1B51A

Oligo-peptide binding protein (oppa) complexed with ksk
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 191
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b51A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b51A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b51A02
1A99A 1JETA 3MBPA 1MXVA 2G93A 4H5FA 3EPEA 4QFNA 2Q2AA 3G3FA 2V3QA 3ILTB 3IOTA 1II5A 1FQCA 1IXHA 2H99A 3MVWA 1BLFA 1FW0A 3OO9A 4E0WA 3SEWA 3G7WA 5I59B 2YPNA 3VE1B 4YMBA 4NF6B 3TCGA 2DXYA 1B5JA 3LSFB 2B4LA 4KFQA 5DEXB 2UVGA 3GBAA 1JW5A 3SEUA 3E9XA 5L8DA 1URGA 1QUIA 3VXCA 4YB5A 1MXZA 3QIMA 1JEVA 4G68A 2D21A 3D4CA 3FJ7A 2NOOA 3KOTA 2XXWA 2DVZA 3R26A 1LFIA 3T9UA 4R72A 3MP1A 4RK9A 4U2RA 1HSEA 2BJJX 5H8HB 4XXUA 1FCKA 1XT8A 3FV2A 3PU5A 4EXKA 3IJOB 3CSBA 4POWA 3MUQA 1PB9A 2CMOA 3K02A 4FORA 1ELJA 2F6PA 2O1MA 3C9HA 3DRGA 3EHSA 1OIBA 2DXRA 1A55A 2XXRA 3A3CA 1NNFA 1QVSA 2QMXA 2IEEA 4OETA 1SW5A 4ZZEA 2ZYOA 3LC8A 1AMFA 1VFDA 5KDTB 3QUFA 3RY3A 1FTMA 2H9BA 1B3LA 4F3BA 4ZDMA 1Q35A 4IY6A 4G8MA 4ONYA 2O69A 2YJPA 5I57A 4KPTA 5AA1A 3FXUA 4U1ZA 2R9JA 1NH8A 3F11A 1B3HA 2Y7IA 3GXAA 1OLCA 3TTNA 2XX9A 3C35A 4R73A 2F7CA 2P1SA 4OESA 3DP8A 1Y4CA 3DRJA 2QS3A 3LR1A 4ND9A 1Y3NA 2O1LA 3ONMA 2O51A 1B0LA 4RJZA 4EQ7A 2PT1A 4X1DA 1DTZA 4H0WA 2OWTA 4G8NA 3SEVA 1NMUA 4OHNA 2HEUA 3C32A 4XKNA 3KN7A 1M5EA 3FXQA 3CSGA 1BP5A 1UTBA 3MVYA 1XVXA 5HPQA 2H5YA 4H8IA 4MH5A 4YZZA 1B5HA 1Q1KA 3EHUA 1IZ1A 3SESA 1MDP1 2OBGA 3Q26A 1P1UA 2Y7WA 5DVJA 3SKPA 1DSNA 1AL3A 4ZEIA 1B51A 2REGA 1GVCA 1B7HA 1A8EA 1D4NA 3C4MA 2Q8JA 4G68B 4R2FA 2UYFA 1P1NA 4DCYA 3ZSFA 2V84A 1IITA 1UIUA 4F3PA 2VD3A 1B6HA 2F6GA 1JW1A 4R6HA 3T22A 2R71A 1R9QA 2X26A 2F5XA 4PP0A 3LSWA 4LZ5A 2ZNSA 3B7DA 3MW0A 3TEPA 1POY1 2QS4A 4R75A 2DYXA 1IXCA 3MVXA 3U92A 2RKMA 1MQGA 1LFGA 3BKIB 3KN3A 4G8HA 5L9MA 1H3DA 4DLDA 4OFLA 2VD2A 1OVTA 1XC1A 3UN6A 4QFLA 3UA8A 4OVJA 3ILUB 1IQ7A 4F3SA 3TCHA 4HCYA 2HQ0A 3JV9A 1A54A 3KSJA 4PQJA 2QSXA 3PUVE 1N3XA 2ABHA 1N3WA 5I57B 2PVUA 4TQUQ 3RT6B 3TUSA 1MPDA 4I9DA 1P1QA 5AA3A 3FVNA 4PFTA 3O28A 2ONKE 4BDLA 3TMGA 3OOAA 3S9LC 4BDMA 2LAOA 5L9SA 2ZXTA 3RTWB 3C34A 2O7IA 3G3JA 3PUYE 3H6UA 3HHGA 2UXAA 1M5DA 1ZKBA 5CMMA 1DTGA 3MC2A 3H3GA 2DWIA 1MXYA 3DLNA 4EF2A 1BKAA 1QW0A 3IL1B 3K1MA 3DRFA 4PFYA 3N6UA 1UTBB 1I69A 3MPKA 2XX8A 1URDA 3H4ZA 1S9TA 4FAJA 1BTJA 2OK2A 4ZE9A 3ODBA 3O66A 1LGBC 2XX7A 1GGGA 4LP2B 4ZECA 1ZLQA 1HSJA 2I0CA 2I48A 2HAVA 1O63A 1MRPA 2ANJA 2B65A 3ZKKA 1DOTA 4O3CA 1R9LA 3LUYA 4AQ4A 1O7TA 2HCAA 2ALUA 1Y20A 3KG2A 2NVUB 4BDRA 1YPNA 3R7XA 4HW8A 3OO6A 3MWBA 1LCTA 4JXIA 3C31A 4ZEKA 1IEJA 3N26A 3LSLA 1EZPA 3T9VA 3O2AA 4Z0IA 1DPPA 1H45A 4FECA 4E0XA 4LZ7A 1PEBA 2D5WA 4O3BA 3H7MA 4RYAA 2XXIA 3RQTA 3PPQA 4ZE8A 1AH5A 3HCQA 4I8CA 4IY5A 4R9GA 5IAIA 4JB7A 1NL5A 3L6GA 3JZJA 4NF5A 4GOTA 4KYDA 5FHMA 1MPCA 3TZAA 3OO7A 5ELVA 1B1HA 1FQEA 3ZKLA 2NXOA 4N13A 3MZ1A 3QSLA 1QULA 3KBRA 1OMPA 4QF9A 4U22A 1F9BA 1M5FA 2QMWA 3LSXA 3CHGA 4QFPA 2QJEA 1NNKA 4MF3A 4KCDA 2ZNUA 2XHDA 3TTMA 2Z8EA 4YICA 2ESNA 5AA2A 3K1NA 3MZ9A 4UACA 5EHSA 4DXUA 1B2HA 2QL3A 3IO4A 2DSFA 3IR1A 4LATA 1LAHE 2RC9A 3E13X 3IOVA 1MH3A 4RPOA 3DM0A 3FVGA 1SD3A 3TTLA 1TFDA 4NF8A 1QKBA 4ZS9A 5H8NA 4R74A 4KD5A 1R6ZA 1ZJLA 2XXQA 4Q30B 4QSDA 1Y4TA 4MLQA 4X1BA 4OYVA 4JSOA 2Z8FA 3DP4A 1MY3A 2DVCA 1Z7ME 4BDOA 3K6UA 2B4MA 3FATA 5H8QA 1H76A 2UVJA 1US4A 1IXIA 5JEIA 1JNFA 4PETA 1LB8A 1N7WA 4N07A 3OSRA 4YB7A 3E3KA 5I56A 3PV0E 4WXJA 2CZLA 1PBPA 4C0RA 4ECFA 3HV1A 1EH3A 4OZ9A 3QXMA 3UGWA 1P99A 4Q0CA 3RYBA 3BBRA 3CRBA 1O64A 3VDFA 3PMVA 5H8SA 5AE4A 4LQ2A 5DVFA 1XHYA 1MM6A 4HTGA 3KEIA 2VHAA 3MAMA 4YKJA 3V89B 1AOVA 3PPNA 2F97A 2IA4A 2ZYMA 1LAXA 5DVIA 2F34A 2XXHA 3OD7A 1PDAA 1LSTA 5CBSA 4XKPA 5KCJA 1TFAA 1RYOA 3LVUA 4NF5B 3V8XB 4QFOA 2A5TA 3N6TA 5TU0A 2DP8A 2AL5A 4EQBA 3KJTA 4EQ9A 3DELB 4QFKA 1NKXA 3EN3A 4EXLA 4ELPA 1B52A 2UVHA 1ANFA 4H6DA 4LUBA 3CG3A 2ONRA 5FTHA 5CM6A 4H5GA 2REJA 3WAFA 5DTBA 1B1XA 4F39A 4GFRA 3BFTA 3MP8A 5AA2B 2F7AA 4F1VA 5ISUA 3K6WA 4IB2A 1MM7A 2V25A 5CI5A 3CI8A 3RYAA 5I2KA 3I6VA 3T96B 3Q25A 3VLWA 4U21A 4NF8B 1H43A 4KR5A 3GZGA 5H8NB 1NFTA 1OQGA 4YAHX 2RCBA 1NH7A 3EHTA 4R2BA 2DWAA 3O6GA 3EF7A 3GBBA 1JVXA 1N04A 5K2YA 1AIVA 1FTOA 1Y3QA 1FQAA 5BWJA 3C33A 3PAMA 1LAGE 4C1TA 1MH4A 3PD9A 1L5TA 1QUKA 1MS7A 2E1SA 4NWCA 1LFHA 5I56B 3FVKA 4NEDA 3FTOA 4Z7EA 4ZEFA 4TLLB 3O6IA 1UTHA 3TQWA 2VOZA 1MY1A 1Y9UA 2ZYKA 4RY1A 5FHNA 1P1OA 2PMSA 3KZGA 4OWDA 2R6GE 3HO7A 3TFLA 1POTA 2I4CA 4L17A 3VFJA 4DDDA 1PB7A 5CC2A 1M5CA 2RCAA 4U1OA 4LONB 5F1QA 5CMKA 5KCJB 2ZYNA 5IKBA 1JW4A 3TELA 5DT6A 4XKQA 1USYE 2A5TB 2I4BA 3O29A 3VV5A 4BLAA 3K0VA 4KYSA 3ECRA 4IO4A 1IUDA 3QK6A 4JSDA 2PBWA 3G3GA 1XVYA 4F2QA 4YKKA 3IO6A 2XXTA 3FD3A 4F18A 1MY0A 4R6KA 5TPAA 1ZTYA 1RKMA 2PT2A 2I0BA 4LA9A 3TPAA 2M8CA 3FGSA 1GTKA 3OEMA 4FE8A 3PPRA 1WDNA 1SW2A 5B7DA 4DXBA 4IO2A 3D4GA 5I2KB 4FATA 4WEPA 3QAXA 2GRVA 3DRKA 2Q2CA 5L9OA 3FV1A 4XTCQ 2HFBA 5I58A 2HXWA 1B7ZA 2O7UA 4N6PA 4YKIA 4LZ8A 4TLMB 3SEXA 4ESXA 3B6QA 1M5BA 1YAEA 2QRYA 5B70A 4RA1A 2X7QA 4OXVA 3TDJA 1LB9A 3U93A 2HAUA 4OFOA 3CIJA 3G3IA 1US5A 1D3KA 1A8FA 1TXFA 4YMAA 4MBPA 1TT1A 3FJGA 5ITPA 1B58A 3IOWA 5I84A 4DCXA 3DRHA 2Y84A 3OEKA 2XD2A 4H8JA 3IB1A 2OJTA 1SDXA 1LLSA 3MQ9A 1JQFA 3K6VA 1SVXB 1VE4A 2V3TA 2XXUA 2AIXA 3K4UA 3T93B 1SW1A 4X48A 1I6BA 4R9FA 5JTYA 4MLVA 3MJNA 3U1OA 3JYRA 1P1WA 1USYH 2X7PA 4OERA 3OXNA 4G68C 4GF8A 3VLUA 1UTHB 5LOMA 5EHMA 4G2ZA 1Y3PA 1LBBA 3FJMA 2I58A 1MG1A 3UP9A 3SERA 1DMBA 5J1DA 3K1PA 1FQFA 4F29A 3V83A 5CBRA 3L6HA 4LQ5A 4EDPA 2RC8A 3SDFA 3U94A 3IJXB 3B6WA 4WEDA 4MFIA 3FUZA 3V5AA 3RTFB 4GQOA 4F31B 2OCUA 3UORA 3S9MC 1PBQA 3A3UA 2H98A 2O68A 2F7BA 2DQVA 3RUMA 1EZ9A 1QKAA 1CE2A 2WOPA 1QJMA 3CVGA 3VXBA 4DZ1A 5FHOA 3O6PA 4X9TA 3RGYA 3W9WA 3TTKA 1URSA 3PPOA 1NNPA 3TCFA 3SETA 4FEBA 2Y7KA 3CFZA 5TPAB 1B9JA 4HS7A 3H6TA 2GHBA 4THIA 1Z7NE 3M3KA 3PD8A 1SYHA 1SW4A 1QUJA 2F36A 4H67A 3PPPA 4O3AA 1KWHA 3TQLA 2Q89A 4XKRA 3O97A 4U4SA 4KYEA 1A7LA 4LVQA 1SI1A 4GLIA 3IK6B 5AA4A 4IGTA 5I58B 2DE2A 3PMWA 4OEUA 4ISUA 2Y7RA 2H4IA 1B5IA 5KZTA 1HSLA 3I5OA 1N76A 4P0GA 3IX1A 1GR2A 4IO3A 3T9HB 3ZS6A 3H06B 4NWDA 1MDQA 3RT8A 2AL4A 4ESWA 4RK2A 2OWSA 4ZEDA 4G77A 3RLFE 4NTLA 3VVDA 4F19A 1EU8A 1B05A 1ATGA 3IAZA 2RC7A 1H44A 5HM4B 4I62A 4BDQA 3G3KA 2D3IA 1PC3A 4GXSB 5JTYB 2ZNTA 2P0SA 1WVJA 4JWOA 3FASA 3PUXE 4F1UA 3P7IA 1VR5A 3IOUA 2E0SA 1MXXA 3S4UA 5ICTA 2F35A 5H8FA 3HHFA 2PX1A 4KI0E 2NUVA 4GWOA 4WKMA 3Q28A 4XIGQ 4U23A 4KHZE 2F78A 5HBCA 5FTIA 5ITOA 2W7YA 5AA2D 4YB6A 3OMBA 1FTLA 3KSXA 2Z22A 4QRZA 2FNCA 1B3GA 4Q5TA 3CFLA 4PFWA 4NMYA 3WAEA 2I3WA 2QPQA 3E4RA 2G29A 5EYFA 4C1UA 3G3HA 1B3FA 1Y1ZA 3OELA 3S9NC 4GL8A 1IXGA 4NF4A 4IGRA 1FTJA 5TP9A 3TTRA 1OVBA 3VVEA 1CB6A 1OLAA 2QS2A 1A40A 4QSCA 2XXPA 1D9VA 4P0IA 4RXLA 4DE8A 3CR9A 2YLNA 4PE5B 2HZLA 1SBPA 4QHQA 2GHAA 4GVOA 2ZMBA 1B4HA 3UIFA 2H25A 1DPEA 3BFUA 4YU0A 5AA4B 2DWHA 4FIMA 5F7VA 4KQPA 3TKDA 2VGQA 1R1NA 1MQJA 3EQ1A 2O84X 1TWYA 1SQYA 1MQHA 4GXAA 4GD5A 3CFXA 1XS5A 1I6AA 2DE4A 3VVFA 2Q9TA 1PB8A 3GLBA 3UK4A 2VP1A 5H8QB 3TODA 4ZZAA 2WOKA 3O6HA 3FZVA 3HPIA 2DOJA 1BIYA 3MPLA 5JK4A 3PUZE 1T0KA 2V3UA 2I6EA 2Y7PA 5CMBA 2DWJA 2THIA 3S2VA 4H1XA 1MPBA 1S50A 5A5XA 3KN8A 2RF1A 4OENA 4POXA 2P2AA 5H8FB 4G4PA 2WOLA 5I2NA 4R6YA 4FJPA 4OTEA 2DE3A 1SYIA 4EUOA 4IO7A 3MP6A 3FXRA 2V93A 4NE4A 3SEYA 2OZZA 3A09A 3LBSA 5M2VA 3KFMA 1ZBMA 3FIRA 4HCWA 1JEUA 2O6AA 4K3FA 3CG1A 3TYHA 2GH9A 2HZKA 1YCJA 1FQDA 4TOZA 3MZBA 3W15C 4IO6A 4Q8RA 3H6VA 1B46A 3PUWE 3FVOA 1ZIUA 4FEDA 3K6XA 2PYYA 3K00A 2QS1A 1VSOA 2RINA 3N5LA 1B40A 4NF4B 4AB5A 2B3BA 2NWJA 1B4ZA 3H03A 3U72A 1LCFA 5TP9B 2XD3A 1IIWA 4ZEBA 3W9VA 3OO8A 2Q88A 3IB0A 3M3FA 1B32A 1FQBA 4I1DA 4GIZA 2FA7A 1XOCA 3Q29A 3M3LA 2I3VA 1B0HA 1ZMGA 1B7UA 4OFJA 3QUJA 2B3FA 1B3EA 1MY4A 1EZOA 3PGFA 3OSQA 1SI0A 2DS9A 4PFUA 1NNTA 3T9XB 3VLVA 1UQWA 3IB2A 1OQHA 2GFEA 3K01A 4QSEA 4JWYA 3K2DA 3PMXA 1YTVA 1MY2A 3OENA 2Z23A 1J1NA 3HSTA 3USDA 4F3GA 4U4XA 4IO5A 1MQIA 2UYEA 2A5SA 5I59A 2UVIA 2XXXA 4NF6A 1JVYA 2ONSA 4ELRA 4JBZA 4M4GA 4EF1A 4BDNA 4DXCA 5DEXA 4F22A 4M1VA 3IORA 3Q27A 3U8QA 4OQOA 4AB6A 1VFEA 4KCCA 3S9EA 4F1YA 5A5XB 3HN0A 3AXFA 4YKPA 5I2NB 3TAJA 1LBCA 2XXVA 5H8HA 1GV8A 4JDFA 4H65A 4P11A 2Z8DA 4GL0A 3B6TA 4DIGA 4RPNA 4UA8A 4JWXA 1S7YA 1N7XA 2XXYA 1FTKA 2FYIA 3R6UA 4ELQA 1MQDA 3RN8A 3MVZA 5ICQA 4F2OA 3KJ7A 3DP6A 5KDTA 3KOSA 1D9YA 3THIA 3M8UA 3O9PA 1I6QA 3RNNA 4OEVA 5BUUA 1MXWA 3DRIA 1Y1MA 2WKYA 4RNSA 2AYSA 5CRYA 2F8DA 2KLFA 4GRKA 5DYHA 3RPWA 1LAFE 3H6WA 1ZU0A 5K2XA 2OLBA 4ELOA 1MXUA 3QYTA 3I3VA 1N84A 3KGCA 5CMCA 4OMBA 3C36A 2I49A 1N0TA 1UIVA 1RYXA 3T66A 3N94A 1WODA
chains in the Genus database with same CATH superfamily
1A99A 1JETA 3MBPA 4GWYA 1MXVA 2G93A 4H5FA 3EPEA 4QFNA 2Q2AA 3G3FA 4MAGA 2V3QA 1FTAA 3ILTB 4OVQA 3IOTA 1II5A 4MHFA 1FQCA 1IXHA 1K9YA 2H99A 3MVWA 1BLFA 1FW0A 3OO9A 4E0WA 3SEWA 3G7WA 5I59B 2YPNA 3VE1B 4YMBA 4NF6B 5EYHA 3TCGA 2DXYA 1B5JA 3E79A 3LSFB 1LBYA 2B4LA 4KFQA 5DEXB 2UVGA 3GBAA 4OVRA 1JW5A 3SEUA 3E9XA 5L8DA 1URGA 1QUIA 3VXCA 4YB5A 1MXZA 3QIMA 1JEVA 4G68A 2D21A 1KA1A 3D4CA 3FJ7A 2NOOA 3KOTA 2XXWA 5IZ3B 2DVZA 3R26A 4NGUA 1LFIA 3T9UA 4R72A 5DW8A 3MP1A 2CZHA 4RK9A 4U2RA 2HXRA 1HSEA 2BJJX 5H8HB 4XXUA 1FCKA 1XT8A 3FV2A 3PU5A 4EXKA 3IJOB 3CSBA 4POWA 3MUQA 2CZKA 1PB9A 2CMOA 3K02A 4FORA 1ELJA 2F6PA 2O1MA 3C9HA 3DRGA 2P3VA 3EHSA 1OIBA 2DXRA 2XA5A 1A55A 2XXRA 3A3CA 1NNFA 1QVSA 2QMXA 2IEEA 4OETA 1SW5A 2OX3A 1D9QA 4ZZEA 2ZYOA 3LC8A 1AMFA 1CNQA 1VFDA 5KDTB 3QUFA 3RY3A 1FPEA 1FTMA 2H9BA 1B3LA 3HFUA 4F3BA 4ZDMA 5I7IA 1Q35A 4IY6A 4G8MA 3BIHA 4XEQA 2ZZXA 4ONYA 2O69A 1Q9DA 2YJPA 5I57A 4KPTA 5AA1A 3FXUA 4U1ZA 2R9JA 1NH8A 3F11A 1B3HA 2Y7IA 3GXAA 1OLCA 4DI4B 1FBGA 3TTNA 2XX9A 3C35A 4R73A 3LUZA 2F7CA 2P1SA 4OESA 3DP8A 1Y4CA 3DRJA 2QS3A 3LR1A 4ND9A 1Y3NA 2O1LA 3ONMA 2O51A 1LBVA 1B0LA 5EQAA 4RJZA 4EQ7A 2PT1A 4X1DA 1DTZA 4H0WA 2OWTA 4G8NA 3SEVA 1NMUA 4OHNA 2HEUA 4P56A 3C32A 1FPIA 4XKNA 3KN7A 1M5EA 3FXQA 3CSGA 1BP5A 1UTBA 3MVYA 4AS5A 5FBPA 1XVXA 5HPQA 2H5YA 4H8IA 4MH5A 4N4UA 4YZZA 1B5HA 1FPJA 1Q1KA 3EHUA 1IZ1A 3SESA 1MDP1 2OBGA 3Q26A 4NQ8A 1P1UA 4PDHA 2Y7WA 5DVJA 2PCRA 3SKPA 1DSNA 1AL3A 4ZEIA 1B51A 2REGA 3NOHA 1GVCA 1B7HA 1A8EA 1D4NA 3C4MA 2Q8JA 5EYGA 4G68B 4P47A 1VDWA 4R2FA 1NV2A 2UYFA 1P1NA 4DCYA 4HXVA 2V84A 3ZSFA 1IITA 1UIUA 4F3PA 2VD3A 1B6HA 2F6GA 1JW1A 4R6HA 3T22A 2R71A 1R9QA 4O94A 2X26A 2F5XA 2F3BA 4G61A 4PP0A 3LSWA 4LZ5A 1LBWA 2ZNSA 3B7DA 5I5PA 3MW0A 3TEPA 1POY1 2QS4A 4R75A 2DYXA 1RDYA 1IXCA 3MVXA 3U92A 2RKMA 1MQGA 2OWZA 1LFGA 3BKIB 3KN3A 1EYJA 4G8HA 5L9MA 1H3DA 4DLDA 1FBEA 4OFLA 2VD2A 1OVTA 4PF6A 1XC1A 3UN6A 2DDKA 4QFLA 3UA8A 2FIXA 4OVJA 3ILUB 1IQ7A 4F3SA 1NUYA 4MMPA 3TCHA 4HCYA 2HQ0A 3JV9A 1A54A 3KSJA 4PQJA 2QSXA 3KBZA 5ESYA 3PUVE 1N3XA 2ABHA 1DBZA 1N3WA 5I57B 4PAIA 2PVUA 2FHYA 4TQUQ 3RT6B 3TUSA 4NHBA 1MPDA 4I9DA 1P1QA 4OA4A 5AA3A 3GYYA 3FVNA 4NN3A 4PFTA 3O28A 1LBXA 2ONKE 4BDLA 1FBHA 3TMGA 3OOAA 2ZZVA 3S9LC 2QVVA 4BDMA 2LAOA 5L9SA 2ZXTA 3RTWB 3C34A 2O7IA 3G3JA 2FIEA 3PUYE 3H6UA 2WBBA 3HHGA 2UXAA 1M5DA 1ZKBA 1JP4A 5CMMA 1DTGA 3MC2A 3H3GA 2DWIA 1MXYA 3DLNA 4EF2A 1G0IA 1BKAA 1QW0A 3IL1B 1NV0A 3K1MA 3DRFA 2HPGA 4PFYA 3N6UA 1UTBB 1I69A 3MPKA 2XX8A 1URDA 3H4ZA 1NUWA 3E78A 1S9TA 4FAJA 1BTJA 2OK2A 4ZE9A 3ODBA 3O66A 5F24A 2F3DA 1LGBC 2XX7A 1GGGA 4LP2B 4ZECA 1ZLQA 1HSJA 2I0CA 2I48A 2HAVA 1NUXA 1O63A 1MRPA 2ANJA 2B65A 3ZKKA 1DOTA 2VPNA 4O3CA 2Y5KA 2Y5LA 1R9LA 3LUYA 4AQ4A 1NV4A 1O7TA 2HCAA 2ALUA 1Y20A 3KG2A 2NVUB 4BDRA 1YPNA 3R7XA 4HW8A 1INPA 3OO6A 2FVZA 3MWBA 1LCTA 4JXIA 3C31A 4MIJA 4ZEKA 1IEJA 3N26A 3LSLA 1EZPA 3T9VA 3O2AA 4Z0IA 1DPPA 1H45A 4FECA 4E0XA 1YXIA 4LZ7A 1PEBA 2D5WA 4O3BA 5IGAA 1DCUA 3H7MA 4RYAA 4XF5A 2XXIA 4MNCA 3RQTA 3PPQA 4ZE8A 1AH5A 3HCQA 4I8CA 4IY5A 4R9GA 5IAIA 2GQ1A 4GWXA 4JB7A 1NL5A 3L6GA 1IMFA 3JZJA 4NF5A 4GOTA 4KYDA 5FHMA 1MPCA 1G0HA 3TZAA 3OO7A 3U65A 5ELVA 1B1HA 1FQEA 3ZKLA 2NXOA 4N13A 3MZ1A 5IM2A 3QSLA 1QULA 1IMBA 3KBRA 1OMPA 4QF9A 4U22A 1F9BA 1M5FA 2QMWA 4JVDA 5IZ1A 2XWVA 3LSXA 5EQ8A 3CHGA 4QFPA 2QJEA 1LEVA 1NNKA 4MF3A 4KCDA 2ZNUA 2XHDA 3TTMA 2Z8EA 4YICA 2ESNA 2HHMA 4MEVA 5AA2A 3K1NA 3MZ9A 4UACA 5EHSA 4DXUA 1B2HA 2QL3A 1FPBA 3IO4A 2DSFA 3IR1A 4LATA 4O8MA 1LAHE 2RC9A 3E13X 3IOVA 1MH3A 4RPOA 3DM0A 3FVGA 1SD3A 4H45A 3TTLA 1TFDA 4NF8A 1QKBA 4ZS9A 5ET6A 5H8NA 4R74A 4KD5A 1R6ZA 1ZJLA 2XXQA 4Q30B 4QSDA 5LTCA 1Y4TA 4MLQA 4X1BA 4OYVA 4JSOA 2Z8FA 3DP4A 1MY3A 3SZPA 2DVCA 1Z7ME 4BDOA 4DI3D 3K6UA 4PE3A 2B4MA 3FATA 5H8QA 1H76A 2UVJA 1US4A 4H46A 1IXIA 1FJ9A 1JNFA 5JEIA 3B50A 4PETA 1LB8A 4NAPA 1N7WA 4GBVA 4N07A 3OSRA 4YB7A 3E3KA 1YYZA 5I56A 3PV0E 4WXJA 2CZLA 1PBPA 4C0RA 4ECFA 3HV1A 1EH3A 4OZ9A 3QXMA 5LDZA 1FPKA 3UGWA 1P99A 4PFRA 4Q0CA 4NF0A 1FBFA 3RYBA 3BBRA 3CRBA 1O64A 4JVIA 1IMAA 3VDFA 3QMFA 3PMVA 5H8SA 5AE4A 4LQ2A 5DVFA 1XHYA 1MM6A 4HTGA 3KEIA 2VHAA 3MAMA 4YKJA 3V89B 1AOVA 4MJOA 3PPNA 2R8TA 2F97A 2IA4A 2ZYMA 1LAXA 5DVIA 2F34A 2XXHA 4I3EA 3OD7A 1PDAA 2ZZWA 1LSTA 5CBSA 4XKPA 5KCJA 1TFAA 1RYOA 3LVUA 4NF5B 3V8XB 4QFOA 2A5TA 3N6TA 5TU0A 1FBDA 2DP8A 2AL5A 4EQBA 3KJTA 4PFBA 4EQ9A 3DELB 4QFKA 1NKXA 3EN3A 4EXLA 4ELPA 1B52A 2UVHA 1ANFA 4H6DA 4LUBA 2WX9A 3CG3A 2ONRA 5FTHA 5CM6A 4H5GA 2REJA 3WAFA 4PDDA 5DTBA 1B1XA 4F39A 4GFRA 3BFTA 3MP8A 5AA2B 2F7AA 4F1VA 5ISUA 3K6WA 4IB2A 1MM7A 2V25A 5CI5A 3CI8A 3RYAA 5I2KA 3I6VA 3T96B 3Q25A 3VLWA 4U21A 4NF8B 1H43A 4KR5A 3GZGA 3LV0A 4FBPA 5H8NB 1NFTA 1OQGA 4YAHX 2RCBA 1NH7A 3EHTA 4R2BA 4QXDA 2DWAA 3O6GA 3EF7A 3GBBA 1JVXA 4PAFA 1N04A 5EQ9A 5K2YA 1AIVA 1FTOA 1Y3QA 1FQAA 5BWJA 3C33A 3PAMA 1LAGE 4PCDA 4PC9A 4C1TA 1MH4A 3PD9A 1L5TA 1QUKA 1MS7A 2E1SA 4NWCA 1LFHA 5I56B 1FPLA 3FVKA 4NEDA 3FTOA 4Z7EA 4N17A 4ZEFA 4TLLB 3O6IA 1UTHA 3TQWA 2VOZA 1MY1A 1Y9UA 2ZYKA 4RY1A 5FHNA 1P1OA 2VPOA 2PMSA 4OWDA 2QVUA 3KZGA 2R6GE 3HO7A 3TFLA 1POTA 2I4CA 4L17A 3VFJA 2XWIA 4DDDA 5EQ7A 1PB7A 5CC2A 1M5CA 2RCAA 4U1OA 4LONB 5F1QA 5CMKA 5KCJB 2ZYNA 5IKBA 1JW4A 3TELA 5DT6A 4XKQA 1USYE 4N8YA 2A5TB 2I4BA 3O29A 3VV5A 4BLAA 3K0VA 4KYSA 3ECRA 4IO4A 1IUDA 4OANA 3IFCA 3QK6A 4N91A 1FPDA 4JSDA 2PFYA 1NV3A 2PBWA 3G3GA 1XVYA 4F2QA 4YKKA 1AWBA 3IO6A 4MCOA 2XXTA 3FD3A 4F18A 1MY0A 4R6KA 5TPAA 1ZTYA 1RKMA 2PT2A 2I0BA 4LA9A 3TPAA 2M8CA 3FGSA 1GTKA 3OEMA 4FE8A 3PPRA 1WDNA 1SW2A 5B7DA 4DXBA 4IO2A 3D4GA 1FRPA 5I2KB 4FATA 4WEPA 3QAXA 2GRVA 3DRKA 2Q2CA 5L9OA 3FV1A 4XTCQ 2HFBA 5I58A 3BIGA 2HXWA 1B7ZA 2O7UA 3T1BA 4N6PA 2WEFA 4YKIA 4LZ8A 4TLMB 3SEXA 4ESXA 3B6QA 1M5BA 1YAEA 2QRYA 1SPIA 5B70A 4RA1A 2X7QA 4NG7A 4OXVA 3TDJA 1LB9A 3U93A 2HAUA 4OFOA 3CIJA 3G3IA 1US5A 1D3KA 1A8FA 1TXFA 4YMAA 4MBPA 1TT1A 4P1EA 3FJGA 5ITPA 1B58A 4PTKA 3IOWA 5I84A 4DCXA 1IMCA 3DRHA 2Y84A 3OEKA 2XD2A 4H8JA 3IB1A 2OJTA 1SDXA 1LLSA 3MQ9A 1JQFA 2KQZA 3K6VA 1SVXB 1VE4A 2V3TA 2XXUA 2AIXA 5A5LA 3FBPA 3K4UA 3T93B 1SW1A 4X48A 1DK4A 1I6BA 4R9FA 5JTYA 4MLVA 3MJNA 3U1OA 3JYRA 1P1WA 1USYH 2X7PA 4OERA 3OXNA 4G68C 4GF8A 3VLUA 1UTHB 5LOMA 5EHMA 2KR0A 4G2ZA 1Y3PA 1LBBA 1NI9A 3FJMA 4GWZA 2I58A 1MG1A 2XWKA 3UP9A 4OVSA 3ROJA 1DMBA 3SERA 5J1DA 3K1PA 1IMDA 1FJ6A 1FQFA 4F29A 3V83A 5CBRA 3L6HA 4LQ5A 4EDPA 2RC8A 3SDFA 3U94A 3IJXB 3B6WA 1RDXA 4WEDA 4P1LA 4MFIA 3FUZA 3V5AA 3RTFB 4GQOA 1KA0A 4F31B 2Q8MA 2OCUA 3UORA 3S9MC 1PBQA 3A3UA 2H98A 2O68A 2F7BA 4HE1A 2DQVA 3RUMA 1EZ9A 1QKAA 1CE2A 2WOPA 4N15A 1QJMA 3CVGA 1RDZA 3VXBA 4DZ1A 2V4CA 5FHOA 4JVCA 3O6PA 4GWUA 4X9TA 3RGYA 4GWWA 3W9WA 3TTKA 1URSA 3A29A 3PPOA 1NNPA 3TCFA 3SETA 4FEBA 2Y7KA 2BJIA 3CFZA 5TPAB 4LN5A 1B9JA 2XWOA 4HS7A 3H6TA 2GHBA 4THIA 1Z7NE 3M3KA 3PD8A 1SYHA 1SW4A 1QUJA 2F36A 4H67A 3PPPA 4O3AA 1KWHA 3TQLA 2Q89A 4XKRA 3O97A 4U4SA 4KYEA 1A7LA 4LVQA 1SI1A 4GLIA 3IK6B 5AA4A 4IGTA 5I58B 2DE2A 3PMWA 4OEUA 4ISUA 4N8GA 2Y7RA 2H4IA 1B5IA 5KZTA 1HSLA 3I5OA 1N76A 2JJKA 4P0GA 3IX1A 1GR2A 4IO3A 3T9HB 3ZS6A 4NX1A 3H06B 4NWDA 1MDQA 3RT8A 2AL4A 4ESWA 4RK2A 2OWSA 4ZEDA 2WYPA 4G77A 3RLFE 4NTLA 4PF8A 3VVDA 4F19A 1EU8A 4GX3A 2P3NA 1B05A 4HE2A 1ATGA 3IAZA 2RC7A 1H44A 5HM4B 4P3LA 4I62A 4BDQA 3G3KA 3KC1A 2D3IA 1PC3A 4GXSB 5JTYB 2ZNTA 2P0SA 1WVJA 4JWOA 3FASA 3PUXE 4F1UA 1NV1A 3P7IA 1VR5A 3IOUA 2E0SA 1MXXA 3S4UA 5ICTA 2F35A 5H8FA 3HHFA 2PX1A 4KI0E 2NUVA 4GWOA 4WKMA 3Q28A 4XIGQ 4U23A 3ISPA 1K9ZA 4KHZE 2F78A 5HBCA 5FTIA 5ITOA 2W7YA 5AA2D 4YB6A 4MX6A 3OMBA 1FTLA 3KSXA 2Z22A 4QRZA 4AS4A 4O7MA 2FNCA 1B3GA 4Q5TA 3CFLA 4PFWA 4NMYA 3WAEA 2I3WA 2QPQA 3E4RA 2G29A 5EYFA 4C1UA 3G3HA 3EKIA 1B3FA 1Y1ZA 3OELA 3T0JA 4OVPA 4N81A 4GWSA 3S9NC 4MNPA 4GL8A 3FXBA 3PTYA 1IXGA 4NF4A 4IGRA 1FTJA 5TP9A 3TTRA 1OVBA 3VVEA 1CB6A 1OLAA 2QS2A 1A40A 4QSCA 2XXPA 1D9VA 4P0IA 1FBCA 4RXLA 4DE8A 3CR9A 2PFZA 2YLNA 4PE5B 2HZLA 1SBPA 4QHQA 2GHAA 4GVOA 2ZMBA 4PFIA 1B4HA 3UIFA 3MSTA 2H25A 1YZ0A 1DPEA 1NV7A 3BFUA 4YU0A 5AA4B 2DWHA 2CEYA 4FIMA 5F7VA 4KQPA 3TKDA 1XI6A 2VGQA 1R1NA 4P9KA 1MQJA 3EQ1A 2O84X 3RYDA 1TWYA 1SQYA 1EYKA 1MQHA 4GXAA 4GD5A 3CFXA 1XS5A 2QFLA 1I6AA 2DE4A 3VVFA 4GX6A 4X8RA 2Q9TA 1PB8A 3GLBA 3UK4A 2VP1A 5H8QB 3TODA 4ZZAA 2WOKA 3O6HA 2MKZA 3IFAA 3FZVA 3HPIA 2DOJA 1BIYA 3MPLA 5JK4A 3PUZE 1T0KA 2V3UA 2I6EA 2Y7PA 5CMBA 2DWJA 1FPFA 2THIA 3S2VA 4H1XA 4OVTA 1MPBA 1S50A 5A5XA 3KN8A 4OENA 2RF1A 1FSAA 4POXA 2P2AA 5H8FB 4G4PA 2WOLA 5I2NA 4R6YA 4FJPA 4OTEA 2DE3A 1SYIA 4EUOA 4IO7A 3MP6A 3FXRA 2V93A 4NE4A 3SEYA 2OZZA 3A09A 3LBSA 4O7IA 5M2VA 3KFMA 1ZBMA 3FIRA 4HCWA 1JEUA 2O6AA 4K3FA 4GX4A 3CG1A 3TYHA 2GH9A 2HZKA 1YCJA 1FQDA 4TOZA 3MZBA 3W15C 4IO6A 4Q8RA 2Q74A 3H6VA 1B46A 3PUWE 3FVOA 3RPLA 1ZIUA 4FEDA 4QBAA 1LBZA 3K6XA 2PYYA 3K00A 2QS1A 1VSOA 2RINA 3N5LA 1B40A 4NF4B 4AB5A 2B3BA 2NWJA 1B4ZA 3H03A 3U72A 3KC0A 2L5VA 1LCFA 5TP9B 2XD3A 1IIWA 4ZEBA 3W9VA 3OO8A 2Q88A 3IB0A 3M3FA 4PGPA 1B32A 1FQBA 4I1DA 5T3JA 4GIZA 2FA7A 4P8BA 1XOCA 3Q29A 3M3LA 2I3VA 1B0HA 1ZMGA 5I3SA 1B7UA 4PBQA 4OFJA 3QUJA 2B3FA 1B3EA 1MY4A 1EZOA 1KZ8A 3PGFA 3OSQA 1SI0A 2DS9A 2CZIA 4PFUA 1NNTA 3T9XB 3VLVA 1UQWA 3IB2A 1OQHA 2GFEA 3K01A 4QSEA 4JWYA 3K2DA 3PMXA 3MYUA 1YTVA 1MY2A 3OENA 4I3YA 2Z23A 1J1NA 3HSTA 3USDA 4F3GA 4U4XA 1IMEA 4IO5A 1MQIA 2UYEA 1FBPA 5ET7A 4X04A 2A5SA 5I59A 2UVIA 2XXXA 4NF6A 1JVYA 2CEXA 2ONSA 4ELRA 4JBZA 2XXKA 4I40A 1QGXA 5ET5A 4M4GA 4EF1A 4BDNA 4DXCA 5DEXA 4F22A 4M1VA 3IORA 3Q27A 3U8QA 4OQOA 4AB6A 4GBWA 1VFEA 4KCCA 4HE0A 5J16A 3S9EA 4PBHA 4F1YA 5A5XB 3HN0A 3AXFA 2QVRA 4YKPA 5IZ3A 5I2NB 3TAJA 1NV5A 1LBCA 4IR8A 1NV6A 2XXVA 2WYKA 5H8HA 1GV8A 4JDFA 4H65A 4P11A 1EYIA 2Z8DA 4GL0A 3B6TA 4DIGA 4RPNA 4UA8A 4JWXA 1S7YA 1N7XA 2XXYA 1FTKA 2FYIA 3R6UA 1MQDA 4ELQA 3RN8A 3MVZA 5ICQA 4F2OA 3KJ7A 2WBDA 3RPLB 5IZZA 3DP6A 5KDTA 3KOSA 1D9YA 3THIA 3M8UA 1NUZA 3O9PA 1I6QA 3RNNA 4OEVA 5BUUA 1MXWA 3DRIA 1Y1MA 2WKYA 4RNSA 4PAKA 2FBPA 5ET8A 2AYSA 5CRYA 1BK4A 2F8DA 2KLFA 4GRKA 5DYHA 4KXPA 3RPWA 1LAFE 3H6WA 1ZU0A 5K2XA 2OLBA 4UABA 4ELOA 1MXUA 3QYTA 1FPGA 3I3VA 1N84A 3B8BA 3KGCA 5CMCA 4XFEA 4OMBA 4MNIA 2VT5A 3C36A 3D1RA 2I49A 4N6DA 1N0TA 1UIVA 1RYXA 3T66A 4N6KA 3N94A 1WODA 4PGNA
chains in the Genus database with same CATH topology
1A99A 1JETA 3MBPA 1MXVA 2G93A 4H5FA 3EPEA 4QFNA 2Q2AA 3G3FA 2V3QA 3ILTB 3IOTA 1II5A 1FQCA 1IXHA 2H99A 3MVWA 1BLFA 1FW0A 3OO9A 4E0WA 3SEWA 3G7WA 5I59B 2YPNA 3VE1B 4YMBA 4NF6B 3TCGA 2DXYA 1B5JA 3LSFB 2B4LA 4KFQA 5DEXB 2UVGA 3GBAA 1JW5A 3SEUA 3E9XA 5L8DA 1URGA 1QUIA 3VXCA 4YB5A 1MXZA 3QIMA 1JEVA 4G68A 2D21A 3D4CA 3FJ7A 2NOOA 3KOTA 2XXWA 2DVZA 3R26A 1LFIA 3T9UA 4R72A 3MP1A 4RK9A 4U2RA 1HSEA 2BJJX 5H8HB 4XXUA 1FCKA 1XT8A 3FV2A 3PU5A 4EXKA 3IJOB 3CSBA 4POWA 3MUQA 1PB9A 2CMOA 3K02A 4FORA 1ELJA 2F6PA 2O1MA 3C9HA 3DRGA 3EHSA 1OIBA 2DXRA 1A55A 2XXRA 3A3CA 1NNFA 1QVSA 2QMXA 2IEEA 4OETA 1SW5A 4ZZEA 2ZYOA 3LC8A 1AMFA 1VFDA 5KDTB 3QUFA 3RY3A 1FTMA 2H9BA 1B3LA 4F3BA 4ZDMA 1Q35A 4IY6A 4G8MA 4ONYA 2O69A 2YJPA 5I57A 4KPTA 5AA1A 3FXUA 4U1ZA 2R9JA 1NH8A 3F11A 1B3HA 2Y7IA 3GXAA 1OLCA 3TTNA 2XX9A 3C35A 4R73A 2F7CA 2P1SA 4OESA 3DP8A 1Y4CA 3DRJA 2QS3A 3LR1A 4ND9A 1Y3NA 2O1LA 3ONMA 2O51A 1B0LA 4RJZA 4EQ7A 2PT1A 4X1DA 1DTZA 4H0WA 2OWTA 4G8NA 3SEVA 1NMUA 4OHNA 2HEUA 3C32A 4XKNA 3KN7A 1M5EA 3FXQA 3CSGA 1BP5A 1UTBA 3MVYA 1XVXA 5HPQA 2H5YA 4H8IA 4MH5A 4YZZA 1B5HA 1Q1KA 3EHUA 1IZ1A 3SESA 1MDP1 2OBGA 3Q26A 1P1UA 2Y7WA 5DVJA 3SKPA 1DSNA 1AL3A 4ZEIA 1B51A 2REGA 1GVCA 1B7HA 1A8EA 1D4NA 3C4MA 2Q8JA 4G68B 4R2FA 2UYFA 1P1NA 4DCYA 3ZSFA 2V84A 1IITA 1UIUA 4F3PA 2VD3A 1B6HA 2F6GA 1JW1A 4R6HA 3T22A 2R71A 1R9QA 2X26A 2F5XA 4PP0A 3LSWA 4LZ5A 2ZNSA 3B7DA 3MW0A 3TEPA 1POY1 2QS4A 4R75A 2DYXA 1IXCA 3MVXA 3U92A 2RKMA 1MQGA 1LFGA 3BKIB 3KN3A 4G8HA 5L9MA 1H3DA 4DLDA 4OFLA 2VD2A 1OVTA 1XC1A 3UN6A 4QFLA 3UA8A 4OVJA 3ILUB 1IQ7A 4F3SA 3TCHA 4HCYA 2HQ0A 3JV9A 1A54A 3KSJA 4PQJA 2QSXA 3PUVE 1N3XA 2ABHA 1N3WA 5I57B 2PVUA 4TQUQ 3RT6B 3TUSA 1MPDA 4I9DA 1P1QA 5AA3A 3FVNA 4PFTA 3O28A 2ONKE 4BDLA 3TMGA 3OOAA 3S9LC 4BDMA 2LAOA 5L9SA 2ZXTA 3RTWB 3C34A 2O7IA 3G3JA 3PUYE 3H6UA 3HHGA 2UXAA 1M5DA 1ZKBA 5CMMA 1DTGA 3MC2A 3H3GA 2DWIA 1MXYA 3DLNA 4EF2A 1BKAA 1QW0A 3IL1B 3K1MA 3DRFA 4PFYA 3N6UA 1UTBB 1I69A 3MPKA 2XX8A 1URDA 3H4ZA 1S9TA 4FAJA 1BTJA 2OK2A 4ZE9A 3ODBA 3O66A 1LGBC 2XX7A 1GGGA 4LP2B 4ZECA 1ZLQA 1HSJA 2I0CA 2I48A 2HAVA 1O63A 1MRPA 2ANJA 2B65A 3ZKKA 1DOTA 4O3CA 1R9LA 3LUYA 4AQ4A 1O7TA 2HCAA 2ALUA 1Y20A 3KG2A 2NVUB 4BDRA 1YPNA 3R7XA 4HW8A 3OO6A 3MWBA 1LCTA 4JXIA 3C31A 4ZEKA 1IEJA 3N26A 3LSLA 1EZPA 3T9VA 3O2AA 4Z0IA 1DPPA 1H45A 4FECA 4E0XA 4LZ7A 1PEBA 2D5WA 4O3BA 3H7MA 4RYAA 2XXIA 3RQTA 3PPQA 4ZE8A 1AH5A 3HCQA 4I8CA 4IY5A 4R9GA 5IAIA 4JB7A 1NL5A 3L6GA 3JZJA 4NF5A 4GOTA 4KYDA 5FHMA 1MPCA 3TZAA 3OO7A 5ELVA 1B1HA 1FQEA 3ZKLA 2NXOA 4N13A 3MZ1A 3QSLA 1QULA 3KBRA 1OMPA 4QF9A 4U22A 1F9BA 1M5FA 2QMWA 3LSXA 3CHGA 4QFPA 2QJEA 1NNKA 4MF3A 4KCDA 2ZNUA 2XHDA 3TTMA 2Z8EA 4YICA 2ESNA 5AA2A 3K1NA 3MZ9A 4UACA 5EHSA 4DXUA 1B2HA 2QL3A 3IO4A 2DSFA 3IR1A 4LATA 1LAHE 2RC9A 3E13X 3IOVA 1MH3A 4RPOA 3DM0A 3FVGA 1SD3A 3TTLA 1TFDA 4NF8A 1QKBA 4ZS9A 5H8NA 4R74A 4KD5A 1R6ZA 1ZJLA 2XXQA 4Q30B 4QSDA 1Y4TA 4MLQA 4X1BA 4OYVA 4JSOA 2Z8FA 3DP4A 1MY3A 2DVCA 1Z7ME 4BDOA 3K6UA 2B4MA 3FATA 5H8QA 1H76A 2UVJA 1US4A 1IXIA 5JEIA 1JNFA 4PETA 1LB8A 1N7WA 4N07A 3OSRA 4YB7A 3E3KA 5I56A 3PV0E 4WXJA 2CZLA 1PBPA 4C0RA 4ECFA 3HV1A 1EH3A 4OZ9A 3QXMA 3UGWA 1P99A 4Q0CA 3RYBA 3BBRA 3CRBA 1O64A 3VDFA 3PMVA 5H8SA 5AE4A 4LQ2A 5DVFA 1XHYA 1MM6A 4HTGA 3KEIA 2VHAA 3MAMA 4YKJA 3V89B 1AOVA 3PPNA 2F97A 2IA4A 2ZYMA 1LAXA 5DVIA 2F34A 2XXHA 3OD7A 1PDAA 1LSTA 5CBSA 4XKPA 5KCJA 1TFAA 1RYOA 3LVUA 4NF5B 3V8XB 4QFOA 2A5TA 3N6TA 5TU0A 2DP8A 2AL5A 4EQBA 3KJTA 4EQ9A 3DELB 4QFKA 1NKXA 3EN3A 4EXLA 4ELPA 1B52A 2UVHA 1ANFA 4H6DA 4LUBA 3CG3A 2ONRA 5FTHA 5CM6A 4H5GA 2REJA 3WAFA 5DTBA 1B1XA 4F39A 4GFRA 3BFTA 3MP8A 5AA2B 2F7AA 4F1VA 5ISUA 3K6WA 4IB2A 1MM7A 2V25A 5CI5A 3CI8A 3RYAA 5I2KA 3I6VA 3T96B 3Q25A 3VLWA 4U21A 4NF8B 1H43A 4KR5A 3GZGA 5H8NB 1NFTA 1OQGA 4YAHX 2RCBA 1NH7A 3EHTA 4R2BA 2DWAA 3O6GA 3EF7A 3GBBA 1JVXA 1N04A 5K2YA 1AIVA 1FTOA 1Y3QA 1FQAA 5BWJA 3C33A 3PAMA 1LAGE 4C1TA 1MH4A 3PD9A 1L5TA 1QUKA 1MS7A 2E1SA 4NWCA 1LFHA 5I56B 3FVKA 4NEDA 3FTOA 4Z7EA 4ZEFA 4TLLB 3O6IA 1UTHA 3TQWA 2VOZA 1MY1A 1Y9UA 2ZYKA 4RY1A 5FHNA 1P1OA 2PMSA 3KZGA 4OWDA 2R6GE 3HO7A 3TFLA 1POTA 2I4CA 4L17A 3VFJA 4DDDA 1PB7A 5CC2A 1M5CA 2RCAA 4U1OA 4LONB 5F1QA 5CMKA 5KCJB 2ZYNA 5IKBA 1JW4A 3TELA 5DT6A 4XKQA 1USYE 2A5TB 2I4BA 3O29A 3VV5A 4BLAA 3K0VA 4KYSA 3ECRA 4IO4A 1IUDA 3QK6A 4JSDA 2PBWA 3G3GA 1XVYA 4F2QA 4YKKA 3IO6A 2XXTA 3FD3A 4F18A 1MY0A 4R6KA 5TPAA 1ZTYA 1RKMA 2PT2A 2I0BA 4LA9A 3TPAA 2M8CA 3FGSA 1GTKA 3OEMA 4FE8A 3PPRA 1WDNA 1SW2A 5B7DA 4DXBA 4IO2A 3D4GA 5I2KB 4FATA 4WEPA 3QAXA 2GRVA 3DRKA 2Q2CA 5L9OA 3FV1A 4XTCQ 2HFBA 5I58A 2HXWA 1B7ZA 2O7UA 4N6PA 4YKIA 4LZ8A 4TLMB 3SEXA 4ESXA 3B6QA 1M5BA 1YAEA 2QRYA 5B70A 4RA1A 2X7QA 4OXVA 3TDJA 1LB9A 3U93A 2HAUA 4OFOA 3CIJA 3G3IA 1US5A 1D3KA 1A8FA 1TXFA 4YMAA 4MBPA 1TT1A 3FJGA 5ITPA 1B58A 3IOWA 5I84A 4DCXA 3DRHA 2Y84A 3OEKA 2XD2A 4H8JA 3IB1A 2OJTA 1SDXA 1LLSA 3MQ9A 1JQFA 3K6VA 1SVXB 1VE4A 2V3TA 2XXUA 2AIXA 3K4UA 3T93B 1SW1A 4X48A 1I6BA 4R9FA 5JTYA 4MLVA 3MJNA 3U1OA 3JYRA 1P1WA 1USYH 2X7PA 4OERA 3OXNA 4G68C 4GF8A 3VLUA 1UTHB 5LOMA 5EHMA 4G2ZA 1Y3PA 1LBBA 3FJMA 2I58A 1MG1A 3UP9A 3SERA 1DMBA 5J1DA 3K1PA 1FQFA 4F29A 3V83A 5CBRA 3L6HA 4LQ5A 4EDPA 2RC8A 3SDFA 3U94A 3IJXB 3B6WA 4WEDA 4MFIA 3FUZA 3V5AA 3RTFB 4GQOA 4F31B 2OCUA 3UORA 3S9MC 1PBQA 3A3UA 2H98A 2O68A 2F7BA 2DQVA 3RUMA 1EZ9A 1QKAA 1CE2A 2WOPA 1QJMA 3CVGA 3VXBA 4DZ1A 5FHOA 3O6PA 4X9TA 3RGYA 3W9WA 3TTKA 1URSA 3PPOA 1NNPA 3TCFA 3SETA 4FEBA 2Y7KA 3CFZA 5TPAB 1B9JA 4HS7A 3H6TA 2GHBA 4THIA 1Z7NE 3M3KA 3PD8A 1SYHA 1SW4A 1QUJA 2F36A 4H67A 3PPPA 4O3AA 1KWHA 3TQLA 2Q89A 4XKRA 3O97A 4U4SA 4KYEA 1A7LA 4LVQA 1SI1A 4GLIA 3IK6B 5AA4A 4IGTA 5I58B 2DE2A 3PMWA 4OEUA 4ISUA 2Y7RA 2H4IA 1B5IA 5KZTA 1HSLA 3I5OA 1N76A 4P0GA 3IX1A 1GR2A 4IO3A 3T9HB 3ZS6A 3H06B 4NWDA 1MDQA 3RT8A 2AL4A 4ESWA 4RK2A 2OWSA 4ZEDA 4G77A 3RLFE 4NTLA 3VVDA 4F19A 1EU8A 1B05A 1ATGA 3IAZA 2RC7A 1H44A 5HM4B 4I62A 4BDQA 3G3KA 2D3IA 1PC3A 4GXSB 5JTYB 2ZNTA 2P0SA 1WVJA 4JWOA 3FASA 3PUXE 4F1UA 3P7IA 1VR5A 3IOUA 2E0SA 1MXXA 3S4UA 5ICTA 2F35A 5H8FA 3HHFA 2PX1A 4KI0E 2NUVA 4GWOA 4WKMA 3Q28A 4XIGQ 4U23A 4KHZE 2F78A 5HBCA 5FTIA 5ITOA 2W7YA 5AA2D 4YB6A 3OMBA 1FTLA 3KSXA 2Z22A 4QRZA 2FNCA 1B3GA 4Q5TA 3CFLA 4PFWA 4NMYA 3WAEA 2I3WA 2QPQA 3E4RA 2G29A 5EYFA 4C1UA 3G3HA 1B3FA 1Y1ZA 3OELA 3S9NC 4GL8A 1IXGA 4NF4A 4IGRA 1FTJA 5TP9A 3TTRA 1OVBA 3VVEA 1CB6A 1OLAA 2QS2A 1A40A 4QSCA 2XXPA 1D9VA 4P0IA 4RXLA 4DE8A 3CR9A 2YLNA 4PE5B 2HZLA 1SBPA 4QHQA 2GHAA 4GVOA 2ZMBA 1B4HA 3UIFA 2H25A 1DPEA 3BFUA 4YU0A 5AA4B 2DWHA 4FIMA 5F7VA 4KQPA 3TKDA 2VGQA 1R1NA 1MQJA 3EQ1A 2O84X 1TWYA 1SQYA 1MQHA 4GXAA 4GD5A 3CFXA 1XS5A 1I6AA 2DE4A 3VVFA 2Q9TA 1PB8A 3GLBA 3UK4A 2VP1A 5H8QB 3TODA 4ZZAA 2WOKA 3O6HA 3FZVA 3HPIA 2DOJA 1BIYA 3MPLA 5JK4A 3PUZE 1T0KA 2V3UA 2I6EA 2Y7PA 5CMBA 2DWJA 2THIA 3S2VA 4H1XA 1MPBA 1S50A 5A5XA 3KN8A 2RF1A 4OENA 4POXA 2P2AA 5H8FB 4G4PA 2WOLA 5I2NA 4R6YA 4FJPA 4OTEA 2DE3A 1SYIA 4EUOA 4IO7A 3MP6A 3FXRA 2V93A 4NE4A 3SEYA 2OZZA 3A09A 3LBSA 5M2VA 3KFMA 1ZBMA 3FIRA 4HCWA 1JEUA 2O6AA 4K3FA 3CG1A 3TYHA 2GH9A 2HZKA 1YCJA 1FQDA 4TOZA 3MZBA 3W15C 4IO6A 4Q8RA 3H6VA 1B46A 3PUWE 3FVOA 1ZIUA 4FEDA 3K6XA 2PYYA 3K00A 2QS1A 1VSOA 2RINA 3N5LA 1B40A 4NF4B 4AB5A 2B3BA 2NWJA 1B4ZA 3H03A 3U72A 1LCFA 5TP9B 2XD3A 1IIWA 4ZEBA 3W9VA 3OO8A 2Q88A 3IB0A 3M3FA 1B32A 1FQBA 4I1DA 4GIZA 2FA7A 1XOCA 3Q29A 3M3LA 2I3VA 1B0HA 1ZMGA 1B7UA 4OFJA 3QUJA 2B3FA 1B3EA 1MY4A 1EZOA 3PGFA 3OSQA 1SI0A 2DS9A 4PFUA 1NNTA 3T9XB 3VLVA 1UQWA 3IB2A 1OQHA 2GFEA 3K01A 4QSEA 4JWYA 3K2DA 3PMXA 1YTVA 1MY2A 3OENA 2Z23A 1J1NA 3HSTA 3USDA 4F3GA 4U4XA 4IO5A 1MQIA 2UYEA 2A5SA 5I59A 2UVIA 2XXXA 4NF6A 1JVYA 2ONSA 4ELRA 4JBZA 4M4GA 4EF1A 4BDNA 4DXCA 5DEXA 4F22A 4M1VA 3IORA 3Q27A 3U8QA 4OQOA 4AB6A 1VFEA 4KCCA 3S9EA 4F1YA 5A5XB 3HN0A 3AXFA 4YKPA 5I2NB 3TAJA 1LBCA 2XXVA 5H8HA 1GV8A 4JDFA 4H65A 4P11A 2Z8DA 4GL0A 3B6TA 4DIGA 4RPNA 4UA8A 4JWXA 1S7YA 1N7XA 2XXYA 1FTKA 2FYIA 3R6UA 4ELQA 1MQDA 3RN8A 3MVZA 5ICQA 4F2OA 3KJ7A 3DP6A 5KDTA 3KOSA 1D9YA 3THIA 3M8UA 3O9PA 1I6QA 3RNNA 4OEVA 5BUUA 1MXWA 3DRIA 1Y1MA 2WKYA 4RNSA 2AYSA 5CRYA 2F8DA 2KLFA 4GRKA 5DYHA 3RPWA 1LAFE 3H6WA 1ZU0A 5K2XA 2OLBA 4ELOA 1MXUA 3QYTA 3I3VA 1N84A 3KGCA 5CMCA 4OMBA 3C36A 2I49A 1N0TA 1UIVA 1RYXA 3T66A 3N94A 1WODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A99 A;  1JET A;  3MBP A;  1MXV A;  2G93 A;  4H5F A;  3EPE A;  4QFN A;  2Q2A A;  3G3F A;  2V3Q A;  3ILT B;  3IOT A;  1II5 A;  1FQC A;  1IXH A;  2H99 A;  3MVW A;  1BLF A;  1FW0 A;  3OO9 A;  4E0W A;  3SEW A;  3G7W A;  5I59 B;  2YPN A;  3VE1 B;  4YMB A;  4NF6 B;  3TCG A;  2DXY A;  1B5J A;  3LSF B;  2B4L A;  4KFQ A;  5DEX B;  2UVG A;  3GBA A;  1JW5 A;  3SEU A;  3E9X A;  5L8D A;  1URG A;  1QUI A;  3VXC A;  4YB5 A;  1MXZ A;  3QIM A;  1JEV A;  4G68 A;  2D21 A;  3D4C A;  3FJ7 A;  2NOO A;  3KOT A;  2XXW A;  2DVZ A;  3R26 A;  1LFI A;  3T9U A;  4R72 A;  3MP1 A;  4RK9 A;  4U2R A;  1HSE A;  2BJJ X;  5H8H B;  4XXU A;  1FCK A;  1XT8 A;  3FV2 A;  3PU5 A;  4EXK A;  3IJO B;  3CSB A;  4POW A;  3MUQ A;  1PB9 A;  2CMO A;  3K02 A;  4FOR A;  1ELJ A;  2F6P A;  2O1M A;  3C9H A;  3DRG A;  3EHS A;  1OIB A;  2DXR A;  1A55 A;  2XXR A;  3A3C A;  1NNF A;  1QVS A;  2QMX A;  2IEE A;  4OET A;  1SW5 A;  4ZZE A;  2ZYO A;  3LC8 A;  1AMF A;  1VFD A;  5KDT B;  3QUF A;  3RY3 A;  1FTM A;  2H9B A;  1B3L A;  4F3B A;  4ZDM A;  1Q35 A;  4IY6 A;  4G8M A;  4ONY A;  2O69 A;  2YJP A;  5I57 A;  4KPT A;  5AA1 A;  3FXU A;  4U1Z A;  2R9J A;  1NH8 A;  3F11 A;  1B3H A;  2Y7I A;  3GXA A;  1OLC A;  3TTN A;  2XX9 A;  3C35 A;  4R73 A;  2F7C A;  2P1S A;  4OES A;  3DP8 A;  1Y4C A;  3DRJ A;  2QS3 A;  3LR1 A;  4ND9 A;  1Y3N A;  2O1L A;  3ONM A;  2O51 A;  1B0L A;  4RJZ A;  4EQ7 A;  2PT1 A;  4X1D A;  1DTZ A;  4H0W A;  2OWT A;  4G8N A;  3SEV A;  1NMU A;  4OHN A;  2HEU A;  3C32 A;  4XKN A;  3KN7 A;  1M5E A;  3FXQ A;  3CSG A;  1BP5 A;  1UTB A;  3MVY A;  1XVX A;  5HPQ A;  2H5Y A;  4H8I A;  4MH5 A;  4YZZ A;  1B5H A;  1Q1K A;  3EHU A;  1IZ1 A;  3SES A;  1MDP 1;  2OBG A;  3Q26 A;  1P1U A;  2Y7W A;  5DVJ A;  3SKP A;  1DSN A;  1AL3 A;  4ZEI A;  1B51 A;  2REG A;  1GVC A;  1B7H A;  1A8E A;  1D4N A;  3C4M A;  2Q8J A;  4G68 B;  4R2F A;  2UYF A;  1P1N A;  4DCY A;  3ZSF A;  2V84 A;  1IIT A;  1UIU A;  4F3P A;  2VD3 A;  1B6H A;  2F6G A;  1JW1 A;  4R6H A;  3T22 A;  2R71 A;  1R9Q A;  2X26 A;  2F5X A;  4PP0 A;  3LSW A;  4LZ5 A;  2ZNS A;  3B7D A;  3MW0 A;  3TEP A;  1POY 1;  2QS4 A;  4R75 A;  2DYX A;  1IXC A;  3MVX A;  3U92 A;  2RKM A;  1MQG A;  1LFG A;  3BKI B;  3KN3 A;  4G8H A;  5L9M A;  1H3D A;  4DLD A;  4OFL A;  2VD2 A;  1OVT A;  1XC1 A;  3UN6 A;  4QFL A;  3UA8 A;  4OVJ A;  3ILU B;  1IQ7 A;  4F3S A;  3TCH A;  4HCY A;  2HQ0 A;  3JV9 A;  1A54 A;  3KSJ A;  4PQJ A;  2QSX A;  3PUV E;  1N3X A;  2ABH A;  1N3W A;  5I57 B;  2PVU A;  4TQU Q;  3RT6 B;  3TUS A;  1MPD A;  4I9D A;  1P1Q A;  5AA3 A;  3FVN A;  4PFT A;  3O28 A;  2ONK E;  4BDL A;  3TMG A;  3OOA A;  3S9L C;  4BDM A;  2LAO A;  5L9S A;  2ZXT A;  3RTW B;  3C34 A;  2O7I A;  3G3J A;  3PUY E;  3H6U A;  3HHG A;  2UXA A;  1M5D A;  1ZKB A;  5CMM A;  1DTG A;  3MC2 A;  3H3G A;  2DWI A;  1MXY A;  3DLN A;  4EF2 A;  1BKA A;  1QW0 A;  3IL1 B;  3K1M A;  3DRF A;  4PFY A;  3N6U A;  1UTB B;  1I69 A;  3MPK A;  2XX8 A;  1URD A;  3H4Z A;  1S9T A;  4FAJ A;  1BTJ A;  2OK2 A;  4ZE9 A;  3ODB A;  3O66 A;  1LGB C;  2XX7 A;  1GGG A;  4LP2 B;  4ZEC A;  1ZLQ A;  1HSJ A;  2I0C A;  2I48 A;  2HAV A;  1O63 A;  1MRP A;  2ANJ A;  2B65 A;  3ZKK A;  1DOT A;  4O3C A;  1R9L A;  3LUY A;  4AQ4 A;  1O7T A;  2HCA A;  2ALU A;  1Y20 A;  3KG2 A;  2NVU B;  4BDR A;  1YPN A;  3R7X A;  4HW8 A;  3OO6 A;  3MWB A;  1LCT A;  4JXI A;  3C31 A;  4ZEK A;  1IEJ A;  3N26 A;  3LSL A;  1EZP A;  3T9V A;  3O2A A;  4Z0I A;  1DPP A;  1H45 A;  4FEC A;  4E0X A;  4LZ7 A;  1PEB A;  2D5W A;  4O3B A;  3H7M A;  4RYA A;  2XXI A;  3RQT A;  3PPQ A;  4ZE8 A;  1AH5 A;  3HCQ A;  4I8C A;  4IY5 A;  4R9G A;  5IAI A;  4JB7 A;  1NL5 A;  3L6G A;  3JZJ A;  4NF5 A;  4GOT A;  4KYD A;  5FHM A;  1MPC A;  3TZA A;  3OO7 A;  5ELV A;  1B1H A;  1FQE A;  3ZKL A;  2NXO A;  4N13 A;  3MZ1 A;  3QSL A;  1QUL A;  3KBR A;  1OMP A;  4QF9 A;  4U22 A;  1F9B A;  1M5F A;  2QMW A;  3LSX A;  3CHG A;  4QFP A;  2QJE A;  1NNK A;  4MF3 A;  4KCD A;  2ZNU A;  2XHD A;  3TTM A;  2Z8E A;  4YIC A;  2ESN A;  5AA2 A;  3K1N A;  3MZ9 A;  4UAC A;  5EHS A;  4DXU A;  1B2H A;  2QL3 A;  3IO4 A;  2DSF A;  3IR1 A;  4LAT A;  1LAH E;  2RC9 A;  3E13 X;  3IOV A;  1MH3 A;  4RPO A;  3DM0 A;  3FVG A;  1SD3 A;  3TTL A;  1TFD A;  4NF8 A;  1QKB A;  4ZS9 A;  5H8N A;  4R74 A;  4KD5 A;  1R6Z A;  1ZJL A;  2XXQ A;  4Q30 B;  4QSD A;  1Y4T A;  4MLQ A;  4X1B A;  4OYV A;  4JSO A;  2Z8F A;  3DP4 A;  1MY3 A;  2DVC A;  1Z7M E;  4BDO A;  3K6U A;  2B4M A;  3FAT A;  5H8Q A;  1H76 A;  2UVJ A;  1US4 A;  1IXI A;  5JEI A;  1JNF A;  4PET A;  1LB8 A;  1N7W A;  4N07 A;  3OSR A;  4YB7 A;  3E3K A;  5I56 A;  3PV0 E;  4WXJ A;  2CZL A;  1PBP A;  4C0R A;  4ECF A;  3HV1 A;  1EH3 A;  4OZ9 A;  3QXM A;  3UGW A;  1P99 A;  4Q0C A;  3RYB A;  3BBR A;  3CRB A;  1O64 A;  3VDF A;  3PMV A;  5H8S A;  5AE4 A;  4LQ2 A;  5DVF A;  1XHY A;  1MM6 A;  4HTG A;  3KEI A;  2VHA A;  3MAM A;  4YKJ A;  3V89 B;  1AOV A;  3PPN A;  2F97 A;  2IA4 A;  2ZYM A;  1LAX A;  5DVI A;  2F34 A;  2XXH A;  3OD7 A;  1PDA A;  1LST A;  5CBS A;  4XKP A;  5KCJ A;  1TFA A;  1RYO A;  3LVU A;  4NF5 B;  3V8X B;  4QFO A;  2A5T A;  3N6T A;  5TU0 A;  2DP8 A;  2AL5 A;  4EQB A;  3KJT A;  4EQ9 A;  3DEL B;  4QFK A;  1NKX A;  3EN3 A;  4EXL A;  4ELP A;  1B52 A;  2UVH A;  1ANF A;  4H6D A;  4LUB A;  3CG3 A;  2ONR A;  5FTH A;  5CM6 A;  4H5G A;  2REJ A;  3WAF A;  5DTB A;  1B1X A;  4F39 A;  4GFR A;  3BFT A;  3MP8 A;  5AA2 B;  2F7A A;  4F1V A;  5ISU A;  3K6W A;  4IB2 A;  1MM7 A;  2V25 A;  5CI5 A;  3CI8 A;  3RYA A;  5I2K A;  3I6V A;  3T96 B;  3Q25 A;  3VLW A;  4U21 A;  4NF8 B;  1H43 A;  4KR5 A;  3GZG A;  5H8N B;  1NFT A;  1OQG A;  4YAH X;  2RCB A;  1NH7 A;  3EHT A;  4R2B A;  2DWA A;  3O6G A;  3EF7 A;  3GBB A;  1JVX A;  1N04 A;  5K2Y A;  1AIV A;  1FTO A;  1Y3Q A;  1FQA A;  5BWJ A;  3C33 A;  3PAM A;  1LAG E;  4C1T A;  1MH4 A;  3PD9 A;  1L5T A;  1QUK A;  1MS7 A;  2E1S A;  4NWC A;  1LFH A;  5I56 B;  3FVK A;  4NED A;  3FTO A;  4Z7E A;  4ZEF A;  4TLL B;  3O6I A;  1UTH A;  3TQW A;  2VOZ A;  1MY1 A;  1Y9U A;  2ZYK A;  4RY1 A;  5FHN A;  1P1O A;  2PMS A;  3KZG A;  4OWD A;  2R6G E;  3HO7 A;  3TFL A;  1POT A;  2I4C A;  4L17 A;  3VFJ A;  4DDD A;  1PB7 A;  5CC2 A;  1M5C A;  2RCA A;  4U1O A;  4LON B;  5F1Q A;  5CMK A;  5KCJ B;  2ZYN A;  5IKB A;  1JW4 A;  3TEL A;  5DT6 A;  4XKQ A;  1USY E;  2A5T B;  2I4B A;  3O29 A;  3VV5 A;  4BLA A;  3K0V A;  4KYS A;  3ECR A;  4IO4 A;  1IUD A;  3QK6 A;  4JSD A;  2PBW A;  3G3G A;  1XVY A;  4F2Q A;  4YKK A;  3IO6 A;  2XXT A;  3FD3 A;  4F18 A;  1MY0 A;  4R6K A;  5TPA A;  1ZTY A;  1RKM A;  2PT2 A;  2I0B A;  4LA9 A;  3TPA A;  2M8C A;  3FGS A;  1GTK A;  3OEM A;  4FE8 A;  3PPR A;  1WDN A;  1SW2 A;  5B7D A;  4DXB A;  4IO2 A;  3D4G A;  5I2K B;  4FAT A;  4WEP A;  3QAX A;  2GRV A;  3DRK A;  2Q2C A;  5L9O A;  3FV1 A;  4XTC Q;  2HFB A;  5I58 A;  2HXW A;  1B7Z A;  2O7U A;  4N6P A;  4YKI A;  4LZ8 A;  4TLM B;  3SEX A;  4ESX A;  3B6Q A;  1M5B A;  1YAE A;  2QRY A;  5B70 A;  4RA1 A;  2X7Q A;  4OXV A;  3TDJ A;  1LB9 A;  3U93 A;  2HAU A;  4OFO A;  3CIJ A;  3G3I A;  1US5 A;  1D3K A;  1A8F A;  1TXF A;  4YMA A;  4MBP A;  1TT1 A;  3FJG A;  5ITP A;  1B58 A;  3IOW A;  5I84 A;  4DCX A;  3DRH A;  2Y84 A;  3OEK A;  2XD2 A;  4H8J A;  3IB1 A;  2OJT A;  1SDX A;  1LLS A;  3MQ9 A;  1JQF A;  3K6V A;  1SVX B;  1VE4 A;  2V3T A;  2XXU A;  2AIX A;  3K4U A;  3T93 B;  1SW1 A;  4X48 A;  1I6B A;  4R9F A;  5JTY A;  4MLV A;  3MJN A;  3U1O A;  3JYR A;  1P1W A;  1USY H;  2X7P A;  4OER A;  3OXN A;  4G68 C;  4GF8 A;  3VLU A;  1UTH B;  5LOM A;  5EHM A;  4G2Z A;  1Y3P A;  1LBB A;  3FJM A;  2I58 A;  1MG1 A;  3UP9 A;  3SER A;  1DMB A;  5J1D A;  3K1P A;  1FQF A;  4F29 A;  3V83 A;  5CBR A;  3L6H A;  4LQ5 A;  4EDP A;  2RC8 A;  3SDF A;  3U94 A;  3IJX B;  3B6W A;  4WED A;  4MFI A;  3FUZ A;  3V5A A;  3RTF B;  4GQO A;  4F31 B;  2OCU A;  3UOR A;  3S9M C;  1PBQ A;  3A3U A;  2H98 A;  2O68 A;  2F7B A;  2DQV A;  3RUM A;  1EZ9 A;  1QKA A;  1CE2 A;  2WOP A;  1QJM A;  3CVG A;  3VXB A;  4DZ1 A;  5FHO A;  3O6P A;  4X9T A;  3RGY A;  3W9W A;  3TTK A;  1URS A;  3PPO A;  1NNP A;  3TCF A;  3SET A;  4FEB A;  2Y7K A;  3CFZ A;  5TPA B;  1B9J A;  4HS7 A;  3H6T A;  2GHB A;  4THI A;  1Z7N E;  3M3K A;  3PD8 A;  1SYH A;  1SW4 A;  1QUJ A;  2F36 A;  4H67 A;  3PPP A;  4O3A A;  1KWH A;  3TQL A;  2Q89 A;  4XKR A;  3O97 A;  4U4S A;  4KYE A;  1A7L A;  4LVQ A;  1SI1 A;  4GLI A;  3IK6 B;  5AA4 A;  4IGT A;  5I58 B;  2DE2 A;  3PMW A;  4OEU A;  4ISU A;  2Y7R A;  2H4I A;  1B5I A;  5KZT A;  1HSL A;  3I5O A;  1N76 A;  4P0G A;  3IX1 A;  1GR2 A;  4IO3 A;  3T9H B;  3ZS6 A;  3H06 B;  4NWD A;  1MDQ A;  3RT8 A;  2AL4 A;  4ESW A;  4RK2 A;  2OWS A;  4ZED A;  4G77 A;  3RLF E;  4NTL A;  3VVD A;  4F19 A;  1EU8 A;  1B05 A;  1ATG A;  3IAZ A;  2RC7 A;  1H44 A;  5HM4 B;  4I62 A;  4BDQ A;  3G3K A;  2D3I A;  1PC3 A;  4GXS B;  5JTY B;  2ZNT A;  2P0S A;  1WVJ A;  4JWO A;  3FAS A;  3PUX E;  4F1U A;  3P7I A;  1VR5 A;  3IOU A;  2E0S A;  1MXX A;  3S4U A;  5ICT A;  2F35 A;  5H8F A;  3HHF A;  2PX1 A;  4KI0 E;  2NUV A;  4GWO A;  4WKM A;  3Q28 A;  4XIG Q;  4U23 A;  4KHZ E;  2F78 A;  5HBC A;  5FTI A;  5ITO A;  2W7Y A;  5AA2 D;  4YB6 A;  3OMB A;  1FTL A;  3KSX A;  2Z22 A;  4QRZ A;  2FNC A;  1B3G A;  4Q5T A;  3CFL A;  4PFW A;  4NMY A;  3WAE A;  2I3W A;  2QPQ A;  3E4R A;  2G29 A;  5EYF A;  4C1U A;  3G3H A;  1B3F A;  1Y1Z A;  3OEL A;  3S9N C;  4GL8 A;  1IXG A;  4NF4 A;  4IGR A;  1FTJ A;  5TP9 A;  3TTR A;  1OVB A;  3VVE A;  1CB6 A;  1OLA A;  2QS2 A;  1A40 A;  4QSC A;  2XXP A;  1D9V A;  4P0I A;  4RXL A;  4DE8 A;  3CR9 A;  2YLN A;  4PE5 B;  2HZL A;  1SBP A;  4QHQ A;  2GHA A;  4GVO A;  2ZMB A;  1B4H A;  3UIF A;  2H25 A;  1DPE A;  3BFU A;  4YU0 A;  5AA4 B;  2DWH A;  4FIM A;  5F7V A;  4KQP A;  3TKD A;  2VGQ A;  1R1N A;  1MQJ A;  3EQ1 A;  2O84 X;  1TWY A;  1SQY A;  1MQH A;  4GXA A;  4GD5 A;  3CFX A;  1XS5 A;  1I6A A;  2DE4 A;  3VVF A;  2Q9T A;  1PB8 A;  3GLB A;  3UK4 A;  2VP1 A;  5H8Q B;  3TOD A;  4ZZA A;  2WOK A;  3O6H A;  3FZV A;  3HPI A;  2DOJ A;  1BIY A;  3MPL A;  5JK4 A;  3PUZ E;  1T0K A;  2V3U A;  2I6E A;  2Y7P A;  5CMB A;  2DWJ A;  2THI A;  3S2V A;  4H1X A;  1MPB A;  1S50 A;  5A5X A;  3KN8 A;  2RF1 A;  4OEN A;  4POX A;  2P2A A;  5H8F B;  4G4P A;  2WOL A;  5I2N A;  4R6Y A;  4FJP A;  4OTE A;  2DE3 A;  1SYI A;  4EUO A;  4IO7 A;  3MP6 A;  3FXR A;  2V93 A;  4NE4 A;  3SEY A;  2OZZ A;  3A09 A;  3LBS A;  5M2V A;  3KFM A;  1ZBM A;  3FIR A;  4HCW A;  1JEU A;  2O6A A;  4K3F A;  3CG1 A;  3TYH A;  2GH9 A;  2HZK A;  1YCJ A;  1FQD A;  4TOZ A;  3MZB A;  3W15 C;  4IO6 A;  4Q8R A;  3H6V A;  1B46 A;  3PUW E;  3FVO A;  1ZIU A;  4FED A;  3K6X A;  2PYY A;  3K00 A;  2QS1 A;  1VSO A;  2RIN A;  3N5L A;  1B40 A;  4NF4 B;  4AB5 A;  2B3B A;  2NWJ A;  1B4Z A;  3H03 A;  3U72 A;  1LCF A;  5TP9 B;  2XD3 A;  1IIW A;  4ZEB A;  3W9V A;  3OO8 A;  2Q88 A;  3IB0 A;  3M3F A;  1B32 A;  1FQB A;  4I1D A;  4GIZ A;  2FA7 A;  1XOC A;  3Q29 A;  3M3L A;  2I3V A;  1B0H A;  1ZMG A;  1B7U A;  4OFJ A;  3QUJ A;  2B3F A;  1B3E A;  1MY4 A;  1EZO A;  3PGF A;  3OSQ A;  1SI0 A;  2DS9 A;  4PFU A;  1NNT A;  3T9X B;  3VLV A;  1UQW A;  3IB2 A;  1OQH A;  2GFE A;  3K01 A;  4QSE A;  4JWY A;  3K2D A;  3PMX A;  1YTV A;  1MY2 A;  3OEN A;  2Z23 A;  1J1N A;  3HST A;  3USD A;  4F3G A;  4U4X A;  4IO5 A;  1MQI A;  2UYE A;  2A5S A;  5I59 A;  2UVI A;  2XXX A;  4NF6 A;  1JVY A;  2ONS A;  4ELR A;  4JBZ A;  4M4G A;  4EF1 A;  4BDN A;  4DXC A;  5DEX A;  4F22 A;  4M1V A;  3IOR A;  3Q27 A;  3U8Q A;  4OQO A;  4AB6 A;  1VFE A;  4KCC A;  3S9E A;  4F1Y A;  5A5X B;  3HN0 A;  3AXF A;  4YKP A;  5I2N B;  3TAJ A;  1LBC A;  2XXV A;  5H8H A;  1GV8 A;  4JDF A;  4H65 A;  4P11 A;  2Z8D A;  4GL0 A;  3B6T A;  4DIG A;  4RPN A;  4UA8 A;  4JWX A;  1S7Y A;  1N7X A;  2XXY A;  1FTK A;  2FYI A;  3R6U A;  4ELQ A;  1MQD A;  3RN8 A;  3MVZ A;  5ICQ A;  4F2O A;  3KJ7 A;  3DP6 A;  5KDT A;  3KOS A;  1D9Y A;  3THI A;  3M8U A;  3O9P A;  1I6Q A;  3RNN A;  4OEV A;  5BUU A;  1MXW A;  3DRI A;  1Y1M A;  2WKY A;  4RNS A;  2AYS A;  5CRY A;  2F8D A;  2KLF A;  4GRK A;  5DYH A;  3RPW A;  1LAF E;  3H6W A;  1ZU0 A;  5K2X A;  2OLB A;  4ELO A;  1MXU A;  3QYT A;  3I3V A;  1N84 A;  3KGC A;  5CMC A;  4OMB A;  3C36 A;  2I49 A;  1N0T A;  1UIV A;  1RYX A;  3T66 A;  3N94 A;  1WOD A; 
#chains in the Genus database with same CATH topology
 1A99 A;  1JET A;  3MBP A;  4GWY A;  1MXV A;  2G93 A;  4H5F A;  3EPE A;  4QFN A;  2Q2A A;  3G3F A;  4MAG A;  2V3Q A;  1FTA A;  3ILT B;  4OVQ A;  3IOT A;  1II5 A;  4MHF A;  1FQC A;  1IXH A;  1K9Y A;  2H99 A;  3MVW A;  1BLF A;  1FW0 A;  3OO9 A;  4E0W A;  3SEW A;  3G7W A;  5I59 B;  2YPN A;  3VE1 B;  4YMB A;  4NF6 B;  5EYH A;  3TCG A;  2DXY A;  1B5J A;  3E79 A;  3LSF B;  1LBY A;  2B4L A;  4KFQ A;  5DEX B;  2UVG A;  3GBA A;  4OVR A;  1JW5 A;  3SEU A;  3E9X A;  5L8D A;  1URG A;  1QUI A;  3VXC A;  4YB5 A;  1MXZ A;  3QIM A;  1JEV A;  4G68 A;  2D21 A;  1KA1 A;  3D4C A;  3FJ7 A;  2NOO A;  3KOT A;  2XXW A;  5IZ3 B;  2DVZ A;  3R26 A;  4NGU A;  1LFI A;  3T9U A;  4R72 A;  5DW8 A;  3MP1 A;  2CZH A;  4RK9 A;  4U2R A;  2HXR A;  1HSE A;  2BJJ X;  5H8H B;  4XXU A;  1FCK A;  1XT8 A;  3FV2 A;  3PU5 A;  4EXK A;  3IJO B;  3CSB A;  4POW A;  3MUQ A;  2CZK A;  1PB9 A;  2CMO A;  3K02 A;  4FOR A;  1ELJ A;  2F6P A;  2O1M A;  3C9H A;  3DRG A;  2P3V A;  3EHS A;  1OIB A;  2DXR A;  2XA5 A;  1A55 A;  2XXR A;  3A3C A;  1NNF A;  1QVS A;  2QMX A;  2IEE A;  4OET A;  1SW5 A;  2OX3 A;  1D9Q A;  4ZZE A;  2ZYO A;  3LC8 A;  1AMF A;  1CNQ A;  1VFD A;  5KDT B;  3QUF A;  3RY3 A;  1FPE A;  1FTM A;  2H9B A;  1B3L A;  3HFU A;  4F3B A;  4ZDM A;  5I7I A;  1Q35 A;  4IY6 A;  4G8M A;  3BIH A;  4XEQ A;  2ZZX A;  4ONY A;  2O69 A;  1Q9D A;  2YJP A;  5I57 A;  4KPT A;  5AA1 A;  3FXU A;  4U1Z A;  2R9J A;  1NH8 A;  3F11 A;  1B3H A;  2Y7I A;  3GXA A;  1OLC A;  4DI4 B;  1FBG A;  3TTN A;  2XX9 A;  3C35 A;  4R73 A;  3LUZ A;  2F7C A;  2P1S A;  4OES A;  3DP8 A;  1Y4C A;  3DRJ A;  2QS3 A;  3LR1 A;  4ND9 A;  1Y3N A;  2O1L A;  3ONM A;  2O51 A;  1LBV A;  1B0L A;  5EQA A;  4RJZ A;  4EQ7 A;  2PT1 A;  4X1D A;  1DTZ A;  4H0W A;  2OWT A;  4G8N A;  3SEV A;  1NMU A;  4OHN A;  2HEU A;  4P56 A;  3C32 A;  1FPI A;  4XKN A;  3KN7 A;  1M5E A;  3FXQ A;  3CSG A;  1BP5 A;  1UTB A;  3MVY A;  4AS5 A;  5FBP A;  1XVX A;  5HPQ A;  2H5Y A;  4H8I A;  4MH5 A;  4N4U A;  4YZZ A;  1B5H A;  1FPJ A;  1Q1K A;  3EHU A;  1IZ1 A;  3SES A;  1MDP 1;  2OBG A;  3Q26 A;  4NQ8 A;  1P1U A;  4PDH A;  2Y7W A;  5DVJ A;  2PCR A;  3SKP A;  1DSN A;  1AL3 A;  4ZEI A;  1B51 A;  2REG A;  3NOH A;  1GVC A;  1B7H A;  1A8E A;  1D4N A;  3C4M A;  2Q8J A;  5EYG A;  4G68 B;  4P47 A;  1VDW A;  4R2F A;  1NV2 A;  2UYF A;  1P1N A;  4DCY A;  4HXV A;  2V84 A;  3ZSF A;  1IIT A;  1UIU A;  4F3P A;  2VD3 A;  1B6H A;  2F6G A;  1JW1 A;  4R6H A;  3T22 A;  2R71 A;  1R9Q A;  4O94 A;  2X26 A;  2F5X A;  2F3B A;  4G61 A;  4PP0 A;  3LSW A;  4LZ5 A;  1LBW A;  2ZNS A;  3B7D A;  5I5P A;  3MW0 A;  3TEP A;  1POY 1;  2QS4 A;  4R75 A;  2DYX A;  1RDY A;  1IXC A;  3MVX A;  3U92 A;  2RKM A;  1MQG A;  2OWZ A;  1LFG A;  3BKI B;  3KN3 A;  1EYJ A;  4G8H A;  5L9M A;  1H3D A;  4DLD A;  1FBE A;  4OFL A;  2VD2 A;  1OVT A;  4PF6 A;  1XC1 A;  3UN6 A;  2DDK A;  4QFL A;  3UA8 A;  2FIX A;  4OVJ A;  3ILU B;  1IQ7 A;  4F3S A;  1NUY A;  4MMP A;  3TCH A;  4HCY A;  2HQ0 A;  3JV9 A;  1A54 A;  3KSJ A;  4PQJ A;  2QSX A;  3KBZ A;  5ESY A;  3PUV E;  1N3X A;  2ABH A;  1DBZ A;  1N3W A;  5I57 B;  4PAI A;  2PVU A;  2FHY A;  4TQU Q;  3RT6 B;  3TUS A;  4NHB A;  1MPD A;  4I9D A;  1P1Q A;  4OA4 A;  5AA3 A;  3GYY A;  3FVN A;  4NN3 A;  4PFT A;  3O28 A;  1LBX A;  2ONK E;  4BDL A;  1FBH A;  3TMG A;  3OOA A;  2ZZV A;  3S9L C;  2QVV A;  4BDM A;  2LAO A;  5L9S A;  2ZXT A;  3RTW B;  3C34 A;  2O7I A;  3G3J A;  2FIE A;  3PUY E;  3H6U A;  2WBB A;  3HHG A;  2UXA A;  1M5D A;  1ZKB A;  1JP4 A;  5CMM A;  1DTG A;  3MC2 A;  3H3G A;  2DWI A;  1MXY A;  3DLN A;  4EF2 A;  1G0I A;  1BKA A;  1QW0 A;  3IL1 B;  1NV0 A;  3K1M A;  3DRF A;  2HPG A;  4PFY A;  3N6U A;  1UTB B;  1I69 A;  3MPK A;  2XX8 A;  1URD A;  3H4Z A;  1NUW A;  3E78 A;  1S9T A;  4FAJ A;  1BTJ A;  2OK2 A;  4ZE9 A;  3ODB A;  3O66 A;  5F24 A;  2F3D A;  1LGB C;  2XX7 A;  1GGG A;  4LP2 B;  4ZEC A;  1ZLQ A;  1HSJ A;  2I0C A;  2I48 A;  2HAV A;  1NUX A;  1O63 A;  1MRP A;  2ANJ A;  2B65 A;  3ZKK A;  1DOT A;  2VPN A;  4O3C A;  2Y5K A;  2Y5L A;  1R9L A;  3LUY A;  4AQ4 A;  1NV4 A;  1O7T A;  2HCA A;  2ALU A;  1Y20 A;  3KG2 A;  2NVU B;  4BDR A;  1YPN A;  3R7X A;  4HW8 A;  1INP A;  3OO6 A;  2FVZ A;  3MWB A;  1LCT A;  4JXI A;  3C31 A;  4MIJ A;  4ZEK A;  1IEJ A;  3N26 A;  3LSL A;  1EZP A;  3T9V A;  3O2A A;  4Z0I A;  1DPP A;  1H45 A;  4FEC A;  4E0X A;  1YXI A;  4LZ7 A;  1PEB A;  2D5W A;  4O3B A;  5IGA A;  1DCU A;  3H7M A;  4RYA A;  4XF5 A;  2XXI A;  4MNC A;  3RQT A;  3PPQ A;  4ZE8 A;  1AH5 A;  3HCQ A;  4I8C A;  4IY5 A;  4R9G A;  5IAI A;  2GQ1 A;  4GWX A;  4JB7 A;  1NL5 A;  3L6G A;  1IMF A;  3JZJ A;  4NF5 A;  4GOT A;  4KYD A;  5FHM A;  1MPC A;  1G0H A;  3TZA A;  3OO7 A;  3U65 A;  5ELV A;  1B1H A;  1FQE A;  3ZKL A;  2NXO A;  4N13 A;  3MZ1 A;  5IM2 A;  3QSL A;  1QUL A;  1IMB A;  3KBR A;  1OMP A;  4QF9 A;  4U22 A;  1F9B A;  1M5F A;  2QMW A;  4JVD A;  5IZ1 A;  2XWV A;  3LSX A;  5EQ8 A;  3CHG A;  4QFP A;  2QJE A;  1LEV A;  1NNK A;  4MF3 A;  4KCD A;  2ZNU A;  2XHD A;  3TTM A;  2Z8E A;  4YIC A;  2ESN A;  2HHM A;  4MEV A;  5AA2 A;  3K1N A;  3MZ9 A;  4UAC A;  5EHS A;  4DXU A;  1B2H A;  2QL3 A;  1FPB A;  3IO4 A;  2DSF A;  3IR1 A;  4LAT A;  4O8M A;  1LAH E;  2RC9 A;  3E13 X;  3IOV A;  1MH3 A;  4RPO A;  3DM0 A;  3FVG A;  1SD3 A;  4H45 A;  3TTL A;  1TFD A;  4NF8 A;  1QKB A;  4ZS9 A;  5ET6 A;  5H8N A;  4R74 A;  4KD5 A;  1R6Z A;  1ZJL A;  2XXQ A;  4Q30 B;  4QSD A;  5LTC A;  1Y4T A;  4MLQ A;  4X1B A;  4OYV A;  4JSO A;  2Z8F A;  3DP4 A;  1MY3 A;  3SZP A;  2DVC A;  1Z7M E;  4BDO A;  4DI3 D;  3K6U A;  4PE3 A;  2B4M A;  3FAT A;  5H8Q A;  1H76 A;  2UVJ A;  1US4 A;  4H46 A;  1IXI A;  1FJ9 A;  1JNF A;  5JEI A;  3B50 A;  4PET A;  1LB8 A;  4NAP A;  1N7W A;  4GBV A;  4N07 A;  3OSR A;  4YB7 A;  3E3K A;  1YYZ A;  5I56 A;  3PV0 E;  4WXJ A;  2CZL A;  1PBP A;  4C0R A;  4ECF A;  3HV1 A;  1EH3 A;  4OZ9 A;  3QXM A;  5LDZ A;  1FPK A;  3UGW A;  1P99 A;  4PFR A;  4Q0C A;  4NF0 A;  1FBF A;  3RYB A;  3BBR A;  3CRB A;  1O64 A;  4JVI A;  1IMA A;  3VDF A;  3QMF A;  3PMV A;  5H8S A;  5AE4 A;  4LQ2 A;  5DVF A;  1XHY A;  1MM6 A;  4HTG A;  3KEI A;  2VHA A;  3MAM A;  4YKJ A;  3V89 B;  1AOV A;  4MJO A;  3PPN A;  2R8T A;  2F97 A;  2IA4 A;  2ZYM A;  1LAX A;  5DVI A;  2F34 A;  2XXH A;  4I3E A;  3OD7 A;  1PDA A;  2ZZW A;  1LST A;  5CBS A;  4XKP A;  5KCJ A;  1TFA A;  1RYO A;  3LVU A;  4NF5 B;  3V8X B;  4QFO A;  2A5T A;  3N6T A;  5TU0 A;  1FBD A;  2DP8 A;  2AL5 A;  4EQB A;  3KJT A;  4PFB A;  4EQ9 A;  3DEL B;  4QFK A;  1NKX A;  3EN3 A;  4EXL A;  4ELP A;  1B52 A;  2UVH A;  1ANF A;  4H6D A;  4LUB A;  2WX9 A;  3CG3 A;  2ONR A;  5FTH A;  5CM6 A;  4H5G A;  2REJ A;  3WAF A;  4PDD A;  5DTB A;  1B1X A;  4F39 A;  4GFR A;  3BFT A;  3MP8 A;  5AA2 B;  2F7A A;  4F1V A;  5ISU A;  3K6W A;  4IB2 A;  1MM7 A;  2V25 A;  5CI5 A;  3CI8 A;  3RYA A;  5I2K A;  3I6V A;  3T96 B;  3Q25 A;  3VLW A;  4U21 A;  4NF8 B;  1H43 A;  4KR5 A;  3GZG A;  3LV0 A;  4FBP A;  5H8N B;  1NFT A;  1OQG A;  4YAH X;  2RCB A;  1NH7 A;  3EHT A;  4R2B A;  4QXD A;  2DWA A;  3O6G A;  3EF7 A;  3GBB A;  1JVX A;  4PAF A;  1N04 A;  5EQ9 A;  5K2Y A;  1AIV A;  1FTO A;  1Y3Q A;  1FQA A;  5BWJ A;  3C33 A;  3PAM A;  1LAG E;  4PCD A;  4PC9 A;  4C1T A;  1MH4 A;  3PD9 A;  1L5T A;  1QUK A;  1MS7 A;  2E1S A;  4NWC A;  1LFH A;  5I56 B;  1FPL A;  3FVK A;  4NED A;  3FTO A;  4Z7E A;  4N17 A;  4ZEF A;  4TLL B;  3O6I A;  1UTH A;  3TQW A;  2VOZ A;  1MY1 A;  1Y9U A;  2ZYK A;  4RY1 A;  5FHN A;  1P1O A;  2VPO A;  2PMS A;  4OWD A;  2QVU A;  3KZG A;  2R6G E;  3HO7 A;  3TFL A;  1POT A;  2I4C A;  4L17 A;  3VFJ A;  2XWI A;  4DDD A;  5EQ7 A;  1PB7 A;  5CC2 A;  1M5C A;  2RCA A;  4U1O A;  4LON B;  5F1Q A;  5CMK A;  5KCJ B;  2ZYN A;  5IKB A;  1JW4 A;  3TEL A;  5DT6 A;  4XKQ A;  1USY E;  4N8Y A;  2A5T B;  2I4B A;  3O29 A;  3VV5 A;  4BLA A;  3K0V A;  4KYS A;  3ECR A;  4IO4 A;  1IUD A;  4OAN A;  3IFC A;  3QK6 A;  4N91 A;  1FPD A;  4JSD A;  2PFY A;  1NV3 A;  2PBW A;  3G3G A;  1XVY A;  4F2Q A;  4YKK A;  1AWB A;  3IO6 A;  4MCO A;  2XXT A;  3FD3 A;  4F18 A;  1MY0 A;  4R6K A;  5TPA A;  1ZTY A;  1RKM A;  2PT2 A;  2I0B A;  4LA9 A;  3TPA A;  2M8C A;  3FGS A;  1GTK A;  3OEM A;  4FE8 A;  3PPR A;  1WDN A;  1SW2 A;  5B7D A;  4DXB A;  4IO2 A;  3D4G A;  1FRP A;  5I2K B;  4FAT A;  4WEP A;  3QAX A;  2GRV A;  3DRK A;  2Q2C A;  5L9O A;  3FV1 A;  4XTC Q;  2HFB A;  5I58 A;  3BIG A;  2HXW A;  1B7Z A;  2O7U A;  3T1B A;  4N6P A;  2WEF A;  4YKI A;  4LZ8 A;  4TLM B;  3SEX A;  4ESX A;  3B6Q A;  1M5B A;  1YAE A;  2QRY A;  1SPI A;  5B70 A;  4RA1 A;  2X7Q A;  4NG7 A;  4OXV A;  3TDJ A;  1LB9 A;  3U93 A;  2HAU A;  4OFO A;  3CIJ A;  3G3I A;  1US5 A;  1D3K A;  1A8F A;  1TXF A;  4YMA A;  4MBP A;  1TT1 A;  4P1E A;  3FJG A;  5ITP A;  1B58 A;  4PTK A;  3IOW A;  5I84 A;  4DCX A;  1IMC A;  3DRH A;  2Y84 A;  3OEK A;  2XD2 A;  4H8J A;  3IB1 A;  2OJT A;  1SDX A;  1LLS A;  3MQ9 A;  1JQF A;  2KQZ A;  3K6V A;  1SVX B;  1VE4 A;  2V3T A;  2XXU A;  2AIX A;  5A5L A;  3FBP A;  3K4U A;  3T93 B;  1SW1 A;  4X48 A;  1DK4 A;  1I6B A;  4R9F A;  5JTY A;  4MLV A;  3MJN A;  3U1O A;  3JYR A;  1P1W A;  1USY H;  2X7P A;  4OER A;  3OXN A;  4G68 C;  4GF8 A;  3VLU A;  1UTH B;  5LOM A;  5EHM A;  2KR0 A;  4G2Z A;  1Y3P A;  1LBB A;  1NI9 A;  3FJM A;  4GWZ A;  2I58 A;  1MG1 A;  2XWK A;  3UP9 A;  4OVS A;  3ROJ A;  1DMB A;  3SER A;  5J1D A;  3K1P A;  1IMD A;  1FJ6 A;  1FQF A;  4F29 A;  3V83 A;  5CBR A;  3L6H A;  4LQ5 A;  4EDP A;  2RC8 A;  3SDF A;  3U94 A;  3IJX B;  3B6W A;  1RDX A;  4WED A;  4P1L A;  4MFI A;  3FUZ A;  3V5A A;  3RTF B;  4GQO A;  1KA0 A;  4F31 B;  2Q8M A;  2OCU A;  3UOR A;  3S9M C;  1PBQ A;  3A3U A;  2H98 A;  2O68 A;  2F7B A;  4HE1 A;  2DQV A;  3RUM A;  1EZ9 A;  1QKA A;  1CE2 A;  2WOP A;  4N15 A;  1QJM A;  3CVG A;  1RDZ A;  3VXB A;  4DZ1 A;  2V4C A;  5FHO A;  4JVC A;  3O6P A;  4GWU A;  4X9T A;  3RGY A;  4GWW A;  3W9W A;  3TTK A;  1URS A;  3A29 A;  3PPO A;  1NNP A;  3TCF A;  3SET A;  4FEB A;  2Y7K A;  2BJI A;  3CFZ A;  5TPA B;  4LN5 A;  1B9J A;  2XWO A;  4HS7 A;  3H6T A;  2GHB A;  4THI A;  1Z7N E;  3M3K A;  3PD8 A;  1SYH A;  1SW4 A;  1QUJ A;  2F36 A;  4H67 A;  3PPP A;  4O3A A;  1KWH A;  3TQL A;  2Q89 A;  4XKR A;  3O97 A;  4U4S A;  4KYE A;  1A7L A;  4LVQ A;  1SI1 A;  4GLI A;  3IK6 B;  5AA4 A;  4IGT A;  5I58 B;  2DE2 A;  3PMW A;  4OEU A;  4ISU A;  4N8G A;  2Y7R A;  2H4I A;  1B5I A;  5KZT A;  1HSL A;  3I5O A;  1N76 A;  2JJK A;  4P0G A;  3IX1 A;  1GR2 A;  4IO3 A;  3T9H B;  3ZS6 A;  4NX1 A;  3H06 B;  4NWD A;  1MDQ A;  3RT8 A;  2AL4 A;  4ESW A;  4RK2 A;  2OWS A;  4ZED A;  2WYP A;  4G77 A;  3RLF E;  4NTL A;  4PF8 A;  3VVD A;  4F19 A;  1EU8 A;  4GX3 A;  2P3N A;  1B05 A;  4HE2 A;  1ATG A;  3IAZ A;  2RC7 A;  1H44 A;  5HM4 B;  4P3L A;  4I62 A;  4BDQ A;  3G3K A;  3KC1 A;  2D3I A;  1PC3 A;  4GXS B;  5JTY B;  2ZNT A;  2P0S A;  1WVJ A;  4JWO A;  3FAS A;  3PUX E;  4F1U A;  1NV1 A;  3P7I A;  1VR5 A;  3IOU A;  2E0S A;  1MXX A;  3S4U A;  5ICT A;  2F35 A;  5H8F A;  3HHF A;  2PX1 A;  4KI0 E;  2NUV A;  4GWO A;  4WKM A;  3Q28 A;  4XIG Q;  4U23 A;  3ISP A;  1K9Z A;  4KHZ E;  2F78 A;  5HBC A;  5FTI A;  5ITO A;  2W7Y A;  5AA2 D;  4YB6 A;  4MX6 A;  3OMB A;  1FTL A;  3KSX A;  2Z22 A;  4QRZ A;  4AS4 A;  4O7M A;  2FNC A;  1B3G A;  4Q5T A;  3CFL A;  4PFW A;  4NMY A;  3WAE A;  2I3W A;  2QPQ A;  3E4R A;  2G29 A;  5EYF A;  4C1U A;  3G3H A;  3EKI A;  1B3F A;  1Y1Z A;  3OEL A;  3T0J A;  4OVP A;  4N81 A;  4GWS A;  3S9N C;  4MNP A;  4GL8 A;  3FXB A;  3PTY A;  1IXG A;  4NF4 A;  4IGR A;  1FTJ A;  5TP9 A;  3TTR A;  1OVB A;  3VVE A;  1CB6 A;  1OLA A;  2QS2 A;  1A40 A;  4QSC A;  2XXP A;  1D9V A;  4P0I A;  1FBC A;  4RXL A;  4DE8 A;  3CR9 A;  2PFZ A;  2YLN A;  4PE5 B;  2HZL A;  1SBP A;  4QHQ A;  2GHA A;  4GVO A;  2ZMB A;  4PFI A;  1B4H A;  3UIF A;  3MST A;  2H25 A;  1YZ0 A;  1DPE A;  1NV7 A;  3BFU A;  4YU0 A;  5AA4 B;  2DWH A;  2CEY A;  4FIM A;  5F7V A;  4KQP A;  3TKD A;  1XI6 A;  2VGQ A;  1R1N A;  4P9K A;  1MQJ A;  3EQ1 A;  2O84 X;  3RYD A;  1TWY A;  1SQY A;  1EYK A;  1MQH A;  4GXA A;  4GD5 A;  3CFX A;  1XS5 A;  2QFL A;  1I6A A;  2DE4 A;  3VVF A;  4GX6 A;  4X8R A;  2Q9T A;  1PB8 A;  3GLB A;  3UK4 A;  2VP1 A;  5H8Q B;  3TOD A;  4ZZA A;  2WOK A;  3O6H A;  2MKZ A;  3IFA A;  3FZV A;  3HPI A;  2DOJ A;  1BIY A;  3MPL A;  5JK4 A;  3PUZ E;  1T0K A;  2V3U A;  2I6E A;  2Y7P A;  5CMB A;  2DWJ A;  1FPF A;  2THI A;  3S2V A;  4H1X A;  4OVT A;  1MPB A;  1S50 A;  5A5X A;  3KN8 A;  4OEN A;  2RF1 A;  1FSA A;  4POX A;  2P2A A;  5H8F B;  4G4P A;  2WOL A;  5I2N A;  4R6Y A;  4FJP A;  4OTE A;  2DE3 A;  1SYI A;  4EUO A;  4IO7 A;  3MP6 A;  3FXR A;  2V93 A;  4NE4 A;  3SEY A;  2OZZ A;  3A09 A;  3LBS A;  4O7I A;  5M2V A;  3KFM A;  1ZBM A;  3FIR A;  4HCW A;  1JEU A;  2O6A A;  4K3F A;  4GX4 A;  3CG1 A;  3TYH A;  2GH9 A;  2HZK A;  1YCJ A;  1FQD A;  4TOZ A;  3MZB A;  3W15 C;  4IO6 A;  4Q8R A;  2Q74 A;  3H6V A;  1B46 A;  3PUW E;  3FVO A;  3RPL A;  1ZIU A;  4FED A;  4QBA A;  1LBZ A;  3K6X A;  2PYY A;  3K00 A;  2QS1 A;  1VSO A;  2RIN A;  3N5L A;  1B40 A;  4NF4 B;  4AB5 A;  2B3B A;  2NWJ A;  1B4Z A;  3H03 A;  3U72 A;  3KC0 A;  2L5V A;  1LCF A;  5TP9 B;  2XD3 A;  1IIW A;  4ZEB A;  3W9V A;  3OO8 A;  2Q88 A;  3IB0 A;  3M3F A;  4PGP A;  1B32 A;  1FQB A;  4I1D A;  5T3J A;  4GIZ A;  2FA7 A;  4P8B A;  1XOC A;  3Q29 A;  3M3L A;  2I3V A;  1B0H A;  1ZMG A;  5I3S A;  1B7U A;  4PBQ A;  4OFJ A;  3QUJ A;  2B3F A;  1B3E A;  1MY4 A;  1EZO A;  1KZ8 A;  3PGF A;  3OSQ A;  1SI0 A;  2DS9 A;  2CZI A;  4PFU A;  1NNT A;  3T9X B;  3VLV A;  1UQW A;  3IB2 A;  1OQH A;  2GFE A;  3K01 A;  4QSE A;  4JWY A;  3K2D A;  3PMX A;  3MYU A;  1YTV A;  1MY2 A;  3OEN A;  4I3Y A;  2Z23 A;  1J1N A;  3HST A;  3USD A;  4F3G A;  4U4X A;  1IME A;  4IO5 A;  1MQI A;  2UYE A;  1FBP A;  5ET7 A;  4X04 A;  2A5S A;  5I59 A;  2UVI A;  2XXX A;  4NF6 A;  1JVY A;  2CEX A;  2ONS A;  4ELR A;  4JBZ A;  2XXK A;  4I40 A;  1QGX A;  5ET5 A;  4M4G A;  4EF1 A;  4BDN A;  4DXC A;  5DEX A;  4F22 A;  4M1V A;  3IOR A;  3Q27 A;  3U8Q A;  4OQO A;  4AB6 A;  4GBW A;  1VFE A;  4KCC A;  4HE0 A;  5J16 A;  3S9E A;  4PBH A;  4F1Y A;  5A5X B;  3HN0 A;  3AXF A;  2QVR A;  4YKP A;  5IZ3 A;  5I2N B;  3TAJ A;  1NV5 A;  1LBC A;  4IR8 A;  1NV6 A;  2XXV A;  2WYK A;  5H8H A;  1GV8 A;  4JDF A;  4H65 A;  4P11 A;  1EYI A;  2Z8D A;  4GL0 A;  3B6T A;  4DIG A;  4RPN A;  4UA8 A;  4JWX A;  1S7Y A;  1N7X A;  2XXY A;  1FTK A;  2FYI A;  3R6U A;  1MQD A;  4ELQ A;  3RN8 A;  3MVZ A;  5ICQ A;  4F2O A;  3KJ7 A;  2WBD A;  3RPL B;  5IZZ A;  3DP6 A;  5KDT A;  3KOS A;  1D9Y A;  3THI A;  3M8U A;  1NUZ A;  3O9P A;  1I6Q A;  3RNN A;  4OEV A;  5BUU A;  1MXW A;  3DRI A;  1Y1M A;  2WKY A;  4RNS A;  4PAK A;  2FBP A;  5ET8 A;  2AYS A;  5CRY A;  1BK4 A;  2F8D A;  2KLF A;  4GRK A;  5DYH A;  4KXP A;  3RPW A;  1LAF E;  3H6W A;  1ZU0 A;  5K2X A;  2OLB A;  4UAB A;  4ELO A;  1MXU A;  3QYT A;  1FPG A;  3I3V A;  1N84 A;  3B8B A;  3KGC A;  5CMC A;  4XFE A;  4OMB A;  4MNI A;  2VT5 A;  3C36 A;  3D1R A;  2I49 A;  4N6D A;  1N0T A;  1UIV A;  1RYX A;  3T66 A;  4N6K A;  3N94 A;  1WOD A;  4PGN A; 
#chains in the Genus database with same CATH homology
 1A99 A;  1JET A;  3MBP A;  1MXV A;  2G93 A;  4H5F A;  3EPE A;  4QFN A;  2Q2A A;  3G3F A;  2V3Q A;  3ILT B;  3IOT A;  1II5 A;  1FQC A;  1IXH A;  2H99 A;  3MVW A;  1BLF A;  1FW0 A;  3OO9 A;  4E0W A;  3SEW A;  3G7W A;  5I59 B;  2YPN A;  3VE1 B;  4YMB A;  4NF6 B;  3TCG A;  2DXY A;  1B5J A;  3LSF B;  2B4L A;  4KFQ A;  5DEX B;  2UVG A;  3GBA A;  1JW5 A;  3SEU A;  3E9X A;  5L8D A;  1URG A;  1QUI A;  3VXC A;  4YB5 A;  1MXZ A;  3QIM A;  1JEV A;  4G68 A;  2D21 A;  3D4C A;  3FJ7 A;  2NOO A;  3KOT A;  2XXW A;  2DVZ A;  3R26 A;  1LFI A;  3T9U A;  4R72 A;  3MP1 A;  4RK9 A;  4U2R A;  1HSE A;  2BJJ X;  5H8H B;  4XXU A;  1FCK A;  1XT8 A;  3FV2 A;  3PU5 A;  4EXK A;  3IJO B;  3CSB A;  4POW A;  3MUQ A;  1PB9 A;  2CMO A;  3K02 A;  4FOR A;  1ELJ A;  2F6P A;  2O1M A;  3C9H A;  3DRG A;  3EHS A;  1OIB A;  2DXR A;  1A55 A;  2XXR A;  3A3C A;  1NNF A;  1QVS A;  2QMX A;  2IEE A;  4OET A;  1SW5 A;  4ZZE A;  2ZYO A;  3LC8 A;  1AMF A;  1VFD A;  5KDT B;  3QUF A;  3RY3 A;  1FTM A;  2H9B A;  1B3L A;  4F3B A;  4ZDM A;  1Q35 A;  4IY6 A;  4G8M A;  4ONY A;  2O69 A;  2YJP A;  5I57 A;  4KPT A;  5AA1 A;  3FXU A;  4U1Z A;  2R9J A;  1NH8 A;  3F11 A;  1B3H A;  2Y7I A;  3GXA A;  1OLC A;  3TTN A;  2XX9 A;  3C35 A;  4R73 A;  2F7C A;  2P1S A;  4OES A;  3DP8 A;  1Y4C A;  3DRJ A;  2QS3 A;  3LR1 A;  4ND9 A;  1Y3N A;  2O1L A;  3ONM A;  2O51 A;  1B0L A;  4RJZ A;  4EQ7 A;  2PT1 A;  4X1D A;  1DTZ A;  4H0W A;  2OWT A;  4G8N A;  3SEV A;  1NMU A;  4OHN A;  2HEU A;  3C32 A;  4XKN A;  3KN7 A;  1M5E A;  3FXQ A;  3CSG A;  1BP5 A;  1UTB A;  3MVY A;  1XVX A;  5HPQ A;  2H5Y A;  4H8I A;  4MH5 A;  4YZZ A;  1B5H A;  1Q1K A;  3EHU A;  1IZ1 A;  3SES A;  1MDP 1;  2OBG A;  3Q26 A;  1P1U A;  2Y7W A;  5DVJ A;  3SKP A;  1DSN A;  1AL3 A;  4ZEI A;  1B51 A;  2REG A;  1GVC A;  1B7H A;  1A8E A;  1D4N A;  3C4M A;  2Q8J A;  4G68 B;  4R2F A;  2UYF A;  1P1N A;  4DCY A;  3ZSF A;  2V84 A;  1IIT A;  1UIU A;  4F3P A;  2VD3 A;  1B6H A;  2F6G A;  1JW1 A;  4R6H A;  3T22 A;  2R71 A;  1R9Q A;  2X26 A;  2F5X A;  4PP0 A;  3LSW A;  4LZ5 A;  2ZNS A;  3B7D A;  3MW0 A;  3TEP A;  1POY 1;  2QS4 A;  4R75 A;  2DYX A;  1IXC A;  3MVX A;  3U92 A;  2RKM A;  1MQG A;  1LFG A;  3BKI B;  3KN3 A;  4G8H A;  5L9M A;  1H3D A;  4DLD A;  4OFL A;  2VD2 A;  1OVT A;  1XC1 A;  3UN6 A;  4QFL A;  3UA8 A;  4OVJ A;  3ILU B;  1IQ7 A;  4F3S A;  3TCH A;  4HCY A;  2HQ0 A;  3JV9 A;  1A54 A;  3KSJ A;  4PQJ A;  2QSX A;  3PUV E;  1N3X A;  2ABH A;  1N3W A;  5I57 B;  2PVU A;  4TQU Q;  3RT6 B;  3TUS A;  1MPD A;  4I9D A;  1P1Q A;  5AA3 A;  3FVN A;  4PFT A;  3O28 A;  2ONK E;  4BDL A;  3TMG A;  3OOA A;  3S9L C;  4BDM A;  2LAO A;  5L9S A;  2ZXT A;  3RTW B;  3C34 A;  2O7I A;  3G3J A;  3PUY E;  3H6U A;  3HHG A;  2UXA A;  1M5D A;  1ZKB A;  5CMM A;  1DTG A;  3MC2 A;  3H3G A;  2DWI A;  1MXY A;  3DLN A;  4EF2 A;  1BKA A;  1QW0 A;  3IL1 B;  3K1M A;  3DRF A;  4PFY A;  3N6U A;  1UTB B;  1I69 A;  3MPK A;  2XX8 A;  1URD A;  3H4Z A;  1S9T A;  4FAJ A;  1BTJ A;  2OK2 A;  4ZE9 A;  3ODB A;  3O66 A;  1LGB C;  2XX7 A;  1GGG A;  4LP2 B;  4ZEC A;  1ZLQ A;  1HSJ A;  2I0C A;  2I48 A;  2HAV A;  1O63 A;  1MRP A;  2ANJ A;  2B65 A;  3ZKK A;  1DOT A;  4O3C A;  1R9L A;  3LUY A;  4AQ4 A;  1O7T A;  2HCA A;  2ALU A;  1Y20 A;  3KG2 A;  2NVU B;  4BDR A;  1YPN A;  3R7X A;  4HW8 A;  3OO6 A;  3MWB A;  1LCT A;  4JXI A;  3C31 A;  4ZEK A;  1IEJ A;  3N26 A;  3LSL A;  1EZP A;  3T9V A;  3O2A A;  4Z0I A;  1DPP A;  1H45 A;  4FEC A;  4E0X A;  4LZ7 A;  1PEB A;  2D5W A;  4O3B A;  3H7M A;  4RYA A;  2XXI A;  3RQT A;  3PPQ A;  4ZE8 A;  1AH5 A;  3HCQ A;  4I8C A;  4IY5 A;  4R9G A;  5IAI A;  4JB7 A;  1NL5 A;  3L6G A;  3JZJ A;  4NF5 A;  4GOT A;  4KYD A;  5FHM A;  1MPC A;  3TZA A;  3OO7 A;  5ELV A;  1B1H A;  1FQE A;  3ZKL A;  2NXO A;  4N13 A;  3MZ1 A;  3QSL A;  1QUL A;  3KBR A;  1OMP A;  4QF9 A;  4U22 A;  1F9B A;  1M5F A;  2QMW A;  3LSX A;  3CHG A;  4QFP A;  2QJE A;  1NNK A;  4MF3 A;  4KCD A;  2ZNU A;  2XHD A;  3TTM A;  2Z8E A;  4YIC A;  2ESN A;  5AA2 A;  3K1N A;  3MZ9 A;  4UAC A;  5EHS A;  4DXU A;  1B2H A;  2QL3 A;  3IO4 A;  2DSF A;  3IR1 A;  4LAT A;  1LAH E;  2RC9 A;  3E13 X;  3IOV A;  1MH3 A;  4RPO A;  3DM0 A;  3FVG A;  1SD3 A;  3TTL A;  1TFD A;  4NF8 A;  1QKB A;  4ZS9 A;  5H8N A;  4R74 A;  4KD5 A;  1R6Z A;  1ZJL A;  2XXQ A;  4Q30 B;  4QSD A;  1Y4T A;  4MLQ A;  4X1B A;  4OYV A;  4JSO A;  2Z8F A;  3DP4 A;  1MY3 A;  2DVC A;  1Z7M E;  4BDO A;  3K6U A;  2B4M A;  3FAT A;  5H8Q A;  1H76 A;  2UVJ A;  1US4 A;  1IXI A;  5JEI A;  1JNF A;  4PET A;  1LB8 A;  1N7W A;  4N07 A;  3OSR A;  4YB7 A;  3E3K A;  5I56 A;  3PV0 E;  4WXJ A;  2CZL A;  1PBP A;  4C0R A;  4ECF A;  3HV1 A;  1EH3 A;  4OZ9 A;  3QXM A;  3UGW A;  1P99 A;  4Q0C A;  3RYB A;  3BBR A;  3CRB A;  1O64 A;  3VDF A;  3PMV A;  5H8S A;  5AE4 A;  4LQ2 A;  5DVF A;  1XHY A;  1MM6 A;  4HTG A;  3KEI A;  2VHA A;  3MAM A;  4YKJ A;  3V89 B;  1AOV A;  3PPN A;  2F97 A;  2IA4 A;  2ZYM A;  1LAX A;  5DVI A;  2F34 A;  2XXH A;  3OD7 A;  1PDA A;  1LST A;  5CBS A;  4XKP A;  5KCJ A;  1TFA A;  1RYO A;  3LVU A;  4NF5 B;  3V8X B;  4QFO A;  2A5T A;  3N6T A;  5TU0 A;  2DP8 A;  2AL5 A;  4EQB A;  3KJT A;  4EQ9 A;  3DEL B;  4QFK A;  1NKX A;  3EN3 A;  4EXL A;  4ELP A;  1B52 A;  2UVH A;  1ANF A;  4H6D A;  4LUB A;  3CG3 A;  2ONR A;  5FTH A;  5CM6 A;  4H5G A;  2REJ A;  3WAF A;  5DTB A;  1B1X A;  4F39 A;  4GFR A;  3BFT A;  3MP8 A;  5AA2 B;  2F7A A;  4F1V A;  5ISU A;  3K6W A;  4IB2 A;  1MM7 A;  2V25 A;  5CI5 A;  3CI8 A;  3RYA A;  5I2K A;  3I6V A;  3T96 B;  3Q25 A;  3VLW A;  4U21 A;  4NF8 B;  1H43 A;  4KR5 A;  3GZG A;  5H8N B;  1NFT A;  1OQG A;  4YAH X;  2RCB A;  1NH7 A;  3EHT A;  4R2B A;  2DWA A;  3O6G A;  3EF7 A;  3GBB A;  1JVX A;  1N04 A;  5K2Y A;  1AIV A;  1FTO A;  1Y3Q A;  1FQA A;  5BWJ A;  3C33 A;  3PAM A;  1LAG E;  4C1T A;  1MH4 A;  3PD9 A;  1L5T A;  1QUK A;  1MS7 A;  2E1S A;  4NWC A;  1LFH A;  5I56 B;  3FVK A;  4NED A;  3FTO A;  4Z7E A;  4ZEF A;  4TLL B;  3O6I A;  1UTH A;  3TQW A;  2VOZ A;  1MY1 A;  1Y9U A;  2ZYK A;  4RY1 A;  5FHN A;  1P1O A;  2PMS A;  3KZG A;  4OWD A;  2R6G E;  3HO7 A;  3TFL A;  1POT A;  2I4C A;  4L17 A;  3VFJ A;  4DDD A;  1PB7 A;  5CC2 A;  1M5C A;  2RCA A;  4U1O A;  4LON B;  5F1Q A;  5CMK A;  5KCJ B;  2ZYN A;  5IKB A;  1JW4 A;  3TEL A;  5DT6 A;  4XKQ A;  1USY E;  2A5T B;  2I4B A;  3O29 A;  3VV5 A;  4BLA A;  3K0V A;  4KYS A;  3ECR A;  4IO4 A;  1IUD A;  3QK6 A;  4JSD A;  2PBW A;  3G3G A;  1XVY A;  4F2Q A;  4YKK A;  3IO6 A;  2XXT A;  3FD3 A;  4F18 A;  1MY0 A;  4R6K A;  5TPA A;  1ZTY A;  1RKM A;  2PT2 A;  2I0B A;  4LA9 A;  3TPA A;  2M8C A;  3FGS A;  1GTK A;  3OEM A;  4FE8 A;  3PPR A;  1WDN A;  1SW2 A;  5B7D A;  4DXB A;  4IO2 A;  3D4G A;  5I2K B;  4FAT A;  4WEP A;  3QAX A;  2GRV A;  3DRK A;  2Q2C A;  5L9O A;  3FV1 A;  4XTC Q;  2HFB A;  5I58 A;  2HXW A;  1B7Z A;  2O7U A;  4N6P A;  4YKI A;  4LZ8 A;  4TLM B;  3SEX A;  4ESX A;  3B6Q A;  1M5B A;  1YAE A;  2QRY A;  5B70 A;  4RA1 A;  2X7Q A;  4OXV A;  3TDJ A;  1LB9 A;  3U93 A;  2HAU A;  4OFO A;  3CIJ A;  3G3I A;  1US5 A;  1D3K A;  1A8F A;  1TXF A;  4YMA A;  4MBP A;  1TT1 A;  3FJG A;  5ITP A;  1B58 A;  3IOW A;  5I84 A;  4DCX A;  3DRH A;  2Y84 A;  3OEK A;  2XD2 A;  4H8J A;  3IB1 A;  2OJT A;  1SDX A;  1LLS A;  3MQ9 A;  1JQF A;  3K6V A;  1SVX B;  1VE4 A;  2V3T A;  2XXU A;  2AIX A;  3K4U A;  3T93 B;  1SW1 A;  4X48 A;  1I6B A;  4R9F A;  5JTY A;  4MLV A;  3MJN A;  3U1O A;  3JYR A;  1P1W A;  1USY H;  2X7P A;  4OER A;  3OXN A;  4G68 C;  4GF8 A;  3VLU A;  1UTH B;  5LOM A;  5EHM A;  4G2Z A;  1Y3P A;  1LBB A;  3FJM A;  2I58 A;  1MG1 A;  3UP9 A;  3SER A;  1DMB A;  5J1D A;  3K1P A;  1FQF A;  4F29 A;  3V83 A;  5CBR A;  3L6H A;  4LQ5 A;  4EDP A;  2RC8 A;  3SDF A;  3U94 A;  3IJX B;  3B6W A;  4WED A;  4MFI A;  3FUZ A;  3V5A A;  3RTF B;  4GQO A;  4F31 B;  2OCU A;  3UOR A;  3S9M C;  1PBQ A;  3A3U A;  2H98 A;  2O68 A;  2F7B A;  2DQV A;  3RUM A;  1EZ9 A;  1QKA A;  1CE2 A;  2WOP A;  1QJM A;  3CVG A;  3VXB A;  4DZ1 A;  5FHO A;  3O6P A;  4X9T A;  3RGY A;  3W9W A;  3TTK A;  1URS A;  3PPO A;  1NNP A;  3TCF A;  3SET A;  4FEB A;  2Y7K A;  3CFZ A;  5TPA B;  1B9J A;  4HS7 A;  3H6T A;  2GHB A;  4THI A;  1Z7N E;  3M3K A;  3PD8 A;  1SYH A;  1SW4 A;  1QUJ A;  2F36 A;  4H67 A;  3PPP A;  4O3A A;  1KWH A;  3TQL A;  2Q89 A;  4XKR A;  3O97 A;  4U4S A;  4KYE A;  1A7L A;  4LVQ A;  1SI1 A;  4GLI A;  3IK6 B;  5AA4 A;  4IGT A;  5I58 B;  2DE2 A;  3PMW A;  4OEU A;  4ISU A;  2Y7R A;  2H4I A;  1B5I A;  5KZT A;  1HSL A;  3I5O A;  1N76 A;  4P0G A;  3IX1 A;  1GR2 A;  4IO3 A;  3T9H B;  3ZS6 A;  3H06 B;  4NWD A;  1MDQ A;  3RT8 A;  2AL4 A;  4ESW A;  4RK2 A;  2OWS A;  4ZED A;  4G77 A;  3RLF E;  4NTL A;  3VVD A;  4F19 A;  1EU8 A;  1B05 A;  1ATG A;  3IAZ A;  2RC7 A;  1H44 A;  5HM4 B;  4I62 A;  4BDQ A;  3G3K A;  2D3I A;  1PC3 A;  4GXS B;  5JTY B;  2ZNT A;  2P0S A;  1WVJ A;  4JWO A;  3FAS A;  3PUX E;  4F1U A;  3P7I A;  1VR5 A;  3IOU A;  2E0S A;  1MXX A;  3S4U A;  5ICT A;  2F35 A;  5H8F A;  3HHF A;  2PX1 A;  4KI0 E;  2NUV A;  4GWO A;  4WKM A;  3Q28 A;  4XIG Q;  4U23 A;  4KHZ E;  2F78 A;  5HBC A;  5FTI A;  5ITO A;  2W7Y A;  5AA2 D;  4YB6 A;  3OMB A;  1FTL A;  3KSX A;  2Z22 A;  4QRZ A;  2FNC A;  1B3G A;  4Q5T A;  3CFL A;  4PFW A;  4NMY A;  3WAE A;  2I3W A;  2QPQ A;  3E4R A;  2G29 A;  5EYF A;  4C1U A;  3G3H A;  1B3F A;  1Y1Z A;  3OEL A;  3S9N C;  4GL8 A;  1IXG A;  4NF4 A;  4IGR A;  1FTJ A;  5TP9 A;  3TTR A;  1OVB A;  3VVE A;  1CB6 A;  1OLA A;  2QS2 A;  1A40 A;  4QSC A;  2XXP A;  1D9V A;  4P0I A;  4RXL A;  4DE8 A;  3CR9 A;  2YLN A;  4PE5 B;  2HZL A;  1SBP A;  4QHQ A;  2GHA A;  4GVO A;  2ZMB A;  1B4H A;  3UIF A;  2H25 A;  1DPE A;  3BFU A;  4YU0 A;  5AA4 B;  2DWH A;  4FIM A;  5F7V A;  4KQP A;  3TKD A;  2VGQ A;  1R1N A;  1MQJ A;  3EQ1 A;  2O84 X;  1TWY A;  1SQY A;  1MQH A;  4GXA A;  4GD5 A;  3CFX A;  1XS5 A;  1I6A A;  2DE4 A;  3VVF A;  2Q9T A;  1PB8 A;  3GLB A;  3UK4 A;  2VP1 A;  5H8Q B;  3TOD A;  4ZZA A;  2WOK A;  3O6H A;  3FZV A;  3HPI A;  2DOJ A;  1BIY A;  3MPL A;  5JK4 A;  3PUZ E;  1T0K A;  2V3U A;  2I6E A;  2Y7P A;  5CMB A;  2DWJ A;  2THI A;  3S2V A;  4H1X A;  1MPB A;  1S50 A;  5A5X A;  3KN8 A;  2RF1 A;  4OEN A;  4POX A;  2P2A A;  5H8F B;  4G4P A;  2WOL A;  5I2N A;  4R6Y A;  4FJP A;  4OTE A;  2DE3 A;  1SYI A;  4EUO A;  4IO7 A;  3MP6 A;  3FXR A;  2V93 A;  4NE4 A;  3SEY A;  2OZZ A;  3A09 A;  3LBS A;  5M2V A;  3KFM A;  1ZBM A;  3FIR A;  4HCW A;  1JEU A;  2O6A A;  4K3F A;  3CG1 A;  3TYH A;  2GH9 A;  2HZK A;  1YCJ A;  1FQD A;  4TOZ A;  3MZB A;  3W15 C;  4IO6 A;  4Q8R A;  3H6V A;  1B46 A;  3PUW E;  3FVO A;  1ZIU A;  4FED A;  3K6X A;  2PYY A;  3K00 A;  2QS1 A;  1VSO A;  2RIN A;  3N5L A;  1B40 A;  4NF4 B;  4AB5 A;  2B3B A;  2NWJ A;  1B4Z A;  3H03 A;  3U72 A;  1LCF A;  5TP9 B;  2XD3 A;  1IIW A;  4ZEB A;  3W9V A;  3OO8 A;  2Q88 A;  3IB0 A;  3M3F A;  1B32 A;  1FQB A;  4I1D A;  4GIZ A;  2FA7 A;  1XOC A;  3Q29 A;  3M3L A;  2I3V A;  1B0H A;  1ZMG A;  1B7U A;  4OFJ A;  3QUJ A;  2B3F A;  1B3E A;  1MY4 A;  1EZO A;  3PGF A;  3OSQ A;  1SI0 A;  2DS9 A;  4PFU A;  1NNT A;  3T9X B;  3VLV A;  1UQW A;  3IB2 A;  1OQH A;  2GFE A;  3K01 A;  4QSE A;  4JWY A;  3K2D A;  3PMX A;  1YTV A;  1MY2 A;  3OEN A;  2Z23 A;  1J1N A;  3HST A;  3USD A;  4F3G A;  4U4X A;  4IO5 A;  1MQI A;  2UYE A;  2A5S A;  5I59 A;  2UVI A;  2XXX A;  4NF6 A;  1JVY A;  2ONS A;  4ELR A;  4JBZ A;  4M4G A;  4EF1 A;  4BDN A;  4DXC A;  5DEX A;  4F22 A;  4M1V A;  3IOR A;  3Q27 A;  3U8Q A;  4OQO A;  4AB6 A;  1VFE A;  4KCC A;  3S9E A;  4F1Y A;  5A5X B;  3HN0 A;  3AXF A;  4YKP A;  5I2N B;  3TAJ A;  1LBC A;  2XXV A;  5H8H A;  1GV8 A;  4JDF A;  4H65 A;  4P11 A;  2Z8D A;  4GL0 A;  3B6T A;  4DIG A;  4RPN A;  4UA8 A;  4JWX A;  1S7Y A;  1N7X A;  2XXY A;  1FTK A;  2FYI A;  3R6U A;  4ELQ A;  1MQD A;  3RN8 A;  3MVZ A;  5ICQ A;  4F2O A;  3KJ7 A;  3DP6 A;  5KDT A;  3KOS A;  1D9Y A;  3THI A;  3M8U A;  3O9P A;  1I6Q A;  3RNN A;  4OEV A;  5BUU A;  1MXW A;  3DRI A;  1Y1M A;  2WKY A;  4RNS A;  2AYS A;  5CRY A;  2F8D A;  2KLF A;  4GRK A;  5DYH A;  3RPW A;  1LAF E;  3H6W A;  1ZU0 A;  5K2X A;  2OLB A;  4ELO A;  1MXU A;  3QYT A;  3I3V A;  1N84 A;  3KGC A;  5CMC A;  4OMB A;  3C36 A;  2I49 A;  1N0T A;  1UIV A;  1RYX A;  3T66 A;  3N94 A;  1WOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...