1B51A

Oligo-peptide binding protein (oppa) complexed with ksk
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 191
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b51A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b51A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b51A02
1UQWA 2WOKA 2ESNA 3SETA 3MP1A 4KYEA 4OFOA 4KR5A 1LAXA 3MW0A 2RC9A 2UVHA 4BDMA 4R72A 3VXCA 3GZGA 1IIWA 5KCJA 2GRVA 5L9OA 4GL8A 4IO3A 1T0KA 4R2BA 3LR1A 2B65A 3PU5A 1J1NA 3OSRA 2AYSA 3IOVA 4XKQA 3VDFA 3T96B 1MQDA 3UN6A 1VSOA 1DOTA 3PMVA 3RPWA 2DWHA 4X1DA 4OMBA 4KYDA 5EHSA 1OQGA 4YU0A 3BFUA 1Y3PA 5I56A 1DTZA 4NF8A 2OCUA 3G3FA 3DP8A 3SEUA 5A5XB 4UA8A 1JVYA 1LAHE 1SW1A 3TYHA 1A8EA 2HFBA 2D21A 1MXXA 4X48A 4OFJA 4EF2A 3USDA 4JB7A 2AL5A 4KQPA 1JW1A 5DTBA 3ILTB 3CFZA 4GD5A 2XD2A 2ZYNA 4WXJA 4NF6A 2RF1A 1R6ZA 2UXAA 1MXYA 3MVZA 1ZKBA 1UTHB 4L17A 1MPDA 4KHZE 2ZYKA 4MFIA 2DE3A 4G68A 5I2NA 2R6GE 3O6GA 5EYFA 3KEIA 1IEJA 1Y9UA 1MM7A 4U23A 1OLAA 1BIYA 3MC2A 2F6PA 3G3JA 1PDAA 4QFPA 1VR5A 5DEXA 2DOJA 1B5JA 3EHSA 4MH5A 2HEUA 1SW5A 3FJ7A 2DP8A 3O6HA 2OJTA 3JZJA 3PPPA 4QHQA 4QFNA 1O64A 1QKAA 1LBCA 1H45A 1BKAA 1MH3A 1IQ7A 2GHAA 3E4RA 2RCAA 3V83A 1IUDA 1Y3QA 2O84X 2VD3A 3MZBA 1DSNA 3M8UA 1Z7ME 3FTOA 3PMXA 4Q30B 3PPOA 1ZIUA 4F3BA 4GXSB 2DWIA 4F2QA 4EUOA 1FQBA 5FTIA 3CG1A 2XXTA 1H76A 5H8SA 3IB2A 4ELOA 3JV9A 2W7YA 3S4UA 1LAGE 3V89B 3C36A 3D4CA 1N7WA 2H98A 5I56B 4N13A 4NF8B 5ISUA 4NTLA 1LFIA 4YAHX 4HTGA 5K2YA 4I62A 3K4UA 3ECRA 2X7QA 3IO6A 2P0SA 4PFWA 4RPOA 1UIUA 2Y84A 4GRKA 1FTOA 3TTRA 3PPNA 2UVIA 1KWHA 3Q29A 4IO4A 4OEVA 5AA1A 4EQ7A 2HXWA 1MY2A 3CHGA 1ZTYA 2Q2CA 1ATGA 4ELPA 4YICA 1GTKA 4Q0CA 4C1TA 1YTVA 1GR2A 1Q1KA 3IOTA 4IY6A 4XXUA 4JWOA 5F7VA 1N04A 2RCBA 4NMYA 2B4MA 4ZEFA 2WOPA 3M3KA 3G3IA 4LVQA 2CZLA 3VXBA 1M5EA 4M4GA 5DEXB 5CBRA 1FTMA 3MWBA 2ALUA 1JNFA 2AIXA 3RT6B 3TTLA 1NH8A 2I6EA 4MBPA 5DYHA 3HV1A 3FVGA 4QSDA 4GF8A 3KOTA 4MLQA 1ANFA 3DP4A 4G68C 1B7UA 4XKNA 3K6XA 3KZGA 1FTLA 4U4SA 1AIVA 3G3HA 1JW4A 3MPKA 1S7YA 3IAZA 2PX1A 4LP2B 3CVGA 4IGRA 4JXIA 1NFTA 1SI0A 3QAXA 3ZS6A 2QRYA 5CMBA 3QXMA 1XC1A 4QRZA 1RYXA 4JWXA 3DRKA 3W9VA 3B6TA 1II5A 1MPCA 3H6UA 3IJOB 2O7UA 1MRPA 4M1VA 4OZ9A 3KSXA 5AA3A 5AA2D 5H8NB 2DS9A 1DTGA 5L8DA 3BFTA 1SBPA 4EF1A 3KN8A 3LSWA 1P99A 3LC8A 4YMAA 2HQ0A 4PQJA 1LAFE 3KJTA 2IA4A 3DELB 1XS5A 1OVBA 3DRJA 5HM4B 3MZ1A 1P1UA 1TXFA 4K3FA 3C34A 1B51A 3C32A 2B3BA 4H5FA 1AMFA 4BDQA 1B3EA 1GV8A 1P1NA 3TCGA 1M5FA 3U8QA 3K2DA 3FXUA 1MY0A 3O29A 4U21A 4POXA 4N07A 4QFOA 1A99A 1B1HA 1Z7NE 3Q28A 3OMBA 3MP8A 2FNCA 1MQIA 3QK6A 4KFQA 3U72A 4N6PA 1M5BA 5I84A 4RA1A 1LFGA 1MXWA 2F8DA 1PB7A 5JTYB 2I4CA 2O69A 3E13X 4FJPA 5BWJA 3K02A 5I2KA 4DE8A 2Q8JA 2QJEA 3VVEA 3PUVE 2PT1A 3O9PA 2ZYMA 2Q2AA 5FHOA 3LSFB 4HW8A 4IY5A 3N5LA 2XXVA 3FATA 4NE4A 2RKMA 4RXLA 5CM6A 1USYH 2QPQA 1S50A 3UA8A 3PPQA 4IO2A 1FQFA 3OOAA 1A40A 3KN7A 3S9MC 3K01A 5H8QA 2I58A 1B7ZA 4GWOA 4NF5A 4EQBA 1R9LA 4OWDA 1MY4A 3VE1B 1I6BA 2DYXA 4R6KA 1B6HA 2PMSA 3FZVA 2XXPA 4PE5B 4U1ZA 4DDDA 3CG3A 4DIGA 3O66A 2GH9A 3H6WA 4BLAA 1QVSA 2Q9TA 3FVOA 1URGA 5DVFA 1HSEA 2H9BA 3BBRA 3H6VA 1B1XA 4FIMA 4QFKA 1QW0A 2V25A 5FHMA 2I0BA 1PB8A 3RGYA 2HZKA 3KBRA 1GGGA 1YPNA 3A3UA 3O28A 4P0IA 4MLVA 1MY3A 3PD8A 4O3CA 1CE2A 3MPLA 4TQUQ 1NMUA 4LZ5A 3ILUB 4R6HA 4F31B 5L9SA 1UTBA 4NWDA 2IEEA 5AA4A 1FTJA 4GIZA 1QKBA 2XX8A 4RK2A 1B3HA 4FECA 4NF4A 4R6YA 4ZDMA 4IO5A 1USYE 4IGTA 2VHAA 3OO6A 2V3UA 3LSLA 2A5TA 1PB9A 3DRHA 1IXGA 3DM0A 2ZNTA 3MZ9A 1H3DA 2XD3A 2HAVA 4LZ7A 3MQ9A 3E3KA 3TELA 5H8HA 4KPTA 1H43A 1ELJA 4JSOA 3JYRA 5TP9B 4F1VA 3FIRA 4ZZAA 3SKPA 3TDJA 2CMOA 2NUVA 3DRIA 3K1NA 3IB0A 2YPNA 4GXAA 3FUZA 3C35A 3N94A 2PT2A 3R7XA 3S9NC 3U93A 2GFEA 4EXKA 2D5WA 2DE2A 4EDPA 3N6TA 1PBQA 2H5YA 3H7MA 3T9HB 4YB7A 3T9XB 4ZE9A 2Y7RA 5J1DA 1FQDA 4FATA 4ELQA 5LOMA 3TODA 3PUWE 3TKDA 3LUYA 4OXVA 2XXIA 5KCJB 1D9YA 3QUJA 4O3BA 1Y1MA 5I57A 1RKMA 4RPNA 4KI0E 4LONB 1SW2A 4TOZA 1B05A 3KJ7A 3H6TA 2OZZA 4GLIA 4YZZA 3RTWB 5CRYA 3L6GA 1D4NA 1B46A 3G7WA 1OQHA 2F7AA 3N26A 2REJA 4WEPA 1UTBB 1N0TA 5AA4B 1FTKA 2QMWA 1Y3NA 2UVGA 4BDNA 3CFXA 2WKYA 3V8XB 4YKPA 2LAOA 2ONKE 4POWA 4OQOA 3VV5A 2A5SA 4P0GA 2I3WA 4NF4B 5ITOA 5L9MA 4U22A 5TU0A 3HN0A 4FORA 2O7IA 3PV0E 4PFTA 1B9JA 3U1OA 4OFLA 1LGBC 2A5TB 5BUUA 5CMCA 5I59A 4NF6B 1B4HA 3HPIA 2XX7A 3H4ZA 3GXAA 2XXRA 2Q89A 1WVJA 3IL1B 1UIVA 2F7BA 4OTEA 3TPAA 1P1OA 2O51A 1SYHA 4G68B 2ONRA 5I2NB 3FV1A 2VP1A 2Z8DA 2VOZA 5KZTA 4RJZA 2QL3A 4LQ2A 2RC8A 2WOLA 1FQCA 4XKRA 3AXFA 3IB1A 3FJGA 3VVDA 4HCWA 3UIFA 1NNKA 5JK4A 1AH5A 3VLVA 3MUQA 4ONYA 4WEDA 1ZBMA 3C31A 3TZAA 3T22A 3SEWA 3O2AA 1B2HA 1OMPA 1POY1 3H06B 1NKXA 3RYBA 1QJMA 5ITPA 1I6QA 4O3AA 1NL5A 1A7LA 3Q27A 3SEXA 3RY3A 1MDP1 1B52A 3B7DA 1L5TA 4AB5A 4DXCA 5TPAA 3F11A 3KGCA 1JW5A 3SEVA 3OO8A 3T66A 3PUXE 3G3GA 2Z22A 5KDTA 4RK9A 4BDRA 2Y7KA 2XXXA 2QS1A 2QSXA 4G4PA 1PC3A 4ELRA 4BDLA 1MDQA 4I1DA 2I48A 3Q25A 3V5AA 1SYIA 5AA2A 1MQHA 1ZU0A 3K00A 2Y7IA 2XXYA 2KLFA 4YKIA 2D3IA 2H4IA 4ND9A 5H8FA 4LZ8A 1MXUA 2ZYOA 3KG2A 4PFUA 2DWJA 2DXYA 2F36A 4DZ1A 5HBCA 3VLWA 4OYVA 1R9QA 3M3FA 4PETA 1XVXA 1VE4A 2Z8FA 1Y4TA 3PPRA 3RN8A 3TMGA 4F19A 1LCTA 1YCJA 2Q88A 2DVZA 3TQWA 2DWAA 2XX9A 4YMBA 5JEIA 4HCYA 4DXBA 1B0HA 2G29A 2AL4A 1EZPA 3RT8A 3OEKA 3R26A 3OXNA 1EU8A 3D4GA 4ECFA 4GOTA 3QUFA 3TCHA 3TFLA 3SESA 5F1QA 1MXZA 1P1WA 3UORA 4QSCA 4R9GA 3THIA 1NNTA 4TLMB 1DPPA 1NH7A 4DLDA 4TLLB 3QSLA 1DMBA 1BTJA 4OESA 3LVUA 1FCKA 1MM6A 3U94A 4PFYA 3DRFA 1MH4A 1ZMGA 2O68A 3CRBA 3TTMA 4IO6A 4ESWA 5A5XA 2NWJA 4KD5A 5EHMA 3EF7A 1LCFA 1FW0A 1EZOA 4P11A 4U4XA 4ZZEA 1VFEA 3CI8A 1IITA 1MG1A 4G8MA 4LATA 4QFLA 3IJXB 2F7CA 3OENA 5ICQA 2F5XA 4GFRA 4R2FA 3RUMA 3MJNA 1XT8A 3TQLA 1HSLA 4MF3A 2PBWA 2H25A 3OELA 2O1LA 1EH3A 3U92A 2O6AA 3CFLA 1H44A 1TWYA 4F1YA 3G3KA 1UTHA 3EHUA 3VFJA 5AA2B 3ONMA 2I0CA 3S9EA 4IO7A 3EHTA 3T93B 1B58A 4ZEKA 3UGWA 4KCCA 1JEUA 3RQTA 1LBBA 1WDNA 2FA7A 3RTFB 4QF9A 5DT6A 1YAEA 3M3LA 4GQOA 4LA9A 1B5IA 1OLCA 3K1PA 1IXHA 3SEYA 3C4MA 3C9HA 3PGFA 2OBGA 3IOWA 2THIA 1B0LA 3CSGA 3K6UA 1NNFA 4F3PA 3MVXA 1A8FA 2F78A 4AQ4A 3PMWA 2OK2A 3OSQA 3I5OA 3SDFA 4F2OA 3GBAA 3PUZE 4EXLA 1TFAA 2VD2A 2ABHA 4IB2A 1JEVA 2O1MA 3TCFA 2XXWA 3RYAA 1MY1A 2V3TA 1XOCA 2OLBA 1XHYA 1OIBA 3LBSA 4C0RA 3MAMA 1OVTA 3SERA 2E1SA 1AL3A 1D9VA 5IKBA 4RYAA 2DVCA 3ZKLA 5I58A 1Y20A 1A54A 1MQJA 2BJJX 3OO7A 3S9LC 3Q26A 3K1MA 5B70A 1B7HA 3TTNA 4XIGQ 3R6UA 5I2KB 3IX1A 4YKKA 5IAIA 1QUIA 3N6UA 3E9XA 1SQYA 4H6DA 4ZECA 3FJMA 3VVFA 2QMXA 3C33A 2REGA 2PYYA 2R9JA 1Y4CA 2F6GA 3IOUA 4F39A 3B6WA 4H8JA 5B7DA 2B4LA 5DVIA 3WAFA 3EN3A 4H67A 4H65A 3PD9A 1PBPA 4FEDA 1POTA 3EQ1A 3CIJA 3HHGA 1JETA 5H8QB 1QUJA 4F29A 4NF5B 2V3QA 2HCAA 4F3SA 1M5DA 5HPQA 4QSEA 2DXRA 3KN3A 3DRGA 2ONSA 3EPEA 5AE4A 4ZE8A 4R73A 4F18A 2H99A 4I9DA 3GLBA 2Z8EA 4GVOA 3ODBA 2OWTA 3W15C 1FQEA 1MPBA 4FE8A 1MQGA 4EQ9A 3S2VA 3FASA 3H03A 2YJPA 1PEBA 2Y7PA 2UYEA 1N3XA 4PP0A 1N7XA 1RYOA 3KSJA 4Q5TA 1TFDA 5CMMA 4G77A 2ANJA 5FHNA 2OWSA 2P1SA 1IXCA 1O7TA 3RNNA 5M2VA 2XXQA 1WODA 4OEUA 3FXRA 5I58B 3IK6B 2PVUA 4U1OA 3OEMA 4YKJA 1GVCA 1US5A 1LLSA 4G2ZA 1I6AA 1B32A 4I8CA 5H8NA 4NEDA 3K6VA 4DCYA 1R1NA 1FQAA 3ZSFA 1JVXA 2R71A 3MBPA 3T9UA 1XVYA 3K6WA 2DQVA 5H8HB 3FVKA 4U2RA 4E0WA 4FAJA 4R9FA 3FXQA 3IO4A 2HZLA 4ISUA 1N3WA 1B3FA 3TTKA 3B6QA 4HS7A 1URSA 4KCDA 1SW4A 2G93A 4NWCA 1HSJA 4H1XA 3OD7A 3I3VA 1A55A 3CSBA 2F34A 3MVWA 4XTCQ 4F3GA 1LSTA 3QYTA 1IZ1A 1JQFA 4KYSA 3TEPA 2HAUA 4X9TA 4ZS9A 2DSFA 4H5GA 4JSDA 5ICTA 3OO9A 5K2XA 3PUYE 2I3VA 5I57B 3CR9A 2X26A 2QS2A 4ZEIA 4THIA 4OERA 4FEBA 3O6IA 3K0VA 1M5CA 2M8CA 5CI5A 2ZXTA 2V93A 4Z0IA 3FD3A 5JTYA 3H3GA 1TT1A 2VGQA 2Z23A 1BLFA 3O97A 1DPEA 3A3CA 4OENA 2X7PA 2ZNUA 3MVYA 1P1QA 3QIMA 3DP6A 2FYIA 4ZEBA 2RC7A 3WAEA 4G8HA 1VFDA 1QUKA 1Q35A 5CBSA 2DE4A 1N76A 1N84A 1SDXA 1ZJLA 2I4BA 4Z7EA 2NXOA 4GL0A 3P7IA 4YB6A 5I59B 2F35A 4DXUA 4UACA 1IXIA 4LQ5A 3TUSA 1B4ZA 1AOVA 3LSXA 1I69A 1Y1ZA 3W9WA 2B3FA 4X1BA 5DVJA 3VLUA 1LB9A 2F97A 1EZ9A 2ZMBA 4ESXA 4F1UA 1QULA 1D3KA 1CB6A 3A09A 4XKPA 1BP5A 1MXVA 1B40A 2V84A 1B5HA 3KOSA 3IORA 1B3GA 1O63A 4OETA 2QS3A 3HSTA 1B3LA 4YB5A 2XHDA 3UP9A 2UVJA 4BDOA 1LB8A 3KFMA 2XXHA 4F22A 4H8IA 5CC2A 2YLNA 2UYFA 3BKIB 3PAMA 1SD3A 2NOOA 3UK4A 2NVUB 4E0XA 4DCXA 3FVNA 3T9VA 1URDA 1US4A 3FV2A 4OHNA 2I49A 2E0SA 4LUBA 5TPAB 2RINA 4RY1A 1SI1A 4WKMA 4JWYA 4ZEDA 3TAJA 3I6VA 3O6PA 5KDTB 1LFHA 1NNPA 2GHBA 4JDFA 3RLFE 2QS4A 5FTHA 3GBBA 4JBZA 1S9TA 2ZNSA 3HCQA 2Y7WA 3ZKKA 3HHFA 4R75A 4H0WA 4AB6A 4RNSA 1ZLQA 3HO7A 3MP6A 4C1UA 4OVJA 2P2AA 1MS7A 5TP9A 5H8FB 1SVXB 4G8NA 2XXUA 3FGSA 1F9BA 4Q8RA 5ELVA 5CMKA 3IR1A 3L6HA 4R74A 3DLNA
chains in the Genus database with same CATH superfamily
1UQWA 2WOKA 1AWBA 2ESNA 3SETA 3MP1A 1NV6A 4KYEA 4OFOA 4KR5A 1FJ6A 1LAXA 3MW0A 2RC9A 2UVHA 4BDMA 4R72A 3VXCA 3GZGA 1IIWA 5KCJA 2GRVA 5L9OA 4GL8A 4IO3A 1T0KA 4R2BA 3LR1A 2B65A 3PU5A 1J1NA 3OSRA 2AYSA 3IOVA 4XKQA 3VDFA 3T96B 1MQDA 3UN6A 5I5PA 1VSOA 1DOTA 3PMVA 3RPWA 2DWHA 4X1DA 4OMBA 2Q74A 4KYDA 5EHSA 1OQGA 4YU0A 4OVTA 3BFUA 1Y3PA 5I56A 1DTZA 4NF8A 2OCUA 3G3FA 3DP8A 3SEUA 5A5XB 4UA8A 1JVYA 1LAHE 1SW1A 3TYHA 1A8EA 2HFBA 1LBXA 2D21A 1JP4A 1MXXA 4X48A 5EYGA 4OFJA 4EF2A 3USDA 5F24A 4JB7A 2AL5A 4KQPA 1JW1A 5DTBA 3ILTB 3CFZA 4GD5A 5EQAA 2XD2A 2ZYNA 4WXJA 1IMEA 4UABA 4NF6A 2RF1A 1R6ZA 2UXAA 1MXYA 3MVZA 1ZKBA 5EQ9A 1UTHB 4L17A 5DW8A 1MPDA 4KHZE 2ZYKA 4MFIA 2DE3A 4G68A 1IMDA 5I2NA 2R6GE 3O6GA 5EYFA 3KEIA 1IEJA 1Y9UA 1EYJA 1MM7A 4U23A 1OLAA 1BIYA 3MC2A 2F6PA 3G3JA 1PDAA 4QFPA 1VR5A 5DEXA 2DOJA 1B5JA 4O8MA 1NUYA 4JVCA 5ET6A 3EHSA 4MH5A 3A29A 3EKIA 2HEUA 1SW5A 3FJ7A 2DP8A 3O6HA 2OJTA 3JZJA 4MNCA 3PPPA 4QHQA 4QFNA 4H46A 1O64A 2FIEA 1QKAA 1LBCA 1H45A 1BKAA 4PF8A 1MH3A 1IQ7A 2GHAA 3E4RA 2RCAA 3V83A 1IUDA 1Y3QA 2O84X 2VD3A 3MZBA 1DSNA 3M8UA 1NV1A 1Z7ME 4Q30B 3FTOA 2WBBA 3PMXA 4O7IA 3PPOA 1NV0A 5FBPA 1ZIUA 2FVZA 4F3BA 4GXSB 2DWIA 4F2QA 1FQBA 5FTIA 4EUOA 3CG1A 2XXTA 3T1BA 1H76A 5H8SA 3IB2A 4ELOA 3JV9A 2W7YA 5T3JA 3S4UA 1LAGE 3V89B 3C36A 4P3LA 3D4CA 1N7WA 2H98A 5I56B 4OA4A 4N13A 4NF8B 1LBZA 5ISUA 4NTLA 1LFIA 4YAHX 4HTGA 5K2YA 4I62A 3K4UA 3ECRA 4PDHA 2X7QA 3IO6A 2P0SA 4PFWA 4RPOA 1UIUA 2Y84A 5A5LA 4GRKA 1FTOA 3TTRA 4MNIA 3PPNA 2UVIA 1KWHA 3Q29A 4IO4A 4OEVA 5AA1A 4EQ7A 1K9ZA 2HXWA 2MKZA 1MY2A 3CHGA 1Q9DA 1ZTYA 2Q2CA 1ATGA 4ELPA 4NGUA 4YICA 1GTKA 4Q0CA 4C1TA 1YTVA 4MCOA 4AS4A 1GR2A 3KC0A 1Q1KA 3IOTA 4IY6A 1INPA 4XXUA 4JWOA 5F7VA 1N04A 2RCBA 4NMYA 2B4MA 4GWWA 4ZEFA 2WOPA 3M3KA 3G3IA 4LVQA 2CZLA 3VXBA 1M5EA 4M4GA 5DEXB 5CBRA 1FTMA 3MWBA 2ALUA 1JNFA 2AIXA 3RT6B 3TTLA 1NH8A 2I6EA 4MBPA 1NV3A 5DYHA 3HV1A 3FVGA 4QSDA 4GF8A 3SZPA 4OVPA 3KOTA 4MLQA 1VDWA 1ANFA 3DP4A 4G68C 1B7UA 4XKNA 5ET7A 3K6XA 3KZGA 1FTLA 4U4SA 4OANA 2VPNA 1AIVA 3G3HA 1JW4A 3MPKA 1S7YA 3IAZA 2PX1A 4LP2B 3CVGA 4IGRA 3D1RA 4JXIA 1NFTA 1SI0A 3QAXA 3ZS6A 2QRYA 5CMBA 4PAKA 3QXMA 1XC1A 4NG7A 4QRZA 1FRPA 1RYXA 4PF6A 4JWXA 3DRKA 3W9VA 3B6TA 1II5A 1MPCA 3H6UA 3IJOB 4P1EA 4PGPA 2O7UA 1MRPA 4M1VA 4OZ9A 4N8GA 3KSXA 5AA3A 5AA2D 5H8NB 2DS9A 3GYYA 1FPKA 1DTGA 5L8DA 1YYZA 3BFTA 1SBPA 1LBVA 5IM2A 4EF1A 3KN8A 2HXRA 3LSWA 1P99A 3LC8A 4XFEA 4YMAA 2HQ0A 4PQJA 1LAFE 3KJTA 2IA4A 3DELB 1XS5A 1OVBA 3DRJA 5HM4B 3MZ1A 1P1UA 1TXFA 4K3FA 3C34A 1B51A 3C32A 2B3BA 4H5FA 1AMFA 4BDQA 1B3EA 4PE3A 1GV8A 4FBPA 1P1NA 1FBCA 3TCGA 1M5FA 4O7MA 3U8QA 3K2DA 3FXUA 4I40A 1MY0A 3O29A 4U21A 4POXA 4JVDA 1EYIA 4N07A 1XI6A 4QFOA 4GWXA 4N91A 1A99A 1B1HA 1Z7NE 3Q28A 2QFLA 3OMBA 3MP8A 2FNCA 1MQIA 3QK6A 4KFQA 4P9KA 3U72A 4N6PA 1M5BA 5I84A 4RA1A 1LFGA 2XWIA 3FBPA 1MXWA 2F8DA 1PB7A 5JTYB 2I4CA 2O69A 2QVVA 4GWZA 3E13X 4FJPA 1NV7A 5BWJA 3K02A 2ZZXA 5I2KA 4DE8A 2Q8JA 2QJEA 3VVEA 3PUVE 2PT1A 3O9PA 2ZYMA 2Q2AA 5FHOA 4N15A 3LSFB 4HW8A 4IY5A 3N5LA 2XXVA 3FATA 4NE4A 1YZ0A 2RKMA 4RXLA 5CM6A 1USYH 2QPQA 1S50A 3UA8A 3PPQA 4MJOA 2V4CA 4IO2A 4DI4B 1FQFA 1LEVA 3OOAA 1A40A 3KN7A 4PFBA 3S9MC 3K01A 5H8QA 2I58A 1B7ZA 4X04A 4GWOA 4NF5A 4EQBA 1R9LA 4OWDA 1MY4A 1NV5A 3VE1B 1I6BA 2DYXA 4R6KA 2OWZA 1B6HA 2PMSA 3FZVA 2XXPA 4PE5B 4U1ZA 4DDDA 3CG3A 3RYDA 4DIGA 3O66A 2GH9A 3H6WA 4BLAA 1QVSA 2Q9TA 4PDDA 3FVOA 1FBPA 1URGA 5DVFA 1HSEA 2H9BA 3BBRA 5LDZA 3H6VA 1B1XA 4FIMA 4QFKA 1QW0A 2V25A 5FHMA 2I0BA 1PB8A 3RGYA 2HZKA 1NV2A 3KBRA 1GGGA 1YPNA 3A3UA 3O28A 4P0IA 4MLVA 1MY3A 3PD8A 4O3CA 1CE2A 3MPLA 4TQUQ 1NMUA 4LZ5A 1EYKA 3ILUB 2DDKA 4HE0A 4R6HA 1FJ9A 4F31B 5L9SA 1UTBA 4NWDA 2IEEA 5AA4A 1FPIA 1FTJA 4GIZA 1QKBA 2XX8A 1IMFA 4RK2A 1B3HA 3QMFA 4FECA 4NF4A 4R6YA 4ZDMA 2Y5LA 4IO5A 1USYE 4IGTA 2VHAA 4GWSA 3ROJA 3OO6A 2V3UA 3LSLA 2A5TA 4HXVA 1PB9A 3DRHA 1IXGA 3DM0A 2ZNTA 3MZ9A 3BIHA 1H3DA 2XD3A 1FPDA 3RPLA 2HAVA 4LZ7A 4I3YA 3MQ9A 3E3KA 3TELA 5H8HA 2CEXA 4KPTA 4OVQA 1H43A 4H45A 2OX3A 1ELJA 4JSOA 3JYRA 5TP9B 4F1VA 3FIRA 4ZZAA 2P3NA 3SKPA 3TDJA 2JJKA 2CMOA 2NUVA 3DRIA 3K1NA 3IB0A 2YPNA 4GXAA 3FUZA 3C35A 3N94A 2Y5KA 4MEVA 2PT2A 3R7XA 3S9NC 3U93A 2GFEA 4EXKA 2D5WA 2DE2A 4EDPA 3N6TA 4PC9A 1PBQA 2H5YA 3H7MA 4GBWA 3T9HB 4YB7A 3T9XB 4ZE9A 2Y7RA 5J1DA 1FQDA 4FATA 4ELQA 5LOMA 3TODA 3BIGA 3PUWE 3TKDA 3LUYA 4OXVA 2XXIA 5KCJB 4X8RA 4LN5A 1D9YA 3QUJA 4O3BA 1Y1MA 5I57A 4GBVA 1RKMA 4RPNA 4KI0E 4LONB 4GWYA 1SW2A 4TOZA 1B05A 3KJ7A 3H6TA 2OZZA 4GLIA 4YZZA 3RTWB 5CRYA 3L6GA 1D4NA 1B46A 1K9YA 3G7WA 1QGXA 1OQHA 2F7AA 3N26A 4I3EA 2VPOA 5ESYA 1RDYA 2REJA 4WEPA 1UTBB 1N0TA 1LBWA 5AA4B 1FTKA 2QMWA 1Y3NA 2UVGA 4GX4A 4BDNA 3CFXA 2WKYA 3V8XB 4YKPA 2LAOA 4MHFA 2ONKE 1RDZA 4POWA 5IZ3A 4OQOA 3VV5A 2A5SA 4P0GA 2BJIA 5EQ7A 2I3WA 4NF4B 5ITOA 5L9MA 4U22A 1G0IA 5TU0A 3HN0A 4FORA 2O7IA 2KQZA 4JVIA 3PV0E 4PFTA 1B9JA 4PGNA 3U1OA 4OFLA 1LGBC 2A5TB 5BUUA 5CMCA 5I59A 4NF6B 1B4HA 3HPIA 2XX7A 3H4ZA 3GXAA 2XXRA 2Q89A 3RPLB 1WVJA 3IL1B 1UIVA 2F7BA 4OTEA 3TPAA 1P1OA 2O51A 1SYHA 4G68B 2ONRA 5I2NB 3FV1A 2VP1A 4NN3A 2Z8DA 2VOZA 5KZTA 4OVRA 4RJZA 2QL3A 4LQ2A 2RC8A 2WOLA 1FQCA 4XKRA 3AXFA 3IB1A 3FJGA 3VVDA 4HCWA 3UIFA 1DBZA 1NNKA 5JK4A 1AH5A 3VLVA 3MUQA 4ONYA 4WEDA 1ZBMA 3C31A 3TZAA 1FBHA 3T22A 3SEWA 3O2AA 4PBQA 4MNPA 2F3DA 1B2HA 2FHYA 2ZZWA 1OMPA 1NUXA 1POY1 4QBAA 3H06B 1NKXA 3RYBA 1QJMA 5ITPA 1I6QA 4O3AA 1NL5A 2F3BA 1A7LA 3Q27A 3SEXA 3RY3A 1MDP1 1B52A 3B7DA 4GWUA 1L5TA 4AB5A 4DXCA 5TPAA 3F11A 3KGCA 1JW5A 3SEVA 3OO8A 1LBYA 3T66A 3PUXE 3G3GA 2Z22A 5KDTA 4RK9A 4BDRA 5IZZA 2Y7KA 2XXXA 2QS1A 2QSXA 3FXBA 4G4PA 1PC3A 4ELRA 4BDLA 2WX9A 1MDQA 4I1DA 4GX6A 4MMPA 5IZ3B 2I48A 3Q25A 3V5AA 1SYIA 4OVSA 4PFIA 1MQHA 1ZU0A 3K00A 5AA2A 2CEYA 2Y7IA 2XXYA 2KLFA 4YKIA 1SPIA 2D3IA 2H4IA 4ND9A 5H8FA 4LZ8A 1MXUA 2ZYOA 3KG2A 4PFUA 2DWJA 2DXYA 2F36A 4DZ1A 5HBCA 3VLWA 4OYVA 1R9QA 3M3FA 4PETA 1XVXA 1VE4A 2Z8FA 4NQ8A 1Y4TA 3PPRA 3RN8A 3TMGA 4F19A 5I7IA 1LCTA 3T0JA 1YCJA 2Q88A 2DVZA 3TQWA 2WEFA 2DWAA 2XX9A 4YMBA 5JEIA 4HCYA 1FPJA 1B0HA 4DXBA 2G29A 1FPGA 2AL4A 2WYKA 1EZPA 3RT8A 3OEKA 3R26A 1EU8A 3OXNA 3D4GA 4ECFA 4GOTA 1RDXA 3QUFA 3TCHA 3TFLA 3SESA 5F1QA 3U65A 1MXZA 1P1WA 4N17A 4P47A 3UORA 4QXDA 4QSCA 4R9GA 3THIA 1NNTA 4P56A 4TLMB 1FSAA 1DPPA 1NH7A 4DLDA 4TLLB 3QSLA 1DMBA 1BTJA 4OESA 3LVUA 1FCKA 1MM6A 3U94A 4PFYA 3DRFA 3HFUA 1MH4A 1ZMGA 2O68A 4PTKA 2PFZA 3CRBA 3TTMA 4IO6A 4ESWA 1DK4A 5A5XA 2XWKA 2NWJA 4KD5A 4DI3D 5EHMA 3EF7A 1LCFA 1FW0A 2ZZVA 4P1LA 1EZOA 4P11A 2XWVA 4U4XA 4ZZEA 3LUZA 1VFEA 3CI8A 1IITA 1MG1A 1FBEA 4G8MA 4LATA 4QFLA 3IJXB 2F7CA 3OENA 5ICQA 2F5XA 4GFRA 4R2FA 3RUMA 3MJNA 1XT8A 3TQLA 1HSLA 5IZ1A 1KA1A 4MF3A 2PBWA 2H25A 2QVUA 3OELA 2O1LA 1EH3A 3U92A 4HE2A 2HPGA 2O6AA 3CFLA 1H44A 1TWYA 4F1YA 3G3KA 1UTHA 3EHUA 3VFJA 5AA2B 3ONMA 2I0CA 3S9EA 4IO7A 3EHTA 3T93B 1B58A 4ZEKA 3UGWA 4KCCA 1JEUA 3RQTA 1LBBA 1WDNA 2FA7A 3RTFB 4QF9A 5DT6A 1YAEA 3M3LA 4GQOA 4LA9A 1B5IA 1OLCA 3LV0A 3K1PA 1IXHA 3SEYA 3C4MA 3C9HA 3PGFA 2OBGA 2FIXA 3IOWA 2THIA 4HE1A 1B0LA 3CSGA 3K6UA 4XEQA 1NNFA 4F3PA 3MVXA 1A8FA 4PAFA 2F78A 4AQ4A 3PMWA 1FPBA 2OK2A 3OSQA 3I5OA 3SDFA 4F2OA 3GBAA 3PUZE 4EXLA 4P8BA 1TFAA 2VD2A 2HHMA 2ABHA 1IMCA 4IB2A 1JEVA 2O1MA 1NV4A 3TCFA 4XF5A 2XXWA 3RYAA 1MY1A 2V3TA 1XOCA 2OLBA 1XHYA 1OIBA 3LBSA 4C0RA 3MAMA 1OVTA 3SERA 1FPLA 2E1SA 1AL3A 1D9VA 5IKBA 4RYAA 2DVCA 2WYPA 3ZKLA 5ET5A 5I58A 5LTCA 1Y20A 1A54A 1MQJA 2QVRA 2BJJX 3OO7A 3S9LC 2KR0A 3Q26A 4N4UA 3K1MA 4N8YA 5B70A 1B7HA 3TTNA 4XIGQ 3R6UA 3IX1A 4YKKA 5I2KB 4N81A 1QUIA 5IAIA 3N6UA 3E9XA 1SQYA 3E79A 4H6DA 3B50A 4ZECA 4KXPA 3FJMA 3VVFA 1D9QA 2QMXA 3C33A 2REGA 2PYYA 2R9JA 1Y4CA 2F6GA 3IOUA 4F39A 2VT5A 3B6WA 4H8JA 5B7DA 1NUWA 1KA0A 2B4LA 5DVIA 4PAIA 3WAFA 4MAGA 3EN3A 4H67A 4H65A 3PD9A 1PBPA 4FEDA 1POTA 3EQ1A 3CIJA 3HHGA 1JETA 5H8QB 1QUJA 4F29A 3MYUA 4NF5B 5ET8A 2V3QA 2HCAA 4F3SA 1NUZA 3ISPA 1M5DA 3IFCA 5HPQA 4QSEA 3KBZA 2DXRA 3KN3A 3DRGA 4O94A 4NF0A 2ONSA 3EPEA 5AE4A 4ZE8A 4PFRA 4R73A 4NHBA 4F18A 2H99A 1FTAA 4I9DA 3GLBA 4PBHA 2Z8EA 4GVOA 3ODBA 2OWTA 3W15C 1FQEA 3E78A 1FBDA 4GX3A 1MPBA 4FE8A 1MQGA 4EQ9A 2FBPA 3S2VA 3FASA 3H03A 1BK4A 2YJPA 3MSTA 1PEBA 2Y7PA 1IMBA 4N6DA 2UYEA 3PTYA 1N3XA 4PP0A 1N7XA 1RYOA 3KSJA 4Q5TA 1TFDA 5CMMA 4G77A 2ANJA 5FHNA 2OWSA 2P1SA 1IXCA 1O7TA 3RNNA 5EYHA 5M2VA 2XXQA 1WODA 4OEUA 3FXRA 5I58B 3IK6B 2PVUA 4U1OA 3OEMA 4YKJA 1GVCA 1US5A 1LLSA 4G2ZA 1I6AA 4IR8A 1B32A 4I8CA 1CNQA 5H8NA 4NEDA 3K6VA 4DCYA 1R1NA 1FQAA 3ZSFA 1JVXA 4PCDA 4NAPA 4N6KA 2R71A 3MBPA 3T9UA 1XVYA 3K6WA 2DQVA 5H8HB 3FVKA 4U2RA 4E0WA 4FAJA 4R9FA 3FXQA 2GQ1A 1FPEA 3IO4A 2HZLA 4ISUA 1N3WA 1B3FA 3TTKA 3B6QA 4HS7A 1URSA 4KCDA 1SW4A 2G93A 1FBFA 1G0HA 4NWCA 1HSJA 4H1XA 3OD7A 3I3VA 1A55A 3CSBA 4MIJA 4G61A 2F34A 3MVWA 4XTCQ 4F3GA 1LSTA 3QYTA 1IZ1A 1JQFA 2CZIA 4KYSA 3TEPA 2HAUA 4X9TA 5EQ8A 5J16A 4ZS9A 2DSFA 4H5GA 4JSDA 5ICTA 3OO9A 5K2XA 3PUYE 4NX1A 2I3VA 5I57B 3CR9A 2X26A 2QS2A 1IMAA 4ZEIA 4THIA 4OERA 4FEBA 3O6IA 3K0VA 1M5CA 2M8CA 5CI5A 2ZXTA 2V93A 4Z0IA 3FD3A 5JTYA 3H3GA 1TT1A 2VGQA 2Z23A 3IFAA 1BLFA 3O97A 1DPEA 2P3VA 3A3CA 4OENA 2X7PA 2ZNUA 3MVYA 1P1QA 3QIMA 3DP6A 2FYIA 1DCUA 4ZEBA 2RC7A 3WAEA 4G8HA 5I3SA 2XA5A 1VFDA 1QUKA 3B8BA 1Q35A 5CBSA 2DE4A 1N76A 1N84A 1SDXA 1ZJLA 2I4BA 4Z7EA 2NXOA 4GL0A 3P7IA 4YB6A 5I59B 2F35A 2Q8MA 4DXUA 4UACA 1IXIA 4LQ5A 3TUSA 1B4ZA 1AOVA 3LSXA 1I69A 1Y1ZA 1YXIA 3W9WA 2B3FA 4X1BA 2R8TA 5DVJA 3VLUA 1LB9A 2F97A 2PCRA 1EZ9A 4MX6A 2ZMBA 4ESXA 4F1UA 1QULA 1D3KA 2XXKA 1CB6A 3A09A 4XKPA 1BP5A 1MXVA 1B40A 2V84A 1B5HA 3KOSA 2CZHA 3IORA 1B3GA 1O63A 4OETA 2QS3A 3HSTA 1B3LA 4YB5A 2L5VA 2XHDA 3UP9A 2UVJA 4BDOA 1LB8A 3KFMA 2XXHA 2CZKA 4F22A 4H8IA 5CC2A 2YLNA 2UYFA 3BKIB 3PAMA 1SD3A 2NOOA 3UK4A 2XWOA 2NVUB 4E0XA 4DCXA 3FVNA 3T9VA 1FBGA 1URDA 1US4A 3FV2A 4OHNA 2I49A 2WBDA 2E0SA 4LUBA 5TPAB 1KZ8A 2RINA 4RY1A 1SI1A 4WKMA 4AS5A 4JWYA 4ZEDA 3TAJA 3I6VA 3KC1A 3O6PA 1NI9A 5KDTB 1LFHA 1NNPA 2GHBA 4JDFA 3RLFE 2QS4A 3NOHA 5FTHA 3GBBA 4JBZA 1S9TA 2ZNSA 3HCQA 2Y7WA 3ZKKA 3HHFA 4R75A 4H0WA 4AB6A 1FPFA 1ZLQA 4RNSA 3HO7A 5IGAA 3MP6A 4C1UA 4OVJA 2P2AA 2PFYA 1MS7A 5TP9A 5H8FB 1SVXB 4G8NA 2XXUA 3FGSA 1F9BA 4Q8RA 5ELVA 5CMKA 3IR1A 3L6HA 4R74A 3DLNA
chains in the Genus database with same CATH topology
1UQWA 2WOKA 2ESNA 3SETA 3MP1A 4KYEA 4OFOA 4KR5A 1LAXA 3MW0A 2RC9A 2UVHA 4BDMA 4R72A 3VXCA 3GZGA 1IIWA 5KCJA 2GRVA 5L9OA 4GL8A 4IO3A 1T0KA 4R2BA 3LR1A 2B65A 3PU5A 1J1NA 3OSRA 2AYSA 3IOVA 4XKQA 3VDFA 3T96B 1MQDA 3UN6A 1VSOA 1DOTA 3PMVA 3RPWA 2DWHA 4X1DA 4OMBA 4KYDA 5EHSA 1OQGA 4YU0A 3BFUA 1Y3PA 5I56A 1DTZA 4NF8A 2OCUA 3G3FA 3DP8A 3SEUA 5A5XB 4UA8A 1JVYA 1LAHE 1SW1A 3TYHA 1A8EA 2HFBA 2D21A 1MXXA 4X48A 4OFJA 4EF2A 3USDA 4JB7A 2AL5A 4KQPA 1JW1A 5DTBA 3ILTB 3CFZA 4GD5A 2XD2A 2ZYNA 4WXJA 4NF6A 2RF1A 1R6ZA 2UXAA 1MXYA 3MVZA 1ZKBA 1UTHB 4L17A 1MPDA 4KHZE 2ZYKA 4MFIA 2DE3A 4G68A 5I2NA 2R6GE 3O6GA 5EYFA 3KEIA 1IEJA 1Y9UA 1MM7A 4U23A 1OLAA 1BIYA 3MC2A 2F6PA 3G3JA 1PDAA 4QFPA 1VR5A 5DEXA 2DOJA 1B5JA 3EHSA 4MH5A 2HEUA 1SW5A 3FJ7A 2DP8A 3O6HA 2OJTA 3JZJA 3PPPA 4QHQA 4QFNA 1O64A 1QKAA 1LBCA 1H45A 1BKAA 1MH3A 1IQ7A 2GHAA 3E4RA 2RCAA 3V83A 1IUDA 1Y3QA 2O84X 2VD3A 3MZBA 1DSNA 3M8UA 1Z7ME 3FTOA 3PMXA 4Q30B 3PPOA 1ZIUA 4F3BA 4GXSB 2DWIA 4F2QA 4EUOA 1FQBA 5FTIA 3CG1A 2XXTA 1H76A 5H8SA 3IB2A 4ELOA 3JV9A 2W7YA 3S4UA 1LAGE 3V89B 3C36A 3D4CA 1N7WA 2H98A 5I56B 4N13A 4NF8B 5ISUA 4NTLA 1LFIA 4YAHX 4HTGA 5K2YA 4I62A 3K4UA 3ECRA 2X7QA 3IO6A 2P0SA 4PFWA 4RPOA 1UIUA 2Y84A 4GRKA 1FTOA 3TTRA 3PPNA 2UVIA 1KWHA 3Q29A 4IO4A 4OEVA 5AA1A 4EQ7A 2HXWA 1MY2A 3CHGA 1ZTYA 2Q2CA 1ATGA 4ELPA 4YICA 1GTKA 4Q0CA 4C1TA 1YTVA 1GR2A 1Q1KA 3IOTA 4IY6A 4XXUA 4JWOA 5F7VA 1N04A 2RCBA 4NMYA 2B4MA 4ZEFA 2WOPA 3M3KA 3G3IA 4LVQA 2CZLA 3VXBA 1M5EA 4M4GA 5DEXB 5CBRA 1FTMA 3MWBA 2ALUA 1JNFA 2AIXA 3RT6B 3TTLA 1NH8A 2I6EA 4MBPA 5DYHA 3HV1A 3FVGA 4QSDA 4GF8A 3KOTA 4MLQA 1ANFA 3DP4A 4G68C 1B7UA 4XKNA 3K6XA 3KZGA 1FTLA 4U4SA 1AIVA 3G3HA 1JW4A 3MPKA 1S7YA 3IAZA 2PX1A 4LP2B 3CVGA 4IGRA 4JXIA 1NFTA 1SI0A 3QAXA 3ZS6A 2QRYA 5CMBA 3QXMA 1XC1A 4QRZA 1RYXA 4JWXA 3DRKA 3W9VA 3B6TA 1II5A 1MPCA 3H6UA 3IJOB 2O7UA 1MRPA 4M1VA 4OZ9A 3KSXA 5AA3A 5AA2D 5H8NB 2DS9A 1DTGA 5L8DA 3BFTA 1SBPA 4EF1A 3KN8A 3LSWA 1P99A 3LC8A 4YMAA 2HQ0A 4PQJA 1LAFE 3KJTA 2IA4A 3DELB 1XS5A 1OVBA 3DRJA 5HM4B 3MZ1A 1P1UA 1TXFA 4K3FA 3C34A 1B51A 3C32A 2B3BA 4H5FA 1AMFA 4BDQA 1B3EA 1GV8A 1P1NA 3TCGA 1M5FA 3U8QA 3K2DA 3FXUA 1MY0A 3O29A 4U21A 4POXA 4N07A 4QFOA 1A99A 1B1HA 1Z7NE 3Q28A 3OMBA 3MP8A 2FNCA 1MQIA 3QK6A 4KFQA 3U72A 4N6PA 1M5BA 5I84A 4RA1A 1LFGA 1MXWA 2F8DA 1PB7A 5JTYB 2I4CA 2O69A 3E13X 4FJPA 5BWJA 3K02A 5I2KA 4DE8A 2Q8JA 2QJEA 3VVEA 3PUVE 2PT1A 3O9PA 2ZYMA 2Q2AA 5FHOA 3LSFB 4HW8A 4IY5A 3N5LA 2XXVA 3FATA 4NE4A 2RKMA 4RXLA 5CM6A 1USYH 2QPQA 1S50A 3UA8A 3PPQA 4IO2A 1FQFA 3OOAA 1A40A 3KN7A 3S9MC 3K01A 5H8QA 2I58A 1B7ZA 4GWOA 4NF5A 4EQBA 1R9LA 4OWDA 1MY4A 3VE1B 1I6BA 2DYXA 4R6KA 1B6HA 2PMSA 3FZVA 2XXPA 4PE5B 4U1ZA 4DDDA 3CG3A 4DIGA 3O66A 2GH9A 3H6WA 4BLAA 1QVSA 2Q9TA 3FVOA 1URGA 5DVFA 1HSEA 2H9BA 3BBRA 3H6VA 1B1XA 4FIMA 4QFKA 1QW0A 2V25A 5FHMA 2I0BA 1PB8A 3RGYA 2HZKA 3KBRA 1GGGA 1YPNA 3A3UA 3O28A 4P0IA 4MLVA 1MY3A 3PD8A 4O3CA 1CE2A 3MPLA 4TQUQ 1NMUA 4LZ5A 3ILUB 4R6HA 4F31B 5L9SA 1UTBA 4NWDA 2IEEA 5AA4A 1FTJA 4GIZA 1QKBA 2XX8A 4RK2A 1B3HA 4FECA 4NF4A 4R6YA 4ZDMA 4IO5A 1USYE 4IGTA 2VHAA 3OO6A 2V3UA 3LSLA 2A5TA 1PB9A 3DRHA 1IXGA 3DM0A 2ZNTA 3MZ9A 1H3DA 2XD3A 2HAVA 4LZ7A 3MQ9A 3E3KA 3TELA 5H8HA 4KPTA 1H43A 1ELJA 4JSOA 3JYRA 5TP9B 4F1VA 3FIRA 4ZZAA 3SKPA 3TDJA 2CMOA 2NUVA 3DRIA 3K1NA 3IB0A 2YPNA 4GXAA 3FUZA 3C35A 3N94A 2PT2A 3R7XA 3S9NC 3U93A 2GFEA 4EXKA 2D5WA 2DE2A 4EDPA 3N6TA 1PBQA 2H5YA 3H7MA 3T9HB 4YB7A 3T9XB 4ZE9A 2Y7RA 5J1DA 1FQDA 4FATA 4ELQA 5LOMA 3TODA 3PUWE 3TKDA 3LUYA 4OXVA 2XXIA 5KCJB 1D9YA 3QUJA 4O3BA 1Y1MA 5I57A 1RKMA 4RPNA 4KI0E 4LONB 1SW2A 4TOZA 1B05A 3KJ7A 3H6TA 2OZZA 4GLIA 4YZZA 3RTWB 5CRYA 3L6GA 1D4NA 1B46A 3G7WA 1OQHA 2F7AA 3N26A 2REJA 4WEPA 1UTBB 1N0TA 5AA4B 1FTKA 2QMWA 1Y3NA 2UVGA 4BDNA 3CFXA 2WKYA 3V8XB 4YKPA 2LAOA 2ONKE 4POWA 4OQOA 3VV5A 2A5SA 4P0GA 2I3WA 4NF4B 5ITOA 5L9MA 4U22A 5TU0A 3HN0A 4FORA 2O7IA 3PV0E 4PFTA 1B9JA 3U1OA 4OFLA 1LGBC 2A5TB 5BUUA 5CMCA 5I59A 4NF6B 1B4HA 3HPIA 2XX7A 3H4ZA 3GXAA 2XXRA 2Q89A 1WVJA 3IL1B 1UIVA 2F7BA 4OTEA 3TPAA 1P1OA 2O51A 1SYHA 4G68B 2ONRA 5I2NB 3FV1A 2VP1A 2Z8DA 2VOZA 5KZTA 4RJZA 2QL3A 4LQ2A 2RC8A 2WOLA 1FQCA 4XKRA 3AXFA 3IB1A 3FJGA 3VVDA 4HCWA 3UIFA 1NNKA 5JK4A 1AH5A 3VLVA 3MUQA 4ONYA 4WEDA 1ZBMA 3C31A 3TZAA 3T22A 3SEWA 3O2AA 1B2HA 1OMPA 1POY1 3H06B 1NKXA 3RYBA 1QJMA 5ITPA 1I6QA 4O3AA 1NL5A 1A7LA 3Q27A 3SEXA 3RY3A 1MDP1 1B52A 3B7DA 1L5TA 4AB5A 4DXCA 5TPAA 3F11A 3KGCA 1JW5A 3SEVA 3OO8A 3T66A 3PUXE 3G3GA 2Z22A 5KDTA 4RK9A 4BDRA 2Y7KA 2XXXA 2QS1A 2QSXA 4G4PA 1PC3A 4ELRA 4BDLA 1MDQA 4I1DA 2I48A 3Q25A 3V5AA 1SYIA 5AA2A 1MQHA 1ZU0A 3K00A 2Y7IA 2XXYA 2KLFA 4YKIA 2D3IA 2H4IA 4ND9A 5H8FA 4LZ8A 1MXUA 2ZYOA 3KG2A 4PFUA 2DWJA 2DXYA 2F36A 4DZ1A 5HBCA 3VLWA 4OYVA 1R9QA 3M3FA 4PETA 1XVXA 1VE4A 2Z8FA 1Y4TA 3PPRA 3RN8A 3TMGA 4F19A 1LCTA 1YCJA 2Q88A 2DVZA 3TQWA 2DWAA 2XX9A 4YMBA 5JEIA 4HCYA 4DXBA 1B0HA 2G29A 2AL4A 1EZPA 3RT8A 3OEKA 3R26A 3OXNA 1EU8A 3D4GA 4ECFA 4GOTA 3QUFA 3TCHA 3TFLA 3SESA 5F1QA 1MXZA 1P1WA 3UORA 4QSCA 4R9GA 3THIA 1NNTA 4TLMB 1DPPA 1NH7A 4DLDA 4TLLB 3QSLA 1DMBA 1BTJA 4OESA 3LVUA 1FCKA 1MM6A 3U94A 4PFYA 3DRFA 1MH4A 1ZMGA 2O68A 3CRBA 3TTMA 4IO6A 4ESWA 5A5XA 2NWJA 4KD5A 5EHMA 3EF7A 1LCFA 1FW0A 1EZOA 4P11A 4U4XA 4ZZEA 1VFEA 3CI8A 1IITA 1MG1A 4G8MA 4LATA 4QFLA 3IJXB 2F7CA 3OENA 5ICQA 2F5XA 4GFRA 4R2FA 3RUMA 3MJNA 1XT8A 3TQLA 1HSLA 4MF3A 2PBWA 2H25A 3OELA 2O1LA 1EH3A 3U92A 2O6AA 3CFLA 1H44A 1TWYA 4F1YA 3G3KA 1UTHA 3EHUA 3VFJA 5AA2B 3ONMA 2I0CA 3S9EA 4IO7A 3EHTA 3T93B 1B58A 4ZEKA 3UGWA 4KCCA 1JEUA 3RQTA 1LBBA 1WDNA 2FA7A 3RTFB 4QF9A 5DT6A 1YAEA 3M3LA 4GQOA 4LA9A 1B5IA 1OLCA 3K1PA 1IXHA 3SEYA 3C4MA 3C9HA 3PGFA 2OBGA 3IOWA 2THIA 1B0LA 3CSGA 3K6UA 1NNFA 4F3PA 3MVXA 1A8FA 2F78A 4AQ4A 3PMWA 2OK2A 3OSQA 3I5OA 3SDFA 4F2OA 3GBAA 3PUZE 4EXLA 1TFAA 2VD2A 2ABHA 4IB2A 1JEVA 2O1MA 3TCFA 2XXWA 3RYAA 1MY1A 2V3TA 1XOCA 2OLBA 1XHYA 1OIBA 3LBSA 4C0RA 3MAMA 1OVTA 3SERA 2E1SA 1AL3A 1D9VA 5IKBA 4RYAA 2DVCA 3ZKLA 5I58A 1Y20A 1A54A 1MQJA 2BJJX 3OO7A 3S9LC 3Q26A 3K1MA 5B70A 1B7HA 3TTNA 4XIGQ 3R6UA 5I2KB 3IX1A 4YKKA 5IAIA 1QUIA 3N6UA 3E9XA 1SQYA 4H6DA 4ZECA 3FJMA 3VVFA 2QMXA 3C33A 2REGA 2PYYA 2R9JA 1Y4CA 2F6GA 3IOUA 4F39A 3B6WA 4H8JA 5B7DA 2B4LA 5DVIA 3WAFA 3EN3A 4H67A 4H65A 3PD9A 1PBPA 4FEDA 1POTA 3EQ1A 3CIJA 3HHGA 1JETA 5H8QB 1QUJA 4F29A 4NF5B 2V3QA 2HCAA 4F3SA 1M5DA 5HPQA 4QSEA 2DXRA 3KN3A 3DRGA 2ONSA 3EPEA 5AE4A 4ZE8A 4R73A 4F18A 2H99A 4I9DA 3GLBA 2Z8EA 4GVOA 3ODBA 2OWTA 3W15C 1FQEA 1MPBA 4FE8A 1MQGA 4EQ9A 3S2VA 3FASA 3H03A 2YJPA 1PEBA 2Y7PA 2UYEA 1N3XA 4PP0A 1N7XA 1RYOA 3KSJA 4Q5TA 1TFDA 5CMMA 4G77A 2ANJA 5FHNA 2OWSA 2P1SA 1IXCA 1O7TA 3RNNA 5M2VA 2XXQA 1WODA 4OEUA 3FXRA 5I58B 3IK6B 2PVUA 4U1OA 3OEMA 4YKJA 1GVCA 1US5A 1LLSA 4G2ZA 1I6AA 1B32A 4I8CA 5H8NA 4NEDA 3K6VA 4DCYA 1R1NA 1FQAA 3ZSFA 1JVXA 2R71A 3MBPA 3T9UA 1XVYA 3K6WA 2DQVA 5H8HB 3FVKA 4U2RA 4E0WA 4FAJA 4R9FA 3FXQA 3IO4A 2HZLA 4ISUA 1N3WA 1B3FA 3TTKA 3B6QA 4HS7A 1URSA 4KCDA 1SW4A 2G93A 4NWCA 1HSJA 4H1XA 3OD7A 3I3VA 1A55A 3CSBA 2F34A 3MVWA 4XTCQ 4F3GA 1LSTA 3QYTA 1IZ1A 1JQFA 4KYSA 3TEPA 2HAUA 4X9TA 4ZS9A 2DSFA 4H5GA 4JSDA 5ICTA 3OO9A 5K2XA 3PUYE 2I3VA 5I57B 3CR9A 2X26A 2QS2A 4ZEIA 4THIA 4OERA 4FEBA 3O6IA 3K0VA 1M5CA 2M8CA 5CI5A 2ZXTA 2V93A 4Z0IA 3FD3A 5JTYA 3H3GA 1TT1A 2VGQA 2Z23A 1BLFA 3O97A 1DPEA 3A3CA 4OENA 2X7PA 2ZNUA 3MVYA 1P1QA 3QIMA 3DP6A 2FYIA 4ZEBA 2RC7A 3WAEA 4G8HA 1VFDA 1QUKA 1Q35A 5CBSA 2DE4A 1N76A 1N84A 1SDXA 1ZJLA 2I4BA 4Z7EA 2NXOA 4GL0A 3P7IA 4YB6A 5I59B 2F35A 4DXUA 4UACA 1IXIA 4LQ5A 3TUSA 1B4ZA 1AOVA 3LSXA 1I69A 1Y1ZA 3W9WA 2B3FA 4X1BA 5DVJA 3VLUA 1LB9A 2F97A 1EZ9A 2ZMBA 4ESXA 4F1UA 1QULA 1D3KA 1CB6A 3A09A 4XKPA 1BP5A 1MXVA 1B40A 2V84A 1B5HA 3KOSA 3IORA 1B3GA 1O63A 4OETA 2QS3A 3HSTA 1B3LA 4YB5A 2XHDA 3UP9A 2UVJA 4BDOA 1LB8A 3KFMA 2XXHA 4F22A 4H8IA 5CC2A 2YLNA 2UYFA 3BKIB 3PAMA 1SD3A 2NOOA 3UK4A 2NVUB 4E0XA 4DCXA 3FVNA 3T9VA 1URDA 1US4A 3FV2A 4OHNA 2I49A 2E0SA 4LUBA 5TPAB 2RINA 4RY1A 1SI1A 4WKMA 4JWYA 4ZEDA 3TAJA 3I6VA 3O6PA 5KDTB 1LFHA 1NNPA 2GHBA 4JDFA 3RLFE 2QS4A 5FTHA 3GBBA 4JBZA 1S9TA 2ZNSA 3HCQA 2Y7WA 3ZKKA 3HHFA 4R75A 4H0WA 4AB6A 4RNSA 1ZLQA 3HO7A 3MP6A 4C1UA 4OVJA 2P2AA 1MS7A 5TP9A 5H8FB 1SVXB 4G8NA 2XXUA 3FGSA 1F9BA 4Q8RA 5ELVA 5CMKA 3IR1A 3L6HA 4R74A 3DLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UQW A;  2WOK A;  2ESN A;  3SET A;  3MP1 A;  4KYE A;  4OFO A;  4KR5 A;  1LAX A;  3MW0 A;  2RC9 A;  2UVH A;  4BDM A;  4R72 A;  3VXC A;  3GZG A;  1IIW A;  5KCJ A;  2GRV A;  5L9O A;  4GL8 A;  4IO3 A;  1T0K A;  4R2B A;  3LR1 A;  2B65 A;  3PU5 A;  1J1N A;  3OSR A;  2AYS A;  3IOV A;  4XKQ A;  3VDF A;  3T96 B;  1MQD A;  3UN6 A;  1VSO A;  1DOT A;  3PMV A;  3RPW A;  2DWH A;  4X1D A;  4OMB A;  4KYD A;  5EHS A;  1OQG A;  4YU0 A;  3BFU A;  1Y3P A;  5I56 A;  1DTZ A;  4NF8 A;  2OCU A;  3G3F A;  3DP8 A;  3SEU A;  5A5X B;  4UA8 A;  1JVY A;  1LAH E;  1SW1 A;  3TYH A;  1A8E A;  2HFB A;  2D21 A;  1MXX A;  4X48 A;  4OFJ A;  4EF2 A;  3USD A;  4JB7 A;  2AL5 A;  4KQP A;  1JW1 A;  5DTB A;  3ILT B;  3CFZ A;  4GD5 A;  2XD2 A;  2ZYN A;  4WXJ A;  4NF6 A;  2RF1 A;  1R6Z A;  2UXA A;  1MXY A;  3MVZ A;  1ZKB A;  1UTH B;  4L17 A;  1MPD A;  4KHZ E;  2ZYK A;  4MFI A;  2DE3 A;  4G68 A;  5I2N A;  2R6G E;  3O6G A;  5EYF A;  3KEI A;  1IEJ A;  1Y9U A;  1MM7 A;  4U23 A;  1OLA A;  1BIY A;  3MC2 A;  2F6P A;  3G3J A;  1PDA A;  4QFP A;  1VR5 A;  5DEX A;  2DOJ A;  1B5J A;  3EHS A;  4MH5 A;  2HEU A;  1SW5 A;  3FJ7 A;  2DP8 A;  3O6H A;  2OJT A;  3JZJ A;  3PPP A;  4QHQ A;  4QFN A;  1O64 A;  1QKA A;  1LBC A;  1H45 A;  1BKA A;  1MH3 A;  1IQ7 A;  2GHA A;  3E4R A;  2RCA A;  3V83 A;  1IUD A;  1Y3Q A;  2O84 X;  2VD3 A;  3MZB A;  1DSN A;  3M8U A;  1Z7M E;  3FTO A;  3PMX A;  4Q30 B;  3PPO A;  1ZIU A;  4F3B A;  4GXS B;  2DWI A;  4F2Q A;  4EUO A;  1FQB A;  5FTI A;  3CG1 A;  2XXT A;  1H76 A;  5H8S A;  3IB2 A;  4ELO A;  3JV9 A;  2W7Y A;  3S4U A;  1LAG E;  3V89 B;  3C36 A;  3D4C A;  1N7W A;  2H98 A;  5I56 B;  4N13 A;  4NF8 B;  5ISU A;  4NTL A;  1LFI A;  4YAH X;  4HTG A;  5K2Y A;  4I62 A;  3K4U A;  3ECR A;  2X7Q A;  3IO6 A;  2P0S A;  4PFW A;  4RPO A;  1UIU A;  2Y84 A;  4GRK A;  1FTO A;  3TTR A;  3PPN A;  2UVI A;  1KWH A;  3Q29 A;  4IO4 A;  4OEV A;  5AA1 A;  4EQ7 A;  2HXW A;  1MY2 A;  3CHG A;  1ZTY A;  2Q2C A;  1ATG A;  4ELP A;  4YIC A;  1GTK A;  4Q0C A;  4C1T A;  1YTV A;  1GR2 A;  1Q1K A;  3IOT A;  4IY6 A;  4XXU A;  4JWO A;  5F7V A;  1N04 A;  2RCB A;  4NMY A;  2B4M A;  4ZEF A;  2WOP A;  3M3K A;  3G3I A;  4LVQ A;  2CZL A;  3VXB A;  1M5E A;  4M4G A;  5DEX B;  5CBR A;  1FTM A;  3MWB A;  2ALU A;  1JNF A;  2AIX A;  3RT6 B;  3TTL A;  1NH8 A;  2I6E A;  4MBP A;  5DYH A;  3HV1 A;  3FVG A;  4QSD A;  4GF8 A;  3KOT A;  4MLQ A;  1ANF A;  3DP4 A;  4G68 C;  1B7U A;  4XKN A;  3K6X A;  3KZG A;  1FTL A;  4U4S A;  1AIV A;  3G3H A;  1JW4 A;  3MPK A;  1S7Y A;  3IAZ A;  2PX1 A;  4LP2 B;  3CVG A;  4IGR A;  4JXI A;  1NFT A;  1SI0 A;  3QAX A;  3ZS6 A;  2QRY A;  5CMB A;  3QXM A;  1XC1 A;  4QRZ A;  1RYX A;  4JWX A;  3DRK A;  3W9V A;  3B6T A;  1II5 A;  1MPC A;  3H6U A;  3IJO B;  2O7U A;  1MRP A;  4M1V A;  4OZ9 A;  3KSX A;  5AA3 A;  5AA2 D;  5H8N B;  2DS9 A;  1DTG A;  5L8D A;  3BFT A;  1SBP A;  4EF1 A;  3KN8 A;  3LSW A;  1P99 A;  3LC8 A;  4YMA A;  2HQ0 A;  4PQJ A;  1LAF E;  3KJT A;  2IA4 A;  3DEL B;  1XS5 A;  1OVB A;  3DRJ A;  5HM4 B;  3MZ1 A;  1P1U A;  1TXF A;  4K3F A;  3C34 A;  1B51 A;  3C32 A;  2B3B A;  4H5F A;  1AMF A;  4BDQ A;  1B3E A;  1GV8 A;  1P1N A;  3TCG A;  1M5F A;  3U8Q A;  3K2D A;  3FXU A;  1MY0 A;  3O29 A;  4U21 A;  4POX A;  4N07 A;  4QFO A;  1A99 A;  1B1H A;  1Z7N E;  3Q28 A;  3OMB A;  3MP8 A;  2FNC A;  1MQI A;  3QK6 A;  4KFQ A;  3U72 A;  4N6P A;  1M5B A;  5I84 A;  4RA1 A;  1LFG A;  1MXW A;  2F8D A;  1PB7 A;  5JTY B;  2I4C A;  2O69 A;  3E13 X;  4FJP A;  5BWJ A;  3K02 A;  5I2K A;  4DE8 A;  2Q8J A;  2QJE A;  3VVE A;  3PUV E;  2PT1 A;  3O9P A;  2ZYM A;  2Q2A A;  5FHO A;  3LSF B;  4HW8 A;  4IY5 A;  3N5L A;  2XXV A;  3FAT A;  4NE4 A;  2RKM A;  4RXL A;  5CM6 A;  1USY H;  2QPQ A;  1S50 A;  3UA8 A;  3PPQ A;  4IO2 A;  1FQF A;  3OOA A;  1A40 A;  3KN7 A;  3S9M C;  3K01 A;  5H8Q A;  2I58 A;  1B7Z A;  4GWO A;  4NF5 A;  4EQB A;  1R9L A;  4OWD A;  1MY4 A;  3VE1 B;  1I6B A;  2DYX A;  4R6K A;  1B6H A;  2PMS A;  3FZV A;  2XXP A;  4PE5 B;  4U1Z A;  4DDD A;  3CG3 A;  4DIG A;  3O66 A;  2GH9 A;  3H6W A;  4BLA A;  1QVS A;  2Q9T A;  3FVO A;  1URG A;  5DVF A;  1HSE A;  2H9B A;  3BBR A;  3H6V A;  1B1X A;  4FIM A;  4QFK A;  1QW0 A;  2V25 A;  5FHM A;  2I0B A;  1PB8 A;  3RGY A;  2HZK A;  3KBR A;  1GGG A;  1YPN A;  3A3U A;  3O28 A;  4P0I A;  4MLV A;  1MY3 A;  3PD8 A;  4O3C A;  1CE2 A;  3MPL A;  4TQU Q;  1NMU A;  4LZ5 A;  3ILU B;  4R6H A;  4F31 B;  5L9S A;  1UTB A;  4NWD A;  2IEE A;  5AA4 A;  1FTJ A;  4GIZ A;  1QKB A;  2XX8 A;  4RK2 A;  1B3H A;  4FEC A;  4NF4 A;  4R6Y A;  4ZDM A;  4IO5 A;  1USY E;  4IGT A;  2VHA A;  3OO6 A;  2V3U A;  3LSL A;  2A5T A;  1PB9 A;  3DRH A;  1IXG A;  3DM0 A;  2ZNT A;  3MZ9 A;  1H3D A;  2XD3 A;  2HAV A;  4LZ7 A;  3MQ9 A;  3E3K A;  3TEL A;  5H8H A;  4KPT A;  1H43 A;  1ELJ A;  4JSO A;  3JYR A;  5TP9 B;  4F1V A;  3FIR A;  4ZZA A;  3SKP A;  3TDJ A;  2CMO A;  2NUV A;  3DRI A;  3K1N A;  3IB0 A;  2YPN A;  4GXA A;  3FUZ A;  3C35 A;  3N94 A;  2PT2 A;  3R7X A;  3S9N C;  3U93 A;  2GFE A;  4EXK A;  2D5W A;  2DE2 A;  4EDP A;  3N6T A;  1PBQ A;  2H5Y A;  3H7M A;  3T9H B;  4YB7 A;  3T9X B;  4ZE9 A;  2Y7R A;  5J1D A;  1FQD A;  4FAT A;  4ELQ A;  5LOM A;  3TOD A;  3PUW E;  3TKD A;  3LUY A;  4OXV A;  2XXI A;  5KCJ B;  1D9Y A;  3QUJ A;  4O3B A;  1Y1M A;  5I57 A;  1RKM A;  4RPN A;  4KI0 E;  4LON B;  1SW2 A;  4TOZ A;  1B05 A;  3KJ7 A;  3H6T A;  2OZZ A;  4GLI A;  4YZZ A;  3RTW B;  5CRY A;  3L6G A;  1D4N A;  1B46 A;  3G7W A;  1OQH A;  2F7A A;  3N26 A;  2REJ A;  4WEP A;  1UTB B;  1N0T A;  5AA4 B;  1FTK A;  2QMW A;  1Y3N A;  2UVG A;  4BDN A;  3CFX A;  2WKY A;  3V8X B;  4YKP A;  2LAO A;  2ONK E;  4POW A;  4OQO A;  3VV5 A;  2A5S A;  4P0G A;  2I3W A;  4NF4 B;  5ITO A;  5L9M A;  4U22 A;  5TU0 A;  3HN0 A;  4FOR A;  2O7I A;  3PV0 E;  4PFT A;  1B9J A;  3U1O A;  4OFL A;  1LGB C;  2A5T B;  5BUU A;  5CMC A;  5I59 A;  4NF6 B;  1B4H A;  3HPI A;  2XX7 A;  3H4Z A;  3GXA A;  2XXR A;  2Q89 A;  1WVJ A;  3IL1 B;  1UIV A;  2F7B A;  4OTE A;  3TPA A;  1P1O A;  2O51 A;  1SYH A;  4G68 B;  2ONR A;  5I2N B;  3FV1 A;  2VP1 A;  2Z8D A;  2VOZ A;  5KZT A;  4RJZ A;  2QL3 A;  4LQ2 A;  2RC8 A;  2WOL A;  1FQC A;  4XKR A;  3AXF A;  3IB1 A;  3FJG A;  3VVD A;  4HCW A;  3UIF A;  1NNK A;  5JK4 A;  1AH5 A;  3VLV A;  3MUQ A;  4ONY A;  4WED A;  1ZBM A;  3C31 A;  3TZA A;  3T22 A;  3SEW A;  3O2A A;  1B2H A;  1OMP A;  1POY 1;  3H06 B;  1NKX A;  3RYB A;  1QJM A;  5ITP A;  1I6Q A;  4O3A A;  1NL5 A;  1A7L A;  3Q27 A;  3SEX A;  3RY3 A;  1MDP 1;  1B52 A;  3B7D A;  1L5T A;  4AB5 A;  4DXC A;  5TPA A;  3F11 A;  3KGC A;  1JW5 A;  3SEV A;  3OO8 A;  3T66 A;  3PUX E;  3G3G A;  2Z22 A;  5KDT A;  4RK9 A;  4BDR A;  2Y7K A;  2XXX A;  2QS1 A;  2QSX A;  4G4P A;  1PC3 A;  4ELR A;  4BDL A;  1MDQ A;  4I1D A;  2I48 A;  3Q25 A;  3V5A A;  1SYI A;  5AA2 A;  1MQH A;  1ZU0 A;  3K00 A;  2Y7I A;  2XXY A;  2KLF A;  4YKI A;  2D3I A;  2H4I A;  4ND9 A;  5H8F A;  4LZ8 A;  1MXU A;  2ZYO A;  3KG2 A;  4PFU A;  2DWJ A;  2DXY A;  2F36 A;  4DZ1 A;  5HBC A;  3VLW A;  4OYV A;  1R9Q A;  3M3F A;  4PET A;  1XVX A;  1VE4 A;  2Z8F A;  1Y4T A;  3PPR A;  3RN8 A;  3TMG A;  4F19 A;  1LCT A;  1YCJ A;  2Q88 A;  2DVZ A;  3TQW A;  2DWA A;  2XX9 A;  4YMB A;  5JEI A;  4HCY A;  4DXB A;  1B0H A;  2G29 A;  2AL4 A;  1EZP A;  3RT8 A;  3OEK A;  3R26 A;  3OXN A;  1EU8 A;  3D4G A;  4ECF A;  4GOT A;  3QUF A;  3TCH A;  3TFL A;  3SES A;  5F1Q A;  1MXZ A;  1P1W A;  3UOR A;  4QSC A;  4R9G A;  3THI A;  1NNT A;  4TLM B;  1DPP A;  1NH7 A;  4DLD A;  4TLL B;  3QSL A;  1DMB A;  1BTJ A;  4OES A;  3LVU A;  1FCK A;  1MM6 A;  3U94 A;  4PFY A;  3DRF A;  1MH4 A;  1ZMG A;  2O68 A;  3CRB A;  3TTM A;  4IO6 A;  4ESW A;  5A5X A;  2NWJ A;  4KD5 A;  5EHM A;  3EF7 A;  1LCF A;  1FW0 A;  1EZO A;  4P11 A;  4U4X A;  4ZZE A;  1VFE A;  3CI8 A;  1IIT A;  1MG1 A;  4G8M A;  4LAT A;  4QFL A;  3IJX B;  2F7C A;  3OEN A;  5ICQ A;  2F5X A;  4GFR A;  4R2F A;  3RUM A;  3MJN A;  1XT8 A;  3TQL A;  1HSL A;  4MF3 A;  2PBW A;  2H25 A;  3OEL A;  2O1L A;  1EH3 A;  3U92 A;  2O6A A;  3CFL A;  1H44 A;  1TWY A;  4F1Y A;  3G3K A;  1UTH A;  3EHU A;  3VFJ A;  5AA2 B;  3ONM A;  2I0C A;  3S9E A;  4IO7 A;  3EHT A;  3T93 B;  1B58 A;  4ZEK A;  3UGW A;  4KCC A;  1JEU A;  3RQT A;  1LBB A;  1WDN A;  2FA7 A;  3RTF B;  4QF9 A;  5DT6 A;  1YAE A;  3M3L A;  4GQO A;  4LA9 A;  1B5I A;  1OLC A;  3K1P A;  1IXH A;  3SEY A;  3C4M A;  3C9H A;  3PGF A;  2OBG A;  3IOW A;  2THI A;  1B0L A;  3CSG A;  3K6U A;  1NNF A;  4F3P A;  3MVX A;  1A8F A;  2F78 A;  4AQ4 A;  3PMW A;  2OK2 A;  3OSQ A;  3I5O A;  3SDF A;  4F2O A;  3GBA A;  3PUZ E;  4EXL A;  1TFA A;  2VD2 A;  2ABH A;  4IB2 A;  1JEV A;  2O1M A;  3TCF A;  2XXW A;  3RYA A;  1MY1 A;  2V3T A;  1XOC A;  2OLB A;  1XHY A;  1OIB A;  3LBS A;  4C0R A;  3MAM A;  1OVT A;  3SER A;  2E1S A;  1AL3 A;  1D9V A;  5IKB A;  4RYA A;  2DVC A;  3ZKL A;  5I58 A;  1Y20 A;  1A54 A;  1MQJ A;  2BJJ X;  3OO7 A;  3S9L C;  3Q26 A;  3K1M A;  5B70 A;  1B7H A;  3TTN A;  4XIG Q;  3R6U A;  5I2K B;  3IX1 A;  4YKK A;  5IAI A;  1QUI A;  3N6U A;  3E9X A;  1SQY A;  4H6D A;  4ZEC A;  3FJM A;  3VVF A;  2QMX A;  3C33 A;  2REG A;  2PYY A;  2R9J A;  1Y4C A;  2F6G A;  3IOU A;  4F39 A;  3B6W A;  4H8J A;  5B7D A;  2B4L A;  5DVI A;  3WAF A;  3EN3 A;  4H67 A;  4H65 A;  3PD9 A;  1PBP A;  4FED A;  1POT A;  3EQ1 A;  3CIJ A;  3HHG A;  1JET A;  5H8Q B;  1QUJ A;  4F29 A;  4NF5 B;  2V3Q A;  2HCA A;  4F3S A;  1M5D A;  5HPQ A;  4QSE A;  2DXR A;  3KN3 A;  3DRG A;  2ONS A;  3EPE A;  5AE4 A;  4ZE8 A;  4R73 A;  4F18 A;  2H99 A;  4I9D A;  3GLB A;  2Z8E A;  4GVO A;  3ODB A;  2OWT A;  3W15 C;  1FQE A;  1MPB A;  4FE8 A;  1MQG A;  4EQ9 A;  3S2V A;  3FAS A;  3H03 A;  2YJP A;  1PEB A;  2Y7P A;  2UYE A;  1N3X A;  4PP0 A;  1N7X A;  1RYO A;  3KSJ A;  4Q5T A;  1TFD A;  5CMM A;  4G77 A;  2ANJ A;  5FHN A;  2OWS A;  2P1S A;  1IXC A;  1O7T A;  3RNN A;  5M2V A;  2XXQ A;  1WOD A;  4OEU A;  3FXR A;  5I58 B;  3IK6 B;  2PVU A;  4U1O A;  3OEM A;  4YKJ A;  1GVC A;  1US5 A;  1LLS A;  4G2Z A;  1I6A A;  1B32 A;  4I8C A;  5H8N A;  4NED A;  3K6V A;  4DCY A;  1R1N A;  1FQA A;  3ZSF A;  1JVX A;  2R71 A;  3MBP A;  3T9U A;  1XVY A;  3K6W A;  2DQV A;  5H8H B;  3FVK A;  4U2R A;  4E0W A;  4FAJ A;  4R9F A;  3FXQ A;  3IO4 A;  2HZL A;  4ISU A;  1N3W A;  1B3F A;  3TTK A;  3B6Q A;  4HS7 A;  1URS A;  4KCD A;  1SW4 A;  2G93 A;  4NWC A;  1HSJ A;  4H1X A;  3OD7 A;  3I3V A;  1A55 A;  3CSB A;  2F34 A;  3MVW A;  4XTC Q;  4F3G A;  1LST A;  3QYT A;  1IZ1 A;  1JQF A;  4KYS A;  3TEP A;  2HAU A;  4X9T A;  4ZS9 A;  2DSF A;  4H5G A;  4JSD A;  5ICT A;  3OO9 A;  5K2X A;  3PUY E;  2I3V A;  5I57 B;  3CR9 A;  2X26 A;  2QS2 A;  4ZEI A;  4THI A;  4OER A;  4FEB A;  3O6I A;  3K0V A;  1M5C A;  2M8C A;  5CI5 A;  2ZXT A;  2V93 A;  4Z0I A;  3FD3 A;  5JTY A;  3H3G A;  1TT1 A;  2VGQ A;  2Z23 A;  1BLF A;  3O97 A;  1DPE A;  3A3C A;  4OEN A;  2X7P A;  2ZNU A;  3MVY A;  1P1Q A;  3QIM A;  3DP6 A;  2FYI A;  4ZEB A;  2RC7 A;  3WAE A;  4G8H A;  1VFD A;  1QUK A;  1Q35 A;  5CBS A;  2DE4 A;  1N76 A;  1N84 A;  1SDX A;  1ZJL A;  2I4B A;  4Z7E A;  2NXO A;  4GL0 A;  3P7I A;  4YB6 A;  5I59 B;  2F35 A;  4DXU A;  4UAC A;  1IXI A;  4LQ5 A;  3TUS A;  1B4Z A;  1AOV A;  3LSX A;  1I69 A;  1Y1Z A;  3W9W A;  2B3F A;  4X1B A;  5DVJ A;  3VLU A;  1LB9 A;  2F97 A;  1EZ9 A;  2ZMB A;  4ESX A;  4F1U A;  1QUL A;  1D3K A;  1CB6 A;  3A09 A;  4XKP A;  1BP5 A;  1MXV A;  1B40 A;  2V84 A;  1B5H A;  3KOS A;  3IOR A;  1B3G A;  1O63 A;  4OET A;  2QS3 A;  3HST A;  1B3L A;  4YB5 A;  2XHD A;  3UP9 A;  2UVJ A;  4BDO A;  1LB8 A;  3KFM A;  2XXH A;  4F22 A;  4H8I A;  5CC2 A;  2YLN A;  2UYF A;  3BKI B;  3PAM A;  1SD3 A;  2NOO A;  3UK4 A;  2NVU B;  4E0X A;  4DCX A;  3FVN A;  3T9V A;  1URD A;  1US4 A;  3FV2 A;  4OHN A;  2I49 A;  2E0S A;  4LUB A;  5TPA B;  2RIN A;  4RY1 A;  1SI1 A;  4WKM A;  4JWY A;  4ZED A;  3TAJ A;  3I6V A;  3O6P A;  5KDT B;  1LFH A;  1NNP A;  2GHB A;  4JDF A;  3RLF E;  2QS4 A;  5FTH A;  3GBB A;  4JBZ A;  1S9T A;  2ZNS A;  3HCQ A;  2Y7W A;  3ZKK A;  3HHF A;  4R75 A;  4H0W A;  4AB6 A;  4RNS A;  1ZLQ A;  3HO7 A;  3MP6 A;  4C1U A;  4OVJ A;  2P2A A;  1MS7 A;  5TP9 A;  5H8F B;  1SVX B;  4G8N A;  2XXU A;  3FGS A;  1F9B A;  4Q8R A;  5ELV A;  5CMK A;  3IR1 A;  3L6H A;  4R74 A;  3DLN A; 
#chains in the Genus database with same CATH topology
 1UQW A;  2WOK A;  1AWB A;  2ESN A;  3SET A;  3MP1 A;  1NV6 A;  4KYE A;  4OFO A;  4KR5 A;  1FJ6 A;  1LAX A;  3MW0 A;  2RC9 A;  2UVH A;  4BDM A;  4R72 A;  3VXC A;  3GZG A;  1IIW A;  5KCJ A;  2GRV A;  5L9O A;  4GL8 A;  4IO3 A;  1T0K A;  4R2B A;  3LR1 A;  2B65 A;  3PU5 A;  1J1N A;  3OSR A;  2AYS A;  3IOV A;  4XKQ A;  3VDF A;  3T96 B;  1MQD A;  3UN6 A;  5I5P A;  1VSO A;  1DOT A;  3PMV A;  3RPW A;  2DWH A;  4X1D A;  4OMB A;  2Q74 A;  4KYD A;  5EHS A;  1OQG A;  4YU0 A;  4OVT A;  3BFU A;  1Y3P A;  5I56 A;  1DTZ A;  4NF8 A;  2OCU A;  3G3F A;  3DP8 A;  3SEU A;  5A5X B;  4UA8 A;  1JVY A;  1LAH E;  1SW1 A;  3TYH A;  1A8E A;  2HFB A;  1LBX A;  2D21 A;  1JP4 A;  1MXX A;  4X48 A;  5EYG A;  4OFJ A;  4EF2 A;  3USD A;  5F24 A;  4JB7 A;  2AL5 A;  4KQP A;  1JW1 A;  5DTB A;  3ILT B;  3CFZ A;  4GD5 A;  5EQA A;  2XD2 A;  2ZYN A;  4WXJ A;  1IME A;  4UAB A;  4NF6 A;  2RF1 A;  1R6Z A;  2UXA A;  1MXY A;  3MVZ A;  1ZKB A;  5EQ9 A;  1UTH B;  4L17 A;  5DW8 A;  1MPD A;  4KHZ E;  2ZYK A;  4MFI A;  2DE3 A;  4G68 A;  1IMD A;  5I2N A;  2R6G E;  3O6G A;  5EYF A;  3KEI A;  1IEJ A;  1Y9U A;  1EYJ A;  1MM7 A;  4U23 A;  1OLA A;  1BIY A;  3MC2 A;  2F6P A;  3G3J A;  1PDA A;  4QFP A;  1VR5 A;  5DEX A;  2DOJ A;  1B5J A;  4O8M A;  1NUY A;  4JVC A;  5ET6 A;  3EHS A;  4MH5 A;  3A29 A;  3EKI A;  2HEU A;  1SW5 A;  3FJ7 A;  2DP8 A;  3O6H A;  2OJT A;  3JZJ A;  4MNC A;  3PPP A;  4QHQ A;  4QFN A;  4H46 A;  1O64 A;  2FIE A;  1QKA A;  1LBC A;  1H45 A;  1BKA A;  4PF8 A;  1MH3 A;  1IQ7 A;  2GHA A;  3E4R A;  2RCA A;  3V83 A;  1IUD A;  1Y3Q A;  2O84 X;  2VD3 A;  3MZB A;  1DSN A;  3M8U A;  1NV1 A;  1Z7M E;  4Q30 B;  3FTO A;  2WBB A;  3PMX A;  4O7I A;  3PPO A;  1NV0 A;  5FBP A;  1ZIU A;  2FVZ A;  4F3B A;  4GXS B;  2DWI A;  4F2Q A;  1FQB A;  5FTI A;  4EUO A;  3CG1 A;  2XXT A;  3T1B A;  1H76 A;  5H8S A;  3IB2 A;  4ELO A;  3JV9 A;  2W7Y A;  5T3J A;  3S4U A;  1LAG E;  3V89 B;  3C36 A;  4P3L A;  3D4C A;  1N7W A;  2H98 A;  5I56 B;  4OA4 A;  4N13 A;  4NF8 B;  1LBZ A;  5ISU A;  4NTL A;  1LFI A;  4YAH X;  4HTG A;  5K2Y A;  4I62 A;  3K4U A;  3ECR A;  4PDH A;  2X7Q A;  3IO6 A;  2P0S A;  4PFW A;  4RPO A;  1UIU A;  2Y84 A;  5A5L A;  4GRK A;  1FTO A;  3TTR A;  4MNI A;  3PPN A;  2UVI A;  1KWH A;  3Q29 A;  4IO4 A;  4OEV A;  5AA1 A;  4EQ7 A;  1K9Z A;  2HXW A;  2MKZ A;  1MY2 A;  3CHG A;  1Q9D A;  1ZTY A;  2Q2C A;  1ATG A;  4ELP A;  4NGU A;  4YIC A;  1GTK A;  4Q0C A;  4C1T A;  1YTV A;  4MCO A;  4AS4 A;  1GR2 A;  3KC0 A;  1Q1K A;  3IOT A;  4IY6 A;  1INP A;  4XXU A;  4JWO A;  5F7V A;  1N04 A;  2RCB A;  4NMY A;  2B4M A;  4GWW A;  4ZEF A;  2WOP A;  3M3K A;  3G3I A;  4LVQ A;  2CZL A;  3VXB A;  1M5E A;  4M4G A;  5DEX B;  5CBR A;  1FTM A;  3MWB A;  2ALU A;  1JNF A;  2AIX A;  3RT6 B;  3TTL A;  1NH8 A;  2I6E A;  4MBP A;  1NV3 A;  5DYH A;  3HV1 A;  3FVG A;  4QSD A;  4GF8 A;  3SZP A;  4OVP A;  3KOT A;  4MLQ A;  1VDW A;  1ANF A;  3DP4 A;  4G68 C;  1B7U A;  4XKN A;  5ET7 A;  3K6X A;  3KZG A;  1FTL A;  4U4S A;  4OAN A;  2VPN A;  1AIV A;  3G3H A;  1JW4 A;  3MPK A;  1S7Y A;  3IAZ A;  2PX1 A;  4LP2 B;  3CVG A;  4IGR A;  3D1R A;  4JXI A;  1NFT A;  1SI0 A;  3QAX A;  3ZS6 A;  2QRY A;  5CMB A;  4PAK A;  3QXM A;  1XC1 A;  4NG7 A;  4QRZ A;  1FRP A;  1RYX A;  4PF6 A;  4JWX A;  3DRK A;  3W9V A;  3B6T A;  1II5 A;  1MPC A;  3H6U A;  3IJO B;  4P1E A;  4PGP A;  2O7U A;  1MRP A;  4M1V A;  4OZ9 A;  4N8G A;  3KSX A;  5AA3 A;  5AA2 D;  5H8N B;  2DS9 A;  3GYY A;  1FPK A;  1DTG A;  5L8D A;  1YYZ A;  3BFT A;  1SBP A;  1LBV A;  5IM2 A;  4EF1 A;  3KN8 A;  2HXR A;  3LSW A;  1P99 A;  3LC8 A;  4XFE A;  4YMA A;  2HQ0 A;  4PQJ A;  1LAF E;  3KJT A;  2IA4 A;  3DEL B;  1XS5 A;  1OVB A;  3DRJ A;  5HM4 B;  3MZ1 A;  1P1U A;  1TXF A;  4K3F A;  3C34 A;  1B51 A;  3C32 A;  2B3B A;  4H5F A;  1AMF A;  4BDQ A;  1B3E A;  4PE3 A;  1GV8 A;  4FBP A;  1P1N A;  1FBC A;  3TCG A;  1M5F A;  4O7M A;  3U8Q A;  3K2D A;  3FXU A;  4I40 A;  1MY0 A;  3O29 A;  4U21 A;  4POX A;  4JVD A;  1EYI A;  4N07 A;  1XI6 A;  4QFO A;  4GWX A;  4N91 A;  1A99 A;  1B1H A;  1Z7N E;  3Q28 A;  2QFL A;  3OMB A;  3MP8 A;  2FNC A;  1MQI A;  3QK6 A;  4KFQ A;  4P9K A;  3U72 A;  4N6P A;  1M5B A;  5I84 A;  4RA1 A;  1LFG A;  2XWI A;  3FBP A;  1MXW A;  2F8D A;  1PB7 A;  5JTY B;  2I4C A;  2O69 A;  2QVV A;  4GWZ A;  3E13 X;  4FJP A;  1NV7 A;  5BWJ A;  3K02 A;  2ZZX A;  5I2K A;  4DE8 A;  2Q8J A;  2QJE A;  3VVE A;  3PUV E;  2PT1 A;  3O9P A;  2ZYM A;  2Q2A A;  5FHO A;  4N15 A;  3LSF B;  4HW8 A;  4IY5 A;  3N5L A;  2XXV A;  3FAT A;  4NE4 A;  1YZ0 A;  2RKM A;  4RXL A;  5CM6 A;  1USY H;  2QPQ A;  1S50 A;  3UA8 A;  3PPQ A;  4MJO A;  2V4C A;  4IO2 A;  4DI4 B;  1FQF A;  1LEV A;  3OOA A;  1A40 A;  3KN7 A;  4PFB A;  3S9M C;  3K01 A;  5H8Q A;  2I58 A;  1B7Z A;  4X04 A;  4GWO A;  4NF5 A;  4EQB A;  1R9L A;  4OWD A;  1MY4 A;  1NV5 A;  3VE1 B;  1I6B A;  2DYX A;  4R6K A;  2OWZ A;  1B6H A;  2PMS A;  3FZV A;  2XXP A;  4PE5 B;  4U1Z A;  4DDD A;  3CG3 A;  3RYD A;  4DIG A;  3O66 A;  2GH9 A;  3H6W A;  4BLA A;  1QVS A;  2Q9T A;  4PDD A;  3FVO A;  1FBP A;  1URG A;  5DVF A;  1HSE A;  2H9B A;  3BBR A;  5LDZ A;  3H6V A;  1B1X A;  4FIM A;  4QFK A;  1QW0 A;  2V25 A;  5FHM A;  2I0B A;  1PB8 A;  3RGY A;  2HZK A;  1NV2 A;  3KBR A;  1GGG A;  1YPN A;  3A3U A;  3O28 A;  4P0I A;  4MLV A;  1MY3 A;  3PD8 A;  4O3C A;  1CE2 A;  3MPL A;  4TQU Q;  1NMU A;  4LZ5 A;  1EYK A;  3ILU B;  2DDK A;  4HE0 A;  4R6H A;  1FJ9 A;  4F31 B;  5L9S A;  1UTB A;  4NWD A;  2IEE A;  5AA4 A;  1FPI A;  1FTJ A;  4GIZ A;  1QKB A;  2XX8 A;  1IMF A;  4RK2 A;  1B3H A;  3QMF A;  4FEC A;  4NF4 A;  4R6Y A;  4ZDM A;  2Y5L A;  4IO5 A;  1USY E;  4IGT A;  2VHA A;  4GWS A;  3ROJ A;  3OO6 A;  2V3U A;  3LSL A;  2A5T A;  4HXV A;  1PB9 A;  3DRH A;  1IXG A;  3DM0 A;  2ZNT A;  3MZ9 A;  3BIH A;  1H3D A;  2XD3 A;  1FPD A;  3RPL A;  2HAV A;  4LZ7 A;  4I3Y A;  3MQ9 A;  3E3K A;  3TEL A;  5H8H A;  2CEX A;  4KPT A;  4OVQ A;  1H43 A;  4H45 A;  2OX3 A;  1ELJ A;  4JSO A;  3JYR A;  5TP9 B;  4F1V A;  3FIR A;  4ZZA A;  2P3N A;  3SKP A;  3TDJ A;  2JJK A;  2CMO A;  2NUV A;  3DRI A;  3K1N A;  3IB0 A;  2YPN A;  4GXA A;  3FUZ A;  3C35 A;  3N94 A;  2Y5K A;  4MEV A;  2PT2 A;  3R7X A;  3S9N C;  3U93 A;  2GFE A;  4EXK A;  2D5W A;  2DE2 A;  4EDP A;  3N6T A;  4PC9 A;  1PBQ A;  2H5Y A;  3H7M A;  4GBW A;  3T9H B;  4YB7 A;  3T9X B;  4ZE9 A;  2Y7R A;  5J1D A;  1FQD A;  4FAT A;  4ELQ A;  5LOM A;  3TOD A;  3BIG A;  3PUW E;  3TKD A;  3LUY A;  4OXV A;  2XXI A;  5KCJ B;  4X8R A;  4LN5 A;  1D9Y A;  3QUJ A;  4O3B A;  1Y1M A;  5I57 A;  4GBV A;  1RKM A;  4RPN A;  4KI0 E;  4LON B;  4GWY A;  1SW2 A;  4TOZ A;  1B05 A;  3KJ7 A;  3H6T A;  2OZZ A;  4GLI A;  4YZZ A;  3RTW B;  5CRY A;  3L6G A;  1D4N A;  1B46 A;  1K9Y A;  3G7W A;  1QGX A;  1OQH A;  2F7A A;  3N26 A;  4I3E A;  2VPO A;  5ESY A;  1RDY A;  2REJ A;  4WEP A;  1UTB B;  1N0T A;  1LBW A;  5AA4 B;  1FTK A;  2QMW A;  1Y3N A;  2UVG A;  4GX4 A;  4BDN A;  3CFX A;  2WKY A;  3V8X B;  4YKP A;  2LAO A;  4MHF A;  2ONK E;  1RDZ A;  4POW A;  5IZ3 A;  4OQO A;  3VV5 A;  2A5S A;  4P0G A;  2BJI A;  5EQ7 A;  2I3W A;  4NF4 B;  5ITO A;  5L9M A;  4U22 A;  1G0I A;  5TU0 A;  3HN0 A;  4FOR A;  2O7I A;  2KQZ A;  4JVI A;  3PV0 E;  4PFT A;  1B9J A;  4PGN A;  3U1O A;  4OFL A;  1LGB C;  2A5T B;  5BUU A;  5CMC A;  5I59 A;  4NF6 B;  1B4H A;  3HPI A;  2XX7 A;  3H4Z A;  3GXA A;  2XXR A;  2Q89 A;  3RPL B;  1WVJ A;  3IL1 B;  1UIV A;  2F7B A;  4OTE A;  3TPA A;  1P1O A;  2O51 A;  1SYH A;  4G68 B;  2ONR A;  5I2N B;  3FV1 A;  2VP1 A;  4NN3 A;  2Z8D A;  2VOZ A;  5KZT A;  4OVR A;  4RJZ A;  2QL3 A;  4LQ2 A;  2RC8 A;  2WOL A;  1FQC A;  4XKR A;  3AXF A;  3IB1 A;  3FJG A;  3VVD A;  4HCW A;  3UIF A;  1DBZ A;  1NNK A;  5JK4 A;  1AH5 A;  3VLV A;  3MUQ A;  4ONY A;  4WED A;  1ZBM A;  3C31 A;  3TZA A;  1FBH A;  3T22 A;  3SEW A;  3O2A A;  4PBQ A;  4MNP A;  2F3D A;  1B2H A;  2FHY A;  2ZZW A;  1OMP A;  1NUX A;  1POY 1;  4QBA A;  3H06 B;  1NKX A;  3RYB A;  1QJM A;  5ITP A;  1I6Q A;  4O3A A;  1NL5 A;  2F3B A;  1A7L A;  3Q27 A;  3SEX A;  3RY3 A;  1MDP 1;  1B52 A;  3B7D A;  4GWU A;  1L5T A;  4AB5 A;  4DXC A;  5TPA A;  3F11 A;  3KGC A;  1JW5 A;  3SEV A;  3OO8 A;  1LBY A;  3T66 A;  3PUX E;  3G3G A;  2Z22 A;  5KDT A;  4RK9 A;  4BDR A;  5IZZ A;  2Y7K A;  2XXX A;  2QS1 A;  2QSX A;  3FXB A;  4G4P A;  1PC3 A;  4ELR A;  4BDL A;  2WX9 A;  1MDQ A;  4I1D A;  4GX6 A;  4MMP A;  5IZ3 B;  2I48 A;  3Q25 A;  3V5A A;  1SYI A;  4OVS A;  4PFI A;  1MQH A;  1ZU0 A;  3K00 A;  5AA2 A;  2CEY A;  2Y7I A;  2XXY A;  2KLF A;  4YKI A;  1SPI A;  2D3I A;  2H4I A;  4ND9 A;  5H8F A;  4LZ8 A;  1MXU A;  2ZYO A;  3KG2 A;  4PFU A;  2DWJ A;  2DXY A;  2F36 A;  4DZ1 A;  5HBC A;  3VLW A;  4OYV A;  1R9Q A;  3M3F A;  4PET A;  1XVX A;  1VE4 A;  2Z8F A;  4NQ8 A;  1Y4T A;  3PPR A;  3RN8 A;  3TMG A;  4F19 A;  5I7I A;  1LCT A;  3T0J A;  1YCJ A;  2Q88 A;  2DVZ A;  3TQW A;  2WEF A;  2DWA A;  2XX9 A;  4YMB A;  5JEI A;  4HCY A;  1FPJ A;  1B0H A;  4DXB A;  2G29 A;  1FPG A;  2AL4 A;  2WYK A;  1EZP A;  3RT8 A;  3OEK A;  3R26 A;  1EU8 A;  3OXN A;  3D4G A;  4ECF A;  4GOT A;  1RDX A;  3QUF A;  3TCH A;  3TFL A;  3SES A;  5F1Q A;  3U65 A;  1MXZ A;  1P1W A;  4N17 A;  4P47 A;  3UOR A;  4QXD A;  4QSC A;  4R9G A;  3THI A;  1NNT A;  4P56 A;  4TLM B;  1FSA A;  1DPP A;  1NH7 A;  4DLD A;  4TLL B;  3QSL A;  1DMB A;  1BTJ A;  4OES A;  3LVU A;  1FCK A;  1MM6 A;  3U94 A;  4PFY A;  3DRF A;  3HFU A;  1MH4 A;  1ZMG A;  2O68 A;  4PTK A;  2PFZ A;  3CRB A;  3TTM A;  4IO6 A;  4ESW A;  1DK4 A;  5A5X A;  2XWK A;  2NWJ A;  4KD5 A;  4DI3 D;  5EHM A;  3EF7 A;  1LCF A;  1FW0 A;  2ZZV A;  4P1L A;  1EZO A;  4P11 A;  2XWV A;  4U4X A;  4ZZE A;  3LUZ A;  1VFE A;  3CI8 A;  1IIT A;  1MG1 A;  1FBE A;  4G8M A;  4LAT A;  4QFL A;  3IJX B;  2F7C A;  3OEN A;  5ICQ A;  2F5X A;  4GFR A;  4R2F A;  3RUM A;  3MJN A;  1XT8 A;  3TQL A;  1HSL A;  5IZ1 A;  1KA1 A;  4MF3 A;  2PBW A;  2H25 A;  2QVU A;  3OEL A;  2O1L A;  1EH3 A;  3U92 A;  4HE2 A;  2HPG A;  2O6A A;  3CFL A;  1H44 A;  1TWY A;  4F1Y A;  3G3K A;  1UTH A;  3EHU A;  3VFJ A;  5AA2 B;  3ONM A;  2I0C A;  3S9E A;  4IO7 A;  3EHT A;  3T93 B;  1B58 A;  4ZEK A;  3UGW A;  4KCC A;  1JEU A;  3RQT A;  1LBB A;  1WDN A;  2FA7 A;  3RTF B;  4QF9 A;  5DT6 A;  1YAE A;  3M3L A;  4GQO A;  4LA9 A;  1B5I A;  1OLC A;  3LV0 A;  3K1P A;  1IXH A;  3SEY A;  3C4M A;  3C9H A;  3PGF A;  2OBG A;  2FIX A;  3IOW A;  2THI A;  4HE1 A;  1B0L A;  3CSG A;  3K6U A;  4XEQ A;  1NNF A;  4F3P A;  3MVX A;  1A8F A;  4PAF A;  2F78 A;  4AQ4 A;  3PMW A;  1FPB A;  2OK2 A;  3OSQ A;  3I5O A;  3SDF A;  4F2O A;  3GBA A;  3PUZ E;  4EXL A;  4P8B A;  1TFA A;  2VD2 A;  2HHM A;  2ABH A;  1IMC A;  4IB2 A;  1JEV A;  2O1M A;  1NV4 A;  3TCF A;  4XF5 A;  2XXW A;  3RYA A;  1MY1 A;  2V3T A;  1XOC A;  2OLB A;  1XHY A;  1OIB A;  3LBS A;  4C0R A;  3MAM A;  1OVT A;  3SER A;  1FPL A;  2E1S A;  1AL3 A;  1D9V A;  5IKB A;  4RYA A;  2DVC A;  2WYP A;  3ZKL A;  5ET5 A;  5I58 A;  5LTC A;  1Y20 A;  1A54 A;  1MQJ A;  2QVR A;  2BJJ X;  3OO7 A;  3S9L C;  2KR0 A;  3Q26 A;  4N4U A;  3K1M A;  4N8Y A;  5B70 A;  1B7H A;  3TTN A;  4XIG Q;  3R6U A;  3IX1 A;  4YKK A;  5I2K B;  4N81 A;  1QUI A;  5IAI A;  3N6U A;  3E9X A;  1SQY A;  3E79 A;  4H6D A;  3B50 A;  4ZEC A;  4KXP A;  3FJM A;  3VVF A;  1D9Q A;  2QMX A;  3C33 A;  2REG A;  2PYY A;  2R9J A;  1Y4C A;  2F6G A;  3IOU A;  4F39 A;  2VT5 A;  3B6W A;  4H8J A;  5B7D A;  1NUW A;  1KA0 A;  2B4L A;  5DVI A;  4PAI A;  3WAF A;  4MAG A;  3EN3 A;  4H67 A;  4H65 A;  3PD9 A;  1PBP A;  4FED A;  1POT A;  3EQ1 A;  3CIJ A;  3HHG A;  1JET A;  5H8Q B;  1QUJ A;  4F29 A;  3MYU A;  4NF5 B;  5ET8 A;  2V3Q A;  2HCA A;  4F3S A;  1NUZ A;  3ISP A;  1M5D A;  3IFC A;  5HPQ A;  4QSE A;  3KBZ A;  2DXR A;  3KN3 A;  3DRG A;  4O94 A;  4NF0 A;  2ONS A;  3EPE A;  5AE4 A;  4ZE8 A;  4PFR A;  4R73 A;  4NHB A;  4F18 A;  2H99 A;  1FTA A;  4I9D A;  3GLB A;  4PBH A;  2Z8E A;  4GVO A;  3ODB A;  2OWT A;  3W15 C;  1FQE A;  3E78 A;  1FBD A;  4GX3 A;  1MPB A;  4FE8 A;  1MQG A;  4EQ9 A;  2FBP A;  3S2V A;  3FAS A;  3H03 A;  1BK4 A;  2YJP A;  3MST A;  1PEB A;  2Y7P A;  1IMB A;  4N6D A;  2UYE A;  3PTY A;  1N3X A;  4PP0 A;  1N7X A;  1RYO A;  3KSJ A;  4Q5T A;  1TFD A;  5CMM A;  4G77 A;  2ANJ A;  5FHN A;  2OWS A;  2P1S A;  1IXC A;  1O7T A;  3RNN A;  5EYH A;  5M2V A;  2XXQ A;  1WOD A;  4OEU A;  3FXR A;  5I58 B;  3IK6 B;  2PVU A;  4U1O A;  3OEM A;  4YKJ A;  1GVC A;  1US5 A;  1LLS A;  4G2Z A;  1I6A A;  4IR8 A;  1B32 A;  4I8C A;  1CNQ A;  5H8N A;  4NED A;  3K6V A;  4DCY A;  1R1N A;  1FQA A;  3ZSF A;  1JVX A;  4PCD A;  4NAP A;  4N6K A;  2R71 A;  3MBP A;  3T9U A;  1XVY A;  3K6W A;  2DQV A;  5H8H B;  3FVK A;  4U2R A;  4E0W A;  4FAJ A;  4R9F A;  3FXQ A;  2GQ1 A;  1FPE A;  3IO4 A;  2HZL A;  4ISU A;  1N3W A;  1B3F A;  3TTK A;  3B6Q A;  4HS7 A;  1URS A;  4KCD A;  1SW4 A;  2G93 A;  1FBF A;  1G0H A;  4NWC A;  1HSJ A;  4H1X A;  3OD7 A;  3I3V A;  1A55 A;  3CSB A;  4MIJ A;  4G61 A;  2F34 A;  3MVW A;  4XTC Q;  4F3G A;  1LST A;  3QYT A;  1IZ1 A;  1JQF A;  2CZI A;  4KYS A;  3TEP A;  2HAU A;  4X9T A;  5EQ8 A;  5J16 A;  4ZS9 A;  2DSF A;  4H5G A;  4JSD A;  5ICT A;  3OO9 A;  5K2X A;  3PUY E;  4NX1 A;  2I3V A;  5I57 B;  3CR9 A;  2X26 A;  2QS2 A;  1IMA A;  4ZEI A;  4THI A;  4OER A;  4FEB A;  3O6I A;  3K0V A;  1M5C A;  2M8C A;  5CI5 A;  2ZXT A;  2V93 A;  4Z0I A;  3FD3 A;  5JTY A;  3H3G A;  1TT1 A;  2VGQ A;  2Z23 A;  3IFA A;  1BLF A;  3O97 A;  1DPE A;  2P3V A;  3A3C A;  4OEN A;  2X7P A;  2ZNU A;  3MVY A;  1P1Q A;  3QIM A;  3DP6 A;  2FYI A;  1DCU A;  4ZEB A;  2RC7 A;  3WAE A;  4G8H A;  5I3S A;  2XA5 A;  1VFD A;  1QUK A;  3B8B A;  1Q35 A;  5CBS A;  2DE4 A;  1N76 A;  1N84 A;  1SDX A;  1ZJL A;  2I4B A;  4Z7E A;  2NXO A;  4GL0 A;  3P7I A;  4YB6 A;  5I59 B;  2F35 A;  2Q8M A;  4DXU A;  4UAC A;  1IXI A;  4LQ5 A;  3TUS A;  1B4Z A;  1AOV A;  3LSX A;  1I69 A;  1Y1Z A;  1YXI A;  3W9W A;  2B3F A;  4X1B A;  2R8T A;  5DVJ A;  3VLU A;  1LB9 A;  2F97 A;  2PCR A;  1EZ9 A;  4MX6 A;  2ZMB A;  4ESX A;  4F1U A;  1QUL A;  1D3K A;  2XXK A;  1CB6 A;  3A09 A;  4XKP A;  1BP5 A;  1MXV A;  1B40 A;  2V84 A;  1B5H A;  3KOS A;  2CZH A;  3IOR A;  1B3G A;  1O63 A;  4OET A;  2QS3 A;  3HST A;  1B3L A;  4YB5 A;  2L5V A;  2XHD A;  3UP9 A;  2UVJ A;  4BDO A;  1LB8 A;  3KFM A;  2XXH A;  2CZK A;  4F22 A;  4H8I A;  5CC2 A;  2YLN A;  2UYF A;  3BKI B;  3PAM A;  1SD3 A;  2NOO A;  3UK4 A;  2XWO A;  2NVU B;  4E0X A;  4DCX A;  3FVN A;  3T9V A;  1FBG A;  1URD A;  1US4 A;  3FV2 A;  4OHN A;  2I49 A;  2WBD A;  2E0S A;  4LUB A;  5TPA B;  1KZ8 A;  2RIN A;  4RY1 A;  1SI1 A;  4WKM A;  4AS5 A;  4JWY A;  4ZED A;  3TAJ A;  3I6V A;  3KC1 A;  3O6P A;  1NI9 A;  5KDT B;  1LFH A;  1NNP A;  2GHB A;  4JDF A;  3RLF E;  2QS4 A;  3NOH A;  5FTH A;  3GBB A;  4JBZ A;  1S9T A;  2ZNS A;  3HCQ A;  2Y7W A;  3ZKK A;  3HHF A;  4R75 A;  4H0W A;  4AB6 A;  1FPF A;  1ZLQ A;  4RNS A;  3HO7 A;  5IGA A;  3MP6 A;  4C1U A;  4OVJ A;  2P2A A;  2PFY A;  1MS7 A;  5TP9 A;  5H8F B;  1SVX B;  4G8N A;  2XXU A;  3FGS A;  1F9B A;  4Q8R A;  5ELV A;  5CMK A;  3IR1 A;  3L6H A;  4R74 A;  3DLN A; 
#chains in the Genus database with same CATH homology
 1UQW A;  2WOK A;  2ESN A;  3SET A;  3MP1 A;  4KYE A;  4OFO A;  4KR5 A;  1LAX A;  3MW0 A;  2RC9 A;  2UVH A;  4BDM A;  4R72 A;  3VXC A;  3GZG A;  1IIW A;  5KCJ A;  2GRV A;  5L9O A;  4GL8 A;  4IO3 A;  1T0K A;  4R2B A;  3LR1 A;  2B65 A;  3PU5 A;  1J1N A;  3OSR A;  2AYS A;  3IOV A;  4XKQ A;  3VDF A;  3T96 B;  1MQD A;  3UN6 A;  1VSO A;  1DOT A;  3PMV A;  3RPW A;  2DWH A;  4X1D A;  4OMB A;  4KYD A;  5EHS A;  1OQG A;  4YU0 A;  3BFU A;  1Y3P A;  5I56 A;  1DTZ A;  4NF8 A;  2OCU A;  3G3F A;  3DP8 A;  3SEU A;  5A5X B;  4UA8 A;  1JVY A;  1LAH E;  1SW1 A;  3TYH A;  1A8E A;  2HFB A;  2D21 A;  1MXX A;  4X48 A;  4OFJ A;  4EF2 A;  3USD A;  4JB7 A;  2AL5 A;  4KQP A;  1JW1 A;  5DTB A;  3ILT B;  3CFZ A;  4GD5 A;  2XD2 A;  2ZYN A;  4WXJ A;  4NF6 A;  2RF1 A;  1R6Z A;  2UXA A;  1MXY A;  3MVZ A;  1ZKB A;  1UTH B;  4L17 A;  1MPD A;  4KHZ E;  2ZYK A;  4MFI A;  2DE3 A;  4G68 A;  5I2N A;  2R6G E;  3O6G A;  5EYF A;  3KEI A;  1IEJ A;  1Y9U A;  1MM7 A;  4U23 A;  1OLA A;  1BIY A;  3MC2 A;  2F6P A;  3G3J A;  1PDA A;  4QFP A;  1VR5 A;  5DEX A;  2DOJ A;  1B5J A;  3EHS A;  4MH5 A;  2HEU A;  1SW5 A;  3FJ7 A;  2DP8 A;  3O6H A;  2OJT A;  3JZJ A;  3PPP A;  4QHQ A;  4QFN A;  1O64 A;  1QKA A;  1LBC A;  1H45 A;  1BKA A;  1MH3 A;  1IQ7 A;  2GHA A;  3E4R A;  2RCA A;  3V83 A;  1IUD A;  1Y3Q A;  2O84 X;  2VD3 A;  3MZB A;  1DSN A;  3M8U A;  1Z7M E;  3FTO A;  3PMX A;  4Q30 B;  3PPO A;  1ZIU A;  4F3B A;  4GXS B;  2DWI A;  4F2Q A;  4EUO A;  1FQB A;  5FTI A;  3CG1 A;  2XXT A;  1H76 A;  5H8S A;  3IB2 A;  4ELO A;  3JV9 A;  2W7Y A;  3S4U A;  1LAG E;  3V89 B;  3C36 A;  3D4C A;  1N7W A;  2H98 A;  5I56 B;  4N13 A;  4NF8 B;  5ISU A;  4NTL A;  1LFI A;  4YAH X;  4HTG A;  5K2Y A;  4I62 A;  3K4U A;  3ECR A;  2X7Q A;  3IO6 A;  2P0S A;  4PFW A;  4RPO A;  1UIU A;  2Y84 A;  4GRK A;  1FTO A;  3TTR A;  3PPN A;  2UVI A;  1KWH A;  3Q29 A;  4IO4 A;  4OEV A;  5AA1 A;  4EQ7 A;  2HXW A;  1MY2 A;  3CHG A;  1ZTY A;  2Q2C A;  1ATG A;  4ELP A;  4YIC A;  1GTK A;  4Q0C A;  4C1T A;  1YTV A;  1GR2 A;  1Q1K A;  3IOT A;  4IY6 A;  4XXU A;  4JWO A;  5F7V A;  1N04 A;  2RCB A;  4NMY A;  2B4M A;  4ZEF A;  2WOP A;  3M3K A;  3G3I A;  4LVQ A;  2CZL A;  3VXB A;  1M5E A;  4M4G A;  5DEX B;  5CBR A;  1FTM A;  3MWB A;  2ALU A;  1JNF A;  2AIX A;  3RT6 B;  3TTL A;  1NH8 A;  2I6E A;  4MBP A;  5DYH A;  3HV1 A;  3FVG A;  4QSD A;  4GF8 A;  3KOT A;  4MLQ A;  1ANF A;  3DP4 A;  4G68 C;  1B7U A;  4XKN A;  3K6X A;  3KZG A;  1FTL A;  4U4S A;  1AIV A;  3G3H A;  1JW4 A;  3MPK A;  1S7Y A;  3IAZ A;  2PX1 A;  4LP2 B;  3CVG A;  4IGR A;  4JXI A;  1NFT A;  1SI0 A;  3QAX A;  3ZS6 A;  2QRY A;  5CMB A;  3QXM A;  1XC1 A;  4QRZ A;  1RYX A;  4JWX A;  3DRK A;  3W9V A;  3B6T A;  1II5 A;  1MPC A;  3H6U A;  3IJO B;  2O7U A;  1MRP A;  4M1V A;  4OZ9 A;  3KSX A;  5AA3 A;  5AA2 D;  5H8N B;  2DS9 A;  1DTG A;  5L8D A;  3BFT A;  1SBP A;  4EF1 A;  3KN8 A;  3LSW A;  1P99 A;  3LC8 A;  4YMA A;  2HQ0 A;  4PQJ A;  1LAF E;  3KJT A;  2IA4 A;  3DEL B;  1XS5 A;  1OVB A;  3DRJ A;  5HM4 B;  3MZ1 A;  1P1U A;  1TXF A;  4K3F A;  3C34 A;  1B51 A;  3C32 A;  2B3B A;  4H5F A;  1AMF A;  4BDQ A;  1B3E A;  1GV8 A;  1P1N A;  3TCG A;  1M5F A;  3U8Q A;  3K2D A;  3FXU A;  1MY0 A;  3O29 A;  4U21 A;  4POX A;  4N07 A;  4QFO A;  1A99 A;  1B1H A;  1Z7N E;  3Q28 A;  3OMB A;  3MP8 A;  2FNC A;  1MQI A;  3QK6 A;  4KFQ A;  3U72 A;  4N6P A;  1M5B A;  5I84 A;  4RA1 A;  1LFG A;  1MXW A;  2F8D A;  1PB7 A;  5JTY B;  2I4C A;  2O69 A;  3E13 X;  4FJP A;  5BWJ A;  3K02 A;  5I2K A;  4DE8 A;  2Q8J A;  2QJE A;  3VVE A;  3PUV E;  2PT1 A;  3O9P A;  2ZYM A;  2Q2A A;  5FHO A;  3LSF B;  4HW8 A;  4IY5 A;  3N5L A;  2XXV A;  3FAT A;  4NE4 A;  2RKM A;  4RXL A;  5CM6 A;  1USY H;  2QPQ A;  1S50 A;  3UA8 A;  3PPQ A;  4IO2 A;  1FQF A;  3OOA A;  1A40 A;  3KN7 A;  3S9M C;  3K01 A;  5H8Q A;  2I58 A;  1B7Z A;  4GWO A;  4NF5 A;  4EQB A;  1R9L A;  4OWD A;  1MY4 A;  3VE1 B;  1I6B A;  2DYX A;  4R6K A;  1B6H A;  2PMS A;  3FZV A;  2XXP A;  4PE5 B;  4U1Z A;  4DDD A;  3CG3 A;  4DIG A;  3O66 A;  2GH9 A;  3H6W A;  4BLA A;  1QVS A;  2Q9T A;  3FVO A;  1URG A;  5DVF A;  1HSE A;  2H9B A;  3BBR A;  3H6V A;  1B1X A;  4FIM A;  4QFK A;  1QW0 A;  2V25 A;  5FHM A;  2I0B A;  1PB8 A;  3RGY A;  2HZK A;  3KBR A;  1GGG A;  1YPN A;  3A3U A;  3O28 A;  4P0I A;  4MLV A;  1MY3 A;  3PD8 A;  4O3C A;  1CE2 A;  3MPL A;  4TQU Q;  1NMU A;  4LZ5 A;  3ILU B;  4R6H A;  4F31 B;  5L9S A;  1UTB A;  4NWD A;  2IEE A;  5AA4 A;  1FTJ A;  4GIZ A;  1QKB A;  2XX8 A;  4RK2 A;  1B3H A;  4FEC A;  4NF4 A;  4R6Y A;  4ZDM A;  4IO5 A;  1USY E;  4IGT A;  2VHA A;  3OO6 A;  2V3U A;  3LSL A;  2A5T A;  1PB9 A;  3DRH A;  1IXG A;  3DM0 A;  2ZNT A;  3MZ9 A;  1H3D A;  2XD3 A;  2HAV A;  4LZ7 A;  3MQ9 A;  3E3K A;  3TEL A;  5H8H A;  4KPT A;  1H43 A;  1ELJ A;  4JSO A;  3JYR A;  5TP9 B;  4F1V A;  3FIR A;  4ZZA A;  3SKP A;  3TDJ A;  2CMO A;  2NUV A;  3DRI A;  3K1N A;  3IB0 A;  2YPN A;  4GXA A;  3FUZ A;  3C35 A;  3N94 A;  2PT2 A;  3R7X A;  3S9N C;  3U93 A;  2GFE A;  4EXK A;  2D5W A;  2DE2 A;  4EDP A;  3N6T A;  1PBQ A;  2H5Y A;  3H7M A;  3T9H B;  4YB7 A;  3T9X B;  4ZE9 A;  2Y7R A;  5J1D A;  1FQD A;  4FAT A;  4ELQ A;  5LOM A;  3TOD A;  3PUW E;  3TKD A;  3LUY A;  4OXV A;  2XXI A;  5KCJ B;  1D9Y A;  3QUJ A;  4O3B A;  1Y1M A;  5I57 A;  1RKM A;  4RPN A;  4KI0 E;  4LON B;  1SW2 A;  4TOZ A;  1B05 A;  3KJ7 A;  3H6T A;  2OZZ A;  4GLI A;  4YZZ A;  3RTW B;  5CRY A;  3L6G A;  1D4N A;  1B46 A;  3G7W A;  1OQH A;  2F7A A;  3N26 A;  2REJ A;  4WEP A;  1UTB B;  1N0T A;  5AA4 B;  1FTK A;  2QMW A;  1Y3N A;  2UVG A;  4BDN A;  3CFX A;  2WKY A;  3V8X B;  4YKP A;  2LAO A;  2ONK E;  4POW A;  4OQO A;  3VV5 A;  2A5S A;  4P0G A;  2I3W A;  4NF4 B;  5ITO A;  5L9M A;  4U22 A;  5TU0 A;  3HN0 A;  4FOR A;  2O7I A;  3PV0 E;  4PFT A;  1B9J A;  3U1O A;  4OFL A;  1LGB C;  2A5T B;  5BUU A;  5CMC A;  5I59 A;  4NF6 B;  1B4H A;  3HPI A;  2XX7 A;  3H4Z A;  3GXA A;  2XXR A;  2Q89 A;  1WVJ A;  3IL1 B;  1UIV A;  2F7B A;  4OTE A;  3TPA A;  1P1O A;  2O51 A;  1SYH A;  4G68 B;  2ONR A;  5I2N B;  3FV1 A;  2VP1 A;  2Z8D A;  2VOZ A;  5KZT A;  4RJZ A;  2QL3 A;  4LQ2 A;  2RC8 A;  2WOL A;  1FQC A;  4XKR A;  3AXF A;  3IB1 A;  3FJG A;  3VVD A;  4HCW A;  3UIF A;  1NNK A;  5JK4 A;  1AH5 A;  3VLV A;  3MUQ A;  4ONY A;  4WED A;  1ZBM A;  3C31 A;  3TZA A;  3T22 A;  3SEW A;  3O2A A;  1B2H A;  1OMP A;  1POY 1;  3H06 B;  1NKX A;  3RYB A;  1QJM A;  5ITP A;  1I6Q A;  4O3A A;  1NL5 A;  1A7L A;  3Q27 A;  3SEX A;  3RY3 A;  1MDP 1;  1B52 A;  3B7D A;  1L5T A;  4AB5 A;  4DXC A;  5TPA A;  3F11 A;  3KGC A;  1JW5 A;  3SEV A;  3OO8 A;  3T66 A;  3PUX E;  3G3G A;  2Z22 A;  5KDT A;  4RK9 A;  4BDR A;  2Y7K A;  2XXX A;  2QS1 A;  2QSX A;  4G4P A;  1PC3 A;  4ELR A;  4BDL A;  1MDQ A;  4I1D A;  2I48 A;  3Q25 A;  3V5A A;  1SYI A;  5AA2 A;  1MQH A;  1ZU0 A;  3K00 A;  2Y7I A;  2XXY A;  2KLF A;  4YKI A;  2D3I A;  2H4I A;  4ND9 A;  5H8F A;  4LZ8 A;  1MXU A;  2ZYO A;  3KG2 A;  4PFU A;  2DWJ A;  2DXY A;  2F36 A;  4DZ1 A;  5HBC A;  3VLW A;  4OYV A;  1R9Q A;  3M3F A;  4PET A;  1XVX A;  1VE4 A;  2Z8F A;  1Y4T A;  3PPR A;  3RN8 A;  3TMG A;  4F19 A;  1LCT A;  1YCJ A;  2Q88 A;  2DVZ A;  3TQW A;  2DWA A;  2XX9 A;  4YMB A;  5JEI A;  4HCY A;  4DXB A;  1B0H A;  2G29 A;  2AL4 A;  1EZP A;  3RT8 A;  3OEK A;  3R26 A;  3OXN A;  1EU8 A;  3D4G A;  4ECF A;  4GOT A;  3QUF A;  3TCH A;  3TFL A;  3SES A;  5F1Q A;  1MXZ A;  1P1W A;  3UOR A;  4QSC A;  4R9G A;  3THI A;  1NNT A;  4TLM B;  1DPP A;  1NH7 A;  4DLD A;  4TLL B;  3QSL A;  1DMB A;  1BTJ A;  4OES A;  3LVU A;  1FCK A;  1MM6 A;  3U94 A;  4PFY A;  3DRF A;  1MH4 A;  1ZMG A;  2O68 A;  3CRB A;  3TTM A;  4IO6 A;  4ESW A;  5A5X A;  2NWJ A;  4KD5 A;  5EHM A;  3EF7 A;  1LCF A;  1FW0 A;  1EZO A;  4P11 A;  4U4X A;  4ZZE A;  1VFE A;  3CI8 A;  1IIT A;  1MG1 A;  4G8M A;  4LAT A;  4QFL A;  3IJX B;  2F7C A;  3OEN A;  5ICQ A;  2F5X A;  4GFR A;  4R2F A;  3RUM A;  3MJN A;  1XT8 A;  3TQL A;  1HSL A;  4MF3 A;  2PBW A;  2H25 A;  3OEL A;  2O1L A;  1EH3 A;  3U92 A;  2O6A A;  3CFL A;  1H44 A;  1TWY A;  4F1Y A;  3G3K A;  1UTH A;  3EHU A;  3VFJ A;  5AA2 B;  3ONM A;  2I0C A;  3S9E A;  4IO7 A;  3EHT A;  3T93 B;  1B58 A;  4ZEK A;  3UGW A;  4KCC A;  1JEU A;  3RQT A;  1LBB A;  1WDN A;  2FA7 A;  3RTF B;  4QF9 A;  5DT6 A;  1YAE A;  3M3L A;  4GQO A;  4LA9 A;  1B5I A;  1OLC A;  3K1P A;  1IXH A;  3SEY A;  3C4M A;  3C9H A;  3PGF A;  2OBG A;  3IOW A;  2THI A;  1B0L A;  3CSG A;  3K6U A;  1NNF A;  4F3P A;  3MVX A;  1A8F A;  2F78 A;  4AQ4 A;  3PMW A;  2OK2 A;  3OSQ A;  3I5O A;  3SDF A;  4F2O A;  3GBA A;  3PUZ E;  4EXL A;  1TFA A;  2VD2 A;  2ABH A;  4IB2 A;  1JEV A;  2O1M A;  3TCF A;  2XXW A;  3RYA A;  1MY1 A;  2V3T A;  1XOC A;  2OLB A;  1XHY A;  1OIB A;  3LBS A;  4C0R A;  3MAM A;  1OVT A;  3SER A;  2E1S A;  1AL3 A;  1D9V A;  5IKB A;  4RYA A;  2DVC A;  3ZKL A;  5I58 A;  1Y20 A;  1A54 A;  1MQJ A;  2BJJ X;  3OO7 A;  3S9L C;  3Q26 A;  3K1M A;  5B70 A;  1B7H A;  3TTN A;  4XIG Q;  3R6U A;  5I2K B;  3IX1 A;  4YKK A;  5IAI A;  1QUI A;  3N6U A;  3E9X A;  1SQY A;  4H6D A;  4ZEC A;  3FJM A;  3VVF A;  2QMX A;  3C33 A;  2REG A;  2PYY A;  2R9J A;  1Y4C A;  2F6G A;  3IOU A;  4F39 A;  3B6W A;  4H8J A;  5B7D A;  2B4L A;  5DVI A;  3WAF A;  3EN3 A;  4H67 A;  4H65 A;  3PD9 A;  1PBP A;  4FED A;  1POT A;  3EQ1 A;  3CIJ A;  3HHG A;  1JET A;  5H8Q B;  1QUJ A;  4F29 A;  4NF5 B;  2V3Q A;  2HCA A;  4F3S A;  1M5D A;  5HPQ A;  4QSE A;  2DXR A;  3KN3 A;  3DRG A;  2ONS A;  3EPE A;  5AE4 A;  4ZE8 A;  4R73 A;  4F18 A;  2H99 A;  4I9D A;  3GLB A;  2Z8E A;  4GVO A;  3ODB A;  2OWT A;  3W15 C;  1FQE A;  1MPB A;  4FE8 A;  1MQG A;  4EQ9 A;  3S2V A;  3FAS A;  3H03 A;  2YJP A;  1PEB A;  2Y7P A;  2UYE A;  1N3X A;  4PP0 A;  1N7X A;  1RYO A;  3KSJ A;  4Q5T A;  1TFD A;  5CMM A;  4G77 A;  2ANJ A;  5FHN A;  2OWS A;  2P1S A;  1IXC A;  1O7T A;  3RNN A;  5M2V A;  2XXQ A;  1WOD A;  4OEU A;  3FXR A;  5I58 B;  3IK6 B;  2PVU A;  4U1O A;  3OEM A;  4YKJ A;  1GVC A;  1US5 A;  1LLS A;  4G2Z A;  1I6A A;  1B32 A;  4I8C A;  5H8N A;  4NED A;  3K6V A;  4DCY A;  1R1N A;  1FQA A;  3ZSF A;  1JVX A;  2R71 A;  3MBP A;  3T9U A;  1XVY A;  3K6W A;  2DQV A;  5H8H B;  3FVK A;  4U2R A;  4E0W A;  4FAJ A;  4R9F A;  3FXQ A;  3IO4 A;  2HZL A;  4ISU A;  1N3W A;  1B3F A;  3TTK A;  3B6Q A;  4HS7 A;  1URS A;  4KCD A;  1SW4 A;  2G93 A;  4NWC A;  1HSJ A;  4H1X A;  3OD7 A;  3I3V A;  1A55 A;  3CSB A;  2F34 A;  3MVW A;  4XTC Q;  4F3G A;  1LST A;  3QYT A;  1IZ1 A;  1JQF A;  4KYS A;  3TEP A;  2HAU A;  4X9T A;  4ZS9 A;  2DSF A;  4H5G A;  4JSD A;  5ICT A;  3OO9 A;  5K2X A;  3PUY E;  2I3V A;  5I57 B;  3CR9 A;  2X26 A;  2QS2 A;  4ZEI A;  4THI A;  4OER A;  4FEB A;  3O6I A;  3K0V A;  1M5C A;  2M8C A;  5CI5 A;  2ZXT A;  2V93 A;  4Z0I A;  3FD3 A;  5JTY A;  3H3G A;  1TT1 A;  2VGQ A;  2Z23 A;  1BLF A;  3O97 A;  1DPE A;  3A3C A;  4OEN A;  2X7P A;  2ZNU A;  3MVY A;  1P1Q A;  3QIM A;  3DP6 A;  2FYI A;  4ZEB A;  2RC7 A;  3WAE A;  4G8H A;  1VFD A;  1QUK A;  1Q35 A;  5CBS A;  2DE4 A;  1N76 A;  1N84 A;  1SDX A;  1ZJL A;  2I4B A;  4Z7E A;  2NXO A;  4GL0 A;  3P7I A;  4YB6 A;  5I59 B;  2F35 A;  4DXU A;  4UAC A;  1IXI A;  4LQ5 A;  3TUS A;  1B4Z A;  1AOV A;  3LSX A;  1I69 A;  1Y1Z A;  3W9W A;  2B3F A;  4X1B A;  5DVJ A;  3VLU A;  1LB9 A;  2F97 A;  1EZ9 A;  2ZMB A;  4ESX A;  4F1U A;  1QUL A;  1D3K A;  1CB6 A;  3A09 A;  4XKP A;  1BP5 A;  1MXV A;  1B40 A;  2V84 A;  1B5H A;  3KOS A;  3IOR A;  1B3G A;  1O63 A;  4OET A;  2QS3 A;  3HST A;  1B3L A;  4YB5 A;  2XHD A;  3UP9 A;  2UVJ A;  4BDO A;  1LB8 A;  3KFM A;  2XXH A;  4F22 A;  4H8I A;  5CC2 A;  2YLN A;  2UYF A;  3BKI B;  3PAM A;  1SD3 A;  2NOO A;  3UK4 A;  2NVU B;  4E0X A;  4DCX A;  3FVN A;  3T9V A;  1URD A;  1US4 A;  3FV2 A;  4OHN A;  2I49 A;  2E0S A;  4LUB A;  5TPA B;  2RIN A;  4RY1 A;  1SI1 A;  4WKM A;  4JWY A;  4ZED A;  3TAJ A;  3I6V A;  3O6P A;  5KDT B;  1LFH A;  1NNP A;  2GHB A;  4JDF A;  3RLF E;  2QS4 A;  5FTH A;  3GBB A;  4JBZ A;  1S9T A;  2ZNS A;  3HCQ A;  2Y7W A;  3ZKK A;  3HHF A;  4R75 A;  4H0W A;  4AB6 A;  4RNS A;  1ZLQ A;  3HO7 A;  3MP6 A;  4C1U A;  4OVJ A;  2P2A A;  1MS7 A;  5TP9 A;  5H8F B;  1SVX B;  4G8N A;  2XXU A;  3FGS A;  1F9B A;  4Q8R A;  5ELV A;  5CMK A;  3IR1 A;  3L6H A;  4R74 A;  3DLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...