1QKAA

Oligo-peptide binding protein (oppa) complexed with krk
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and Calorimetric Analysis of Peptide Binding to Oppa Protein
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Protein transport
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
total genus 189
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1qkaA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qkaA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1qkaA02
4OXVA 4QFOA 1PB9A 3L6HA 4OTEA 2DE3A 2E1SA 2QS4A 3G3GA 4KPTA 1GV8A 1P1QA 3RTFB 1MQDA 4LZ7A 4K3FA 3HHGA 1GR2A 1B7ZA 3CFZA 4IO5A 3KN3A 2B4LA 4RPNA 4YB7A 3S9EA 1SI0A 2RC7A 4HCWA 3EN3A 3TQWA 4OYVA 1LFGA 3VVFA 4IO6A 2Z8DA 3CVGA 3CR9A 1I6AA 2Q9TA 4QF9A 3O9PA 5KDTA 1LFHA 1IXHA 3LR1A 1ZLQA 4TQUQ 3AXFA 2GFEA 4ESWA 2F7AA 1TT1A 1LAGE 3TUSA 1JW4A 2F34A 2Q2CA 2VOZA 4NF8A 3T96B 1OLAA 3OSQA 1D9VA 1NL5A 3IO4A 3DRKA 1WVJA 1WODA 1UTBA 4G77A 4TLLB 5AA2D 1B58A 3C9HA 3ILTB 1JW5A 1N04A 1USYH 5ICQA 2Z8EA 3JYRA 1J1NA 3M3KA 3N5LA 4L17A 1M5CA 2QL3A 3K6VA 2Q89A 5FHMA 2E0SA 3LVUA 2V3QA 3HN0A 3TTMA 1OLCA 3JV9A 2ONKE 5DT6A 4AQ4A 4IY5A 4QRZA 1O7TA 4X1BA 3C36A 2Y7WA 2XHDA 3K6WA 4X9TA 3K1MA 3IORA 1Y4CA 2OK2A 3PU5A 5AA1A 5CBRA 4Z0IA 5AA2B 3G3HA 4I1DA 3THIA 5BUUA 2X7QA 3TCGA 1B46A 4YAHX 4JBZA 1Y3PA 2AL4A 1MQGA 4GRKA 3U93A 3S9LC 3LSXA 1EZPA 3TTRA 1MDP1 1H76A 1H43A 4PE5B 5A5XA 4OEVA 4R75A 4R6KA 5CRYA 1L5TA 3RN8A 3S2VA 4PFTA 2B65A 2W7YA 3ONMA 1PBQA 2VGQA 4OHNA 4DCYA 3KJ7A 4QSCA 4HTGA 4XTCQ 4EDPA 2F7CA 1Q1KA 3K1NA 2QJEA 1B52A 1FQBA 4LP2B 3RT8A 3KZGA 3VXBA 4C1TA 2OLBA 4QSDA 4TLMB 2QS3A 3OO6A 2UVIA 4NF4A 3VFJA 4DE8A 1D4NA 1OIBA 1B7UA 4OERA 3LUYA 3ODBA 1DSNA 2O6AA 4M1VA 4EF1A 1POTA 4KFQA 4RXLA 1R9QA 3MPKA 1P99A 2Q88A 5DVIA 3FXUA 1P1UA 3PV0E 1DPPA 3K6XA 4LVQA 2DXYA 3FXRA 5I84A 5CM6A 4U1OA 4G8MA 4FEBA 3CSBA 2HEUA 4Q8RA 2Y7PA 2I4CA 4ELQA 5B7DA 5I59B 5DVJA 1A8EA 2O7UA 3MUQA 3UGWA 4F3SA 1IUDA 4H5FA 1FQCA 4YKPA 5DEXA 3QAXA 1YPNA 2XD3A 3OD7A 1N0TA 1Y9UA 2ESNA 4F3GA 5CMKA 3FJ7A 4GXSB 4IO2A 4NWDA 2ZMBA 5I58A 3M8UA 4NF8B 1XC1A 3IB0A 3IAZA 4OFLA 3FTOA 4AB6A 4PFWA 3VLUA 3PGFA 1P1OA 3FZVA 3T93B 4MLQA 1O64A 1MQIA 2P1SA 3CSGA 2PT2A 3B7DA 1N3WA 2X26A 5AE4A 4FIMA 4H1XA 4GQOA 4ZECA 2GRVA 4OQOA 1N7XA 1VE4A 3TFLA 4WKMA 3MZ1A 1FTOA 5FTHA 4KCCA 3OMBA 1AOVA 5I56B 5IKBA 2Q8JA 1JVYA 3PMVA 4DLDA 1B6HA 3UORA 1M5EA 3VV5A 3T9HB 2QS2A 2O1MA 2QPQA 2DWJA 2XXQA 1GVCA 2OCUA 2UYEA 3IOVA 3K02A 3PUVE 1OQGA 2O68A 3TZAA 1R1NA 1QUKA 1EZ9A 3G3KA 1B32A 4I8CA 1FQFA 4KYEA 4GF8A 4F1UA 4O3BA 1UIUA 1MRPA 2RF1A 5TPAA 4KYSA 2I3VA 1B4HA 1LAHE 2F35A 2Q2AA 4F3BA 3EF7A 4GWOA 1MXVA 4H0WA 2RC9A 1H45A 3PUWE 4I9DA 3Q25A 1A54A 4ZEDA 2V3TA 4MH5A 3SDFA 4OFJA 1Y1MA 3K00A 3M3FA 4XKQA 3WAFA 1BIYA 1OVTA 2M8CA 1MY3A 3PUYE 4OWDA 4BDNA 4GFRA 1B4ZA 4ZZAA 4R6HA 1URSA 5B70A 3PUZE 2NXOA 4ELPA 1MS7A 5FHNA 1MDQA 5KCJA 3G3JA 3IOWA 3CFXA 5HBCA 5TU0A 4G68A 3SERA 1I6QA 1MXXA 1F9BA 1B51A 1LB8A 2H4IA 1B3GA 3N26A 3OSRA 3RYAA 4OENA 1P1WA 3SETA 4ZS9A 2PBWA 3CHGA 4PFUA 5TP9A 4EUOA 2RINA 1YAEA 1USYE 5JK4A 1MY4A 4NTLA 2XXVA 4QSEA 2R9JA 3RYBA 1R6ZA 2ZNSA 3R6UA 4H65A 1UQWA 5CI5A 3SEYA 5AA2A 3LBSA 3ZS6A 4GVOA 4H8JA 4FATA 3MJNA 5KDTB 1IXIA 2RCAA 1SW5A 2DWHA 2FA7A 4IGRA 3UN6A 2PMSA 3FV1A 3FJMA 4OESA 2Z8FA 4HCYA 2NVUB 4ISUA 1P1NA 5EYFA 4THIA 2WOPA 1RYOA 4GIZA 4NMYA 3RNNA 3W9WA 1A55A 2XXIA 3H6VA 4R73A 2A5SA 2ALUA 3KN7A 3TTNA 3VLWA 3HO7A 2O1LA 4ND9A 1MY2A 2RC8A 4NF6B 1RKMA 3KSJA 4PETA 1XS5A 4U2RA 2IEEA 3EQ1A 3QUFA 4FECA 4C0RA 3IK6B 2I49A 5ICTA 5I2KA 4UA8A 3UA8A 1FTMA 3CIJA 4G68B 2CZLA 3LSLA 4FE8A 1MM7A 2VD2A 5L9SA 5F1QA 1FQDA 1HSJA 1PDAA 3KOTA 3MP1A 2XXYA 3GZGA 1B5JA 4JWXA 4IO7A 1EH3A 2KLFA 3I5OA 3DRHA 4ZEKA 1Y3NA 3GBBA 1SW2A 3E9XA 1QKAA 2HAVA 3H06B 4G2ZA 3LSFB 4KR5A 2XXUA 4YKKA 3FIRA 4U23A 3F11A 2BJJX 4XXUA 4R2BA 3IO6A 2DE4A 1URGA 5DYHA 1UIVA 4QFLA 2A5TA 4IY6A 4QHQA 4F2QA 1IZ1A 1IXCA 4BDQA 1IIWA 2DS9A 4BDLA 4I62A 2WOKA 1MY1A 4IO4A 3ZKLA 5K2XA 2O51A 3ZKKA 1ZKBA 2DP8A 2YLNA 2HCAA 3TPAA 1VR5A 1MY0A 3PPRA 4LZ8A 4IB2A 5FHOA 4POWA 3TTKA 1M5DA 2CMOA 4DXUA 1T0KA 1BKAA 4R74A 3V83A 4NF5A 1B2HA 2G29A 1OQHA 3DP4A 3C31A 3MBPA 1B5HA 4YB6A 2PT1A 1A7LA 3K0VA 3Q26A 3OO8A 4U22A 3MAMA 3I6VA 5EHMA 5HM4B 3KN8A 5H8FB 2HFBA 1S9TA 3TQLA 4DIGA 3CFLA 1VSOA 1PC3A 3MPLA 1II5A 3D4CA 2I58A 1DMBA 2V25A 3GLBA 1B1HA 3S9NC 4R72A 2GHAA 2ZYNA 4F1YA 1SW4A 1NH8A 4FEDA 4IGTA 3FUZA 3OXNA 2DOJA 3T9VA 3E13X 2Z23A 3TODA 4OFOA 4TOZA 3K1PA 3W15C 4F39A 1QKBA 3Q28A 4FORA 3PMWA 3USDA 4U1ZA 3HV1A 5ISUA 3RQTA 4GL8A 4RPOA 1IQ7A 1MXWA 4Z7EA 3DP8A 3B6TA 3R7XA 4KD5A 3U72A 1HSEA 5HPQA 3FVOA 1JNFA 4H6DA 4LZ5A 4NE4A 1OVBA 3IB2A 3O2AA 2XXXA 3OO7A 4JWYA 3K4UA 4E0WA 4JSDA 1YCJA 4F3PA 3MW0A 4NF6A 2QS1A 4YKJA 3V89B 1RYXA 3H6WA 3M3LA 5I2NA 3SEUA 1QUJA 1SI1A 4NF5B 3GBAA 3K6UA 3OENA 3TCFA 4RK2A 3UP9A 1SQYA 3H03A 4RJZA 3MVYA 1JW1A 1QVSA 1QW0A 3IOUA 3PMXA 4MBPA 4OMBA 1IEJA 1JVXA 3EHSA 4P0GA 1NMUA 3EPEA 4U4XA 3FV2A 4Q0CA 2DXRA 4ZE8A 1XT8A 1B9JA 4RYAA 5LOMA 4YICA 4ZDMA 3DELB 3A3UA 1B3HA 1DPEA 4WEDA 2NOOA 5H8HA 5K2YA 1Z7ME 1OMPA 2UXAA 3PPPA 1HSLA 4MFIA 2V84A 1JETA 1S50A 2ONRA 2DE2A 3RUMA 2O69A 4GXAA 1QUIA 4O3AA 1YTVA 2DVCA 4RA1A 5AA4A 3EHUA 2D21A 1ZIUA 1DTZA 2ZYKA 4DDDA 2B4MA 5F7VA 3TDJA 3UK4A 3PD8A 3T22A 3FATA 3TEPA 1TFDA 3C34A 5ITOA 4YKIA 2HZKA 3U1OA 5KCJB 3VLVA 2NUVA 2DWAA 1A99A 3TAJA 3FJGA 3O6HA 1BTJA 3C35A 3FVNA 3IL1B 2R6GE 4MF3A 5DVFA 2F7BA 4C1UA 2F36A 2FNCA 4KHZE 5I57A 4BDRA 4O3CA 1NFTA 3MVZA 3C4MA 4XKPA 1GGGA 3RT6B 2P0SA 3TMGA 1XHYA 2ZYMA 4GD5A 3MC2A 4GOTA 1SBPA 1FQAA 4FAJA 3MZBA 1FQEA 1SW1A 1ZJLA 3G3IA 4GL0A 1XVYA 3FVGA 4LQ5A 2RCBA 3H7MA 3ILUB 1BLFA 2Y7RA 3TCHA 3E3KA 2RKMA 1MPBA 4N13A 4R6YA 2ONSA 1MXZA 2UVJA 2F6PA 5FTIA 4F19A 3O28A 5KZTA 2A5TB 4WXJA 2B3BA 4KI0E 5L8DA 1US4A 4LATA 3IB1A 2OJTA 3CG1A 1SYHA 3FASA 2H99A 1ZTYA 5A5XB 2DVZA 3TELA 4AB5A 3KGCA 3H4ZA 4EXKA 1GTKA 1M5BA 3W9VA 3T9XB 1AH5A 4WEPA 1UTHA 3DLNA 2QSXA 4LQ2A 4Q30B 2YPNA 2UVGA 3C32A 5I58B 1BP5A 3DRGA 2WKYA 4PP0A 4OEUA 4YB5A 4KCDA 1Y3QA 3JZJA 3VVEA 3VE1B 4POXA 3R26A 3O6IA 3Q27A 1LBBA 1PB8A 4EQBA 4IO3A 1CB6A 3OEMA 4YMAA 2HXWA 5J1DA 3SKPA 1N84A 3FXQA 3MWBA 3RLFE 4LA9A 3HCQA 1IXGA 4Q5TA 3U8QA 3ZSFA 4HS7A 4F2OA 4QFKA 4P11A 3PAMA 3DRIA 3N6UA 4HW8A 3GXAA 4DZ1A 2HAUA 2ZXTA 1QULA 3FD3A 2QMXA 2XX8A 4R2FA 2REJA 2UYFA 3KEIA 3CG3A 5JTYA 3IX1A 1MPDA 2YJPA 2ZNTA 4MLVA 5L9OA 1DTGA 4ZEBA 1LLSA 3O29A 3O97A 3OOAA 5BWJA 4ONYA 2HZLA 1TWYA 2QRYA 1B1XA 5ELVA 1Z7NE 1TFAA 3HHFA 3PD9A 4BLAA 4NF4B 1A8FA 1R9LA 3IJOB 4DCXA 3CI8A 1EU8A 2XXHA 3CRBA 3OEKA 3DP6A 4JB7A 3SESA 1LFIA 5CMCA 5H8QB 4E0XA 1B05A 4XKRA 4OVJA 4ELRA 1LCFA 4ECFA 3VXCA 5L9MA 1UTBB 3K01A 2QMWA 3N94A 2Z22A 1AL3A 1QJMA 4EQ7A 5AA3A 2ANJA 5H8NB 5H8NA 3EHTA 1XOCA 2HQ0A 2PVUA 1Y20A 1LSTA 1NNFA 2XXWA 3B6WA 3HPIA 3O66A 3PPOA 4G4PA 2ZNUA 4F22A 4YMBA 1B3EA 1M5FA 4X1DA 5CC2A 2F97A 1B3FA 2H9BA 1TXFA 3IOTA 4JXIA 1AIVA 3QK6A 1H44A 2I4BA 4YU0A 3LC8A 3DM0A 2G93A 2OZZA 1D9YA 3K2DA 4RNSA 3PPNA 3SEVA 2VP1A 1B0LA 4H5GA 2H25A 4U21A 5CMBA 2UVHA 1IITA 1JEUA 3A3CA 3FGSA 5I57B 1ATGA 4U4SA 5JTYB 1AMFA 2IA4A 1ZU0A 1PEBA 3KSXA 2D5WA 1N3XA 1US5A 3KJTA 5TPAB 3QUJA 1Y1ZA 1PBPA 4OETA 2O84X 2AYSA 2DSFA 3V8XB 2F5XA 3S4UA 3BFUA 2Y7IA 3B6QA 1FTJA 4BDOA 3BBRA 3U92A 4N6PA 4EQ9A 3O6GA 1B3LA 1MQJA 3QSLA 1POY1 2OWTA 4ZEIA 3H3GA 5H8QA 5M2VA 1FTLA 3Q29A 3PPQA 4R9GA 2Y7KA 5H8HB 3SEWA 3VDFA 2H98A 4DXBA 4EXLA 4F18A 2DWIA 4XIGQ 2LAOA 2VD3A 2V93A 5DTBA 4GLIA 3G7WA 3TTLA 4FJPA 1SYIA 1B40A 1NNKA 2Y84A 2WOLA 3H6TA 5H8SA 2ZYOA 4JSOA 1MH4A 4ZZEA 1H3DA 3G3FA 3A09A 2FYIA 5EHSA 2F6GA 1MXYA 4EF2A 4LUBA 1JEVA 4OZ9A 4N07A 4QFPA 4R9FA 5AA4B 3RPWA 5I56A 2DYXA 1Y4TA 2XXPA 3E4RA 1LB9A 3N6TA 1MQHA 3SEXA 1NNTA 5JEIA 4F1VA 2XX7A 2D3IA 3MP6A 3U94A 1I6BA 5DEXB 3MZ9A 3T66A 3T9UA 3HSTA 3MVWA 5CMMA 4DXCA 2F78A 1LGBC 3QIMA 2B3FA 2H5YA 4JWOA 4RK9A 3IR1A 5I2KB 4JDFA 2O7IA 2AL5A 2XXTA 1D3KA 3QYTA 4X48A 1SD3A 4BDMA 1ANFA 1ELJA 3VVDA 1O63A 1N76A 2XXRA 3LSWA 1NNPA 3MP8A 3MQ9A 4G8HA 3S9MC 2PYYA 5TP9B 3O6PA 1EZOA 1NH7A 3KFMA 2REGA 2I0BA 1A40A 1WDNA 2NWJA 3RTWB 3DRFA 4G68C 4UACA 1DOTA 4NWCA 4F31B 1CE2A 3WAEA 1MPCA 4RY1A 2X7PA 2VHAA 2OBGA 3MVXA 1PB7A 1LAXA 3BFTA 3QXMA 5IAIA 4F29A 1SDXA 1Q35A 5H8FA 4XKNA 3KBRA 1XVXA 2I6EA 3D4GA 4QFNA 3UIFA 1FW0A 2GHBA 1LBCA 3C33A 1LCTA 4G8NA 2XD2A 4M4GA 4PFYA 2AIXA 1FTKA 3ECRA 3FVKA 1SVXB 2F8DA 1KWHA 3IJXB 3L6GA 3P7IA 3KOSA 4ZEFA 2THIA 3OO9A 2PX1A 1B7HA 1MM6A 1JQFA 2P2AA 4PQJA 1UTHB 3RGYA 3RY3A 3TYHA 4KQPA 3V5AA 1MXUA 1FCKA 1I69A 1ZMGA 4NEDA 4P0IA 1N7WA 3KG2A 1URDA 2V3UA 3OELA 2OWSA 3H6UA 4ELOA 1LAFE 2DQVA 1S7YA 2I0CA 3TKDA 5CBSA 5ITPA 3BKIB 4H8IA 1ZBMA 4ESXA 2R71A 2ABHA 2I48A 4YZZA 3PUXE 1B5IA 4LONB 2GH9A 1B0HA 4KYDA 4ZE9A 3DRJA 3I3VA 5I2NB 1MH3A 1NKXA 2I3WA 1VFDA 4H67A 1MG1A 1VFEA 2XX9A 5I59A
chains in the Genus database with same CATH superfamily
2DE3A 2P3VA 1P1QA 1IMBA 1MQDA 4K3FA 2B4LA 1FBCA 3EN3A 4QF9A 1TT1A 2Q2CA 3T96B 1NL5A 3C9HA 3ILTB 4L17A 5IAIA 1M5CA 2QL3A 3K6VA 2Q89A 2E0SA 2V3QA 3HN0A 1O7TA 3C36A 5CBRA 3G3HA 3TCGA 2WYKA 1Y3PA 1FBFA 3LSXA 1EZPA 1MDP1 1H76A 1H43A 5A5XA 4PFTA 4PFIA 4OHNA 4XTCQ 3KJ7A 4EDPA 5I56A 4C1TA 3ODBA 4M1VA 3U65A 3MPKA 5DVIA 3FXUA 1DPPA 4U1OA 3CSBA 2HEUA 4Q8RA 4YKPA 2XD3A 4GXSB 4IO2A 3IAZA 4OFLA 3FZVA 2P1SA 3B7DA 2X26A 1N7XA 1VE4A 5IKBA 3PMVA 4DLDA 1B6HA 3UORA 1M5EA 2Q8MA 2O1MA 2QPQA 2DWJA 1OQGA 4N8GA 2O68A 3TZAA 1QUKA 1B32A 1FBGA 4GBWA 4O3BA 1UIUA 1G0HA 4GWOA 4H0WA 2RC9A 4MH5A 4OFJA 3K00A 4NHBA 4OWDA 3GYYA 4R6HA 1URSA 3G3JA 3CFXA 5TU0A 1I6QA 1LBZA 1B51A 3N26A 4P47A 3RYAA 4PGNA 4GWWA 4ZS9A 1MY4A 2R9JA 2ZNSA 1UQWA 4P56A 3LBSA 2DWHA 4IGRA 4HCYA 3T1BA 2NVUB 4ISUA 1RYOA 3W9WA 1A55A 2XXIA 2ALUA 3VLWA 1MY2A 4LN5A 3QUFA 4C0RA 5I2KA 1FTMA 2CZLA 1FQDA 3KOTA 4H45A 1SW2A 3H06B 3FIRA 4U23A 3F11A 2BJJX 3IO6A 1VDWA 4MX6A 4PFRA 4IO4A 3ZKKA 1MY0A 4IB2A 4POWA 1T0KA 4P1LA 3V83A 1NI9A 3MBPA 2G29A 4MNCA 2PT1A 3MAMA 3I6VA 5H8FB 2HFBA 1PC3A 1II5A 3GLBA 2I58A 2V25A 2ZYNA 2Z23A 3TODA 1QKBA 1LBYA 3PMWA 4U1ZA 3B6TA 1EYKA 3U72A 2XXXA 3OO7A 4JWYA 3K4UA 2ZZXA 4JSDA 4PAIA 3H6WA 3K6UA 5DVJA 3EHSA 1NMUA 3FV2A 1XT8A 5LOMA 1FJ6A 4ZDMA 5H8HA 1FPFA 1HSLA 2V84A 1QUIA 4O3AA 4RA1A 5AA4A 3EHUA 1FSAA 1DTZA 2ZYKA 2B4MA 5IM2A 1TFDA 5KCJB 3TAJA 3C35A 4GWZA 5DVFA 4PDDA 2F7BA 4O3CA 3MVZA 3C4MA 2P0SA 1BK4A 1SW1A 3G3IA 2RCBA 4R6YA 4OVPA 1MXZA 3PTYA 2F6PA 5KZTA 2A5TB 4WXJA 2B3BA 5L8DA 1US4A 3CG1A 3FASA 2H99A 3ROJA 5A5XB 4EXKA 1GTKA 3W9VA 4LQ2A 2YPNA 4OEUA 1Y3QA 4N6KA 4EQBA 1CB6A 5J1DA 3FXQA 3MWBA 1IXGA 4QFKA 3N6UA 3FD3A 2QMXA 2CZHA 2PFZA 3O29A 1IMFA 2HZLA 5ELVA 4NF4B 1R9LA 3D1RA 5IGAA 2XXHA 1CNQA 1LFIA 5CMCA 1B05A 4XKRA 4ECFA 1FPBA 5ESYA 4P1EA 2ANJA 2HQ0A 3HPIA 4N4UA 2ZNUA 1B3EA 2H9BA 1AIVA 1H44A 3DM0A 4XFEA 3PPNA 3SEVA 4H5GA 5CMBA 3FGSA 1IITA 1ZU0A 1FPLA 1PEBA 2FVZA 1Y1ZA 4OETA 2O84X 1K9ZA 4BDOA 4N6PA 1MQJA 5M2VA 5EQ7A 1KA0A 4F18A 4EXLA 2DWIA 3G7WA 4FJPA 5T3JA 1B40A 1NNKA 2WOLA 2ZYOA 4ZZEA 2Q74A 5AA4B 3N6TA 3SEXA 4NQ8A 3T66A 4DXCA 2F78A 4RK9A 3QYTA 4X48A 1ANFA 1ELJA 3MP8A 2F3BA 1A40A 3RTWB 4G68C 2VHAA 2OBGA 3BFTA 4OVQA 4P9KA 1XVXA 3C33A 1LCTA 4G8NA 2F8DA 3L6GA 2PX1A 1B7HA 4PQJA 3RGYA 3TYHA 4ELOA 2I0CA 2ABHA 1FPDA 1B5IA 3I3VA 2I3WA 1VFEA 4GWUA 1PB9A 3G3GA 4KPTA 3RTFB 4LZ7A 3CFZA 3KN3A 4HCWA 4OYVA 3VVFA 2Z8DA 1I6AA 2Q9TA 3O9PA 1AWBA 1IXHA 3LR1A 1ZLQA 4TQUQ 5ET5A 3TUSA 1JW4A 4NF8A 1WVJA 1UTBA 4G77A 4TLLB 1B58A 2QVRA 2Y5KA 1N04A 5ICQA 1J1NA 4PF8A 5FHMA 1OLCA 5DT6A 1Y4CA 3PU5A 4Z0IA 4GX4A 4I1DA 2X7QA 3FBPA 4GRKA 4OEVA 1PBQA 1Q1KA 2QJEA 3KZGA 4QSDA 4NF4A 4DE8A 4I40A 1D4NA 4OERA 3LUYA 4P3LA 4KFQA 4RXLA 5CM6A 2I4CA 5B7DA 3UGWA 4H5FA 3QAXA 1YPNA 2XWKA 1N0TA 1Y9UA 2ESNA 4NWDA 3M8UA 1XC1A 3FTOA 4AB6A 3ISPA 4MLQA 1O64A 1MQIA 2PT2A 1N3WA 4GQOA 1FTOA 1AOVA 1JVYA 4N15A 2QS2A 2XXQA 2UYEA 3IOVA 3K02A 3PUVE 4MAGA 1EZ9A 4I8CA 1IMAA 4F1UA 2I3VA 4F3BA 2F35A 4KXPA 1FBDA 1H45A 2QFLA 2QVUA 3Q25A 3SDFA 1Y1MA 3M3FA 2WBDA 4XKQA 4BDNA 1OVTA 1MY3A 2XWOA 3PUZE 1MS7A 3A29A 3IOWA 4NGUA 5HBCA 2WBBA 1MXXA 1F9BA 1LB8A 4OENA 1P1WA 4PFUA 4EUOA 4XF5A 2XXVA 3R6UA 3RYBA 3SEYA 5AA2A 4H8JA 1LBWA 1SW5A 2PMSA 3FV1A 4NN3A 4GWXA 1P1NA 4THIA 4GIZA 3B8BA 4R73A 4ND9A 4NF6B 4PETA 1XS5A 3EQ1A 3IK6B 4QBAA 2XXYA 1B5JA 5LTCA 2KLFA 3DRHA 3GBBA 1QKAA 2HAVA 5J16A 1INPA 2XA5A 4F2QA 1IZ1A 2DS9A 4I62A 1MY1A 4XEQA 2O51A 1NUZA 1ZKBA 2HCAA 4FATA 4LZ8A 4DXUA 2CMOA 1BKAA 4R74A 2FBPA 1B2HA 3DP4A 1B5HA 1NV1A 4YB6A 3K0VA 3Q26A 5HM4B 3KN8A 2BJIA 4GX3A 3MPLA 1DMBA 1B1HA 4F1YA 4IGTA 3FUZA 1IMDA 3T9VA 3E13X 1IMCA 4OFOA 4TOZA 3Q28A 4FORA 3USDA 5ISUA 3RQTA 4GL8A 4Z7EA 3DP8A 4KD5A 5HPQA 1HSEA 3FVOA 3O2AA 1NV7A 1YCJA 1RYXA 5I2NA 4NF5B 4MCOA 1SQYA 3H03A 4MBPA 4P0GA 4YICA 2MKZA 2XWVA 3A3UA 3PPPA 2UXAA 1Q9DA 4GWSA 2DE2A 2O69A 4N8YA 1NV3A 1ZIUA 1EYIA 3PD8A 1DK4A 3FATA 3U1OA 2HZKA 2DWAA 1A99A 3O6HA 3IL1B 2R6GE 4MF3A 1YZ0A 2FNCA 5I57A 4BDRA 2QVVA 3MC2A 4FAJA 1ZJLA 4LQ5A 3ILUB 4DI3D 3TCHA 2RKMA 1MPBA 4N13A 2UVJA 4F19A 4MEVA 3O28A 4JVIA 4KI0E 1SYHA 3H4ZA 4O8MA 4Q30B 2UVGA 4KCDA 3O6IA 1LBBA 2HXWA 3SKPA 5I3SA 4LA9A 1LBXA 4F2OA 4P11A 3PAMA 4NAPA 4DZ1A 2ZXTA 2REJA 3KEIA 1MPDA 5L9OA 4MLVA 5EQ9A 2WEFA 1FBEA 4H46A 2QRYA 1B1XA 1TFAA 4QXDA 4BLAA 4O7MA 4ELRA 5F24A 1FRPA 3N94A 1AL3A 5H8NB 3B6WA 1Y20A 5I57B 2F97A 1TXFA 4YU0A 2OZZA 2FHYA 3K2DA 2H25A 1JEUA 4U4SA 5JTYB 1AMFA 2IA4A 5DW8A 1N3XA 2AYSA 2DSFA 3V8XB 3BFUA 4HE2A 4EQ9A 1B3LA 3QSLA 3RUMA 5H8QA 3VDFA 1FBPA 3PPQA 4R9GA 5DTBA 1RDYA 5I5PA 3H6TA 2PCRA 5H8SA 1H3DA 1DBZA 3A09A 1MXYA 4MJOA 4N07A 1Y4TA 1NNTA 2D3IA 3MP6A 1I6BA 3MZ9A 3HSTA 4HXVA 2B3FA 1KZ8A 2O7IA 2AL5A 1D3KA 3VVDA 2XXRA 1NUYA 4N6DA 3S9MC 3IFAA 5TP9B 1NH7A 2NWJA 2KQZA 2X7PA 1PB7A 3QXMA 1SDXA 1Q35A 4I3YA 5H8FA 3KBRA 1LBCA 4HE0A 3ECRA 3FVKA 5ET8A 1FPIA 1SVXB 1KWHA 3IJXB 3P7IA 4ZEFA 2WX9A 1MM6A 4KQPA 4O94A 3KG2A 2V3UA 3H6UA 5CBSA 3TKDA 1NV2A 4H8IA 2R71A 4AS4A 4LONB 3DRJA 1MH3A 1NKXA 1VFDA 2XX9A 4OXVA 2QS4A 2E1SA 2P3NA 1GR2A 4IO5A 3S9EA 4YB7A 3RYDA 1SI0A 2RC7A 4IO6A 1LFHA 5KDTA 4ESWA 2F7AA 1LAGE 2F34A 2VOZA 1OLAA 3OSQA 1D9VA 1USYH 3JYRA 3N5LA 3LVUA 2ONKE 4AQ4A 4QRZA 4X1BA 4X9TA 4MNIA 2OK2A 5AA1A 5AA2B 1B46A 4YAHX 3S9LC 1G0IA 1L5TA 4R6KA 5CRYA 3S2VA 4QSCA 2VGQA 4DCYA 4HTGA 4LP2B 2XWIA 4TLMB 3OO6A 1OIBA 1B7UA 1DSNA 2O6AA 1POTA 2CZKA 1R9QA 5ET7A 1P99A 2Q88A 2OX3A 1P1UA 3PV0E 3K6XA 5I84A 2DXYA 4G8MA 4FEBA 2HXRA 5I59B 3FXBA 3MUQA 4F3SA 1IUDA 3OD7A 3FJ7A 2ZMBA 5I58A 4NF8B 4GWYA 4PFWA 3VLUA 3PGFA 4PBHA 5AE4A 4FIMA 3OMBA 2Q8JA 3VV5A 1GVCA 2OCUA 4GF8A 1MRPA 2Q2AA 3EF7A 3PUWE 4JVDA 1A54A 4ZEDA 3WAFA 2M8CA 3EKIA 4GFRA 5B70A 3RPLA 5EYGA 4ELPA 5FHNA 2H4IA 3CHGA 5JK4A 2RINA 1USYE 4NTLA 4H65A 5CI5A 2HHMA 3ZS6A 5KDTB 3MJNA 2FA7A 3UN6A 2Z8FA 2WOPA 3KN7A 3HO7A 2O1LA 2RC8A 2JJKA 1RKMA 4U2RA 4FECA 4O7IA 1FTAA 4UA8A 4OVRA 4G68B 3LSLA 5L9SA 1HSJA 1PDAA 3GZGA 3I5OA 4ZEKA 4KR5A 5H8HB 4G2ZA 3LSFB 2XXUA 4YKKA 5IZ1A 2DE4A 5DYHA 2A5TA 4QFLA 1IXCA 1NV0A 5K2XA 3PPRA 5FHOA 4NF5A 1OQHA 1A7LA 5EHMA 4DIGA 3CFLA 5I7IA 4KYEA 1VSOA 3D4CA 3S9NC 4R72A 1SW4A 1NH8A 4FEDA 3K1PA 3W15C 4DI4B 3R7XA 4H6DA 1OVBA 3IB2A 4E0WA 4OA4A 4F3PA 4PGPA 2QS1A 3SEUA 1QUJA 1SI1A 3TCFA 4RK2A 3UP9A 4RJZA 3MVYA 4OMBA 1QW0A 3IOUA 3RN8A 5ICTA 1IEJA 3EPEA 4Q0CA 4ZE8A 4RYAA 1B9JA 3LUZA 1DPEA 4WEDA 2NOOA 4NG7A 5K2YA 1Z7ME 4GXAA 4N81A 3T0JA 4UABA 5F7VA 3TDJA 3T22A 1KA1A 2ZZVA 2NUVA 3FJGA 3FVNA 4C1UA 2F36A 1FPEA 4XKPA 1GGGA 1XHYA 2ZYMA 4GD5A 1SBPA 1FQAA 1FQEA 4GL0A 1XVYA 3FVGA 2Y7RA 4PAKA 5FTIA 4OVTA 4LATA 2OJTA 1ZTYA 2DVZA 3TELA 4AB5A 3C32A 3DRGA 4PP0A 3JZJA 3VVEA 3VE1B 4POXA 3R26A 3OEMA 3U8QA 1QULA 4R2FA 5JTYA 2ZNTA 4ZEBA 1LLSA 3OOAA 5BWJA 1DCUA 1TWYA 3HHFA 3PD9A 3HFUA 1A8FA 3IJOB 3CI8A 3OEKA 1EU8A 3CRBA 3DP6A 5H8QB 4E0XA 4OVJA 1LCFA 5L9MA 3K01A 2Z22A 3EHTA 1NNFA 2XXWA 3O66A 4G4PA 4F22A 3IOTA 4JXIA 3QK6A 2I4BA 3BIHA 1D9YA 2VP1A 2KR0A 1FPJA 2UVHA 1ATGA 5TPAB 1US5A 1PBPA 2Y7IA 3B6QA 2ZZWA 3U92A 1POY1 5I56B 3H3GA 3SEWA 2H98A 4DXBA 4XIGQ 2LAOA 2VD3A 2V93A 4GLIA 3LV0A 1SYIA 2Y84A 1MH4A 3G3FA 4N91A 2FYIA 5EHSA 1JP4A 3IFCA 4R9FA 1YYZA 2XXPA 1MQHA 4F1VA 2XX7A 4P8BA 5DEXB 3T9UA 5CMMA 5I2KB 4JDFA 2CEXA 4BDMA 1SD3A 4OVSA 3SZPA 1N76A 3LSWA 1NNPA 4G8HA 2PYYA 3E79A 1EZOA 3KFMA 1WDNA 5ET6A 4NWCA 1MPCA 4RY1A 2HPGA 2I6EA 3D4GA 1FW0A 2GHBA 2XD2A 4PFYA 2AIXA 3KC0A 2THIA 3OO9A 1NV4A 2P2AA 3RY3A 3V5AA 1MXUA 1N7WA 3OELA 1NV5A 1LAFE 1S7YA 2WYPA 3E78A 4ESXA 1ZBMA 2I48A 4YZZA 3PUXE 4KYDA 1B0HA 1LEVA 4H67A 3Q29A 1MG1A 3UK4A 5I59A 4QFOA 3L6HA 4OTEA 1IMEA 1GV8A 5LDZA 3HHGA 1B7ZA 4RPNA 3TQWA 1LFGA 3CVGA 3CR9A 3AXFA 2GFEA 2R8TA 2XXKA 3IO4A 3KC1A 3DRKA 1XI6A 1WODA 5AA2D 1JW5A 2Z8EA 5H8NA 3M3KA 3TTMA 3JV9A 4IY5A 2Y7WA 2XHDA 3K6WA 3K1MA 3IORA 5BUUA 3THIA 4JBZA 2AL4A 1MQGA 3U93A 3TTRA 1K9YA 4PE5B 1SPIA 4R75A 2B65A 2W7YA 3ONMA 3RPLB 2F7CA 3K1NA 4MHFA 3RT8A 1B52A 1FQBA 3VXBA 3NOHA 2OLBA 3VFJA 2QS3A 4PDHA 2UVIA 4EF1A 4LVQA 1NUXA 3FXRA 3BIGA 2Y7PA 4PAFA 4ELQA 1A8EA 2O7UA 1FQCA 5DEXA 4F3GA 5CMKA 3IB0A 1FPKA 1P1OA 3T93B 3CSGA 4H1XA 4ZECA 2GRVA 4OQOA 3TFLA 4WKMA 3MZ1A 5FTHA 4KCCA 3T9HB 4X8RA 1R1NA 3G3KA 1FQFA 3MSTA 2Y5LA 5TPAA 2RF1A 2V4CA 4KYSA 1B4HA 1LAHE 1MXVA 4I9DA 2V3TA 1BIYA 3PUYE 1B4ZA 4ZZAA 2NXOA 1MDQA 5KCJA 4G68A 3SERA 3OSRA 1B3GA 1NUWA 3SETA 2PBWA 5TP9A 1YAEA 4QSEA 1R6ZA 4OANA 4JVCA 4GVOA 1IXIA 2RCAA 2GQ1A 3FJMA 4OESA 5EYFA 4NMYA 3RNNA 3TTNA 3H6VA 2A5SA 5FBPA 3KSJA 2IEEA 2I49A 3UA8A 3CIJA 4FE8A 1FJ9A 5EQAA 1MM7A 2VD2A 2FIXA 5F1QA 2OWZA 3MP1A 4JWXA 4IO7A 1EH3A 1Y3NA 3E9XA 5IZZA 1D9QA 4XXUA 4R2BA 1URGA 1UIVA 4IY6A 4QHQA 4BDQA 1IIWA 4I3EA 4BDLA 2WOKA 3ZKLA 2DP8A 2YLNA 3TPAA 1VR5A 4AS5A 3TTKA 1M5DA 2CEYA 4PE3A 3C31A 4U22A 4X04A 3KBZA 3OO8A 3TQLA 1S9TA 4PF6A 2GHAA 4PBQA 3OXNA 2DOJA 4NF0A 4F39A 3HV1A 4N17A 4RPOA 1IQ7A 1MXWA 1JNFA 4NE4A 4LZ5A 3MW0A 1EYJA 4NF6A 4YKJA 3V89B 3M3LA 2VT5A 3GBAA 3OENA 1JW1A 1QVSA 3PMXA 4U4XA 1JVXA 3QMFA 2DXRA 3DELB 1B3HA 1OMPA 4MFIA 1JETA 1S50A 2ONRA 1YTVA 2DVCA 4HE1A 2D21A 4DDDA 3TEPA 3C34A 5ITOA 4YKIA 3VLVA 5IZ3B 1BTJA 4KHZE 1NFTA 3RT6B 3TMGA 2VPOA 4GOTA 3MZBA 3H7MA 1BLFA 3E3KA 2ONSA 2L5VA 3IB1A 1QGXA 3KGCA 1M5BA 3T9XB 1AH5A 4WEPA 1UTHA 2DDKA 2QSXA 3DLNA 1RDXA 5I58B 1BP5A 2WKYA 4YB5A 3Q27A 1PB8A 4IO3A 2CZIA 4YMAA 1N84A 5EQ8A 3RLFE 3HCQA 4Q5TA 3ZSFA 4MNPA 4HS7A 3DRIA 4HW8A 3GXAA 2HAUA 2XX8A 2UYFA 3CG3A 3IX1A 1FBHA 2YJPA 4MMPA 1DTGA 3B50A 3O97A 4GBVA 4ONYA 1Z7NE 4DCXA 3SESA 4JB7A 3VXCA 1UTBB 2QMWA 4EQ7A 1QJMA 5AA3A 1XOCA 2PVUA 1LSTA 3PPOA 4YMBA 1M5FA 4X1DA 5CC2A 1B3FA 1LBVA 3LC8A 2G93A 4RNSA 1B0LA 4U21A 3A3CA 3KSXA 2D5WA 1NV6A 3KJTA 4MIJA 3QUJA 4G61A 2F5XA 3S4UA 5EYHA 1FTJA 3BBRA 1YXIA 1FPGA 4FBPA 3O6GA 2OWTA 4ZEIA 1FTLA 2Y7KA 3TTLA 4JSOA 2F6GA 4EF2A 4LUBA 1JEVA 4OZ9A 4PFBA 4QFPA 3RPWA 2DYXA 3E4RA 1LB9A 5JEIA 3U94A 5A5LA 2FIEA 3MVWA 5IZ3A 4IR8A 1LGBC 3QIMA 2H5YA 4JWOA 3IR1A 2PFYA 2XXTA 4PC9A 1O63A 3MQ9A 3O6PA 2REGA 2I0BA 3DRFA 4UACA 1DOTA 4F31B 1CE2A 3WAEA 4PTKA 3MVXA 1LAXA 4F29A 4XKNA 3UIFA 4QFNA 4NX1A 4M4GA 1FTKA 3KOSA 1JQFA 1UTHB 4GX6A 1FCKA 1I69A 1ZMGA 2VPNA 4NEDA 4P0IA 1URDA 3MYUA 2OWSA 2DQVA 5ITPA 2F3DA 3BKIB 1RDZA 2GH9A 4ZE9A 4PCDA 5I2NB
chains in the Genus database with same CATH topology
4OXVA 4QFOA 1PB9A 3L6HA 4OTEA 2DE3A 2E1SA 2QS4A 3G3GA 4KPTA 1GV8A 1P1QA 3RTFB 1MQDA 4LZ7A 4K3FA 3HHGA 1GR2A 1B7ZA 3CFZA 4IO5A 3KN3A 2B4LA 4RPNA 4YB7A 3S9EA 1SI0A 2RC7A 4HCWA 3EN3A 3TQWA 4OYVA 1LFGA 3VVFA 4IO6A 2Z8DA 3CVGA 3CR9A 1I6AA 2Q9TA 4QF9A 3O9PA 5KDTA 1LFHA 1IXHA 3LR1A 1ZLQA 4TQUQ 3AXFA 2GFEA 4ESWA 2F7AA 1TT1A 1LAGE 3TUSA 1JW4A 2F34A 2Q2CA 2VOZA 4NF8A 3T96B 1OLAA 3OSQA 1D9VA 1NL5A 3IO4A 3DRKA 1WVJA 1WODA 1UTBA 4G77A 4TLLB 5AA2D 1B58A 3C9HA 3ILTB 1JW5A 1N04A 1USYH 5ICQA 2Z8EA 3JYRA 1J1NA 3M3KA 3N5LA 4L17A 1M5CA 2QL3A 3K6VA 2Q89A 5FHMA 2E0SA 3LVUA 2V3QA 3HN0A 3TTMA 1OLCA 3JV9A 2ONKE 5DT6A 4AQ4A 4IY5A 4QRZA 1O7TA 4X1BA 3C36A 2Y7WA 2XHDA 3K6WA 4X9TA 3K1MA 3IORA 1Y4CA 2OK2A 3PU5A 5AA1A 5CBRA 4Z0IA 5AA2B 3G3HA 4I1DA 3THIA 5BUUA 2X7QA 3TCGA 1B46A 4YAHX 4JBZA 1Y3PA 2AL4A 1MQGA 4GRKA 3U93A 3S9LC 3LSXA 1EZPA 3TTRA 1MDP1 1H76A 1H43A 4PE5B 5A5XA 4OEVA 4R75A 4R6KA 5CRYA 1L5TA 3RN8A 3S2VA 4PFTA 2B65A 2W7YA 3ONMA 1PBQA 2VGQA 4OHNA 4DCYA 3KJ7A 4QSCA 4HTGA 4XTCQ 4EDPA 2F7CA 1Q1KA 3K1NA 2QJEA 1B52A 1FQBA 4LP2B 3RT8A 3KZGA 3VXBA 4C1TA 2OLBA 4QSDA 4TLMB 2QS3A 3OO6A 2UVIA 4NF4A 3VFJA 4DE8A 1D4NA 1OIBA 1B7UA 4OERA 3LUYA 3ODBA 1DSNA 2O6AA 4M1VA 4EF1A 1POTA 4KFQA 4RXLA 1R9QA 3MPKA 1P99A 2Q88A 5DVIA 3FXUA 1P1UA 3PV0E 1DPPA 3K6XA 4LVQA 2DXYA 3FXRA 5I84A 5CM6A 4U1OA 4G8MA 4FEBA 3CSBA 2HEUA 4Q8RA 2Y7PA 2I4CA 4ELQA 5B7DA 5I59B 5DVJA 1A8EA 2O7UA 3MUQA 3UGWA 4F3SA 1IUDA 4H5FA 1FQCA 4YKPA 5DEXA 3QAXA 1YPNA 2XD3A 3OD7A 1N0TA 1Y9UA 2ESNA 4F3GA 5CMKA 3FJ7A 4GXSB 4IO2A 4NWDA 2ZMBA 5I58A 3M8UA 4NF8B 1XC1A 3IB0A 3IAZA 4OFLA 3FTOA 4AB6A 4PFWA 3VLUA 3PGFA 1P1OA 3FZVA 3T93B 4MLQA 1O64A 1MQIA 2P1SA 3CSGA 2PT2A 3B7DA 1N3WA 2X26A 5AE4A 4FIMA 4H1XA 4GQOA 4ZECA 2GRVA 4OQOA 1N7XA 1VE4A 3TFLA 4WKMA 3MZ1A 1FTOA 5FTHA 4KCCA 3OMBA 1AOVA 5I56B 5IKBA 2Q8JA 1JVYA 3PMVA 4DLDA 1B6HA 3UORA 1M5EA 3VV5A 3T9HB 2QS2A 2O1MA 2QPQA 2DWJA 2XXQA 1GVCA 2OCUA 2UYEA 3IOVA 3K02A 3PUVE 1OQGA 2O68A 3TZAA 1R1NA 1QUKA 1EZ9A 3G3KA 1B32A 4I8CA 1FQFA 4KYEA 4GF8A 4F1UA 4O3BA 1UIUA 1MRPA 2RF1A 5TPAA 4KYSA 2I3VA 1B4HA 1LAHE 2F35A 2Q2AA 4F3BA 3EF7A 4GWOA 1MXVA 4H0WA 2RC9A 1H45A 3PUWE 4I9DA 3Q25A 1A54A 4ZEDA 2V3TA 4MH5A 3SDFA 4OFJA 1Y1MA 3K00A 3M3FA 4XKQA 3WAFA 1BIYA 1OVTA 2M8CA 1MY3A 3PUYE 4OWDA 4BDNA 4GFRA 1B4ZA 4ZZAA 4R6HA 1URSA 5B70A 3PUZE 2NXOA 4ELPA 1MS7A 5FHNA 1MDQA 5KCJA 3G3JA 3IOWA 3CFXA 5HBCA 5TU0A 4G68A 3SERA 1I6QA 1MXXA 1F9BA 1B51A 1LB8A 2H4IA 1B3GA 3N26A 3OSRA 3RYAA 4OENA 1P1WA 3SETA 4ZS9A 2PBWA 3CHGA 4PFUA 5TP9A 4EUOA 2RINA 1YAEA 1USYE 5JK4A 1MY4A 4NTLA 2XXVA 4QSEA 2R9JA 3RYBA 1R6ZA 2ZNSA 3R6UA 4H65A 1UQWA 5CI5A 3SEYA 5AA2A 3LBSA 3ZS6A 4GVOA 4H8JA 4FATA 3MJNA 5KDTB 1IXIA 2RCAA 1SW5A 2DWHA 2FA7A 4IGRA 3UN6A 2PMSA 3FV1A 3FJMA 4OESA 2Z8FA 4HCYA 2NVUB 4ISUA 1P1NA 5EYFA 4THIA 2WOPA 1RYOA 4GIZA 4NMYA 3RNNA 3W9WA 1A55A 2XXIA 3H6VA 4R73A 2A5SA 2ALUA 3KN7A 3TTNA 3VLWA 3HO7A 2O1LA 4ND9A 1MY2A 2RC8A 4NF6B 1RKMA 3KSJA 4PETA 1XS5A 4U2RA 2IEEA 3EQ1A 3QUFA 4FECA 4C0RA 3IK6B 2I49A 5ICTA 5I2KA 4UA8A 3UA8A 1FTMA 3CIJA 4G68B 2CZLA 3LSLA 4FE8A 1MM7A 2VD2A 5L9SA 5F1QA 1FQDA 1HSJA 1PDAA 3KOTA 3MP1A 2XXYA 3GZGA 1B5JA 4JWXA 4IO7A 1EH3A 2KLFA 3I5OA 3DRHA 4ZEKA 1Y3NA 3GBBA 1SW2A 3E9XA 1QKAA 2HAVA 3H06B 4G2ZA 3LSFB 4KR5A 2XXUA 4YKKA 3FIRA 4U23A 3F11A 2BJJX 4XXUA 4R2BA 3IO6A 2DE4A 1URGA 5DYHA 1UIVA 4QFLA 2A5TA 4IY6A 4QHQA 4F2QA 1IZ1A 1IXCA 4BDQA 1IIWA 2DS9A 4BDLA 4I62A 2WOKA 1MY1A 4IO4A 3ZKLA 5K2XA 2O51A 3ZKKA 1ZKBA 2DP8A 2YLNA 2HCAA 3TPAA 1VR5A 1MY0A 3PPRA 4LZ8A 4IB2A 5FHOA 4POWA 3TTKA 1M5DA 2CMOA 4DXUA 1T0KA 1BKAA 4R74A 3V83A 4NF5A 1B2HA 2G29A 1OQHA 3DP4A 3C31A 3MBPA 1B5HA 4YB6A 2PT1A 1A7LA 3K0VA 3Q26A 3OO8A 4U22A 3MAMA 3I6VA 5EHMA 5HM4B 3KN8A 5H8FB 2HFBA 1S9TA 3TQLA 4DIGA 3CFLA 1VSOA 1PC3A 3MPLA 1II5A 3D4CA 2I58A 1DMBA 2V25A 3GLBA 1B1HA 3S9NC 4R72A 2GHAA 2ZYNA 4F1YA 1SW4A 1NH8A 4FEDA 4IGTA 3FUZA 3OXNA 2DOJA 3T9VA 3E13X 2Z23A 3TODA 4OFOA 4TOZA 3K1PA 3W15C 4F39A 1QKBA 3Q28A 4FORA 3PMWA 3USDA 4U1ZA 3HV1A 5ISUA 3RQTA 4GL8A 4RPOA 1IQ7A 1MXWA 4Z7EA 3DP8A 3B6TA 3R7XA 4KD5A 3U72A 1HSEA 5HPQA 3FVOA 1JNFA 4H6DA 4LZ5A 4NE4A 1OVBA 3IB2A 3O2AA 2XXXA 3OO7A 4JWYA 3K4UA 4E0WA 4JSDA 1YCJA 4F3PA 3MW0A 4NF6A 2QS1A 4YKJA 3V89B 1RYXA 3H6WA 3M3LA 5I2NA 3SEUA 1QUJA 1SI1A 4NF5B 3GBAA 3K6UA 3OENA 3TCFA 4RK2A 3UP9A 1SQYA 3H03A 4RJZA 3MVYA 1JW1A 1QVSA 1QW0A 3IOUA 3PMXA 4MBPA 4OMBA 1IEJA 1JVXA 3EHSA 4P0GA 1NMUA 3EPEA 4U4XA 3FV2A 4Q0CA 2DXRA 4ZE8A 1XT8A 1B9JA 4RYAA 5LOMA 4YICA 4ZDMA 3DELB 3A3UA 1B3HA 1DPEA 4WEDA 2NOOA 5H8HA 5K2YA 1Z7ME 1OMPA 2UXAA 3PPPA 1HSLA 4MFIA 2V84A 1JETA 1S50A 2ONRA 2DE2A 3RUMA 2O69A 4GXAA 1QUIA 4O3AA 1YTVA 2DVCA 4RA1A 5AA4A 3EHUA 2D21A 1ZIUA 1DTZA 2ZYKA 4DDDA 2B4MA 5F7VA 3TDJA 3UK4A 3PD8A 3T22A 3FATA 3TEPA 1TFDA 3C34A 5ITOA 4YKIA 2HZKA 3U1OA 5KCJB 3VLVA 2NUVA 2DWAA 1A99A 3TAJA 3FJGA 3O6HA 1BTJA 3C35A 3FVNA 3IL1B 2R6GE 4MF3A 5DVFA 2F7BA 4C1UA 2F36A 2FNCA 4KHZE 5I57A 4BDRA 4O3CA 1NFTA 3MVZA 3C4MA 4XKPA 1GGGA 3RT6B 2P0SA 3TMGA 1XHYA 2ZYMA 4GD5A 3MC2A 4GOTA 1SBPA 1FQAA 4FAJA 3MZBA 1FQEA 1SW1A 1ZJLA 3G3IA 4GL0A 1XVYA 3FVGA 4LQ5A 2RCBA 3H7MA 3ILUB 1BLFA 2Y7RA 3TCHA 3E3KA 2RKMA 1MPBA 4N13A 4R6YA 2ONSA 1MXZA 2UVJA 2F6PA 5FTIA 4F19A 3O28A 5KZTA 2A5TB 4WXJA 2B3BA 4KI0E 5L8DA 1US4A 4LATA 3IB1A 2OJTA 3CG1A 1SYHA 3FASA 2H99A 1ZTYA 5A5XB 2DVZA 3TELA 4AB5A 3KGCA 3H4ZA 4EXKA 1GTKA 1M5BA 3W9VA 3T9XB 1AH5A 4WEPA 1UTHA 3DLNA 2QSXA 4LQ2A 4Q30B 2YPNA 2UVGA 3C32A 5I58B 1BP5A 3DRGA 2WKYA 4PP0A 4OEUA 4YB5A 4KCDA 1Y3QA 3JZJA 3VVEA 3VE1B 4POXA 3R26A 3O6IA 3Q27A 1LBBA 1PB8A 4EQBA 4IO3A 1CB6A 3OEMA 4YMAA 2HXWA 5J1DA 3SKPA 1N84A 3FXQA 3MWBA 3RLFE 4LA9A 3HCQA 1IXGA 4Q5TA 3U8QA 3ZSFA 4HS7A 4F2OA 4QFKA 4P11A 3PAMA 3DRIA 3N6UA 4HW8A 3GXAA 4DZ1A 2HAUA 2ZXTA 1QULA 3FD3A 2QMXA 2XX8A 4R2FA 2REJA 2UYFA 3KEIA 3CG3A 5JTYA 3IX1A 1MPDA 2YJPA 2ZNTA 4MLVA 5L9OA 1DTGA 4ZEBA 1LLSA 3O29A 3O97A 3OOAA 5BWJA 4ONYA 2HZLA 1TWYA 2QRYA 1B1XA 5ELVA 1Z7NE 1TFAA 3HHFA 3PD9A 4BLAA 4NF4B 1A8FA 1R9LA 3IJOB 4DCXA 3CI8A 1EU8A 2XXHA 3CRBA 3OEKA 3DP6A 4JB7A 3SESA 1LFIA 5CMCA 5H8QB 4E0XA 1B05A 4XKRA 4OVJA 4ELRA 1LCFA 4ECFA 3VXCA 5L9MA 1UTBB 3K01A 2QMWA 3N94A 2Z22A 1AL3A 1QJMA 4EQ7A 5AA3A 2ANJA 5H8NB 5H8NA 3EHTA 1XOCA 2HQ0A 2PVUA 1Y20A 1LSTA 1NNFA 2XXWA 3B6WA 3HPIA 3O66A 3PPOA 4G4PA 2ZNUA 4F22A 4YMBA 1B3EA 1M5FA 4X1DA 5CC2A 2F97A 1B3FA 2H9BA 1TXFA 3IOTA 4JXIA 1AIVA 3QK6A 1H44A 2I4BA 4YU0A 3LC8A 3DM0A 2G93A 2OZZA 1D9YA 3K2DA 4RNSA 3PPNA 3SEVA 2VP1A 1B0LA 4H5GA 2H25A 4U21A 5CMBA 2UVHA 1IITA 1JEUA 3A3CA 3FGSA 5I57B 1ATGA 4U4SA 5JTYB 1AMFA 2IA4A 1ZU0A 1PEBA 3KSXA 2D5WA 1N3XA 1US5A 3KJTA 5TPAB 3QUJA 1Y1ZA 1PBPA 4OETA 2O84X 2AYSA 2DSFA 3V8XB 2F5XA 3S4UA 3BFUA 2Y7IA 3B6QA 1FTJA 4BDOA 3BBRA 3U92A 4N6PA 4EQ9A 3O6GA 1B3LA 1MQJA 3QSLA 1POY1 2OWTA 4ZEIA 3H3GA 5H8QA 5M2VA 1FTLA 3Q29A 3PPQA 4R9GA 2Y7KA 5H8HB 3SEWA 3VDFA 2H98A 4DXBA 4EXLA 4F18A 2DWIA 4XIGQ 2LAOA 2VD3A 2V93A 5DTBA 4GLIA 3G7WA 3TTLA 4FJPA 1SYIA 1B40A 1NNKA 2Y84A 2WOLA 3H6TA 5H8SA 2ZYOA 4JSOA 1MH4A 4ZZEA 1H3DA 3G3FA 3A09A 2FYIA 5EHSA 2F6GA 1MXYA 4EF2A 4LUBA 1JEVA 4OZ9A 4N07A 4QFPA 4R9FA 5AA4B 3RPWA 5I56A 2DYXA 1Y4TA 2XXPA 3E4RA 1LB9A 3N6TA 1MQHA 3SEXA 1NNTA 5JEIA 4F1VA 2XX7A 2D3IA 3MP6A 3U94A 1I6BA 5DEXB 3MZ9A 3T66A 3T9UA 3HSTA 3MVWA 5CMMA 4DXCA 2F78A 1LGBC 3QIMA 2B3FA 2H5YA 4JWOA 4RK9A 3IR1A 5I2KB 4JDFA 2O7IA 2AL5A 2XXTA 1D3KA 3QYTA 4X48A 1SD3A 4BDMA 1ANFA 1ELJA 3VVDA 1O63A 1N76A 2XXRA 3LSWA 1NNPA 3MP8A 3MQ9A 4G8HA 3S9MC 2PYYA 5TP9B 3O6PA 1EZOA 1NH7A 3KFMA 2REGA 2I0BA 1A40A 1WDNA 2NWJA 3RTWB 3DRFA 4G68C 4UACA 1DOTA 4NWCA 4F31B 1CE2A 3WAEA 1MPCA 4RY1A 2X7PA 2VHAA 2OBGA 3MVXA 1PB7A 1LAXA 3BFTA 3QXMA 5IAIA 4F29A 1SDXA 1Q35A 5H8FA 4XKNA 3KBRA 1XVXA 2I6EA 3D4GA 4QFNA 3UIFA 1FW0A 2GHBA 1LBCA 3C33A 1LCTA 4G8NA 2XD2A 4M4GA 4PFYA 2AIXA 1FTKA 3ECRA 3FVKA 1SVXB 2F8DA 1KWHA 3IJXB 3L6GA 3P7IA 3KOSA 4ZEFA 2THIA 3OO9A 2PX1A 1B7HA 1MM6A 1JQFA 2P2AA 4PQJA 1UTHB 3RGYA 3RY3A 3TYHA 4KQPA 3V5AA 1MXUA 1FCKA 1I69A 1ZMGA 4NEDA 4P0IA 1N7WA 3KG2A 1URDA 2V3UA 3OELA 2OWSA 3H6UA 4ELOA 1LAFE 2DQVA 1S7YA 2I0CA 3TKDA 5CBSA 5ITPA 3BKIB 4H8IA 1ZBMA 4ESXA 2R71A 2ABHA 2I48A 4YZZA 3PUXE 1B5IA 4LONB 2GH9A 1B0HA 4KYDA 4ZE9A 3DRJA 3I3VA 5I2NB 1MH3A 1NKXA 2I3WA 1VFDA 4H67A 1MG1A 1VFEA 2XX9A 5I59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXV A;  4QFO A;  1PB9 A;  3L6H A;  4OTE A;  2DE3 A;  2E1S A;  2QS4 A;  3G3G A;  4KPT A;  1GV8 A;  1P1Q A;  3RTF B;  1MQD A;  4LZ7 A;  4K3F A;  3HHG A;  1GR2 A;  1B7Z A;  3CFZ A;  4IO5 A;  3KN3 A;  2B4L A;  4RPN A;  4YB7 A;  3S9E A;  1SI0 A;  2RC7 A;  4HCW A;  3EN3 A;  3TQW A;  4OYV A;  1LFG A;  3VVF A;  4IO6 A;  2Z8D A;  3CVG A;  3CR9 A;  1I6A A;  2Q9T A;  4QF9 A;  3O9P A;  5KDT A;  1LFH A;  1IXH A;  3LR1 A;  1ZLQ A;  4TQU Q;  3AXF A;  2GFE A;  4ESW A;  2F7A A;  1TT1 A;  1LAG E;  3TUS A;  1JW4 A;  2F34 A;  2Q2C A;  2VOZ A;  4NF8 A;  3T96 B;  1OLA A;  3OSQ A;  1D9V A;  1NL5 A;  3IO4 A;  3DRK A;  1WVJ A;  1WOD A;  1UTB A;  4G77 A;  4TLL B;  5AA2 D;  1B58 A;  3C9H A;  3ILT B;  1JW5 A;  1N04 A;  1USY H;  5ICQ A;  2Z8E A;  3JYR A;  1J1N A;  3M3K A;  3N5L A;  4L17 A;  1M5C A;  2QL3 A;  3K6V A;  2Q89 A;  5FHM A;  2E0S A;  3LVU A;  2V3Q A;  3HN0 A;  3TTM A;  1OLC A;  3JV9 A;  2ONK E;  5DT6 A;  4AQ4 A;  4IY5 A;  4QRZ A;  1O7T A;  4X1B A;  3C36 A;  2Y7W A;  2XHD A;  3K6W A;  4X9T A;  3K1M A;  3IOR A;  1Y4C A;  2OK2 A;  3PU5 A;  5AA1 A;  5CBR A;  4Z0I A;  5AA2 B;  3G3H A;  4I1D A;  3THI A;  5BUU A;  2X7Q A;  3TCG A;  1B46 A;  4YAH X;  4JBZ A;  1Y3P A;  2AL4 A;  1MQG A;  4GRK A;  3U93 A;  3S9L C;  3LSX A;  1EZP A;  3TTR A;  1MDP 1;  1H76 A;  1H43 A;  4PE5 B;  5A5X A;  4OEV A;  4R75 A;  4R6K A;  5CRY A;  1L5T A;  3RN8 A;  3S2V A;  4PFT A;  2B65 A;  2W7Y A;  3ONM A;  1PBQ A;  2VGQ A;  4OHN A;  4DCY A;  3KJ7 A;  4QSC A;  4HTG A;  4XTC Q;  4EDP A;  2F7C A;  1Q1K A;  3K1N A;  2QJE A;  1B52 A;  1FQB A;  4LP2 B;  3RT8 A;  3KZG A;  3VXB A;  4C1T A;  2OLB A;  4QSD A;  4TLM B;  2QS3 A;  3OO6 A;  2UVI A;  4NF4 A;  3VFJ A;  4DE8 A;  1D4N A;  1OIB A;  1B7U A;  4OER A;  3LUY A;  3ODB A;  1DSN A;  2O6A A;  4M1V A;  4EF1 A;  1POT A;  4KFQ A;  4RXL A;  1R9Q A;  3MPK A;  1P99 A;  2Q88 A;  5DVI A;  3FXU A;  1P1U A;  3PV0 E;  1DPP A;  3K6X A;  4LVQ A;  2DXY A;  3FXR A;  5I84 A;  5CM6 A;  4U1O A;  4G8M A;  4FEB A;  3CSB A;  2HEU A;  4Q8R A;  2Y7P A;  2I4C A;  4ELQ A;  5B7D A;  5I59 B;  5DVJ A;  1A8E A;  2O7U A;  3MUQ A;  3UGW A;  4F3S A;  1IUD A;  4H5F A;  1FQC A;  4YKP A;  5DEX A;  3QAX A;  1YPN A;  2XD3 A;  3OD7 A;  1N0T A;  1Y9U A;  2ESN A;  4F3G A;  5CMK A;  3FJ7 A;  4GXS B;  4IO2 A;  4NWD A;  2ZMB A;  5I58 A;  3M8U A;  4NF8 B;  1XC1 A;  3IB0 A;  3IAZ A;  4OFL A;  3FTO A;  4AB6 A;  4PFW A;  3VLU A;  3PGF A;  1P1O A;  3FZV A;  3T93 B;  4MLQ A;  1O64 A;  1MQI A;  2P1S A;  3CSG A;  2PT2 A;  3B7D A;  1N3W A;  2X26 A;  5AE4 A;  4FIM A;  4H1X A;  4GQO A;  4ZEC A;  2GRV A;  4OQO A;  1N7X A;  1VE4 A;  3TFL A;  4WKM A;  3MZ1 A;  1FTO A;  5FTH A;  4KCC A;  3OMB A;  1AOV A;  5I56 B;  5IKB A;  2Q8J A;  1JVY A;  3PMV A;  4DLD A;  1B6H A;  3UOR A;  1M5E A;  3VV5 A;  3T9H B;  2QS2 A;  2O1M A;  2QPQ A;  2DWJ A;  2XXQ A;  1GVC A;  2OCU A;  2UYE A;  3IOV A;  3K02 A;  3PUV E;  1OQG A;  2O68 A;  3TZA A;  1R1N A;  1QUK A;  1EZ9 A;  3G3K A;  1B32 A;  4I8C A;  1FQF A;  4KYE A;  4GF8 A;  4F1U A;  4O3B A;  1UIU A;  1MRP A;  2RF1 A;  5TPA A;  4KYS A;  2I3V A;  1B4H A;  1LAH E;  2F35 A;  2Q2A A;  4F3B A;  3EF7 A;  4GWO A;  1MXV A;  4H0W A;  2RC9 A;  1H45 A;  3PUW E;  4I9D A;  3Q25 A;  1A54 A;  4ZED A;  2V3T A;  4MH5 A;  3SDF A;  4OFJ A;  1Y1M A;  3K00 A;  3M3F A;  4XKQ A;  3WAF A;  1BIY A;  1OVT A;  2M8C A;  1MY3 A;  3PUY E;  4OWD A;  4BDN A;  4GFR A;  1B4Z A;  4ZZA A;  4R6H A;  1URS A;  5B70 A;  3PUZ E;  2NXO A;  4ELP A;  1MS7 A;  5FHN A;  1MDQ A;  5KCJ A;  3G3J A;  3IOW A;  3CFX A;  5HBC A;  5TU0 A;  4G68 A;  3SER A;  1I6Q A;  1MXX A;  1F9B A;  1B51 A;  1LB8 A;  2H4I A;  1B3G A;  3N26 A;  3OSR A;  3RYA A;  4OEN A;  1P1W A;  3SET A;  4ZS9 A;  2PBW A;  3CHG A;  4PFU A;  5TP9 A;  4EUO A;  2RIN A;  1YAE A;  1USY E;  5JK4 A;  1MY4 A;  4NTL A;  2XXV A;  4QSE A;  2R9J A;  3RYB A;  1R6Z A;  2ZNS A;  3R6U A;  4H65 A;  1UQW A;  5CI5 A;  3SEY A;  5AA2 A;  3LBS A;  3ZS6 A;  4GVO A;  4H8J A;  4FAT A;  3MJN A;  5KDT B;  1IXI A;  2RCA A;  1SW5 A;  2DWH A;  2FA7 A;  4IGR A;  3UN6 A;  2PMS A;  3FV1 A;  3FJM A;  4OES A;  2Z8F A;  4HCY A;  2NVU B;  4ISU A;  1P1N A;  5EYF A;  4THI A;  2WOP A;  1RYO A;  4GIZ A;  4NMY A;  3RNN A;  3W9W A;  1A55 A;  2XXI A;  3H6V A;  4R73 A;  2A5S A;  2ALU A;  3KN7 A;  3TTN A;  3VLW A;  3HO7 A;  2O1L A;  4ND9 A;  1MY2 A;  2RC8 A;  4NF6 B;  1RKM A;  3KSJ A;  4PET A;  1XS5 A;  4U2R A;  2IEE A;  3EQ1 A;  3QUF A;  4FEC A;  4C0R A;  3IK6 B;  2I49 A;  5ICT A;  5I2K A;  4UA8 A;  3UA8 A;  1FTM A;  3CIJ A;  4G68 B;  2CZL A;  3LSL A;  4FE8 A;  1MM7 A;  2VD2 A;  5L9S A;  5F1Q A;  1FQD A;  1HSJ A;  1PDA A;  3KOT A;  3MP1 A;  2XXY A;  3GZG A;  1B5J A;  4JWX A;  4IO7 A;  1EH3 A;  2KLF A;  3I5O A;  3DRH A;  4ZEK A;  1Y3N A;  3GBB A;  1SW2 A;  3E9X A;  1QKA A;  2HAV A;  3H06 B;  4G2Z A;  3LSF B;  4KR5 A;  2XXU A;  4YKK A;  3FIR A;  4U23 A;  3F11 A;  2BJJ X;  4XXU A;  4R2B A;  3IO6 A;  2DE4 A;  1URG A;  5DYH A;  1UIV A;  4QFL A;  2A5T A;  4IY6 A;  4QHQ A;  4F2Q A;  1IZ1 A;  1IXC A;  4BDQ A;  1IIW A;  2DS9 A;  4BDL A;  4I62 A;  2WOK A;  1MY1 A;  4IO4 A;  3ZKL A;  5K2X A;  2O51 A;  3ZKK A;  1ZKB A;  2DP8 A;  2YLN A;  2HCA A;  3TPA A;  1VR5 A;  1MY0 A;  3PPR A;  4LZ8 A;  4IB2 A;  5FHO A;  4POW A;  3TTK A;  1M5D A;  2CMO A;  4DXU A;  1T0K A;  1BKA A;  4R74 A;  3V83 A;  4NF5 A;  1B2H A;  2G29 A;  1OQH A;  3DP4 A;  3C31 A;  3MBP A;  1B5H A;  4YB6 A;  2PT1 A;  1A7L A;  3K0V A;  3Q26 A;  3OO8 A;  4U22 A;  3MAM A;  3I6V A;  5EHM A;  5HM4 B;  3KN8 A;  5H8F B;  2HFB A;  1S9T A;  3TQL A;  4DIG A;  3CFL A;  1VSO A;  1PC3 A;  3MPL A;  1II5 A;  3D4C A;  2I58 A;  1DMB A;  2V25 A;  3GLB A;  1B1H A;  3S9N C;  4R72 A;  2GHA A;  2ZYN A;  4F1Y A;  1SW4 A;  1NH8 A;  4FED A;  4IGT A;  3FUZ A;  3OXN A;  2DOJ A;  3T9V A;  3E13 X;  2Z23 A;  3TOD A;  4OFO A;  4TOZ A;  3K1P A;  3W15 C;  4F39 A;  1QKB A;  3Q28 A;  4FOR A;  3PMW A;  3USD A;  4U1Z A;  3HV1 A;  5ISU A;  3RQT A;  4GL8 A;  4RPO A;  1IQ7 A;  1MXW A;  4Z7E A;  3DP8 A;  3B6T A;  3R7X A;  4KD5 A;  3U72 A;  1HSE A;  5HPQ A;  3FVO A;  1JNF A;  4H6D A;  4LZ5 A;  4NE4 A;  1OVB A;  3IB2 A;  3O2A A;  2XXX A;  3OO7 A;  4JWY A;  3K4U A;  4E0W A;  4JSD A;  1YCJ A;  4F3P A;  3MW0 A;  4NF6 A;  2QS1 A;  4YKJ A;  3V89 B;  1RYX A;  3H6W A;  3M3L A;  5I2N A;  3SEU A;  1QUJ A;  1SI1 A;  4NF5 B;  3GBA A;  3K6U A;  3OEN A;  3TCF A;  4RK2 A;  3UP9 A;  1SQY A;  3H03 A;  4RJZ A;  3MVY A;  1JW1 A;  1QVS A;  1QW0 A;  3IOU A;  3PMX A;  4MBP A;  4OMB A;  1IEJ A;  1JVX A;  3EHS A;  4P0G A;  1NMU A;  3EPE A;  4U4X A;  3FV2 A;  4Q0C A;  2DXR A;  4ZE8 A;  1XT8 A;  1B9J A;  4RYA A;  5LOM A;  4YIC A;  4ZDM A;  3DEL B;  3A3U A;  1B3H A;  1DPE A;  4WED A;  2NOO A;  5H8H A;  5K2Y A;  1Z7M E;  1OMP A;  2UXA A;  3PPP A;  1HSL A;  4MFI A;  2V84 A;  1JET A;  1S50 A;  2ONR A;  2DE2 A;  3RUM A;  2O69 A;  4GXA A;  1QUI A;  4O3A A;  1YTV A;  2DVC A;  4RA1 A;  5AA4 A;  3EHU A;  2D21 A;  1ZIU A;  1DTZ A;  2ZYK A;  4DDD A;  2B4M A;  5F7V A;  3TDJ A;  3UK4 A;  3PD8 A;  3T22 A;  3FAT A;  3TEP A;  1TFD A;  3C34 A;  5ITO A;  4YKI A;  2HZK A;  3U1O A;  5KCJ B;  3VLV A;  2NUV A;  2DWA A;  1A99 A;  3TAJ A;  3FJG A;  3O6H A;  1BTJ A;  3C35 A;  3FVN A;  3IL1 B;  2R6G E;  4MF3 A;  5DVF A;  2F7B A;  4C1U A;  2F36 A;  2FNC A;  4KHZ E;  5I57 A;  4BDR A;  4O3C A;  1NFT A;  3MVZ A;  3C4M A;  4XKP A;  1GGG A;  3RT6 B;  2P0S A;  3TMG A;  1XHY A;  2ZYM A;  4GD5 A;  3MC2 A;  4GOT A;  1SBP A;  1FQA A;  4FAJ A;  3MZB A;  1FQE A;  1SW1 A;  1ZJL A;  3G3I A;  4GL0 A;  1XVY A;  3FVG A;  4LQ5 A;  2RCB A;  3H7M A;  3ILU B;  1BLF A;  2Y7R A;  3TCH A;  3E3K A;  2RKM A;  1MPB A;  4N13 A;  4R6Y A;  2ONS A;  1MXZ A;  2UVJ A;  2F6P A;  5FTI A;  4F19 A;  3O28 A;  5KZT A;  2A5T B;  4WXJ A;  2B3B A;  4KI0 E;  5L8D A;  1US4 A;  4LAT A;  3IB1 A;  2OJT A;  3CG1 A;  1SYH A;  3FAS A;  2H99 A;  1ZTY A;  5A5X B;  2DVZ A;  3TEL A;  4AB5 A;  3KGC A;  3H4Z A;  4EXK A;  1GTK A;  1M5B A;  3W9V A;  3T9X B;  1AH5 A;  4WEP A;  1UTH A;  3DLN A;  2QSX A;  4LQ2 A;  4Q30 B;  2YPN A;  2UVG A;  3C32 A;  5I58 B;  1BP5 A;  3DRG A;  2WKY A;  4PP0 A;  4OEU A;  4YB5 A;  4KCD A;  1Y3Q A;  3JZJ A;  3VVE A;  3VE1 B;  4POX A;  3R26 A;  3O6I A;  3Q27 A;  1LBB A;  1PB8 A;  4EQB A;  4IO3 A;  1CB6 A;  3OEM A;  4YMA A;  2HXW A;  5J1D A;  3SKP A;  1N84 A;  3FXQ A;  3MWB A;  3RLF E;  4LA9 A;  3HCQ A;  1IXG A;  4Q5T A;  3U8Q A;  3ZSF A;  4HS7 A;  4F2O A;  4QFK A;  4P11 A;  3PAM A;  3DRI A;  3N6U A;  4HW8 A;  3GXA A;  4DZ1 A;  2HAU A;  2ZXT A;  1QUL A;  3FD3 A;  2QMX A;  2XX8 A;  4R2F A;  2REJ A;  2UYF A;  3KEI A;  3CG3 A;  5JTY A;  3IX1 A;  1MPD A;  2YJP A;  2ZNT A;  4MLV A;  5L9O A;  1DTG A;  4ZEB A;  1LLS A;  3O29 A;  3O97 A;  3OOA A;  5BWJ A;  4ONY A;  2HZL A;  1TWY A;  2QRY A;  1B1X A;  5ELV A;  1Z7N E;  1TFA A;  3HHF A;  3PD9 A;  4BLA A;  4NF4 B;  1A8F A;  1R9L A;  3IJO B;  4DCX A;  3CI8 A;  1EU8 A;  2XXH A;  3CRB A;  3OEK A;  3DP6 A;  4JB7 A;  3SES A;  1LFI A;  5CMC A;  5H8Q B;  4E0X A;  1B05 A;  4XKR A;  4OVJ A;  4ELR A;  1LCF A;  4ECF A;  3VXC A;  5L9M A;  1UTB B;  3K01 A;  2QMW A;  3N94 A;  2Z22 A;  1AL3 A;  1QJM A;  4EQ7 A;  5AA3 A;  2ANJ A;  5H8N B;  5H8N A;  3EHT A;  1XOC A;  2HQ0 A;  2PVU A;  1Y20 A;  1LST A;  1NNF A;  2XXW A;  3B6W A;  3HPI A;  3O66 A;  3PPO A;  4G4P A;  2ZNU A;  4F22 A;  4YMB A;  1B3E A;  1M5F A;  4X1D A;  5CC2 A;  2F97 A;  1B3F A;  2H9B A;  1TXF A;  3IOT A;  4JXI A;  1AIV A;  3QK6 A;  1H44 A;  2I4B A;  4YU0 A;  3LC8 A;  3DM0 A;  2G93 A;  2OZZ A;  1D9Y A;  3K2D A;  4RNS A;  3PPN A;  3SEV A;  2VP1 A;  1B0L A;  4H5G A;  2H25 A;  4U21 A;  5CMB A;  2UVH A;  1IIT A;  1JEU A;  3A3C A;  3FGS A;  5I57 B;  1ATG A;  4U4S A;  5JTY B;  1AMF A;  2IA4 A;  1ZU0 A;  1PEB A;  3KSX A;  2D5W A;  1N3X A;  1US5 A;  3KJT A;  5TPA B;  3QUJ A;  1Y1Z A;  1PBP A;  4OET A;  2O84 X;  2AYS A;  2DSF A;  3V8X B;  2F5X A;  3S4U A;  3BFU A;  2Y7I A;  3B6Q A;  1FTJ A;  4BDO A;  3BBR A;  3U92 A;  4N6P A;  4EQ9 A;  3O6G A;  1B3L A;  1MQJ A;  3QSL A;  1POY 1;  2OWT A;  4ZEI A;  3H3G A;  5H8Q A;  5M2V A;  1FTL A;  3Q29 A;  3PPQ A;  4R9G A;  2Y7K A;  5H8H B;  3SEW A;  3VDF A;  2H98 A;  4DXB A;  4EXL A;  4F18 A;  2DWI A;  4XIG Q;  2LAO A;  2VD3 A;  2V93 A;  5DTB A;  4GLI A;  3G7W A;  3TTL A;  4FJP A;  1SYI A;  1B40 A;  1NNK A;  2Y84 A;  2WOL A;  3H6T A;  5H8S A;  2ZYO A;  4JSO A;  1MH4 A;  4ZZE A;  1H3D A;  3G3F A;  3A09 A;  2FYI A;  5EHS A;  2F6G A;  1MXY A;  4EF2 A;  4LUB A;  1JEV A;  4OZ9 A;  4N07 A;  4QFP A;  4R9F A;  5AA4 B;  3RPW A;  5I56 A;  2DYX A;  1Y4T A;  2XXP A;  3E4R A;  1LB9 A;  3N6T A;  1MQH A;  3SEX A;  1NNT A;  5JEI A;  4F1V A;  2XX7 A;  2D3I A;  3MP6 A;  3U94 A;  1I6B A;  5DEX B;  3MZ9 A;  3T66 A;  3T9U A;  3HST A;  3MVW A;  5CMM A;  4DXC A;  2F78 A;  1LGB C;  3QIM A;  2B3F A;  2H5Y A;  4JWO A;  4RK9 A;  3IR1 A;  5I2K B;  4JDF A;  2O7I A;  2AL5 A;  2XXT A;  1D3K A;  3QYT A;  4X48 A;  1SD3 A;  4BDM A;  1ANF A;  1ELJ A;  3VVD A;  1O63 A;  1N76 A;  2XXR A;  3LSW A;  1NNP A;  3MP8 A;  3MQ9 A;  4G8H A;  3S9M C;  2PYY A;  5TP9 B;  3O6P A;  1EZO A;  1NH7 A;  3KFM A;  2REG A;  2I0B A;  1A40 A;  1WDN A;  2NWJ A;  3RTW B;  3DRF A;  4G68 C;  4UAC A;  1DOT A;  4NWC A;  4F31 B;  1CE2 A;  3WAE A;  1MPC A;  4RY1 A;  2X7P A;  2VHA A;  2OBG A;  3MVX A;  1PB7 A;  1LAX A;  3BFT A;  3QXM A;  5IAI A;  4F29 A;  1SDX A;  1Q35 A;  5H8F A;  4XKN A;  3KBR A;  1XVX A;  2I6E A;  3D4G A;  4QFN A;  3UIF A;  1FW0 A;  2GHB A;  1LBC A;  3C33 A;  1LCT A;  4G8N A;  2XD2 A;  4M4G A;  4PFY A;  2AIX A;  1FTK A;  3ECR A;  3FVK A;  1SVX B;  2F8D A;  1KWH A;  3IJX B;  3L6G A;  3P7I A;  3KOS A;  4ZEF A;  2THI A;  3OO9 A;  2PX1 A;  1B7H A;  1MM6 A;  1JQF A;  2P2A A;  4PQJ A;  1UTH B;  3RGY A;  3RY3 A;  3TYH A;  4KQP A;  3V5A A;  1MXU A;  1FCK A;  1I69 A;  1ZMG A;  4NED A;  4P0I A;  1N7W A;  3KG2 A;  1URD A;  2V3U A;  3OEL A;  2OWS A;  3H6U A;  4ELO A;  1LAF E;  2DQV A;  1S7Y A;  2I0C A;  3TKD A;  5CBS A;  5ITP A;  3BKI B;  4H8I A;  1ZBM A;  4ESX A;  2R71 A;  2ABH A;  2I48 A;  4YZZ A;  3PUX E;  1B5I A;  4LON B;  2GH9 A;  1B0H A;  4KYD A;  4ZE9 A;  3DRJ A;  3I3V A;  5I2N B;  1MH3 A;  1NKX A;  2I3W A;  1VFD A;  4H67 A;  1MG1 A;  1VFE A;  2XX9 A;  5I59 A; 
#chains in the Genus database with same CATH topology
 2DE3 A;  2P3V A;  1P1Q A;  1IMB A;  1MQD A;  4K3F A;  2B4L A;  1FBC A;  3EN3 A;  4QF9 A;  1TT1 A;  2Q2C A;  3T96 B;  1NL5 A;  3C9H A;  3ILT B;  4L17 A;  5IAI A;  1M5C A;  2QL3 A;  3K6V A;  2Q89 A;  2E0S A;  2V3Q A;  3HN0 A;  1O7T A;  3C36 A;  5CBR A;  3G3H A;  3TCG A;  2WYK A;  1Y3P A;  1FBF A;  3LSX A;  1EZP A;  1MDP 1;  1H76 A;  1H43 A;  5A5X A;  4PFT A;  4PFI A;  4OHN A;  4XTC Q;  3KJ7 A;  4EDP A;  5I56 A;  4C1T A;  3ODB A;  4M1V A;  3U65 A;  3MPK A;  5DVI A;  3FXU A;  1DPP A;  4U1O A;  3CSB A;  2HEU A;  4Q8R A;  4YKP A;  2XD3 A;  4GXS B;  4IO2 A;  3IAZ A;  4OFL A;  3FZV A;  2P1S A;  3B7D A;  2X26 A;  1N7X A;  1VE4 A;  5IKB A;  3PMV A;  4DLD A;  1B6H A;  3UOR A;  1M5E A;  2Q8M A;  2O1M A;  2QPQ A;  2DWJ A;  1OQG A;  4N8G A;  2O68 A;  3TZA A;  1QUK A;  1B32 A;  1FBG A;  4GBW A;  4O3B A;  1UIU A;  1G0H A;  4GWO A;  4H0W A;  2RC9 A;  4MH5 A;  4OFJ A;  3K00 A;  4NHB A;  4OWD A;  3GYY A;  4R6H A;  1URS A;  3G3J A;  3CFX A;  5TU0 A;  1I6Q A;  1LBZ A;  1B51 A;  3N26 A;  4P47 A;  3RYA A;  4PGN A;  4GWW A;  4ZS9 A;  1MY4 A;  2R9J A;  2ZNS A;  1UQW A;  4P56 A;  3LBS A;  2DWH A;  4IGR A;  4HCY A;  3T1B A;  2NVU B;  4ISU A;  1RYO A;  3W9W A;  1A55 A;  2XXI A;  2ALU A;  3VLW A;  1MY2 A;  4LN5 A;  3QUF A;  4C0R A;  5I2K A;  1FTM A;  2CZL A;  1FQD A;  3KOT A;  4H45 A;  1SW2 A;  3H06 B;  3FIR A;  4U23 A;  3F11 A;  2BJJ X;  3IO6 A;  1VDW A;  4MX6 A;  4PFR A;  4IO4 A;  3ZKK A;  1MY0 A;  4IB2 A;  4POW A;  1T0K A;  4P1L A;  3V83 A;  1NI9 A;  3MBP A;  2G29 A;  4MNC A;  2PT1 A;  3MAM A;  3I6V A;  5H8F B;  2HFB A;  1PC3 A;  1II5 A;  3GLB A;  2I58 A;  2V25 A;  2ZYN A;  2Z23 A;  3TOD A;  1QKB A;  1LBY A;  3PMW A;  4U1Z A;  3B6T A;  1EYK A;  3U72 A;  2XXX A;  3OO7 A;  4JWY A;  3K4U A;  2ZZX A;  4JSD A;  4PAI A;  3H6W A;  3K6U A;  5DVJ A;  3EHS A;  1NMU A;  3FV2 A;  1XT8 A;  5LOM A;  1FJ6 A;  4ZDM A;  5H8H A;  1FPF A;  1HSL A;  2V84 A;  1QUI A;  4O3A A;  4RA1 A;  5AA4 A;  3EHU A;  1FSA A;  1DTZ A;  2ZYK A;  2B4M A;  5IM2 A;  1TFD A;  5KCJ B;  3TAJ A;  3C35 A;  4GWZ A;  5DVF A;  4PDD A;  2F7B A;  4O3C A;  3MVZ A;  3C4M A;  2P0S A;  1BK4 A;  1SW1 A;  3G3I A;  2RCB A;  4R6Y A;  4OVP A;  1MXZ A;  3PTY A;  2F6P A;  5KZT A;  2A5T B;  4WXJ A;  2B3B A;  5L8D A;  1US4 A;  3CG1 A;  3FAS A;  2H99 A;  3ROJ A;  5A5X B;  4EXK A;  1GTK A;  3W9V A;  4LQ2 A;  2YPN A;  4OEU A;  1Y3Q A;  4N6K A;  4EQB A;  1CB6 A;  5J1D A;  3FXQ A;  3MWB A;  1IXG A;  4QFK A;  3N6U A;  3FD3 A;  2QMX A;  2CZH A;  2PFZ A;  3O29 A;  1IMF A;  2HZL A;  5ELV A;  4NF4 B;  1R9L A;  3D1R A;  5IGA A;  2XXH A;  1CNQ A;  1LFI A;  5CMC A;  1B05 A;  4XKR A;  4ECF A;  1FPB A;  5ESY A;  4P1E A;  2ANJ A;  2HQ0 A;  3HPI A;  4N4U A;  2ZNU A;  1B3E A;  2H9B A;  1AIV A;  1H44 A;  3DM0 A;  4XFE A;  3PPN A;  3SEV A;  4H5G A;  5CMB A;  3FGS A;  1IIT A;  1ZU0 A;  1FPL A;  1PEB A;  2FVZ A;  1Y1Z A;  4OET A;  2O84 X;  1K9Z A;  4BDO A;  4N6P A;  1MQJ A;  5M2V A;  5EQ7 A;  1KA0 A;  4F18 A;  4EXL A;  2DWI A;  3G7W A;  4FJP A;  5T3J A;  1B40 A;  1NNK A;  2WOL A;  2ZYO A;  4ZZE A;  2Q74 A;  5AA4 B;  3N6T A;  3SEX A;  4NQ8 A;  3T66 A;  4DXC A;  2F78 A;  4RK9 A;  3QYT A;  4X48 A;  1ANF A;  1ELJ A;  3MP8 A;  2F3B A;  1A40 A;  3RTW B;  4G68 C;  2VHA A;  2OBG A;  3BFT A;  4OVQ A;  4P9K A;  1XVX A;  3C33 A;  1LCT A;  4G8N A;  2F8D A;  3L6G A;  2PX1 A;  1B7H A;  4PQJ A;  3RGY A;  3TYH A;  4ELO A;  2I0C A;  2ABH A;  1FPD A;  1B5I A;  3I3V A;  2I3W A;  1VFE A;  4GWU A;  1PB9 A;  3G3G A;  4KPT A;  3RTF B;  4LZ7 A;  3CFZ A;  3KN3 A;  4HCW A;  4OYV A;  3VVF A;  2Z8D A;  1I6A A;  2Q9T A;  3O9P A;  1AWB A;  1IXH A;  3LR1 A;  1ZLQ A;  4TQU Q;  5ET5 A;  3TUS A;  1JW4 A;  4NF8 A;  1WVJ A;  1UTB A;  4G77 A;  4TLL B;  1B58 A;  2QVR A;  2Y5K A;  1N04 A;  5ICQ A;  1J1N A;  4PF8 A;  5FHM A;  1OLC A;  5DT6 A;  1Y4C A;  3PU5 A;  4Z0I A;  4GX4 A;  4I1D A;  2X7Q A;  3FBP A;  4GRK A;  4OEV A;  1PBQ A;  1Q1K A;  2QJE A;  3KZG A;  4QSD A;  4NF4 A;  4DE8 A;  4I40 A;  1D4N A;  4OER A;  3LUY A;  4P3L A;  4KFQ A;  4RXL A;  5CM6 A;  2I4C A;  5B7D A;  3UGW A;  4H5F A;  3QAX A;  1YPN A;  2XWK A;  1N0T A;  1Y9U A;  2ESN A;  4NWD A;  3M8U A;  1XC1 A;  3FTO A;  4AB6 A;  3ISP A;  4MLQ A;  1O64 A;  1MQI A;  2PT2 A;  1N3W A;  4GQO A;  1FTO A;  1AOV A;  1JVY A;  4N15 A;  2QS2 A;  2XXQ A;  2UYE A;  3IOV A;  3K02 A;  3PUV E;  4MAG A;  1EZ9 A;  4I8C A;  1IMA A;  4F1U A;  2I3V A;  4F3B A;  2F35 A;  4KXP A;  1FBD A;  1H45 A;  2QFL A;  2QVU A;  3Q25 A;  3SDF A;  1Y1M A;  3M3F A;  2WBD A;  4XKQ A;  4BDN A;  1OVT A;  1MY3 A;  2XWO A;  3PUZ E;  1MS7 A;  3A29 A;  3IOW A;  4NGU A;  5HBC A;  2WBB A;  1MXX A;  1F9B A;  1LB8 A;  4OEN A;  1P1W A;  4PFU A;  4EUO A;  4XF5 A;  2XXV A;  3R6U A;  3RYB A;  3SEY A;  5AA2 A;  4H8J A;  1LBW A;  1SW5 A;  2PMS A;  3FV1 A;  4NN3 A;  4GWX A;  1P1N A;  4THI A;  4GIZ A;  3B8B A;  4R73 A;  4ND9 A;  4NF6 B;  4PET A;  1XS5 A;  3EQ1 A;  3IK6 B;  4QBA A;  2XXY A;  1B5J A;  5LTC A;  2KLF A;  3DRH A;  3GBB A;  1QKA A;  2HAV A;  5J16 A;  1INP A;  2XA5 A;  4F2Q A;  1IZ1 A;  2DS9 A;  4I62 A;  1MY1 A;  4XEQ A;  2O51 A;  1NUZ A;  1ZKB A;  2HCA A;  4FAT A;  4LZ8 A;  4DXU A;  2CMO A;  1BKA A;  4R74 A;  2FBP A;  1B2H A;  3DP4 A;  1B5H A;  1NV1 A;  4YB6 A;  3K0V A;  3Q26 A;  5HM4 B;  3KN8 A;  2BJI A;  4GX3 A;  3MPL A;  1DMB A;  1B1H A;  4F1Y A;  4IGT A;  3FUZ A;  1IMD A;  3T9V A;  3E13 X;  1IMC A;  4OFO A;  4TOZ A;  3Q28 A;  4FOR A;  3USD A;  5ISU A;  3RQT A;  4GL8 A;  4Z7E A;  3DP8 A;  4KD5 A;  5HPQ A;  1HSE A;  3FVO A;  3O2A A;  1NV7 A;  1YCJ A;  1RYX A;  5I2N A;  4NF5 B;  4MCO A;  1SQY A;  3H03 A;  4MBP A;  4P0G A;  4YIC A;  2MKZ A;  2XWV A;  3A3U A;  3PPP A;  2UXA A;  1Q9D A;  4GWS A;  2DE2 A;  2O69 A;  4N8Y A;  1NV3 A;  1ZIU A;  1EYI A;  3PD8 A;  1DK4 A;  3FAT A;  3U1O A;  2HZK A;  2DWA A;  1A99 A;  3O6H A;  3IL1 B;  2R6G E;  4MF3 A;  1YZ0 A;  2FNC A;  5I57 A;  4BDR A;  2QVV A;  3MC2 A;  4FAJ A;  1ZJL A;  4LQ5 A;  3ILU B;  4DI3 D;  3TCH A;  2RKM A;  1MPB A;  4N13 A;  2UVJ A;  4F19 A;  4MEV A;  3O28 A;  4JVI A;  4KI0 E;  1SYH A;  3H4Z A;  4O8M A;  4Q30 B;  2UVG A;  4KCD A;  3O6I A;  1LBB A;  2HXW A;  3SKP A;  5I3S A;  4LA9 A;  1LBX A;  4F2O A;  4P11 A;  3PAM A;  4NAP A;  4DZ1 A;  2ZXT A;  2REJ A;  3KEI A;  1MPD A;  5L9O A;  4MLV A;  5EQ9 A;  2WEF A;  1FBE A;  4H46 A;  2QRY A;  1B1X A;  1TFA A;  4QXD A;  4BLA A;  4O7M A;  4ELR A;  5F24 A;  1FRP A;  3N94 A;  1AL3 A;  5H8N B;  3B6W A;  1Y20 A;  5I57 B;  2F97 A;  1TXF A;  4YU0 A;  2OZZ A;  2FHY A;  3K2D A;  2H25 A;  1JEU A;  4U4S A;  5JTY B;  1AMF A;  2IA4 A;  5DW8 A;  1N3X A;  2AYS A;  2DSF A;  3V8X B;  3BFU A;  4HE2 A;  4EQ9 A;  1B3L A;  3QSL A;  3RUM A;  5H8Q A;  3VDF A;  1FBP A;  3PPQ A;  4R9G A;  5DTB A;  1RDY A;  5I5P A;  3H6T A;  2PCR A;  5H8S A;  1H3D A;  1DBZ A;  3A09 A;  1MXY A;  4MJO A;  4N07 A;  1Y4T A;  1NNT A;  2D3I A;  3MP6 A;  1I6B A;  3MZ9 A;  3HST A;  4HXV A;  2B3F A;  1KZ8 A;  2O7I A;  2AL5 A;  1D3K A;  3VVD A;  2XXR A;  1NUY A;  4N6D A;  3S9M C;  3IFA A;  5TP9 B;  1NH7 A;  2NWJ A;  2KQZ A;  2X7P A;  1PB7 A;  3QXM A;  1SDX A;  1Q35 A;  4I3Y A;  5H8F A;  3KBR A;  1LBC A;  4HE0 A;  3ECR A;  3FVK A;  5ET8 A;  1FPI A;  1SVX B;  1KWH A;  3IJX B;  3P7I A;  4ZEF A;  2WX9 A;  1MM6 A;  4KQP A;  4O94 A;  3KG2 A;  2V3U A;  3H6U A;  5CBS A;  3TKD A;  1NV2 A;  4H8I A;  2R71 A;  4AS4 A;  4LON B;  3DRJ A;  1MH3 A;  1NKX A;  1VFD A;  2XX9 A;  4OXV A;  2QS4 A;  2E1S A;  2P3N A;  1GR2 A;  4IO5 A;  3S9E A;  4YB7 A;  3RYD A;  1SI0 A;  2RC7 A;  4IO6 A;  1LFH A;  5KDT A;  4ESW A;  2F7A A;  1LAG E;  2F34 A;  2VOZ A;  1OLA A;  3OSQ A;  1D9V A;  1USY H;  3JYR A;  3N5L A;  3LVU A;  2ONK E;  4AQ4 A;  4QRZ A;  4X1B A;  4X9T A;  4MNI A;  2OK2 A;  5AA1 A;  5AA2 B;  1B46 A;  4YAH X;  3S9L C;  1G0I A;  1L5T A;  4R6K A;  5CRY A;  3S2V A;  4QSC A;  2VGQ A;  4DCY A;  4HTG A;  4LP2 B;  2XWI A;  4TLM B;  3OO6 A;  1OIB A;  1B7U A;  1DSN A;  2O6A A;  1POT A;  2CZK A;  1R9Q A;  5ET7 A;  1P99 A;  2Q88 A;  2OX3 A;  1P1U A;  3PV0 E;  3K6X A;  5I84 A;  2DXY A;  4G8M A;  4FEB A;  2HXR A;  5I59 B;  3FXB A;  3MUQ A;  4F3S A;  1IUD A;  3OD7 A;  3FJ7 A;  2ZMB A;  5I58 A;  4NF8 B;  4GWY A;  4PFW A;  3VLU A;  3PGF A;  4PBH A;  5AE4 A;  4FIM A;  3OMB A;  2Q8J A;  3VV5 A;  1GVC A;  2OCU A;  4GF8 A;  1MRP A;  2Q2A A;  3EF7 A;  3PUW E;  4JVD A;  1A54 A;  4ZED A;  3WAF A;  2M8C A;  3EKI A;  4GFR A;  5B70 A;  3RPL A;  5EYG A;  4ELP A;  5FHN A;  2H4I A;  3CHG A;  5JK4 A;  2RIN A;  1USY E;  4NTL A;  4H65 A;  5CI5 A;  2HHM A;  3ZS6 A;  5KDT B;  3MJN A;  2FA7 A;  3UN6 A;  2Z8F A;  2WOP A;  3KN7 A;  3HO7 A;  2O1L A;  2RC8 A;  2JJK A;  1RKM A;  4U2R A;  4FEC A;  4O7I A;  1FTA A;  4UA8 A;  4OVR A;  4G68 B;  3LSL A;  5L9S A;  1HSJ A;  1PDA A;  3GZG A;  3I5O A;  4ZEK A;  4KR5 A;  5H8H B;  4G2Z A;  3LSF B;  2XXU A;  4YKK A;  5IZ1 A;  2DE4 A;  5DYH A;  2A5T A;  4QFL A;  1IXC A;  1NV0 A;  5K2X A;  3PPR A;  5FHO A;  4NF5 A;  1OQH A;  1A7L A;  5EHM A;  4DIG A;  3CFL A;  5I7I A;  4KYE A;  1VSO A;  3D4C A;  3S9N C;  4R72 A;  1SW4 A;  1NH8 A;  4FED A;  3K1P A;  3W15 C;  4DI4 B;  3R7X A;  4H6D A;  1OVB A;  3IB2 A;  4E0W A;  4OA4 A;  4F3P A;  4PGP A;  2QS1 A;  3SEU A;  1QUJ A;  1SI1 A;  3TCF A;  4RK2 A;  3UP9 A;  4RJZ A;  3MVY A;  4OMB A;  1QW0 A;  3IOU A;  3RN8 A;  5ICT A;  1IEJ A;  3EPE A;  4Q0C A;  4ZE8 A;  4RYA A;  1B9J A;  3LUZ A;  1DPE A;  4WED A;  2NOO A;  4NG7 A;  5K2Y A;  1Z7M E;  4GXA A;  4N81 A;  3T0J A;  4UAB A;  5F7V A;  3TDJ A;  3T22 A;  1KA1 A;  2ZZV A;  2NUV A;  3FJG A;  3FVN A;  4C1U A;  2F36 A;  1FPE A;  4XKP A;  1GGG A;  1XHY A;  2ZYM A;  4GD5 A;  1SBP A;  1FQA A;  1FQE A;  4GL0 A;  1XVY A;  3FVG A;  2Y7R A;  4PAK A;  5FTI A;  4OVT A;  4LAT A;  2OJT A;  1ZTY A;  2DVZ A;  3TEL A;  4AB5 A;  3C32 A;  3DRG A;  4PP0 A;  3JZJ A;  3VVE A;  3VE1 B;  4POX A;  3R26 A;  3OEM A;  3U8Q A;  1QUL A;  4R2F A;  5JTY A;  2ZNT A;  4ZEB A;  1LLS A;  3OOA A;  5BWJ A;  1DCU A;  1TWY A;  3HHF A;  3PD9 A;  3HFU A;  1A8F A;  3IJO B;  3CI8 A;  3OEK A;  1EU8 A;  3CRB A;  3DP6 A;  5H8Q B;  4E0X A;  4OVJ A;  1LCF A;  5L9M A;  3K01 A;  2Z22 A;  3EHT A;  1NNF A;  2XXW A;  3O66 A;  4G4P A;  4F22 A;  3IOT A;  4JXI A;  3QK6 A;  2I4B A;  3BIH A;  1D9Y A;  2VP1 A;  2KR0 A;  1FPJ A;  2UVH A;  1ATG A;  5TPA B;  1US5 A;  1PBP A;  2Y7I A;  3B6Q A;  2ZZW A;  3U92 A;  1POY 1;  5I56 B;  3H3G A;  3SEW A;  2H98 A;  4DXB A;  4XIG Q;  2LAO A;  2VD3 A;  2V93 A;  4GLI A;  3LV0 A;  1SYI A;  2Y84 A;  1MH4 A;  3G3F A;  4N91 A;  2FYI A;  5EHS A;  1JP4 A;  3IFC A;  4R9F A;  1YYZ A;  2XXP A;  1MQH A;  4F1V A;  2XX7 A;  4P8B A;  5DEX B;  3T9U A;  5CMM A;  5I2K B;  4JDF A;  2CEX A;  4BDM A;  1SD3 A;  4OVS A;  3SZP A;  1N76 A;  3LSW A;  1NNP A;  4G8H A;  2PYY A;  3E79 A;  1EZO A;  3KFM A;  1WDN A;  5ET6 A;  4NWC A;  1MPC A;  4RY1 A;  2HPG A;  2I6E A;  3D4G A;  1FW0 A;  2GHB A;  2XD2 A;  4PFY A;  2AIX A;  3KC0 A;  2THI A;  3OO9 A;  1NV4 A;  2P2A A;  3RY3 A;  3V5A A;  1MXU A;  1N7W A;  3OEL A;  1NV5 A;  1LAF E;  1S7Y A;  2WYP A;  3E78 A;  4ESX A;  1ZBM A;  2I48 A;  4YZZ A;  3PUX E;  4KYD A;  1B0H A;  1LEV A;  4H67 A;  3Q29 A;  1MG1 A;  3UK4 A;  5I59 A;  4QFO A;  3L6H A;  4OTE A;  1IME A;  1GV8 A;  5LDZ A;  3HHG A;  1B7Z A;  4RPN A;  3TQW A;  1LFG A;  3CVG A;  3CR9 A;  3AXF A;  2GFE A;  2R8T A;  2XXK A;  3IO4 A;  3KC1 A;  3DRK A;  1XI6 A;  1WOD A;  5AA2 D;  1JW5 A;  2Z8E A;  5H8N A;  3M3K A;  3TTM A;  3JV9 A;  4IY5 A;  2Y7W A;  2XHD A;  3K6W A;  3K1M A;  3IOR A;  5BUU A;  3THI A;  4JBZ A;  2AL4 A;  1MQG A;  3U93 A;  3TTR A;  1K9Y A;  4PE5 B;  1SPI A;  4R75 A;  2B65 A;  2W7Y A;  3ONM A;  3RPL B;  2F7C A;  3K1N A;  4MHF A;  3RT8 A;  1B52 A;  1FQB A;  3VXB A;  3NOH A;  2OLB A;  3VFJ A;  2QS3 A;  4PDH A;  2UVI A;  4EF1 A;  4LVQ A;  1NUX A;  3FXR A;  3BIG A;  2Y7P A;  4PAF A;  4ELQ A;  1A8E A;  2O7U A;  1FQC A;  5DEX A;  4F3G A;  5CMK A;  3IB0 A;  1FPK A;  1P1O A;  3T93 B;  3CSG A;  4H1X A;  4ZEC A;  2GRV A;  4OQO A;  3TFL A;  4WKM A;  3MZ1 A;  5FTH A;  4KCC A;  3T9H B;  4X8R A;  1R1N A;  3G3K A;  1FQF A;  3MST A;  2Y5L A;  5TPA A;  2RF1 A;  2V4C A;  4KYS A;  1B4H A;  1LAH E;  1MXV A;  4I9D A;  2V3T A;  1BIY A;  3PUY E;  1B4Z A;  4ZZA A;  2NXO A;  1MDQ A;  5KCJ A;  4G68 A;  3SER A;  3OSR A;  1B3G A;  1NUW A;  3SET A;  2PBW A;  5TP9 A;  1YAE A;  4QSE A;  1R6Z A;  4OAN A;  4JVC A;  4GVO A;  1IXI A;  2RCA A;  2GQ1 A;  3FJM A;  4OES A;  5EYF A;  4NMY A;  3RNN A;  3TTN A;  3H6V A;  2A5S A;  5FBP A;  3KSJ A;  2IEE A;  2I49 A;  3UA8 A;  3CIJ A;  4FE8 A;  1FJ9 A;  5EQA A;  1MM7 A;  2VD2 A;  2FIX A;  5F1Q A;  2OWZ A;  3MP1 A;  4JWX A;  4IO7 A;  1EH3 A;  1Y3N A;  3E9X A;  5IZZ A;  1D9Q A;  4XXU A;  4R2B A;  1URG A;  1UIV A;  4IY6 A;  4QHQ A;  4BDQ A;  1IIW A;  4I3E A;  4BDL A;  2WOK A;  3ZKL A;  2DP8 A;  2YLN A;  3TPA A;  1VR5 A;  4AS5 A;  3TTK A;  1M5D A;  2CEY A;  4PE3 A;  3C31 A;  4U22 A;  4X04 A;  3KBZ A;  3OO8 A;  3TQL A;  1S9T A;  4PF6 A;  2GHA A;  4PBQ A;  3OXN A;  2DOJ A;  4NF0 A;  4F39 A;  3HV1 A;  4N17 A;  4RPO A;  1IQ7 A;  1MXW A;  1JNF A;  4NE4 A;  4LZ5 A;  3MW0 A;  1EYJ A;  4NF6 A;  4YKJ A;  3V89 B;  3M3L A;  2VT5 A;  3GBA A;  3OEN A;  1JW1 A;  1QVS A;  3PMX A;  4U4X A;  1JVX A;  3QMF A;  2DXR A;  3DEL B;  1B3H A;  1OMP A;  4MFI A;  1JET A;  1S50 A;  2ONR A;  1YTV A;  2DVC A;  4HE1 A;  2D21 A;  4DDD A;  3TEP A;  3C34 A;  5ITO A;  4YKI A;  3VLV A;  5IZ3 B;  1BTJ A;  4KHZ E;  1NFT A;  3RT6 B;  3TMG A;  2VPO A;  4GOT A;  3MZB A;  3H7M A;  1BLF A;  3E3K A;  2ONS A;  2L5V A;  3IB1 A;  1QGX A;  3KGC A;  1M5B A;  3T9X B;  1AH5 A;  4WEP A;  1UTH A;  2DDK A;  2QSX A;  3DLN A;  1RDX A;  5I58 B;  1BP5 A;  2WKY A;  4YB5 A;  3Q27 A;  1PB8 A;  4IO3 A;  2CZI A;  4YMA A;  1N84 A;  5EQ8 A;  3RLF E;  3HCQ A;  4Q5T A;  3ZSF A;  4MNP A;  4HS7 A;  3DRI A;  4HW8 A;  3GXA A;  2HAU A;  2XX8 A;  2UYF A;  3CG3 A;  3IX1 A;  1FBH A;  2YJP A;  4MMP A;  1DTG A;  3B50 A;  3O97 A;  4GBV A;  4ONY A;  1Z7N E;  4DCX A;  3SES A;  4JB7 A;  3VXC A;  1UTB B;  2QMW A;  4EQ7 A;  1QJM A;  5AA3 A;  1XOC A;  2PVU A;  1LST A;  3PPO A;  4YMB A;  1M5F A;  4X1D A;  5CC2 A;  1B3F A;  1LBV A;  3LC8 A;  2G93 A;  4RNS A;  1B0L A;  4U21 A;  3A3C A;  3KSX A;  2D5W A;  1NV6 A;  3KJT A;  4MIJ A;  3QUJ A;  4G61 A;  2F5X A;  3S4U A;  5EYH A;  1FTJ A;  3BBR A;  1YXI A;  1FPG A;  4FBP A;  3O6G A;  2OWT A;  4ZEI A;  1FTL A;  2Y7K A;  3TTL A;  4JSO A;  2F6G A;  4EF2 A;  4LUB A;  1JEV A;  4OZ9 A;  4PFB A;  4QFP A;  3RPW A;  2DYX A;  3E4R A;  1LB9 A;  5JEI A;  3U94 A;  5A5L A;  2FIE A;  3MVW A;  5IZ3 A;  4IR8 A;  1LGB C;  3QIM A;  2H5Y A;  4JWO A;  3IR1 A;  2PFY A;  2XXT A;  4PC9 A;  1O63 A;  3MQ9 A;  3O6P A;  2REG A;  2I0B A;  3DRF A;  4UAC A;  1DOT A;  4F31 B;  1CE2 A;  3WAE A;  4PTK A;  3MVX A;  1LAX A;  4F29 A;  4XKN A;  3UIF A;  4QFN A;  4NX1 A;  4M4G A;  1FTK A;  3KOS A;  1JQF A;  1UTH B;  4GX6 A;  1FCK A;  1I69 A;  1ZMG A;  2VPN A;  4NED A;  4P0I A;  1URD A;  3MYU A;  2OWS A;  2DQV A;  5ITP A;  2F3D A;  3BKI B;  1RDZ A;  2GH9 A;  4ZE9 A;  4PCD A;  5I2N B; 
#chains in the Genus database with same CATH homology
 4OXV A;  4QFO A;  1PB9 A;  3L6H A;  4OTE A;  2DE3 A;  2E1S A;  2QS4 A;  3G3G A;  4KPT A;  1GV8 A;  1P1Q A;  3RTF B;  1MQD A;  4LZ7 A;  4K3F A;  3HHG A;  1GR2 A;  1B7Z A;  3CFZ A;  4IO5 A;  3KN3 A;  2B4L A;  4RPN A;  4YB7 A;  3S9E A;  1SI0 A;  2RC7 A;  4HCW A;  3EN3 A;  3TQW A;  4OYV A;  1LFG A;  3VVF A;  4IO6 A;  2Z8D A;  3CVG A;  3CR9 A;  1I6A A;  2Q9T A;  4QF9 A;  3O9P A;  5KDT A;  1LFH A;  1IXH A;  3LR1 A;  1ZLQ A;  4TQU Q;  3AXF A;  2GFE A;  4ESW A;  2F7A A;  1TT1 A;  1LAG E;  3TUS A;  1JW4 A;  2F34 A;  2Q2C A;  2VOZ A;  4NF8 A;  3T96 B;  1OLA A;  3OSQ A;  1D9V A;  1NL5 A;  3IO4 A;  3DRK A;  1WVJ A;  1WOD A;  1UTB A;  4G77 A;  4TLL B;  5AA2 D;  1B58 A;  3C9H A;  3ILT B;  1JW5 A;  1N04 A;  1USY H;  5ICQ A;  2Z8E A;  3JYR A;  1J1N A;  3M3K A;  3N5L A;  4L17 A;  1M5C A;  2QL3 A;  3K6V A;  2Q89 A;  5FHM A;  2E0S A;  3LVU A;  2V3Q A;  3HN0 A;  3TTM A;  1OLC A;  3JV9 A;  2ONK E;  5DT6 A;  4AQ4 A;  4IY5 A;  4QRZ A;  1O7T A;  4X1B A;  3C36 A;  2Y7W A;  2XHD A;  3K6W A;  4X9T A;  3K1M A;  3IOR A;  1Y4C A;  2OK2 A;  3PU5 A;  5AA1 A;  5CBR A;  4Z0I A;  5AA2 B;  3G3H A;  4I1D A;  3THI A;  5BUU A;  2X7Q A;  3TCG A;  1B46 A;  4YAH X;  4JBZ A;  1Y3P A;  2AL4 A;  1MQG A;  4GRK A;  3U93 A;  3S9L C;  3LSX A;  1EZP A;  3TTR A;  1MDP 1;  1H76 A;  1H43 A;  4PE5 B;  5A5X A;  4OEV A;  4R75 A;  4R6K A;  5CRY A;  1L5T A;  3RN8 A;  3S2V A;  4PFT A;  2B65 A;  2W7Y A;  3ONM A;  1PBQ A;  2VGQ A;  4OHN A;  4DCY A;  3KJ7 A;  4QSC A;  4HTG A;  4XTC Q;  4EDP A;  2F7C A;  1Q1K A;  3K1N A;  2QJE A;  1B52 A;  1FQB A;  4LP2 B;  3RT8 A;  3KZG A;  3VXB A;  4C1T A;  2OLB A;  4QSD A;  4TLM B;  2QS3 A;  3OO6 A;  2UVI A;  4NF4 A;  3VFJ A;  4DE8 A;  1D4N A;  1OIB A;  1B7U A;  4OER A;  3LUY A;  3ODB A;  1DSN A;  2O6A A;  4M1V A;  4EF1 A;  1POT A;  4KFQ A;  4RXL A;  1R9Q A;  3MPK A;  1P99 A;  2Q88 A;  5DVI A;  3FXU A;  1P1U A;  3PV0 E;  1DPP A;  3K6X A;  4LVQ A;  2DXY A;  3FXR A;  5I84 A;  5CM6 A;  4U1O A;  4G8M A;  4FEB A;  3CSB A;  2HEU A;  4Q8R A;  2Y7P A;  2I4C A;  4ELQ A;  5B7D A;  5I59 B;  5DVJ A;  1A8E A;  2O7U A;  3MUQ A;  3UGW A;  4F3S A;  1IUD A;  4H5F A;  1FQC A;  4YKP A;  5DEX A;  3QAX A;  1YPN A;  2XD3 A;  3OD7 A;  1N0T A;  1Y9U A;  2ESN A;  4F3G A;  5CMK A;  3FJ7 A;  4GXS B;  4IO2 A;  4NWD A;  2ZMB A;  5I58 A;  3M8U A;  4NF8 B;  1XC1 A;  3IB0 A;  3IAZ A;  4OFL A;  3FTO A;  4AB6 A;  4PFW A;  3VLU A;  3PGF A;  1P1O A;  3FZV A;  3T93 B;  4MLQ A;  1O64 A;  1MQI A;  2P1S A;  3CSG A;  2PT2 A;  3B7D A;  1N3W A;  2X26 A;  5AE4 A;  4FIM A;  4H1X A;  4GQO A;  4ZEC A;  2GRV A;  4OQO A;  1N7X A;  1VE4 A;  3TFL A;  4WKM A;  3MZ1 A;  1FTO A;  5FTH A;  4KCC A;  3OMB A;  1AOV A;  5I56 B;  5IKB A;  2Q8J A;  1JVY A;  3PMV A;  4DLD A;  1B6H A;  3UOR A;  1M5E A;  3VV5 A;  3T9H B;  2QS2 A;  2O1M A;  2QPQ A;  2DWJ A;  2XXQ A;  1GVC A;  2OCU A;  2UYE A;  3IOV A;  3K02 A;  3PUV E;  1OQG A;  2O68 A;  3TZA A;  1R1N A;  1QUK A;  1EZ9 A;  3G3K A;  1B32 A;  4I8C A;  1FQF A;  4KYE A;  4GF8 A;  4F1U A;  4O3B A;  1UIU A;  1MRP A;  2RF1 A;  5TPA A;  4KYS A;  2I3V A;  1B4H A;  1LAH E;  2F35 A;  2Q2A A;  4F3B A;  3EF7 A;  4GWO A;  1MXV A;  4H0W A;  2RC9 A;  1H45 A;  3PUW E;  4I9D A;  3Q25 A;  1A54 A;  4ZED A;  2V3T A;  4MH5 A;  3SDF A;  4OFJ A;  1Y1M A;  3K00 A;  3M3F A;  4XKQ A;  3WAF A;  1BIY A;  1OVT A;  2M8C A;  1MY3 A;  3PUY E;  4OWD A;  4BDN A;  4GFR A;  1B4Z A;  4ZZA A;  4R6H A;  1URS A;  5B70 A;  3PUZ E;  2NXO A;  4ELP A;  1MS7 A;  5FHN A;  1MDQ A;  5KCJ A;  3G3J A;  3IOW A;  3CFX A;  5HBC A;  5TU0 A;  4G68 A;  3SER A;  1I6Q A;  1MXX A;  1F9B A;  1B51 A;  1LB8 A;  2H4I A;  1B3G A;  3N26 A;  3OSR A;  3RYA A;  4OEN A;  1P1W A;  3SET A;  4ZS9 A;  2PBW A;  3CHG A;  4PFU A;  5TP9 A;  4EUO A;  2RIN A;  1YAE A;  1USY E;  5JK4 A;  1MY4 A;  4NTL A;  2XXV A;  4QSE A;  2R9J A;  3RYB A;  1R6Z A;  2ZNS A;  3R6U A;  4H65 A;  1UQW A;  5CI5 A;  3SEY A;  5AA2 A;  3LBS A;  3ZS6 A;  4GVO A;  4H8J A;  4FAT A;  3MJN A;  5KDT B;  1IXI A;  2RCA A;  1SW5 A;  2DWH A;  2FA7 A;  4IGR A;  3UN6 A;  2PMS A;  3FV1 A;  3FJM A;  4OES A;  2Z8F A;  4HCY A;  2NVU B;  4ISU A;  1P1N A;  5EYF A;  4THI A;  2WOP A;  1RYO A;  4GIZ A;  4NMY A;  3RNN A;  3W9W A;  1A55 A;  2XXI A;  3H6V A;  4R73 A;  2A5S A;  2ALU A;  3KN7 A;  3TTN A;  3VLW A;  3HO7 A;  2O1L A;  4ND9 A;  1MY2 A;  2RC8 A;  4NF6 B;  1RKM A;  3KSJ A;  4PET A;  1XS5 A;  4U2R A;  2IEE A;  3EQ1 A;  3QUF A;  4FEC A;  4C0R A;  3IK6 B;  2I49 A;  5ICT A;  5I2K A;  4UA8 A;  3UA8 A;  1FTM A;  3CIJ A;  4G68 B;  2CZL A;  3LSL A;  4FE8 A;  1MM7 A;  2VD2 A;  5L9S A;  5F1Q A;  1FQD A;  1HSJ A;  1PDA A;  3KOT A;  3MP1 A;  2XXY A;  3GZG A;  1B5J A;  4JWX A;  4IO7 A;  1EH3 A;  2KLF A;  3I5O A;  3DRH A;  4ZEK A;  1Y3N A;  3GBB A;  1SW2 A;  3E9X A;  1QKA A;  2HAV A;  3H06 B;  4G2Z A;  3LSF B;  4KR5 A;  2XXU A;  4YKK A;  3FIR A;  4U23 A;  3F11 A;  2BJJ X;  4XXU A;  4R2B A;  3IO6 A;  2DE4 A;  1URG A;  5DYH A;  1UIV A;  4QFL A;  2A5T A;  4IY6 A;  4QHQ A;  4F2Q A;  1IZ1 A;  1IXC A;  4BDQ A;  1IIW A;  2DS9 A;  4BDL A;  4I62 A;  2WOK A;  1MY1 A;  4IO4 A;  3ZKL A;  5K2X A;  2O51 A;  3ZKK A;  1ZKB A;  2DP8 A;  2YLN A;  2HCA A;  3TPA A;  1VR5 A;  1MY0 A;  3PPR A;  4LZ8 A;  4IB2 A;  5FHO A;  4POW A;  3TTK A;  1M5D A;  2CMO A;  4DXU A;  1T0K A;  1BKA A;  4R74 A;  3V83 A;  4NF5 A;  1B2H A;  2G29 A;  1OQH A;  3DP4 A;  3C31 A;  3MBP A;  1B5H A;  4YB6 A;  2PT1 A;  1A7L A;  3K0V A;  3Q26 A;  3OO8 A;  4U22 A;  3MAM A;  3I6V A;  5EHM A;  5HM4 B;  3KN8 A;  5H8F B;  2HFB A;  1S9T A;  3TQL A;  4DIG A;  3CFL A;  1VSO A;  1PC3 A;  3MPL A;  1II5 A;  3D4C A;  2I58 A;  1DMB A;  2V25 A;  3GLB A;  1B1H A;  3S9N C;  4R72 A;  2GHA A;  2ZYN A;  4F1Y A;  1SW4 A;  1NH8 A;  4FED A;  4IGT A;  3FUZ A;  3OXN A;  2DOJ A;  3T9V A;  3E13 X;  2Z23 A;  3TOD A;  4OFO A;  4TOZ A;  3K1P A;  3W15 C;  4F39 A;  1QKB A;  3Q28 A;  4FOR A;  3PMW A;  3USD A;  4U1Z A;  3HV1 A;  5ISU A;  3RQT A;  4GL8 A;  4RPO A;  1IQ7 A;  1MXW A;  4Z7E A;  3DP8 A;  3B6T A;  3R7X A;  4KD5 A;  3U72 A;  1HSE A;  5HPQ A;  3FVO A;  1JNF A;  4H6D A;  4LZ5 A;  4NE4 A;  1OVB A;  3IB2 A;  3O2A A;  2XXX A;  3OO7 A;  4JWY A;  3K4U A;  4E0W A;  4JSD A;  1YCJ A;  4F3P A;  3MW0 A;  4NF6 A;  2QS1 A;  4YKJ A;  3V89 B;  1RYX A;  3H6W A;  3M3L A;  5I2N A;  3SEU A;  1QUJ A;  1SI1 A;  4NF5 B;  3GBA A;  3K6U A;  3OEN A;  3TCF A;  4RK2 A;  3UP9 A;  1SQY A;  3H03 A;  4RJZ A;  3MVY A;  1JW1 A;  1QVS A;  1QW0 A;  3IOU A;  3PMX A;  4MBP A;  4OMB A;  1IEJ A;  1JVX A;  3EHS A;  4P0G A;  1NMU A;  3EPE A;  4U4X A;  3FV2 A;  4Q0C A;  2DXR A;  4ZE8 A;  1XT8 A;  1B9J A;  4RYA A;  5LOM A;  4YIC A;  4ZDM A;  3DEL B;  3A3U A;  1B3H A;  1DPE A;  4WED A;  2NOO A;  5H8H A;  5K2Y A;  1Z7M E;  1OMP A;  2UXA A;  3PPP A;  1HSL A;  4MFI A;  2V84 A;  1JET A;  1S50 A;  2ONR A;  2DE2 A;  3RUM A;  2O69 A;  4GXA A;  1QUI A;  4O3A A;  1YTV A;  2DVC A;  4RA1 A;  5AA4 A;  3EHU A;  2D21 A;  1ZIU A;  1DTZ A;  2ZYK A;  4DDD A;  2B4M A;  5F7V A;  3TDJ A;  3UK4 A;  3PD8 A;  3T22 A;  3FAT A;  3TEP A;  1TFD A;  3C34 A;  5ITO A;  4YKI A;  2HZK A;  3U1O A;  5KCJ B;  3VLV A;  2NUV A;  2DWA A;  1A99 A;  3TAJ A;  3FJG A;  3O6H A;  1BTJ A;  3C35 A;  3FVN A;  3IL1 B;  2R6G E;  4MF3 A;  5DVF A;  2F7B A;  4C1U A;  2F36 A;  2FNC A;  4KHZ E;  5I57 A;  4BDR A;  4O3C A;  1NFT A;  3MVZ A;  3C4M A;  4XKP A;  1GGG A;  3RT6 B;  2P0S A;  3TMG A;  1XHY A;  2ZYM A;  4GD5 A;  3MC2 A;  4GOT A;  1SBP A;  1FQA A;  4FAJ A;  3MZB A;  1FQE A;  1SW1 A;  1ZJL A;  3G3I A;  4GL0 A;  1XVY A;  3FVG A;  4LQ5 A;  2RCB A;  3H7M A;  3ILU B;  1BLF A;  2Y7R A;  3TCH A;  3E3K A;  2RKM A;  1MPB A;  4N13 A;  4R6Y A;  2ONS A;  1MXZ A;  2UVJ A;  2F6P A;  5FTI A;  4F19 A;  3O28 A;  5KZT A;  2A5T B;  4WXJ A;  2B3B A;  4KI0 E;  5L8D A;  1US4 A;  4LAT A;  3IB1 A;  2OJT A;  3CG1 A;  1SYH A;  3FAS A;  2H99 A;  1ZTY A;  5A5X B;  2DVZ A;  3TEL A;  4AB5 A;  3KGC A;  3H4Z A;  4EXK A;  1GTK A;  1M5B A;  3W9V A;  3T9X B;  1AH5 A;  4WEP A;  1UTH A;  3DLN A;  2QSX A;  4LQ2 A;  4Q30 B;  2YPN A;  2UVG A;  3C32 A;  5I58 B;  1BP5 A;  3DRG A;  2WKY A;  4PP0 A;  4OEU A;  4YB5 A;  4KCD A;  1Y3Q A;  3JZJ A;  3VVE A;  3VE1 B;  4POX A;  3R26 A;  3O6I A;  3Q27 A;  1LBB A;  1PB8 A;  4EQB A;  4IO3 A;  1CB6 A;  3OEM A;  4YMA A;  2HXW A;  5J1D A;  3SKP A;  1N84 A;  3FXQ A;  3MWB A;  3RLF E;  4LA9 A;  3HCQ A;  1IXG A;  4Q5T A;  3U8Q A;  3ZSF A;  4HS7 A;  4F2O A;  4QFK A;  4P11 A;  3PAM A;  3DRI A;  3N6U A;  4HW8 A;  3GXA A;  4DZ1 A;  2HAU A;  2ZXT A;  1QUL A;  3FD3 A;  2QMX A;  2XX8 A;  4R2F A;  2REJ A;  2UYF A;  3KEI A;  3CG3 A;  5JTY A;  3IX1 A;  1MPD A;  2YJP A;  2ZNT A;  4MLV A;  5L9O A;  1DTG A;  4ZEB A;  1LLS A;  3O29 A;  3O97 A;  3OOA A;  5BWJ A;  4ONY A;  2HZL A;  1TWY A;  2QRY A;  1B1X A;  5ELV A;  1Z7N E;  1TFA A;  3HHF A;  3PD9 A;  4BLA A;  4NF4 B;  1A8F A;  1R9L A;  3IJO B;  4DCX A;  3CI8 A;  1EU8 A;  2XXH A;  3CRB A;  3OEK A;  3DP6 A;  4JB7 A;  3SES A;  1LFI A;  5CMC A;  5H8Q B;  4E0X A;  1B05 A;  4XKR A;  4OVJ A;  4ELR A;  1LCF A;  4ECF A;  3VXC A;  5L9M A;  1UTB B;  3K01 A;  2QMW A;  3N94 A;  2Z22 A;  1AL3 A;  1QJM A;  4EQ7 A;  5AA3 A;  2ANJ A;  5H8N B;  5H8N A;  3EHT A;  1XOC A;  2HQ0 A;  2PVU A;  1Y20 A;  1LST A;  1NNF A;  2XXW A;  3B6W A;  3HPI A;  3O66 A;  3PPO A;  4G4P A;  2ZNU A;  4F22 A;  4YMB A;  1B3E A;  1M5F A;  4X1D A;  5CC2 A;  2F97 A;  1B3F A;  2H9B A;  1TXF A;  3IOT A;  4JXI A;  1AIV A;  3QK6 A;  1H44 A;  2I4B A;  4YU0 A;  3LC8 A;  3DM0 A;  2G93 A;  2OZZ A;  1D9Y A;  3K2D A;  4RNS A;  3PPN A;  3SEV A;  2VP1 A;  1B0L A;  4H5G A;  2H25 A;  4U21 A;  5CMB A;  2UVH A;  1IIT A;  1JEU A;  3A3C A;  3FGS A;  5I57 B;  1ATG A;  4U4S A;  5JTY B;  1AMF A;  2IA4 A;  1ZU0 A;  1PEB A;  3KSX A;  2D5W A;  1N3X A;  1US5 A;  3KJT A;  5TPA B;  3QUJ A;  1Y1Z A;  1PBP A;  4OET A;  2O84 X;  2AYS A;  2DSF A;  3V8X B;  2F5X A;  3S4U A;  3BFU A;  2Y7I A;  3B6Q A;  1FTJ A;  4BDO A;  3BBR A;  3U92 A;  4N6P A;  4EQ9 A;  3O6G A;  1B3L A;  1MQJ A;  3QSL A;  1POY 1;  2OWT A;  4ZEI A;  3H3G A;  5H8Q A;  5M2V A;  1FTL A;  3Q29 A;  3PPQ A;  4R9G A;  2Y7K A;  5H8H B;  3SEW A;  3VDF A;  2H98 A;  4DXB A;  4EXL A;  4F18 A;  2DWI A;  4XIG Q;  2LAO A;  2VD3 A;  2V93 A;  5DTB A;  4GLI A;  3G7W A;  3TTL A;  4FJP A;  1SYI A;  1B40 A;  1NNK A;  2Y84 A;  2WOL A;  3H6T A;  5H8S A;  2ZYO A;  4JSO A;  1MH4 A;  4ZZE A;  1H3D A;  3G3F A;  3A09 A;  2FYI A;  5EHS A;  2F6G A;  1MXY A;  4EF2 A;  4LUB A;  1JEV A;  4OZ9 A;  4N07 A;  4QFP A;  4R9F A;  5AA4 B;  3RPW A;  5I56 A;  2DYX A;  1Y4T A;  2XXP A;  3E4R A;  1LB9 A;  3N6T A;  1MQH A;  3SEX A;  1NNT A;  5JEI A;  4F1V A;  2XX7 A;  2D3I A;  3MP6 A;  3U94 A;  1I6B A;  5DEX B;  3MZ9 A;  3T66 A;  3T9U A;  3HST A;  3MVW A;  5CMM A;  4DXC A;  2F78 A;  1LGB C;  3QIM A;  2B3F A;  2H5Y A;  4JWO A;  4RK9 A;  3IR1 A;  5I2K B;  4JDF A;  2O7I A;  2AL5 A;  2XXT A;  1D3K A;  3QYT A;  4X48 A;  1SD3 A;  4BDM A;  1ANF A;  1ELJ A;  3VVD A;  1O63 A;  1N76 A;  2XXR A;  3LSW A;  1NNP A;  3MP8 A;  3MQ9 A;  4G8H A;  3S9M C;  2PYY A;  5TP9 B;  3O6P A;  1EZO A;  1NH7 A;  3KFM A;  2REG A;  2I0B A;  1A40 A;  1WDN A;  2NWJ A;  3RTW B;  3DRF A;  4G68 C;  4UAC A;  1DOT A;  4NWC A;  4F31 B;  1CE2 A;  3WAE A;  1MPC A;  4RY1 A;  2X7P A;  2VHA A;  2OBG A;  3MVX A;  1PB7 A;  1LAX A;  3BFT A;  3QXM A;  5IAI A;  4F29 A;  1SDX A;  1Q35 A;  5H8F A;  4XKN A;  3KBR A;  1XVX A;  2I6E A;  3D4G A;  4QFN A;  3UIF A;  1FW0 A;  2GHB A;  1LBC A;  3C33 A;  1LCT A;  4G8N A;  2XD2 A;  4M4G A;  4PFY A;  2AIX A;  1FTK A;  3ECR A;  3FVK A;  1SVX B;  2F8D A;  1KWH A;  3IJX B;  3L6G A;  3P7I A;  3KOS A;  4ZEF A;  2THI A;  3OO9 A;  2PX1 A;  1B7H A;  1MM6 A;  1JQF A;  2P2A A;  4PQJ A;  1UTH B;  3RGY A;  3RY3 A;  3TYH A;  4KQP A;  3V5A A;  1MXU A;  1FCK A;  1I69 A;  1ZMG A;  4NED A;  4P0I A;  1N7W A;  3KG2 A;  1URD A;  2V3U A;  3OEL A;  2OWS A;  3H6U A;  4ELO A;  1LAF E;  2DQV A;  1S7Y A;  2I0C A;  3TKD A;  5CBS A;  5ITP A;  3BKI B;  4H8I A;  1ZBM A;  4ESX A;  2R71 A;  2ABH A;  2I48 A;  4YZZ A;  3PUX E;  1B5I A;  4LON B;  2GH9 A;  1B0H A;  4KYD A;  4ZE9 A;  3DRJ A;  3I3V A;  5I2N B;  1MH3 A;  1NKX A;  2I3W A;  1VFD A;  4H67 A;  1MG1 A;  1VFE A;  2XX9 A;  5I59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...