4OZ9A 2DWAA 1Y3QA 1NH7A 3K01A 5I84A 2H5YA 3KN7A 4ZE9A 3V83A 3CSGA 4KHZE 3RPWA 4IO6A 4F2OA 2I0CA 1JETA 3PUXE 5K2XA 2REGA 3SETA 5H8HB 4RPOA 3ZS6A 2NUVA 4YICA 3MAMA 4JWOA 3OO6A 4F2QA 5HM4B 1LB8A 3IB0A 4ZE8A 1VSOA 3MZ9A 3H7MA 3GBBA 5I58B 3TTRA 3N6UA 2O69A 1L5TA 1GGGA 1B5IA 1DTGA 4L17A 1IXGA 1LBCA 1LAHE 3RQTA 2AYSA 4OXVA 2DWHA 2O7IA 4OENA 4XKNA 1UTBB 5KDTB 3O28A 5HPQA 1QUKA 1CE2A 1PEBA 3K6VA 4H1XA 4F1UA 3PMXA 5CRYA 3CFLA 3W9VA 4TQUQ 3KOTA 4IGTA 3S2VA 3PPQA 4ZEBA 1DTZA 3LVUA 3E3KA 3TCFA 4GF8A 1WODA 5J1DA 2ZYKA 3H6VA 2I4BA 2DVCA 4U4XA 4LA9A 4LVQA 4PP0A 3SKPA 4C1UA 1B32A 4U1OA 3OELA 1R6ZA 3T9HB 4HCWA 3PPOA 3FJ7A 2XD2A 1M5EA 4OETA 2FYIA 4BDOA 4X1BA 1VR5A 2F7CA 4RK2A 3C35A 3HHGA 3RGYA 1VFEA 1PBQA 5H8SA 1MQJA 3I6VA 4F1YA 4O3AA 2F34A 4IO2A 4YKJA 3FXUA 3B6WA 3H6UA 4ZZAA 3LC8A 1ZU0A 4ZEDA 1A99A 1SI1A 2V3QA 1XC1A 3W9WA 1Y20A 2Y7RA 2D3IA 3RNNA 5AA3A 1MPDA 3CI8A 3O97A 2F97A 4K3FA 4LP2B 4U1ZA 1B40A 1SDXA 3O2AA 4YMBA 3DRKA 4F1VA 3TTLA 2DOJA 5H8HA 2AL5A 1IEJA 1PDAA 3K6UA 4EUOA 2HZLA 3E4RA 1I6QA 1UTHB 5I2KA 4QFOA 3H06B 5B70A 1AH5A 1H45A 3OMBA 3S9EA 3MC2A 1DPPA 2B65A 5FHMA 2RC8A 3Q26A 2ZYMA 1MQHA 5I58A 4IGRA 2REJA 2B4MA 4H8JA 3LSLA 2GH9A 1VE4A 4GOTA 1MQIA 1IQ7A 3R7XA 4OERA 4PFTA 4BDLA 3DP8A 2OK2A 4KCDA 1B3GA 5M2VA 2NXOA 3DRGA 1Y1ZA 2QRYA 4Q8RA 4FORA 3MJNA 1SW4A 2M8CA 1JQFA 3U94A 4ELOA 4MBPA 2Q88A 2ONRA 3N5LA 4GQOA 3TTKA 5AA4B 4ONYA 1AMFA 1QW0A 1US5A 2AIXA 1MXUA 3Q28A 4R74A 1Y3PA 1O7TA 3FGSA 4OYVA 5JTYA 3OSRA 1R1NA 3RT6B 2R6GE 5FTIA 1R9QA 4F3PA 4ISUA 2NVUB 2XHDA 1QKBA 1H44A 3VLWA 4R9FA 3PMWA 5ELVA 5IAIA 3FJGA 4G2ZA 4ZZEA 2I48A 3U72A 3VDFA 3RT8A 2Z8EA 4M1VA 4ZEFA 5AA2B 1DOTA 2HZKA 5H8QB 3TTMA 1N3WA 2DWIA 1US4A 3IJXB 4H6DA 3RYBA 2ONSA 2XXQA 4DCXA 2XXVA 4BLAA 3THIA 1Q35A 3EF7A 2O84X 4XKPA 3HSTA 4QRZA 4OFLA 1D9VA 3PMVA 2B3FA 5CM6A 1J1NA 4FE8A 2YLNA 1UIVA 4NMYA 4YZZA 3S4UA 4LUBA 3K0VA 3I5OA 2WOPA 1B4ZA 2OCUA 4DE8A 3IO4A 4JDFA 1N76A 1SQYA 3KGCA 2Z22A 2O6AA 1UTHA 2R71A 3QK6A 5DVFA 3OEKA 1B51A 3UP9A 3ILTB 2I3VA 1B5HA 3TELA 3E13X 3H6TA 3TFLA 3GLBA 3K6WA 3C32A 1FQFA 3SDFA 3FD3A 1B7UA 3FVOA 3PU5A 5DVIA 5EHSA 4M4GA 2G93A 4H5FA 1FQCA 1OMPA 3U92A 1PC3A 1P1QA 4RK9A 4C0RA 5I56B 3QXMA 2GRVA 3B6QA 5IKBA 1MM7A 4IY5A 3GXAA 2GHBA 3IAZA 3MP8A 2I49A 4H67A 1B4HA 3KSJA 3VV5A 4KYDA 5DYHA 2FNCA 2A5TB 4KFQA 4FIMA 5ISUA 4OFOA 1B3EA 1YAEA 3Q25A 1YCJA 3TPAA 4Q0CA 1TWYA 3KG2A 1NL5A 4R6KA 3SEWA 4JB7A 2DXRA 1XVXA 3Q29A 4RYAA 4G8NA 4NWDA 4IO5A 3DELB 3CR9A 1XS5A 4GRKA 3TTNA 1Z7ME 3CG1A 1MXZA 5TPAB 2Q8JA 2ZNSA 3JYRA 3FVNA 4OFJA 1MH3A 2XX9A 5AA2A 5CMKA 4XKQA 5H8QA 5B7DA 4XXUA 1NNFA 1P1UA 3EHSA 3DLNA 4LZ7A 1IZ1A 2F7BA 1AIVA 3IB1A 1URDA 4R73A 3T9XB 1B5JA 3OO9A 5CI5A 3PV0E 3KBRA 5I57B 4E0XA 4LQ5A 1IXCA 4Q5TA 1A7LA 5CMMA 2QL3A 3S9MC 1PB9A 3RTFB 1URSA 4WKMA 4RXLA 2QS1A 3KN8A 1P1OA 1S7YA 5H8FB 3ZKLA 5CC2A 5I2KB 2RKMA 1MXVA 1JW1A 3VVEA 1B3FA 1ATGA 4FECA 3B7DA 2H25A 2XXIA 3H03A 2XXHA 4EF2A 4GL0A 1BIYA 2X7QA 3KOSA 1MDP1 2QJEA 1SW5A 1EZ9A 1Z7NE 3EN3A 4IO7A 1LCTA 3ECRA 3R6UA 1N3XA 3E9XA 3LBSA 1AL3A 5I56A 1B7ZA 1XVYA 5JK4A 1OIBA 2I58A 1JEUA 3W15C 2V25A 1QJMA 4YB5A 2OWSA 4G68B 1QUJA 4TOZA 2A5TA 3C9HA 1DMBA 3VLVA 3MP6A 4N07A 2RF1A 5L9OA 3MVZA 3IORA 4U22A 3KZGA 3HV1A 1SD3A 2RCAA 5JTYB 4F19A 4EXKA 2UVIA 2NWJA 3VXBA 3GZGA 5TPAA 4F39A 2ABHA 1HSJA 4P11A 4NF5A 3C36A 1P99A 2P2AA 1JNFA 4RA1A 1S50A 3OO8A 1MG1A 3N6TA 1KWHA 4G4PA 3PGFA 4ZS9A 3KEIA 3K02A 1TFAA 1D9YA 1USYE 1NNPA 5AA2D 1O64A 5K2YA 4MLVA 3PPPA 1TXFA 2YJPA 2VD3A 2DE4A 3FV2A 4KYEA 3LUYA 1S9TA 5EYFA 5I57A 1OLAA 5CBRA 1MXYA 4PE5B 2I6EA 1TFDA 4WEDA 1MY3A 3BKIB 3TDJA 4HTGA 5FHNA 4BDQA 1N7XA 1ZJLA 3T9VA 1MQDA 4POXA 2OWTA 2E1SA 3P7IA 4LONB 4EQ7A 3HHFA 5A5XA 4DXCA 2A5SA 4OVJA 5L9SA 3ILUB 1LSTA 4ELRA 4FEDA 3FTOA 1ELJA 5H8FA 2XXPA 1UIUA 4GXAA 1B05A 4KCCA 2UYEA 2O68A 2Q2AA 1POY1 3FXRA 4DXUA 2GHAA 1IXIA 4OQOA 3G3IA 1LBBA 1JW5A 4ZEIA 1SVXB 5CBSA 4I62A 3O6IA 3RUMA 1B0HA 4BDNA 1FQBA 2QPQA 1JVXA 1QULA 1SYIA 4ZDMA 3ZSFA 4ESWA 4JWYA 3OD7A 5DVJA 1QKAA 4QHQA 3H3GA 4U21A 4ECFA 2ZMBA 4G8HA 2V3TA 1OVTA 4OEVA 4G68A 4G68C 4ESXA 4X48A 4KQPA 2UVJA 1QVSA 3M3LA 1JW4A 1GV8A 2O51A 3K1MA 3KJTA 2W7YA 2V84A 1WVJA 3MPLA 2KLFA 2D21A 4GL8A 1MY1A 1LAFE 2Q89A 1LLSA 2UVHA 3TCHA 4YMAA 3QSLA 3EQ1A 4LQ2A 2HCAA 4N6PA 2DVZA 3UN6A 4RY1A 1SI0A 3SEUA 4NF8A 3UGWA 4F3SA 2HQ0A 3G3JA 2QMXA 2VP1A 1CB6A 1NFTA 3K4UA 2PYYA 2F7AA 1LFGA 5L9MA 1DSNA 1JEVA 4EQ9A 1UQWA 3WAFA 3SEVA 4NTLA 1PB8A 3CIJA 3IO6A 3RYAA 3IR1A 4RPNA 3RN8A 1B1XA 5AA1A 3IB2A 2QMWA 4F3GA 2F78A 3IOWA 4FJPA 1BP5A 2F35A 4IO3A 3S9LC 4QFKA 2X26A 2ZYOA 3G3GA 2Y7KA 4JXIA 3TODA 5ICTA 1B2HA 3CG3A 3MBPA 1NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6H A;  4QFL A;  1H76 A;  3K00 A;  3PD8 A;  5HBC A;  1AOV A;  3DRF A;  2X7P A;  2HAU A;  4DLD A;  1A8E A;  2PX1 A;  3V89 B;  1BKA A;  3M3F A;  4F22 A;  4N13 A;  3T93 B;  4Z0I A;  2R9J A;  3D4C A;  3PUY E;  1B3L A;  3BFT A;  4GIZ A;  4PFW A;  3RTW B;  4P0I A;  4FEB A;  4HCY A;  3PPN A;  4BDM A;  2XXT A;  3EPE A;  4X9T A;  3V8X B;  3TCG A;  3IL1 B;  3MUQ A;  2HAV A;  2Q2C A;  1P1N A;  1B46 A;  3SEY A;  2G29 A;  2IEE A;  5FTH A;  1LAG E;  4OHN A;  3IOT A;  3OO7 A;  1M5F A;  1GR2 A;  4Z7E A;  1LFH A;  3IOU A;  1MPC A;  1M5B A;  4YAH X;  2XX8 A;  5F1Q A;  1MXX A;  4H65 A;  4U4S A;  3TYH A;  5KZT A;  3U8Q A;  2BJJ X;  1QUI A;  4IY6 A;  1EU8 A;  4GD5 A;  1FCK A;  3TEP A;  1ANF A;  1B0L A;  2XXR A;  3SER A;  1Q1K A;  2QS3 A;  3CSB A;  2F6P A;  1M5D A;  3R26 A;  4NF5 B;  1DPE A;  4QSE A;  2RCB A;  4O3C A;  5EHM A;  1EZP A;  1XT8 A;  4GVO A;  3FAT A;  3DP4 A;  1XHY A;  2DXY A;  1MH4 A;  4MF3 A;  1GVC A;  2VD2 A;  1A40 A;  1FQE A;  1NNT A;  2RC9 A;  3K1P A;  4ND9 A;  3N94 A;  4HS7 A;  2THI A;  1FQD A;  1FTJ A;  4TLL B;  3DM0 A;  4R9G A;  1MY0 A;  1ZBM A;  4MH5 A;  4MFI A;  5AE4 A;  4UAC A;  1IUD A;  3FZV A;  3ODB A;  4NF6 B;  3LR1 A;  4KR5 A;  3HO7 A;  3MPK A;  2YPN A;  5DT6 A;  4I1D A;  2DYX A;  5TP9 B;  1OQH A;  2Q9T A;  4C1T A;  2RC7 A;  1H43 A;  5KCJ B;  5DTB A;  4KD5 A;  2DE2 A;  3DP6 A;  1LGB C;  3VFJ A;  2UVG A;  3SES A;  2OLB A;  3VVF A;  5A5X B;  2OJT A;  5H8N B;  4OWD A;  2XD3 A;  3TQL A;  5CMC A;  1Y9U A;  1B1H A;  1FW0 A;  4OMB A;  2V3U A;  2Y7I A;  4RJZ A;  3T66 A;  1MM6 A;  2DSF A;  3CFX A;  3CHG A;  4F29 A;  4QSD A;  3FUZ A;  2E0S A;  2I0B A;  3SEX A;  3TZA A;  1MY4 A;  3OEN A;  3O29 A;  2OZZ A;  1ZIU A;  2OBG A;  4DZ1 A;  3K1N A;  3M8U A;  3U93 A;  1FTO A;  3OOA A;  4EF1 A;  3B6T A;  2Y7W A;  1MDQ A;  4KPT A;  3DRH A;  1RKM A;  4OTE A;  2VOZ A;  4R2F A;  2ANJ A;  1O63 A;  5I59 B;  2AL4 A;  2Y7P A;  1YTV A;  3QUJ A;  1P1W A;  3C4M A;  3FVK A;  4FAJ A;  2UXA A;  4XTC Q;  1Y4T A;  2LAO A;  3CVG A;  1I6B A;  3PUZ E;  3HN0 A;  1H3D A;  3O6P A;  3IX1 A;  3MVX A;  2PMS A;  3PUW E;  2B3B A;  1D3K A;  1A8F A;  4TLM B;  1YPN A;  2H98 A;  4HW8 A;  3QAX A;  5DEX B;  5ITP A;  2QSX A;  1N84 A;  5CMB A;  3LSF B;  5BWJ A;  4POW A;  4PET A;  1B9J A;  3Q27 A;  4NF8 B;  3U1O A;  4QFN A;  1ZMG A;  4X1D A;  2FA7 A;  3MWB A;  1FQA A;  2ONK E;  2NOO A;  2DP8 A;  3T96 B;  3LSX A;  4JWX A;  1ZLQ A;  5FHO A;  4DIG A;  2ALU A;  2V93 A;  1BLF A;  2O1L A;  4NF4 B;  3KFM A;  1NNK A;  3FVG A;  3M3K A;  5ITO A;  3MQ9 A;  4AQ4 A;  3C34 A;  1FTM A;  1FTL A;  1RYX A;  4NF6 A;  3MZ1 A;  4G8M A;  3WAE A;  4QFP A;  4PFU A;  5TP9 A;  4ELP A;  4OEU A;  5BUU A;  3IOV A;  5KCJ A;  1XOC A;  2ZYN A;  3HCQ A;  3MP1 A;  3KJ7 A;  4JSO A;  4MLQ A;  1II5 A;  5H8N A;  3KN3 A;  5L8D A;  3VVD A;  4Q30 B;  4FAT A;  4GLI A;  3QUF A;  3L6H A;  4R72 A;  1OQG A;  1ZKB A;  2IA4 A;  1N7W A;  2PT1 A;  4LZ8 A;  1IXH A;  1D4N A;  1Y1M A;  3EHU A;  2F36 A;  5TU0 A;  2ZXT A;  3GBA A;  4YKI A;  4JSD A;  4XKR A;  1MRP A;  3UK4 A;  4JBZ A;  4KI0 E;  3UA8 A;  3DRI A;  1BTJ A;  3CFZ A;  1OVB A;  3LSW A;  5I59 A;  1POT A;  2H99 A;  1MXW A;  3UIF A;  4DXB A;  1MY2 A;  1I6A A;  1R9L A;  4PFY A;  4U23 A;  1MQG A;  4R75 A;  4DDD A;  1HSL A;  2DE3 A;  3A3C A;  3TAJ A;  3TKD A;  4YKP A;  4DCY A;  1SW2 A;  1NH8 A;  3K6X A;  4NE4 A;  1A55 A;  2F6G A;  2HFB A;  2Z8F A;  4GXS B;  4EDP A;  1PBP A;  1UTB A;  5KDT A;  1NKX A;  3CRB A;  3VE1 B;  2P1S A;  3QYT A;  5DEX A;  3A3U A;  3L6G A;  1SYH A;  1VFD A;  1B7H A;  2F5X A;  3G7W A;  4LZ5 A;  5I2N B;  1WDN A;  1URG A;  2O7U A;  2WOK A;  2Y84 A;  3FAS A;  1T0K A;  3TUS A;  3T22 A;  4H0W A;  2XX7 A;  3O6G A;  3OSQ A;  2ZNU A;  3H4Z A;  1M5C A;  4NF4 A;  4R6H A;  2GFE A;  1PB7 A;  4NWC A;  2D5W A;  2ZNT A;  3V5A A;  4LAT A;  4WEP A;  2XXU A;  2PBW A;  2HXW A;  2Z23 A;  3QIM A;  4GWO A;  2CZL A;  2QS2 A;  2PVU A;  2P0S A;  3PPR A;  2RIN A;  2Z8D A;  4R2B A;  3O66 A;  2I3W A;  3PUV E;  4WXJ A;  3AXF A;  1F9B A;  1ZTY A;  3G3F A;  2B4L A;  1JVY A;  4E0W A;  2I4C A;  2XXX A;  2VGQ A;  4F3B A;  4UA8 A;  1EH3 A;  2H4I A;  3H6W A;  3K2D A;  1FTK A;  1HSE A;  2PT2 A;  2XXW A;  2DS9 A;  1EZO A;  4R6Y A;  2VHA A;  3ZKK A;  4XIG Q;  5JEI A;  1LAX A;  3PD9 A;  3USD A;  3UOR A;  3RLF E;  3I3V A;  2WOL A;  4OES A;  4THI A;  3T9U A;  2WKY A;  3C31 A;  3FJM A;  4BDR A;  4P0G A;  4RNS A;  3FXQ A;  3BBR A;  3D4G A;  2H9B A;  3A09 A;  3TQW A;  3O6H A;  2XXY A;  3IK6 B;  5F7V A;  4AB6 A;  4YKK A;  3DRJ A;  4ZEK A;  2O1M A;  1B52 A;  1IIW A;  3JV9 A;  4EXL A;  2UYF A;  3FIR A;  1SW1 A;  1RYO A;  2F8D A;  4F31 B;  5AA4 A;  3F11 A;  2DWJ A;  4ZEC A;  3HPI A;  3MW0 A;  4H8I A;  3VLU A;  1LB9 A;  4H5G A;  1Y3N A;  2ESN A;  1USY H;  5I2N A;  1I69 A;  3OEM A;  4AB5 A;  1LCF A;  4F18 A;  1MS7 A;  1N0T A;  1B3H A;  3TMG A;  1B58 A;  3N26 A;  2DQV A;  3FV1 A;  3RY3 A;  3MZB A;  2QS4 A;  4QF9 A;  4IB2 A;  4YB6 A;  3C33 A;  5LOM A;  4ELQ A;  1Y4C A;  3S9N C;  3ONM A;  4U2R A;  3PAM A;  5ICQ A;  1OLC A;  4EQB A;  3JZJ A;  3OXN A;  2HEU A;  1GTK A;  3G3H A;  4PQJ A;  3VXC A;  3EHT A;  4O3B A;  2CMO A;  4YB7 A;  3MVY A;  4I9D A;  1IIT A;  3BFU A;  4IO4 A;  4KYS A;  4GFR A;  1SBP A;  3G3K A;  4G77 A;  1MPB A;  4NED A;  3O9P A;  1N04 A;  4YU0 A;  3MVW A;  1A54 A;  1LFI A;  3IJO B;  4QSC A;  4I8C A;  1TT1 A;  3KSX A;  4OZ9 A;  2DWA A;  1Y3Q A;  1NH7 A;  3K01 A;  5I84 A;  2H5Y A;  3KN7 A;  4ZE9 A;  3V83 A;  3CSG A;  4KHZ E;  3RPW A;  4IO6 A;  4F2O A;  2I0C A;  1JET A;  3PUX E;  5K2X A;  2REG A;  3SET A;  5H8H B;  4RPO A;  3ZS6 A;  2NUV A;  4YIC A;  3MAM A;  4JWO A;  3OO6 A;  4F2Q A;  5HM4 B;  1LB8 A;  3IB0 A;  4ZE8 A;  1VSO A;  3MZ9 A;  3H7M A;  3GBB A;  5I58 B;  3TTR A;  3N6U A;  2O69 A;  1L5T A;  1GGG A;  1B5I A;  1DTG A;  4L17 A;  1IXG A;  1LBC A;  1LAH E;  3RQT A;  2AYS A;  4OXV A;  2DWH A;  2O7I A;  4OEN A;  4XKN A;  1UTB B;  5KDT B;  3O28 A;  5HPQ A;  1QUK A;  1CE2 A;  1PEB A;  3K6V A;  4H1X A;  4F1U A;  3PMX A;  5CRY A;  3CFL A;  3W9V A;  4TQU Q;  3KOT A;  4IGT A;  3S2V A;  3PPQ A;  4ZEB A;  1DTZ A;  3LVU A;  3E3K A;  3TCF A;  4GF8 A;  1WOD A;  5J1D A;  2ZYK A;  3H6V A;  2I4B A;  2DVC A;  4U4X A;  4LA9 A;  4LVQ A;  4PP0 A;  3SKP A;  4C1U A;  1B32 A;  4U1O A;  3OEL A;  1R6Z A;  3T9H B;  4HCW A;  3PPO A;  3FJ7 A;  2XD2 A;  1M5E A;  4OET A;  2FYI A;  4BDO A;  4X1B A;  1VR5 A;  2F7C A;  4RK2 A;  3C35 A;  3HHG A;  3RGY A;  1VFE A;  1PBQ A;  5H8S A;  1MQJ A;  3I6V A;  4F1Y A;  4O3A A;  2F34 A;  4IO2 A;  4YKJ A;  3FXU A;  3B6W A;  3H6U A;  4ZZA A;  3LC8 A;  1ZU0 A;  4ZED A;  1A99 A;  1SI1 A;  2V3Q A;  1XC1 A;  3W9W A;  1Y20 A;  2Y7R A;  2D3I A;  3RNN A;  5AA3 A;  1MPD A;  3CI8 A;  3O97 A;  2F97 A;  4K3F A;  4LP2 B;  4U1Z A;  1B40 A;  1SDX A;  3O2A A;  4YMB A;  3DRK A;  4F1V A;  3TTL A;  2DOJ A;  5H8H A;  2AL5 A;  1IEJ A;  1PDA A;  3K6U A;  4EUO A;  2HZL A;  3E4R A;  1I6Q A;  1UTH B;  5I2K A;  4QFO A;  3H06 B;  5B70 A;  1AH5 A;  1H45 A;  3OMB A;  3S9E A;  3MC2 A;  1DPP A;  2B65 A;  5FHM A;  2RC8 A;  3Q26 A;  2ZYM A;  1MQH A;  5I58 A;  4IGR A;  2REJ A;  2B4M A;  4H8J A;  3LSL A;  2GH9 A;  1VE4 A;  4GOT A;  1MQI A;  1IQ7 A;  3R7X A;  4OER A;  4PFT A;  4BDL A;  3DP8 A;  2OK2 A;  4KCD A;  1B3G A;  5M2V A;  2NXO A;  3DRG A;  1Y1Z A;  2QRY A;  4Q8R A;  4FOR A;  3MJN A;  1SW4 A;  2M8C A;  1JQF A;  3U94 A;  4ELO A;  4MBP A;  2Q88 A;  2ONR A;  3N5L A;  4GQO A;  3TTK A;  5AA4 B;  4ONY A;  1AMF A;  1QW0 A;  1US5 A;  2AIX A;  1MXU A;  3Q28 A;  4R74 A;  1Y3P A;  1O7T A;  3FGS A;  4OYV A;  5JTY A;  3OSR A;  1R1N A;  3RT6 B;  2R6G E;  5FTI A;  1R9Q A;  4F3P A;  4ISU A;  2NVU B;  2XHD A;  1QKB A;  1H44 A;  3VLW A;  4R9F A;  3PMW A;  5ELV A;  5IAI A;  3FJG A;  4G2Z A;  4ZZE A;  2I48 A;  3U72 A;  3VDF A;  3RT8 A;  2Z8E A;  4M1V A;  4ZEF A;  5AA2 B;  1DOT A;  2HZK A;  5H8Q B;  3TTM A;  1N3W A;  2DWI A;  1US4 A;  3IJX B;  4H6D A;  3RYB A;  2ONS A;  2XXQ A;  4DCX A;  2XXV A;  4BLA A;  3THI A;  1Q35 A;  3EF7 A;  2O84 X;  4XKP A;  3HST A;  4QRZ A;  4OFL A;  1D9V A;  3PMV A;  2B3F A;  5CM6 A;  1J1N A;  4FE8 A;  2YLN A;  1UIV A;  4NMY A;  4YZZ A;  3S4U A;  4LUB A;  3K0V A;  3I5O A;  2WOP A;  1B4Z A;  2OCU A;  4DE8 A;  3IO4 A;  4JDF A;  1N76 A;  1SQY A;  3KGC A;  2Z22 A;  2O6A A;  1UTH A;  2R71 A;  3QK6 A;  5DVF A;  3OEK A;  1B51 A;  3UP9 A;  3ILT B;  2I3V A;  1B5H A;  3TEL A;  3E13 X;  3H6T A;  3TFL A;  3GLB A;  3K6W A;  3C32 A;  1FQF A;  3SDF A;  3FD3 A;  1B7U A;  3FVO A;  3PU5 A;  5DVI A;  5EHS A;  4M4G A;  2G93 A;  4H5F A;  1FQC A;  1OMP A;  3U92 A;  1PC3 A;  1P1Q A;  4RK9 A;  4C0R A;  5I56 B;  3QXM A;  2GRV A;  3B6Q A;  5IKB A;  1MM7 A;  4IY5 A;  3GXA A;  2GHB A;  3IAZ A;  3MP8 A;  2I49 A;  4H67 A;  1B4H A;  3KSJ A;  3VV5 A;  4KYD A;  5DYH A;  2FNC A;  2A5T B;  4KFQ A;  4FIM A;  5ISU A;  4OFO A;  1B3E A;  1YAE A;  3Q25 A;  1YCJ A;  3TPA A;  4Q0C A;  1TWY A;  3KG2 A;  1NL5 A;  4R6K A;  3SEW A;  4JB7 A;  2DXR A;  1XVX A;  3Q29 A;  4RYA A;  4G8N A;  4NWD A;  4IO5 A;  3DEL B;  3CR9 A;  1XS5 A;  4GRK A;  3TTN A;  1Z7M E;  3CG1 A;  1MXZ A;  5TPA B;  2Q8J A;  2ZNS A;  3JYR A;  3FVN A;  4OFJ A;  1MH3 A;  2XX9 A;  5AA2 A;  5CMK A;  4XKQ A;  5H8Q A;  5B7D A;  4XXU A;  1NNF A;  1P1U A;  3EHS A;  3DLN A;  4LZ7 A;  1IZ1 A;  2F7B A;  1AIV A;  3IB1 A;  1URD A;  4R73 A;  3T9X B;  1B5J A;  3OO9 A;  5CI5 A;  3PV0 E;  3KBR A;  5I57 B;  4E0X A;  4LQ5 A;  1IXC A;  4Q5T A;  1A7L A;  5CMM A;  2QL3 A;  3S9M C;  1PB9 A;  3RTF B;  1URS A;  4WKM A;  4RXL A;  2QS1 A;  3KN8 A;  1P1O A;  1S7Y A;  5H8F B;  3ZKL A;  5CC2 A;  5I2K B;  2RKM A;  1MXV A;  1JW1 A;  3VVE A;  1B3F A;  1ATG A;  4FEC A;  3B7D A;  2H25 A;  2XXI A;  3H03 A;  2XXH A;  4EF2 A;  4GL0 A;  1BIY A;  2X7Q A;  3KOS A;  1MDP 1;  2QJE A;  1SW5 A;  1EZ9 A;  1Z7N E;  3EN3 A;  4IO7 A;  1LCT A;  3ECR A;  3R6U A;  1N3X A;  3E9X A;  3LBS A;  1AL3 A;  5I56 A;  1B7Z A;  1XVY A;  5JK4 A;  1OIB A;  2I58 A;  1JEU A;  3W15 C;  2V25 A;  1QJM A;  4YB5 A;  2OWS A;  4G68 B;  1QUJ A;  4TOZ A;  2A5T A;  3C9H A;  1DMB A;  3VLV A;  3MP6 A;  4N07 A;  2RF1 A;  5L9O A;  3MVZ A;  3IOR A;  4U22 A;  3KZG A;  3HV1 A;  1SD3 A;  2RCA A;  5JTY B;  4F19 A;  4EXK A;  2UVI A;  2NWJ A;  3VXB A;  3GZG A;  5TPA A;  4F39 A;  2ABH A;  1HSJ A;  4P11 A;  4NF5 A;  3C36 A;  1P99 A;  2P2A A;  1JNF A;  4RA1 A;  1S50 A;  3OO8 A;  1MG1 A;  3N6T A;  1KWH A;  4G4P A;  3PGF A;  4ZS9 A;  3KEI A;  3K02 A;  1TFA A;  1D9Y A;  1USY E;  1NNP A;  5AA2 D;  1O64 A;  5K2Y A;  4MLV A;  3PPP A;  1TXF A;  2YJP A;  2VD3 A;  2DE4 A;  3FV2 A;  4KYE A;  3LUY A;  1S9T A;  5EYF A;  5I57 A;  1OLA A;  5CBR A;  1MXY A;  4PE5 B;  2I6E A;  1TFD A;  4WED A;  1MY3 A;  3BKI B;  3TDJ A;  4HTG A;  5FHN A;  4BDQ A;  1N7X A;  1ZJL A;  3T9V A;  1MQD A;  4POX A;  2OWT A;  2E1S A;  3P7I A;  4LON B;  4EQ7 A;  3HHF A;  5A5X A;  4DXC A;  2A5S A;  4OVJ A;  5L9S A;  3ILU B;  1LST A;  4ELR A;  4FED A;  3FTO A;  1ELJ A;  5H8F A;  2XXP A;  1UIU A;  4GXA A;  1B05 A;  4KCC A;  2UYE A;  2O68 A;  2Q2A A;  1POY 1;  3FXR A;  4DXU A;  2GHA A;  1IXI A;  4OQO A;  3G3I A;  1LBB A;  1JW5 A;  4ZEI A;  1SVX B;  5CBS A;  4I62 A;  3O6I A;  3RUM A;  1B0H A;  4BDN A;  1FQB A;  2QPQ A;  1JVX A;  1QUL A;  1SYI A;  4ZDM A;  3ZSF A;  4ESW A;  4JWY A;  3OD7 A;  5DVJ A;  1QKA A;  4QHQ A;  3H3G A;  4U21 A;  4ECF A;  2ZMB A;  4G8H A;  2V3T A;  1OVT A;  4OEV A;  4G68 A;  4G68 C;  4ESX A;  4X48 A;  4KQP A;  2UVJ A;  1QVS A;  3M3L A;  1JW4 A;  1GV8 A;  2O51 A;  3K1M A;  3KJT A;  2W7Y A;  2V84 A;  1WVJ A;  3MPL A;  2KLF A;  2D21 A;  4GL8 A;  1MY1 A;  1LAF E;  2Q89 A;  1LLS A;  2UVH A;  3TCH A;  4YMA A;  3QSL A;  3EQ1 A;  4LQ2 A;  2HCA A;  4N6P A;  2DVZ A;  3UN6 A;  4RY1 A;  1SI0 A;  3SEU A;  4NF8 A;  3UGW A;  4F3S A;  2HQ0 A;  3G3J A;  2QMX A;  2VP1 A;  1CB6 A;  1NFT A;  3K4U A;  2PYY A;  2F7A A;  1LFG A;  5L9M A;  1DSN A;  1JEV A;  4EQ9 A;  1UQW A;  3WAF A;  3SEV A;  4NTL A;  1PB8 A;  3CIJ A;  3IO6 A;  3RYA A;  3IR1 A;  4RPN A;  3RN8 A;  1B1X A;  5AA1 A;  3IB2 A;  2QMW A;  4F3G A;  2F78 A;  3IOW A;  4FJP A;  1BP5 A;  2F35 A;  4IO3 A;  3S9L C;  4QFK A;  2X26 A;  2ZYO A;  3G3G A;  2Y7K A;  4JXI A;  3TOD A;  5ICT A;  1B2H A;  3CG3 A;  3MBP A;  1NMU A; 
#chains in the Genus database with same CATH topology
 1B6H A;  4QFL A;  1H76 A;  3K00 A;  3PD8 A;  2JJK A;  5HBC A;  1AOV A;  3DRF A;  2X7P A;  2HAU A;  4DLD A;  1A8E A;  2PX1 A;  2FIX A;  3V89 B;  1BKA A;  3M3F A;  4NX1 A;  4GWY A;  4F22 A;  4N13 A;  3T93 B;  4Z0I A;  2R9J A;  3D4C A;  3PUY E;  1B3L A;  3BFT A;  4GIZ A;  1XI6 A;  2XWV A;  2ZZW A;  4PFW A;  3RTW B;  4P0I A;  4FEB A;  4HCY A;  3PPN A;  4BDM A;  2XXT A;  3EPE A;  4X9T A;  3V8X B;  3TCG A;  3IL1 B;  3MUQ A;  2HAV A;  2Q2C A;  1P1N A;  1B46 A;  3SEY A;  2G29 A;  2IEE A;  5FTH A;  1LAG E;  4OHN A;  3IOT A;  3OO7 A;  4NN3 A;  1M5F A;  1GR2 A;  4Z7E A;  1LFH A;  3IOU A;  3SZP A;  1MPC A;  1M5B A;  4YAH X;  2XX8 A;  5F1Q A;  4N6D A;  1MXX A;  4H65 A;  4N17 A;  4U4S A;  3TYH A;  5KZT A;  3U8Q A;  2BJJ X;  1QUI A;  4PDH A;  3KC0 A;  4IY6 A;  1EU8 A;  2KR0 A;  4GD5 A;  1NV0 A;  1FCK A;  4PBQ A;  3TEP A;  1ANF A;  4PAK A;  5EYH A;  1B0L A;  2XXR A;  3SER A;  1Q1K A;  2QS3 A;  3CSB A;  2F6P A;  1M5D A;  1NV6 A;  3R26 A;  4NF5 B;  1DPE A;  4PFI A;  2WBD A;  4QSE A;  2RCB A;  4O3C A;  5EHM A;  1EZP A;  1XT8 A;  4GVO A;  4IR8 A;  4NG7 A;  3FAT A;  3DP4 A;  1D9Q A;  1XHY A;  2DXY A;  1FBE A;  2FHY A;  4PCD A;  1MH4 A;  2GQ1 A;  4MF3 A;  1GVC A;  2VD2 A;  3B50 A;  1A40 A;  1FQE A;  1NNT A;  2WYP A;  2RC9 A;  3K1P A;  4ND9 A;  3N94 A;  4HS7 A;  2THI A;  1FQD A;  1FTJ A;  4TLL B;  3DM0 A;  4R9G A;  1MY0 A;  1ZBM A;  3BIH A;  4MH5 A;  4MFI A;  5AE4 A;  4UAC A;  4MX6 A;  1IUD A;  3FZV A;  3ODB A;  4NF6 B;  3LR1 A;  4KR5 A;  3HO7 A;  5I5P A;  3MPK A;  2YPN A;  2BJI A;  5DT6 A;  4I1D A;  2DYX A;  5TP9 B;  1OQH A;  2Q9T A;  4OAN A;  4C1T A;  2RC7 A;  4JVD A;  1H43 A;  5KCJ B;  5DTB A;  4KD5 A;  2DE2 A;  3DP6 A;  1LGB C;  2L5V A;  3VFJ A;  2UVG A;  3SES A;  2OLB A;  3VVF A;  5A5X B;  2OJT A;  5H8N B;  4OWD A;  2XD3 A;  3TQL A;  5CMC A;  1Y9U A;  1B1H A;  1FW0 A;  4OMB A;  2V3U A;  2Y7I A;  4RJZ A;  1MM6 A;  3T66 A;  2DSF A;  3CFX A;  3CHG A;  4F29 A;  1FBD A;  3EKI A;  1G0H A;  4QSD A;  3FUZ A;  2E0S A;  4H46 A;  2I0B A;  3SEX A;  3TZA A;  3KC1 A;  1MY4 A;  3OEN A;  3O29 A;  2OZZ A;  4NAP A;  2OWZ A;  1ZIU A;  2OBG A;  4DZ1 A;  3K1N A;  3M8U A;  3U93 A;  1FTO A;  2FVZ A;  3OOA A;  4EF1 A;  1FPJ A;  3B6T A;  2Y7W A;  1MDQ A;  4KPT A;  3DRH A;  1RKM A;  4OTE A;  2VOZ A;  4R2F A;  2ANJ A;  1O63 A;  5I59 B;  4I3Y A;  2AL4 A;  2Y7P A;  1YTV A;  1Q9D A;  1AWB A;  3QUJ A;  1P1W A;  3C4M A;  4MHF A;  3FVK A;  4FAJ A;  4P47 A;  2UXA A;  2OX3 A;  4XTC Q;  1Y4T A;  2LAO A;  3CVG A;  1I6B A;  3PUZ E;  3HN0 A;  1H3D A;  3O6P A;  1KA0 A;  3IX1 A;  3MVX A;  2PMS A;  3PUW E;  1LBV A;  4PTK A;  2B3B A;  1D3K A;  1A8F A;  4TLM B;  1YPN A;  2H98 A;  4HW8 A;  3QAX A;  4MAG A;  5DEX B;  5ITP A;  3B8B A;  2QSX A;  1N84 A;  5CMB A;  3LSF B;  5BWJ A;  3E79 A;  4POW A;  4PET A;  1B9J A;  3Q27 A;  4NF8 B;  3U1O A;  4QFN A;  1ZMG A;  4X1D A;  2FA7 A;  3MWB A;  1FQA A;  2ONK E;  2XWK A;  2NOO A;  2DP8 A;  3T96 B;  3LSX A;  4JWX A;  1ZLQ A;  5FHO A;  4DIG A;  2P3N A;  2ALU A;  2V93 A;  5IM2 A;  1YYZ A;  1BLF A;  2O1L A;  4NF4 B;  3KFM A;  1NNK A;  3FVG A;  3M3K A;  5ITO A;  3MQ9 A;  4AQ4 A;  3C34 A;  5F24 A;  1FTM A;  1FTL A;  1RYX A;  4NF6 A;  3MZ1 A;  4G8M A;  3WAE A;  2DDK A;  4OA4 A;  4QFP A;  3LUZ A;  4PFU A;  5TP9 A;  4ELP A;  4OEU A;  5BUU A;  3IOV A;  5KCJ A;  4P8B A;  4PAI A;  1XOC A;  2ZYN A;  3HCQ A;  3MP1 A;  1FJ6 A;  3KJ7 A;  4JSO A;  4MLQ A;  4HE2 A;  1II5 A;  1LEV A;  5H8N A;  3KN3 A;  4PGP A;  5L8D A;  3VVD A;  4Q30 B;  4FAT A;  4GLI A;  1KZ8 A;  3QUF A;  3L6H A;  4R72 A;  3LV0 A;  1OQG A;  1ZKB A;  2IA4 A;  1N7W A;  2PT1 A;  4LZ8 A;  1IXH A;  4GX6 A;  1D4N A;  1Y1M A;  3E78 A;  3EHU A;  2F36 A;  5TU0 A;  2ZXT A;  3GBA A;  4YKI A;  4JSD A;  4XKR A;  1MRP A;  2XWI A;  4PGN A;  3UK4 A;  4JBZ A;  4KI0 E;  3UA8 A;  3DRI A;  1BTJ A;  3CFZ A;  1OVB A;  3LSW A;  5I59 A;  1POT A;  2H99 A;  1MXW A;  3UIF A;  4DXB A;  1MY2 A;  1I6A A;  1R9L A;  4PFY A;  4U23 A;  1MQG A;  4R75 A;  3T1B A;  4DDD A;  1HSL A;  2DE3 A;  3A3C A;  3TAJ A;  3TKD A;  4YKP A;  4DCY A;  1SW2 A;  1NH8 A;  3K6X A;  4NE4 A;  2HHM A;  1A55 A;  2F6G A;  2HFB A;  2Z8F A;  4GXS B;  4N8G A;  4EDP A;  1DCU A;  1NV3 A;  1PBP A;  1UTB A;  5KDT A;  1NKX A;  3CRB A;  3VE1 B;  2P1S A;  3QYT A;  5DEX A;  2KQZ A;  4UAB A;  3A3U A;  3L6G A;  1DK4 A;  1SYH A;  1VFD A;  1B7H A;  2F5X A;  4PDD A;  3G7W A;  4LZ5 A;  5I2N B;  1WDN A;  1URG A;  2R8T A;  2O7U A;  5IGA A;  2WOK A;  2Y84 A;  3FAS A;  1T0K A;  3TUS A;  1RDZ A;  1NUX A;  3T22 A;  4H0W A;  2XX7 A;  3O6G A;  4G61 A;  3OSQ A;  2ZNU A;  3H4Z A;  1M5C A;  1LBZ A;  4NF4 A;  4DI3 D;  4R6H A;  2GFE A;  1PB7 A;  4NWC A;  2D5W A;  2ZNT A;  3V5A A;  4LAT A;  2PCR A;  4WEP A;  2XXU A;  2PBW A;  2HXW A;  1IMF A;  2Z23 A;  3QIM A;  4GWO A;  2CZL A;  2QS2 A;  1YXI A;  4MNP A;  2PVU A;  2P0S A;  3PPR A;  2MKZ A;  2RIN A;  2Z8D A;  4R2B A;  3O66 A;  2I3W A;  3PUV E;  4WXJ A;  3AXF A;  1F9B A;  1ZTY A;  4JVC A;  3G3F A;  2B4L A;  4MIJ A;  1JVY A;  4E0W A;  2PFZ A;  2I4C A;  2XXX A;  2VGQ A;  4F3B A;  4UA8 A;  1EH3 A;  2VPO A;  2H4I A;  3H6W A;  3K2D A;  3D1R A;  1FTK A;  5IZZ A;  1HSE A;  2PT2 A;  2XXW A;  2DS9 A;  1EZO A;  4R6Y A;  2VHA A;  1JP4 A;  3ZKK A;  4XIG Q;  5JEI A;  1LAX A;  3PD9 A;  4N4U A;  4NF0 A;  3USD A;  3UOR A;  3RLF E;  4HE1 A;  3I3V A;  2WOL A;  4OES A;  4THI A;  3T9U A;  2WKY A;  3C31 A;  3FJM A;  1FRP A;  4BDR A;  4P0G A;  4RNS A;  3FXQ A;  3BBR A;  3D4G A;  2H9B A;  3HFU A;  3A09 A;  4NHB A;  3TQW A;  3O6H A;  2XXY A;  3IK6 B;  4O94 A;  5F7V A;  4AB6 A;  4YKK A;  3DRJ A;  4ZEK A;  2O1M A;  2QVU A;  1B52 A;  1IIW A;  3JV9 A;  4EXL A;  2UYF A;  3FIR A;  4N6K A;  1SW1 A;  1RYO A;  2F8D A;  4F31 B;  5AA4 A;  3F11 A;  2DWJ A;  4ZEC A;  3HPI A;  3MW0 A;  4H8I A;  1SPI A;  3VLU A;  1LB9 A;  4H5G A;  1IMB A;  1FPE A;  1Y3N A;  2ESN A;  2XXK A;  1USY H;  5I2N A;  1I69 A;  3OEM A;  4AB5 A;  1LCF A;  4F18 A;  1FPI A;  2CZH A;  1MS7 A;  1N0T A;  1B3H A;  1G0I A;  3TMG A;  1B58 A;  3N26 A;  2DQV A;  3FV1 A;  3RY3 A;  1FPK A;  3MZB A;  2QS4 A;  4QF9 A;  4IB2 A;  4YB6 A;  3C33 A;  5LOM A;  4ELQ A;  1Y4C A;  3S9N C;  3ONM A;  4U2R A;  3PAM A;  5ICQ A;  1OLC A;  4EQB A;  3JZJ A;  3OXN A;  2HEU A;  1GTK A;  2Y5K A;  3G3H A;  4PQJ A;  3VXC A;  3EHT A;  4O3B A;  2CMO A;  4YB7 A;  3MVY A;  4I9D A;  1IIT A;  4I3E A;  3BFU A;  4PF8 A;  4IO4 A;  4KYS A;  4GFR A;  1SBP A;  3G3K A;  4G77 A;  1MPB A;  4NED A;  3O9P A;  4FBP A;  1N04 A;  4YU0 A;  3MVW A;  1A54 A;  1LFI A;  3IJO B;  4QSC A;  4I8C A;  1TT1 A;  3KSX A;  4OZ9 A;  2DWA A;  1Y3Q A;  1NH7 A;  3K01 A;  5I84 A;  2H5Y A;  3KN7 A;  3PTY A;  4ZE9 A;  3V83 A;  3CSG A;  2PFY A;  4KHZ E;  2CEX A;  3RPW A;  5ET8 A;  4IO6 A;  4MJO A;  4F2O A;  2I0C A;  1JET A;  3PUX E;  5K2X A;  2REG A;  2XA5 A;  3SET A;  5H8H B;  4RPO A;  3ZS6 A;  4OVP A;  2NUV A;  4YIC A;  2F3B A;  3MAM A;  4JWO A;  3OO6 A;  5DW8 A;  5IZ1 A;  4F2Q A;  2ZZX A;  5HM4 B;  1LB8 A;  3IB0 A;  4JVI A;  3MST A;  4ZE8 A;  1VSO A;  3MZ9 A;  4N81 A;  3H7M A;  4GBV A;  3GBB A;  4MCO A;  1LBW A;  5I58 B;  3TTR A;  5LTC A;  4XFE A;  3N6U A;  2O69 A;  1L5T A;  1GGG A;  1B5I A;  1DTG A;  4L17 A;  1IXG A;  1LBC A;  1LAH E;  3RQT A;  2AYS A;  4OXV A;  2DWH A;  2O7I A;  4OEN A;  4XKN A;  1UTB B;  5KDT B;  3O28 A;  5HPQ A;  1NV4 A;  1QUK A;  1CE2 A;  1PEB A;  3K6V A;  1QGX A;  1FPL A;  4H1X A;  4F1U A;  3PMX A;  5CRY A;  1FPF A;  3CFL A;  3W9V A;  2WBB A;  2QVV A;  4TQU Q;  3KOT A;  4IGT A;  3S2V A;  3PPQ A;  4ZEB A;  1DTZ A;  2CZI A;  3LVU A;  3E3K A;  3TCF A;  4GF8 A;  2FIE A;  5I7I A;  1WOD A;  5J1D A;  2ZYK A;  5FBP A;  1NV7 A;  3H6V A;  1FSA A;  2I4B A;  2DVC A;  4U4X A;  4LA9 A;  4LVQ A;  4PP0 A;  3SKP A;  4C1U A;  1B32 A;  4U1O A;  3OEL A;  1R6Z A;  1INP A;  4HCW A;  3T9H B;  3PPO A;  3FJ7 A;  4H45 A;  3RPL B;  2XD2 A;  1M5E A;  4OET A;  2FYI A;  1LBX A;  4BDO A;  4X1B A;  1VR5 A;  2F7C A;  4RK2 A;  3C35 A;  3HHG A;  3RGY A;  1VFE A;  1PBQ A;  5H8S A;  1MQJ A;  3I6V A;  4F1Y A;  4O3A A;  2F34 A;  3GYY A;  4IO2 A;  4YKJ A;  3FXU A;  3B6W A;  3H6U A;  4X04 A;  4ZZA A;  3LC8 A;  1ZU0 A;  4ZED A;  1A99 A;  1SI1 A;  2V3Q A;  1XC1 A;  3W9W A;  1Y20 A;  2Y7R A;  2D3I A;  3RNN A;  4P9K A;  5AA3 A;  4N8Y A;  1MPD A;  3KBZ A;  3CI8 A;  3O97 A;  2F97 A;  4K3F A;  4LP2 B;  4U1Z A;  1B40 A;  1FPB A;  1SDX A;  1NV5 A;  3O2A A;  4YMB A;  3DRK A;  4F1V A;  5T3J A;  3TTL A;  4MMP A;  2DOJ A;  5H8H A;  2AL5 A;  2CEY A;  1IEJ A;  4MEV A;  1PDA A;  3K6U A;  4EUO A;  2HZL A;  1EYJ A;  3E4R A;  1I6Q A;  1UTH B;  5ET7 A;  5I2K A;  4QFO A;  3H06 B;  5B70 A;  1AH5 A;  1H45 A;  3OMB A;  3S9E A;  3MC2 A;  1DPP A;  2B65 A;  1FBC A;  5FHM A;  2RC8 A;  3Q26 A;  2ZYM A;  1MQH A;  5I58 A;  4IGR A;  2REJ A;  2B4M A;  4H8J A;  3LSL A;  2GH9 A;  4X8R A;  1VE4 A;  4GOT A;  1MQI A;  1IQ7 A;  1FBG A;  3R7X A;  4OER A;  4PFT A;  4BDL A;  3DP8 A;  4O7M A;  2OK2 A;  4HE0 A;  4KCD A;  1B3G A;  5M2V A;  2NXO A;  3DRG A;  1Y1Z A;  2QRY A;  4Q8R A;  4FOR A;  3MJN A;  3NOH A;  1SW4 A;  3BIG A;  2M8C A;  4O8M A;  1JQF A;  3U94 A;  4ELO A;  4MBP A;  2Q88 A;  2ONR A;  3N5L A;  4GQO A;  3TTK A;  3T0J A;  5AA4 B;  4ONY A;  1AMF A;  1QW0 A;  1EYK A;  1US5 A;  2AIX A;  1MXU A;  3Q28 A;  4R74 A;  4O7I A;  1Y3P A;  1O7T A;  3FGS A;  4GWX A;  4OYV A;  5ET5 A;  5JTY A;  3OSR A;  3A29 A;  1R1N A;  3RT6 B;  2R6G E;  5FTI A;  1R9Q A;  4F3P A;  4ISU A;  1FPG A;  2NVU B;  2XHD A;  1NV2 A;  1QKB A;  1H44 A;  3VLW A;  4R9F A;  1FBF A;  3PMW A;  5ELV A;  5IAI A;  3FJG A;  4PC9 A;  4G2Z A;  4ZZE A;  2I48 A;  3U72 A;  3RPL A;  3VDF A;  3RT8 A;  2Z8E A;  4M1V A;  2WYK A;  4ZEF A;  5AA2 B;  1DOT A;  2HZK A;  5H8Q B;  1N3W A;  3TTM A;  2DWI A;  1US4 A;  3IJX B;  4H6D A;  3RYB A;  2ONS A;  2XXQ A;  4DCX A;  2XXV A;  4BLA A;  3THI A;  1Q35 A;  3IFA A;  4GWU A;  3EF7 A;  2O84 X;  1BK4 A;  4XKP A;  3HST A;  4QRZ A;  4OFL A;  1D9V A;  3PMV A;  2WEF A;  2B3F A;  5EYG A;  5CM6 A;  1IMD A;  4P3L A;  1J1N A;  4FE8 A;  2YLN A;  1UIV A;  2V4C A;  4NMY A;  4YZZ A;  3S4U A;  4LUB A;  3K0V A;  3I5O A;  2WOP A;  1B4Z A;  2OCU A;  4PE3 A;  4DE8 A;  3IO4 A;  4JDF A;  1N76 A;  1SQY A;  3KGC A;  2Z22 A;  2O6A A;  1UTH A;  2R71 A;  3QK6 A;  5DVF A;  3OEK A;  1B51 A;  3UP9 A;  3ILT B;  1RDX A;  2I3V A;  1B5H A;  3TEL A;  3E13 X;  3H6T A;  3IFC A;  3TFL A;  3GLB A;  4PAF A;  3K6W A;  3C32 A;  1NUZ A;  1FQF A;  3SDF A;  3FD3 A;  1B7U A;  3FVO A;  3PU5 A;  4GWW A;  5DVI A;  5EHS A;  4M4G A;  2G93 A;  4P56 A;  4GX4 A;  4H5F A;  4GBW A;  2VPN A;  1FQC A;  1OMP A;  3U92 A;  1PC3 A;  1P1Q A;  4RK9 A;  4C0R A;  5I56 B;  3QXM A;  2GRV A;  3B6Q A;  5IKB A;  1MM7 A;  4IY5 A;  3GXA A;  5A5L A;  2GHB A;  3IAZ A;  3MP8 A;  3QMF A;  2I49 A;  4H67 A;  1B4H A;  3KSJ A;  3VV5 A;  4KYD A;  5DYH A;  2FNC A;  2A5T B;  4KFQ A;  1IMA A;  4FIM A;  5ISU A;  1NUW A;  4OFO A;  1B3E A;  1YAE A;  1CNQ A;  3Q25 A;  1YCJ A;  3TPA A;  4Q0C A;  1TWY A;  3KG2 A;  1NL5 A;  4R6K A;  5IZ3 B;  3SEW A;  4JB7 A;  2DXR A;  1XVX A;  3Q29 A;  4RYA A;  4G8N A;  4NWD A;  4IO5 A;  3DEL B;  4GX3 A;  3CR9 A;  1XS5 A;  4GRK A;  3TTN A;  1Z7M E;  3CG1 A;  1MXZ A;  5TPA B;  2Q8J A;  2ZNS A;  3JYR A;  4XEQ A;  3RYD A;  3FXB A;  3FVN A;  4OFJ A;  1FTA A;  1MH3 A;  2XX9 A;  5AA2 A;  5CMK A;  4P1E A;  4XKQ A;  5H8Q A;  5B7D A;  4XXU A;  1NNF A;  1P1U A;  3EHS A;  4PBH A;  1KA1 A;  3DLN A;  4LZ7 A;  4XF5 A;  1IZ1 A;  1IME A;  2F7B A;  1AIV A;  3IB1 A;  1URD A;  4R73 A;  3T9X B;  1B5J A;  3OO9 A;  3U65 A;  4NGU A;  5CI5 A;  3PV0 E;  3KBR A;  4N15 A;  5I57 B;  4E0X A;  4LQ5 A;  4PF6 A;  1IXC A;  4Q5T A;  1A7L A;  5CMM A;  2QL3 A;  3S9M C;  5ET6 A;  1PB9 A;  3RTF B;  2Q8M A;  1URS A;  4WKM A;  4RXL A;  2QS1 A;  3KN8 A;  1EYI A;  1P1O A;  1S7Y A;  5H8F B;  3ZKL A;  5CC2 A;  5I2K B;  2RKM A;  1MXV A;  4PFR A;  1RDY A;  1JW1 A;  4GWS A;  3VVE A;  1B3F A;  3FBP A;  1ATG A;  4FEC A;  3B7D A;  1VDW A;  2H25 A;  2XXI A;  3H03 A;  2XXH A;  4EF2 A;  4GL0 A;  4MNC A;  1BIY A;  1K9Z A;  2X7Q A;  3KOS A;  4LN5 A;  1MDP 1;  2QJE A;  1IMC A;  1LBY A;  1SW5 A;  1EZ9 A;  1Z7N E;  3EN3 A;  4IO7 A;  1LCT A;  2HXR A;  3ECR A;  3R6U A;  1N3X A;  3E9X A;  3LBS A;  3ROJ A;  1AL3 A;  5I56 A;  1B7Z A;  1XVY A;  2XWO A;  2FBP A;  5JK4 A;  1OIB A;  2I58 A;  1JEU A;  3W15 C;  2V25 A;  1QJM A;  5EQ7 A;  4YB5 A;  2OWS A;  4G68 B;  1QUJ A;  4TOZ A;  2A5T A;  3C9H A;  4QXD A;  1DMB A;  3VLV A;  3MP6 A;  4N07 A;  2RF1 A;  5L9O A;  4P1L A;  3MVZ A;  3IOR A;  4U22 A;  3KZG A;  3HV1 A;  5I3S A;  1SD3 A;  2RCA A;  5JTY B;  4F19 A;  5IZ3 A;  4EXK A;  2UVI A;  2NWJ A;  3VXB A;  3GZG A;  5TPA A;  4F39 A;  4N91 A;  2ABH A;  1HSJ A;  4P11 A;  4NF5 A;  3C36 A;  1DBZ A;  1P99 A;  4QBA A;  2P2A A;  2QVR A;  4KXP A;  1JNF A;  4RA1 A;  1NUY A;  1S50 A;  3OO8 A;  1MG1 A;  3N6T A;  1KWH A;  4G4P A;  3PGF A;  4ZS9 A;  3KEI A;  3K02 A;  1TFA A;  1D9Y A;  1USY E;  1NNP A;  5AA2 D;  1O64 A;  5K2Y A;  4MLV A;  3PPP A;  1TXF A;  2YJP A;  2VD3 A;  2DE4 A;  3FV2 A;  4OVS A;  4AS4 A;  4GWZ A;  4KYE A;  4OVR A;  3LUY A;  1S9T A;  5EYF A;  1K9Y A;  5I57 A;  1OLA A;  2QFL A;  5CBR A;  1MXY A;  4PE5 B;  2I6E A;  1TFD A;  4WED A;  1MY3 A;  3BKI B;  3TDJ A;  1NV1 A;  4HTG A;  5FHN A;  4BDQ A;  1N7X A;  2HPG A;  5EQ8 A;  1ZJL A;  3T9V A;  1MQD A;  4POX A;  2OWT A;  2E1S A;  3P7I A;  4LON B;  4EQ7 A;  3HHF A;  5A5X A;  4DXC A;  2A5S A;  4OVJ A;  5L9S A;  3ILU B;  1LST A;  4ELR A;  4FED A;  3FTO A;  1ELJ A;  1YZ0 A;  5H8F A;  2XXP A;  1UIU A;  4GXA A;  1B05 A;  4KCC A;  4DI4 B;  2UYE A;  2O68 A;  2Q2A A;  1POY 1;  3FXR A;  2CZK A;  3ISP A;  4DXU A;  2GHA A;  1IXI A;  4OQO A;  3G3I A;  1LBB A;  1JW5 A;  5ESY A;  4ZEI A;  1SVX B;  5CBS A;  4I62 A;  3O6I A;  3RUM A;  2P3V A;  1B0H A;  4BDN A;  1FQB A;  2QPQ A;  1JVX A;  1QUL A;  1SYI A;  4ZDM A;  3ZSF A;  4ESW A;  4JWY A;  3OD7 A;  5DVJ A;  1QKA A;  4QHQ A;  3H3G A;  4U21 A;  4ECF A;  2ZMB A;  4G8H A;  3MYU A;  2V3T A;  1OVT A;  4OEV A;  4G68 A;  4G68 C;  1NI9 A;  4ESX A;  4X48 A;  5J16 A;  4KQP A;  2UVJ A;  1QVS A;  3M3L A;  1JW4 A;  1GV8 A;  2O51 A;  4HXV A;  3K1M A;  3KJT A;  1FPD A;  2W7Y A;  2V84 A;  1WVJ A;  3MPL A;  4I40 A;  2KLF A;  2D21 A;  4GL8 A;  1MY1 A;  1LAF E;  2Q89 A;  1LLS A;  2UVH A;  3TCH A;  4YMA A;  3QSL A;  3EQ1 A;  4LQ2 A;  2HCA A;  4N6P A;  2DVZ A;  5EQA A;  2F3D A;  3UN6 A;  4RY1 A;  1SI0 A;  3SEU A;  4NF8 A;  2ZZV A;  3UGW A;  4F3S A;  2HQ0 A;  3G3J A;  2QMX A;  2VP1 A;  1CB6 A;  1NFT A;  3K4U A;  2PYY A;  2F7A A;  1LFG A;  2VT5 A;  5L9M A;  2WX9 A;  1DSN A;  1JEV A;  1FJ9 A;  4PFB A;  4NQ8 A;  4EQ9 A;  1UQW A;  3WAF A;  4MNI A;  3SEV A;  4NTL A;  1PB8 A;  3CIJ A;  3IO6 A;  3RYA A;  5LDZ A;  3IR1 A;  4RPN A;  3RN8 A;  1FBP A;  1FBH A;  1B1X A;  5AA1 A;  3IB2 A;  2QMW A;  4F3G A;  2Q74 A;  2F78 A;  3IOW A;  4OVT A;  4FJP A;  1BP5 A;  2F35 A;  4IO3 A;  3S9L C;  4QFK A;  2X26 A;  2ZYO A;  3G3G A;  2Y7K A;  2Y5L A;  4OVQ A;  4JXI A;  3TOD A;  5ICT A;  1B2H A;  3CG3 A;  3MBP A;  4AS5 A;  5EQ9 A;  1NMU A; 
#chains in the Genus database with same CATH homology
 1B6H A;  4QFL A;  1H76 A;  3K00 A;  3PD8 A;  5HBC A;  1AOV A;  3DRF A;  2X7P A;  2HAU A;  4DLD A;  1A8E A;  2PX1 A;  3V89 B;  1BKA A;  3M3F A;  4F22 A;  4N13 A;  3T93 B;  4Z0I A;  2R9J A;  3D4C A;  3PUY E;  1B3L A;  3BFT A;  4GIZ A;  4PFW A;  3RTW B;  4P0I A;  4FEB A;  4HCY A;  3PPN A;  4BDM A;  2XXT A;  3EPE A;  4X9T A;  3V8X B;  3TCG A;  3IL1 B;  3MUQ A;  2HAV A;  2Q2C A;  1P1N A;  1B46 A;  3SEY A;  2G29 A;  2IEE A;  5FTH A;  1LAG E;  4OHN A;  3IOT A;  3OO7 A;  1M5F A;  1GR2 A;  4Z7E A;  1LFH A;  3IOU A;  1MPC A;  1M5B A;  4YAH X;  2XX8 A;  5F1Q A;  1MXX A;  4H65 A;  4U4S A;  3TYH A;  5KZT A;  3U8Q A;  2BJJ X;  1QUI A;  4IY6 A;  1EU8 A;  4GD5 A;  1FCK A;  3TEP A;  1ANF A;  1B0L A;  2XXR A;  3SER A;  1Q1K A;  2QS3 A;  3CSB A;  2F6P A;  1M5D A;  3R26 A;  4NF5 B;  1DPE A;  4QSE A;  2RCB A;  4O3C A;  5EHM A;  1EZP A;  1XT8 A;  4GVO A;  3FAT A;  3DP4 A;  1XHY A;  2DXY A;  1MH4 A;  4MF3 A;  1GVC A;  2VD2 A;  1A40 A;  1FQE A;  1NNT A;  2RC9 A;  3K1P A;  4ND9 A;  3N94 A;  4HS7 A;  2THI A;  1FQD A;  1FTJ A;  4TLL B;  3DM0 A;  4R9G A;  1MY0 A;  1ZBM A;  4MH5 A;  4MFI A;  5AE4 A;  4UAC A;  1IUD A;  3FZV A;  3ODB A;  4NF6 B;  3LR1 A;  4KR5 A;  3HO7 A;  3MPK A;  2YPN A;  5DT6 A;  4I1D A;  2DYX A;  5TP9 B;  1OQH A;  2Q9T A;  4C1T A;  2RC7 A;  1H43 A;  5KCJ B;  5DTB A;  4KD5 A;  2DE2 A;  3DP6 A;  1LGB C;  3VFJ A;  2UVG A;  3SES A;  2OLB A;  3VVF A;  5A5X B;  2OJT A;  5H8N B;  4OWD A;  2XD3 A;  3TQL A;  5CMC A;  1Y9U A;  1B1H A;  1FW0 A;  4OMB A;  2V3U A;  2Y7I A;  4RJZ A;  3T66 A;  1MM6 A;  2DSF A;  3CFX A;  3CHG A;  4F29 A;  4QSD A;  3FUZ A;  2E0S A;  2I0B A;  3SEX A;  3TZA A;  1MY4 A;  3OEN A;  3O29 A;  2OZZ A;  1ZIU A;  2OBG A;  4DZ1 A;  3K1N A;  3M8U A;  3U93 A;  1FTO A;  3OOA A;  4EF1 A;  3B6T A;  2Y7W A;  1MDQ A;  4KPT A;  3DRH A;  1RKM A;  4OTE A;  2VOZ A;  4R2F A;  2ANJ A;  1O63 A;  5I59 B;  2AL4 A;  2Y7P A;  1YTV A;  3QUJ A;  1P1W A;  3C4M A;  3FVK A;  4FAJ A;  2UXA A;  4XTC Q;  1Y4T A;  2LAO A;  3CVG A;  1I6B A;  3PUZ E;  3HN0 A;  1H3D A;  3O6P A;  3IX1 A;  3MVX A;  2PMS A;  3PUW E;  2B3B A;  1D3K A;  1A8F A;  4TLM B;  1YPN A;  2H98 A;  4HW8 A;  3QAX A;  5DEX B;  5ITP A;  2QSX A;  1N84 A;  5CMB A;  3LSF B;  5BWJ A;  4POW A;  4PET A;  1B9J A;  3Q27 A;  4NF8 B;  3U1O A;  4QFN A;  1ZMG A;  4X1D A;  2FA7 A;  3MWB A;  1FQA A;  2ONK E;  2NOO A;  2DP8 A;  3T96 B;  3LSX A;  4JWX A;  1ZLQ A;  5FHO A;  4DIG A;  2ALU A;  2V93 A;  1BLF A;  2O1L A;  4NF4 B;  3KFM A;  1NNK A;  3FVG A;  3M3K A;  5ITO A;  3MQ9 A;  4AQ4 A;  3C34 A;  1FTM A;  1FTL A;  1RYX A;  4NF6 A;  3MZ1 A;  4G8M A;  3WAE A;  4QFP A;  4PFU A;  5TP9 A;  4ELP A;  4OEU A;  5BUU A;  3IOV A;  5KCJ A;  1XOC A;  2ZYN A;  3HCQ A;  3MP1 A;  3KJ7 A;  4JSO A;  4MLQ A;  1II5 A;  5H8N A;  3KN3 A;  5L8D A;  3VVD A;  4Q30 B;  4FAT A;  4GLI A;  3QUF A;  3L6H A;  4R72 A;  1OQG A;  1ZKB A;  2IA4 A;  1N7W A;  2PT1 A;  4LZ8 A;  1IXH A;  1D4N A;  1Y1M A;  3EHU A;  2F36 A;  5TU0 A;  2ZXT A;  3GBA A;  4YKI A;  4JSD A;  4XKR A;  1MRP A;  3UK4 A;  4JBZ A;  4KI0 E;  3UA8 A;  3DRI A;  1BTJ A;  3CFZ A;  1OVB A;  3LSW A;  5I59 A;  1POT A;  2H99 A;  1MXW A;  3UIF A;  4DXB A;  1MY2 A;  1I6A A;  1R9L A;  4PFY A;  4U23 A;  1MQG A;  4R75 A;  4DDD A;  1HSL A;  2DE3 A;  3A3C A;  3TAJ A;  3TKD A;  4YKP A;  4DCY A;  1SW2 A;  1NH8 A;  3K6X A;  4NE4 A;  1A55 A;  2F6G A;  2HFB A;  2Z8F A;  4GXS B;  4EDP A;  1PBP A;  1UTB A;  5KDT A;  1NKX A;  3CRB A;  3VE1 B;  2P1S A;  3QYT A;  5DEX A;  3A3U A;  3L6G A;  1SYH A;  1VFD A;  1B7H A;  2F5X A;  3G7W A;  4LZ5 A;  5I2N B;  1WDN A;  1URG A;  2O7U A;  2WOK A;  2Y84 A;  3FAS A;  1T0K A;  3TUS A;  3T22 A;  4H0W A;  2XX7 A;  3O6G A;  3OSQ A;  2ZNU A;  3H4Z A;  1M5C A;  4NF4 A;  4R6H A;  2GFE A;  1PB7 A;  4NWC A;  2D5W A;  2ZNT A;  3V5A A;  4LAT A;  4WEP A;  2XXU A;  2PBW A;  2HXW A;  2Z23 A;  3QIM A;  4GWO A;  2CZL A;  2QS2 A;  2PVU A;  2P0S A;  3PPR A;  2RIN A;  2Z8D A;  4R2B A;  3O66 A;  2I3W A;  3PUV E;  4WXJ A;  3AXF A;  1F9B A;  1ZTY A;  3G3F A;  2B4L A;  1JVY A;  4E0W A;  2I4C A;  2XXX A;  2VGQ A;  4F3B A;  4UA8 A;  1EH3 A;  2H4I A;  3H6W A;  3K2D A;  1FTK A;  1HSE A;  2PT2 A;  2XXW A;  2DS9 A;  1EZO A;  4R6Y A;  2VHA A;  3ZKK A;  4XIG Q;  5JEI A;  1LAX A;  3PD9 A;  3USD A;  3UOR A;  3RLF E;  3I3V A;  2WOL A;  4OES A;  4THI A;  3T9U A;  2WKY A;  3C31 A;  3FJM A;  4BDR A;  4P0G A;  4RNS A;  3FXQ A;  3BBR A;  3D4G A;  2H9B A;  3A09 A;  3TQW A;  3O6H A;  2XXY A;  3IK6 B;  5F7V A;  4AB6 A;  4YKK A;  3DRJ A;  4ZEK A;  2O1M A;  1B52 A;  1IIW A;  3JV9 A;  4EXL A;  2UYF A;  3FIR A;  1SW1 A;  1RYO A;  2F8D A;  4F31 B;  5AA4 A;  3F11 A;  2DWJ A;  4ZEC A;  3HPI A;  3MW0 A;  4H8I A;  3VLU A;  1LB9 A;  4H5G A;  1Y3N A;  2ESN A;  1USY H;  5I2N A;  1I69 A;  3OEM A;  4AB5 A;  1LCF A;  4F18 A;  1MS7 A;  1N0T A;  1B3H A;  3TMG A;  1B58 A;  3N26 A;  2DQV A;  3FV1 A;  3RY3 A;  3MZB A;  2QS4 A;  4QF9 A;  4IB2 A;  4YB6 A;  3C33 A;  5LOM A;  4ELQ A;  1Y4C A;  3S9N C;  3ONM A;  4U2R A;  3PAM A;  5ICQ A;  1OLC A;  4EQB A;  3JZJ A;  3OXN A;  2HEU A;  1GTK A;  3G3H A;  4PQJ A;  3VXC A;  3EHT A;  4O3B A;  2CMO A;  4YB7 A;  3MVY A;  4I9D A;  1IIT A;  3BFU A;  4IO4 A;  4KYS A;  4GFR A;  1SBP A;  3G3K A;  4G77 A;  1MPB A;  4NED A;  3O9P A;  1N04 A;  4YU0 A;  3MVW A;  1A54 A;  1LFI A;  3IJO B;  4QSC A;  4I8C A;  1TT1 A;  3KSX A;  4OZ9 A;  2DWA A;  1Y3Q A;  1NH7 A;  3K01 A;  5I84 A;  2H5Y A;  3KN7 A;  4ZE9 A;  3V83 A;  3CSG A;  4KHZ E;  3RPW A;  4IO6 A;  4F2O A;  2I0C A;  1JET A;  3PUX E;  5K2X A;  2REG A;  3SET A;  5H8H B;  4RPO A;  3ZS6 A;  2NUV A;  4YIC A;  3MAM A;  4JWO A;  3OO6 A;  4F2Q A;  5HM4 B;  1LB8 A;  3IB0 A;  4ZE8 A;  1VSO A;  3MZ9 A;  3H7M A;  3GBB A;  5I58 B;  3TTR A;  3N6U A;  2O69 A;  1L5T A;  1GGG A;  1B5I A;  1DTG A;  4L17 A;  1IXG A;  1LBC A;  1LAH E;  3RQT A;  2AYS A;  4OXV A;  2DWH A;  2O7I A;  4OEN A;  4XKN A;  1UTB B;  5KDT B;  3O28 A;  5HPQ A;  1QUK A;  1CE2 A;  1PEB A;  3K6V A;  4H1X A;  4F1U A;  3PMX A;  5CRY A;  3CFL A;  3W9V A;  4TQU Q;  3KOT A;  4IGT A;  3S2V A;  3PPQ A;  4ZEB A;  1DTZ A;  3LVU A;  3E3K A;  3TCF A;  4GF8 A;  1WOD A;  5J1D A;  2ZYK A;  3H6V A;  2I4B A;  2DVC A;  4U4X A;  4LA9 A;  4LVQ A;  4PP0 A;  3SKP A;  4C1U A;  1B32 A;  4U1O A;  3OEL A;  1R6Z A;  3T9H B;  4HCW A;  3PPO A;  3FJ7 A;  2XD2 A;  1M5E A;  4OET A;  2FYI A;  4BDO A;  4X1B A;  1VR5 A;  2F7C A;  4RK2 A;  3C35 A;  3HHG A;  3RGY A;  1VFE A;  1PBQ A;  5H8S A;  1MQJ A;  3I6V A;  4F1Y A;  4O3A A;  2F34 A;  4IO2 A;  4YKJ A;  3FXU A;  3B6W A;  3H6U A;  4ZZA A;  3LC8 A;  1ZU0 A;  4ZED A;  1A99 A;  1SI1 A;  2V3Q A;  1XC1 A;  3W9W A;  1Y20 A;  2Y7R A;  2D3I A;  3RNN A;  5AA3 A;  1MPD A;  3CI8 A;  3O97 A;  2F97 A;  4K3F A;  4LP2 B;  4U1Z A;  1B40 A;  1SDX A;  3O2A A;  4YMB A;  3DRK A;  4F1V A;  3TTL A;  2DOJ A;  5H8H A;  2AL5 A;  1IEJ A;  1PDA A;  3K6U A;  4EUO A;  2HZL A;  3E4R A;  1I6Q A;  1UTH B;  5I2K A;  4QFO A;  3H06 B;  5B70 A;  1AH5 A;  1H45 A;  3OMB A;  3S9E A;  3MC2 A;  1DPP A;  2B65 A;  5FHM A;  2RC8 A;  3Q26 A;  2ZYM A;  1MQH A;  5I58 A;  4IGR A;  2REJ A;  2B4M A;  4H8J A;  3LSL A;  2GH9 A;  1VE4 A;  4GOT A;  1MQI A;  1IQ7 A;  3R7X A;  4OER A;  4PFT A;  4BDL A;  3DP8 A;  2OK2 A;  4KCD A;  1B3G A;  5M2V A;  2NXO A;  3DRG A;  1Y1Z A;  2QRY A;  4Q8R A;  4FOR A;  3MJN A;  1SW4 A;  2M8C A;  1JQF A;  3U94 A;  4ELO A;  4MBP A;  2Q88 A;  2ONR A;  3N5L A;  4GQO A;  3TTK A;  5AA4 B;  4ONY A;  1AMF A;  1QW0 A;  1US5 A;  2AIX A;  1MXU A;  3Q28 A;  4R74 A;  1Y3P A;  1O7T A;  3FGS A;  4OYV A;  5JTY A;  3OSR A;  1R1N A;  3RT6 B;  2R6G E;  5FTI A;  1R9Q A;  4F3P A;  4ISU A;  2NVU B;  2XHD A;  1QKB A;  1H44 A;  3VLW A;  4R9F A;  3PMW A;  5ELV A;  5IAI A;  3FJG A;  4G2Z A;  4ZZE A;  2I48 A;  3U72 A;  3VDF A;  3RT8 A;  2Z8E A;  4M1V A;  4ZEF A;  5AA2 B;  1DOT A;  2HZK A;  5H8Q B;  3TTM A;  1N3W A;  2DWI A;  1US4 A;  3IJX B;  4H6D A;  3RYB A;  2ONS A;  2XXQ A;  4DCX A;  2XXV A;  4BLA A;  3THI A;  1Q35 A;  3EF7 A;  2O84 X;  4XKP A;  3HST A;  4QRZ A;  4OFL A;  1D9V A;  3PMV A;  2B3F A;  5CM6 A;  1J1N A;  4FE8 A;  2YLN A;  1UIV A;  4NMY A;  4YZZ A;  3S4U A;  4LUB A;  3K0V A;  3I5O A;  2WOP A;  1B4Z A;  2OCU A;  4DE8 A;  3IO4 A;  4JDF A;  1N76 A;  1SQY A;  3KGC A;  2Z22 A;  2O6A A;  1UTH A;  2R71 A;  3QK6 A;  5DVF A;  3OEK A;  1B51 A;  3UP9 A;  3ILT B;  2I3V A;  1B5H A;  3TEL A;  3E13 X;  3H6T A;  3TFL A;  3GLB A;  3K6W A;  3C32 A;  1FQF A;  3SDF A;  3FD3 A;  1B7U A;  3FVO A;  3PU5 A;  5DVI A;  5EHS A;  4M4G A;  2G93 A;  4H5F A;  1FQC A;  1OMP A;  3U92 A;  1PC3 A;  1P1Q A;  4RK9 A;  4C0R A;  5I56 B;  3QXM A;  2GRV A;  3B6Q A;  5IKB A;  1MM7 A;  4IY5 A;  3GXA A;  2GHB A;  3IAZ A;  3MP8 A;  2I49 A;  4H67 A;  1B4H A;  3KSJ A;  3VV5 A;  4KYD A;  5DYH A;  2FNC A;  2A5T B;  4KFQ A;  4FIM A;  5ISU A;  4OFO A;  1B3E A;  1YAE A;  3Q25 A;  1YCJ A;  3TPA A;  4Q0C A;  1TWY A;  3KG2 A;  1NL5 A;  4R6K A;  3SEW A;  4JB7 A;  2DXR A;  1XVX A;  3Q29 A;  4RYA A;  4G8N A;  4NWD A;  4IO5 A;  3DEL B;  3CR9 A;  1XS5 A;  4GRK A;  3TTN A;  1Z7M E;  3CG1 A;  1MXZ A;  5TPA B;  2Q8J A;  2ZNS A;  3JYR A;  3FVN A;  4OFJ A;  1MH3 A;  2XX9 A;  5AA2 A;  5CMK A;  4XKQ A;  5H8Q A;  5B7D A;  4XXU A;  1NNF A;  1P1U A;  3EHS A;  3DLN A;  4LZ7 A;  1IZ1 A;  2F7B A;  1AIV A;  3IB1 A;  1URD A;  4R73 A;  3T9X B;  1B5J A;  3OO9 A;  5CI5 A;  3PV0 E;  3KBR A;  5I57 B;  4E0X A;  4LQ5 A;  1IXC A;  4Q5T A;  1A7L A;  5CMM A;  2QL3 A;  3S9M C;  1PB9 A;  3RTF B;  1URS A;  4WKM A;  4RXL A;  2QS1 A;  3KN8 A;  1P1O A;  1S7Y A;  5H8F B;  3ZKL A;  5CC2 A;  5I2K B;  2RKM A;  1MXV A;  1JW1 A;  3VVE A;  1B3F A;  1ATG A;  4FEC A;  3B7D A;  2H25 A;  2XXI A;  3H03 A;  2XXH A;  4EF2 A;  4GL0 A;  1BIY A;  2X7Q A;  3KOS A;  1MDP 1;  2QJE A;  1SW5 A;  1EZ9 A;  1Z7N E;  3EN3 A;  4IO7 A;  1LCT A;  3ECR A;  3R6U A;  1N3X A;  3E9X A;  3LBS A;  1AL3 A;  5I56 A;  1B7Z A;  1XVY A;  5JK4 A;  1OIB A;  2I58 A;  1JEU A;  3W15 C;  2V25 A;  1QJM A;  4YB5 A;  2OWS A;  4G68 B;  1QUJ A;  4TOZ A;  2A5T A;  3C9H A;  1DMB A;  3VLV A;  3MP6 A;  4N07 A;  2RF1 A;  5L9O A;  3MVZ A;  3IOR A;  4U22 A;  3KZG A;  3HV1 A;  1SD3 A;  2RCA A;  5JTY B;  4F19 A;  4EXK A;  2UVI A;  2NWJ A;  3VXB A;  3GZG A;  5TPA A;  4F39 A;  2ABH A;  1HSJ A;  4P11 A;  4NF5 A;  3C36 A;  1P99 A;  2P2A A;  1JNF A;  4RA1 A;  1S50 A;  3OO8 A;  1MG1 A;  3N6T A;  1KWH A;  4G4P A;  3PGF A;  4ZS9 A;  3KEI A;  3K02 A;  1TFA A;  1D9Y A;  1USY E;  1NNP A;  5AA2 D;  1O64 A;  5K2Y A;  4MLV A;  3PPP A;  1TXF A;  2YJP A;  2VD3 A;  2DE4 A;  3FV2 A;  4KYE A;  3LUY A;  1S9T A;  5EYF A;  5I57 A;  1OLA A;  5CBR A;  1MXY A;  4PE5 B;  2I6E A;  1TFD A;  4WED A;  1MY3 A;  3BKI B;  3TDJ A;  4HTG A;  5FHN A;  4BDQ A;  1N7X A;  1ZJL A;  3T9V A;  1MQD A;  4POX A;  2OWT A;  2E1S A;  3P7I A;  4LON B;  4EQ7 A;  3HHF A;  5A5X A;  4DXC A;  2A5S A;  4OVJ A;  5L9S A;  3ILU B;  1LST A;  4ELR A;  4FED A;  3FTO A;  1ELJ A;  5H8F A;  2XXP A;  1UIU A;  4GXA A;  1B05 A;  4KCC A;  2UYE A;  2O68 A;  2Q2A A;  1POY 1;  3FXR A;  4DXU A;  2GHA A;  1IXI A;  4OQO A;  3G3I A;  1LBB A;  1JW5 A;  4ZEI A;  1SVX B;  5CBS A;  4I62 A;  3O6I A;  3RUM A;  1B0H A;  4BDN A;  1FQB A;  2QPQ A;  1JVX A;  1QUL A;  1SYI A;  4ZDM A;  3ZSF A;  4ESW A;  4JWY A;  3OD7 A;  5DVJ A;  1QKA A;  4QHQ A;  3H3G A;  4U21 A;  4ECF A;  2ZMB A;  4G8H A;  2V3T A;  1OVT A;  4OEV A;  4G68 A;  4G68 C;  4ESX A;  4X48 A;  4KQP A;  2UVJ A;  1QVS A;  3M3L A;  1JW4 A;  1GV8 A;  2O51 A;  3K1M A;  3KJT A;  2W7Y A;  2V84 A;  1WVJ A;  3MPL A;  2KLF A;  2D21 A;  4GL8 A;  1MY1 A;  1LAF E;  2Q89 A;  1LLS A;  2UVH A;  3TCH A;  4YMA A;  3QSL A;  3EQ1 A;  4LQ2 A;  2HCA A;  4N6P A;  2DVZ A;  3UN6 A;  4RY1 A;  1SI0 A;  3SEU A;  4NF8 A;  3UGW A;  4F3S A;  2HQ0 A;  3G3J A;  2QMX A;  2VP1 A;  1CB6 A;  1NFT A;  3K4U A;  2PYY A;  2F7A A;  1LFG A;  5L9M A;  1DSN A;  1JEV A;  4EQ9 A;  1UQW A;  3WAF A;  3SEV A;  4NTL A;  1PB8 A;  3CIJ A;  3IO6 A;  3RYA A;  3IR1 A;  4RPN A;  3RN8 A;  1B1X A;  5AA1 A;  3IB2 A;  2QMW A;  4F3G A;  2F78 A;  3IOW A;  4FJP A;  1BP5 A;  2F35 A;  4IO3 A;  3S9L C;  4QFK A;  2X26 A;  2ZYO A;  3G3G A;  2Y7K A;  4JXI A;  3TOD A;  5ICT A;  1B2H A;  3CG3 A;  3MBP A;  1NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...