1B3GA

Oligo-peptide binding protein (oppa) complexed with kik
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 193
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b3gA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3gA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b3gA02
2B3BA 3BBRA 2ONSA 1VR5A 2F6GA 2OWSA 3TEPA 2H4IA 4BDNA 1DSNA 3OMBA 5ITPA 2OK2A 2UXAA 3Q26A 5TPAA 3K1PA 4G68C 4FIMA 3SEYA 4EF1A 3M3KA 3QSLA 2GH9A 5AE4A 4YKIA 4POXA 1II5A 4C1TA 1R1NA 4R74A 4GLIA 4XIGQ 4YICA 4O3AA 4RPOA 2UVHA 4G8NA 3C4MA 1UIUA 5EYFA 1DPPA 3KG2A 3MZ9A 3VFJA 3PPQA 4HCWA 2PBWA 4EQ9A 5AA4B 4U1ZA 3CR9A 4N6PA 1ATGA 4ISUA 3T66A 3TODA 3IOUA 1LBBA 4IY6A 1MQDA 4NF8B 2HEUA 1N3XA 4RY1A 5AA4A 3K6WA 1CB6A 3UN6A 1ZKBA 1R6ZA 1B05A 4I1DA 3FXUA 2DOJA 3EQ1A 3G3FA 4NF8A 4YAHX 3T9XB 1XC1A 4GIZA 1TXFA 3MBPA 1DTGA 2QS4A 2R9JA 5H8FA 3CFXA 2ANJA 5FTIA 4H8JA 4LATA 1JW5A 3MZBA 2W7YA 1SVXB 2ABHA 5IAIA 4PETA 3O66A 2CZLA 1N84A 2NWJA 2Q89A 3U93A 1FQFA 1XS5A 1Y3NA 3KSXA 4HS7A 3E3KA 4H65A 2DE2A 3N6TA 4LZ5A 1A8EA 1IIWA 2OWTA 4R2FA 2FYIA 3K2DA 2XXTA 3RYAA 3IOVA 4NEDA 4DCYA 1N7WA 4ZEBA 4U4SA 1B3LA 4P0IA 4OEVA 1MPDA 3IR1A 3FVNA 3G3JA 2DQVA 4IY5A 1L5TA 3FJGA 3SEXA 3UP9A 3FGSA 4IO7A 1IUDA 3H6TA 4G68B 4NF5B 2R6GE 3TQWA 1QVSA 3PGFA 2DP8A 5I59B 5KDTB 2DS9A 1USYH 3VVDA 4ZEDA 4JSOA 1EZ9A 4KFQA 3S9EA 4G68A 3ZKKA 4NF5A 4OFOA 3VVEA 4PP0A 1PB9A 4R6YA 3FJMA 5H8SA 1MY3A 5I59A 1B5HA 5KDTA 1B0LA 1Y4CA 4ELRA 1LB9A 1OQGA 4F1YA 4IO6A 4DCXA 4R72A 3LSLA 4MBPA 3MVWA 4F3SA 2NVUB 1B46A 3OO7A 1M5CA 1B7UA 1PBQA 5DVFA 2G93A 3IO4A 4YZZA 1MH3A 2A5SA 5B70A 5DT6A 1FTOA 3DRJA 5DVIA 1GVCA 3K4UA 3R6UA 4BDRA 3Q27A 3C34A 2UYFA 1BTJA 3DP6A 2Q2AA 2VHAA 3UA8A 3O97A 2FA7A 1D4NA 1P1QA 3OENA 4G8HA 2B4LA 5AA3A 2GHAA 2QJEA 4QFLA 2AIXA 3DELB 1OLCA 4X1BA 5JK4A 1O7TA 1LSTA 2XXUA 5DTBA 4NF6B 2RINA 3VDFA 4PFTA 4DZ1A 1R9QA 3TTMA 3MWBA 4ZEKA 1H44A 5AA2D 1QUIA 4NF6A 5A5XB 4OFJA 1GGGA 3MVZA 2UVGA 4DXUA 4F3BA 1B1XA 4OFLA 2D3IA 2XX9A 3M3FA 4G4PA 4F2QA 4ELPA 4X9TA 2Y7PA 4R2BA 1A99A 4F18A 4U2RA 2I4BA 4UA8A 3VXBA 3UGWA 4F1UA 5FTHA 4OESA 4P0GA 3OD7A 4ZDMA 3Q28A 3DP4A 2RCBA 4GQOA 5JTYB 4P11A 1MXWA 3OSQA 3OSRA 4KHZE 2WOLA 1MDP1 3OO8A 5CMKA 1ZTYA 3KZGA 5JTYA 3PMXA 3TUSA 4FECA 4YKJA 5KCJB 5I57B 3OO9A 1I6QA 1PDAA 3B6QA 4DE8A 3LSWA 1DOTA 4JB7A 5I57A 2G29A 1Z7ME 4WKMA 1J1NA 3CHGA 3PPOA 4G77A 1SYIA 5I2NB 2ONRA 2BJJX 2D21A 2RCAA 1FQBA 3PD8A 1VSOA 1IQ7A 1OVTA 2RC8A 2R71A 1MQIA 5H8HB 4LONB 3LVUA 4AB6A 4EXLA 1WODA 3PUXE 1PEBA 3G3KA 1B5JA 3V5AA 3CI8A 1MQHA 5H8HA 4YMBA 2HZLA 3H6WA 2HAUA 1Q1KA 4HTGA 4EXKA 2XHDA 2Q9TA 2WOPA 5CRYA 3BFTA 3ECRA 4ONYA 4KYEA 2XXPA 5AA2B 2E0SA 3K1MA 1N76A 2O7IA 2ESNA 3IB1A 2XD2A 4ESXA 2I3WA 3CIJA 3PUZE 1RYOA 1IXCA 1B3EA 3VLUA 3VLVA 3T22A 4TQUQ 4JXIA 1H76A 2VD3A 1XVXA 2QS2A 2V3UA 4DLDA 3MQ9A 1POTA 2Q2CA 4YU0A 1JNFA 1MY0A 4HCYA 3L6GA 3L6HA 2XXYA 5B7DA 3C35A 5JEIA 3H6UA 2I0BA 2H25A 1FQAA 3HV1A 4Q30B 3CVGA 5L9OA 1NNTA 4JWXA 1LAGE 1RYXA 4OWDA 3G7WA 3TQLA 3Q25A 2OLBA 5FHMA 4XKRA 4H8IA 3G3HA 5M2VA 4PE5B 3RNNA 1IITA 3MVXA 5F1QA 1NNPA 2DE3A 2P2AA 3KN7A 4R75A 4MLQA 2F6PA 3FIRA 3GBAA 1B0HA 4NF4B 1MY2A 1OIBA 3FATA 3MUQA 1B7ZA 2PT1A 1Y1MA 3N94A 3H03A 1FTJA 1S50A 3EN3A 2PT2A 4NF4A 4H0WA 3K6VA 4RYAA 3RT6B 3KOSA 2YJPA 1MS7A 2I6EA 2NOOA 3IO6A 3OEMA 4MF3A 2WOKA 3RN8A 3R7XA 5I58B 4EF2A 5I84A 1BIYA 3DP8A 2IEEA 4TLMB 1XVYA 2DYXA 1B5IA 4ECFA 1MXUA 2O6AA 5I58A 4KCDA 1TFDA 2A5TB 3I3VA 3OO6A 3FXRA 3TMGA 3H6VA 4JSDA 2XXXA 3FZVA 1IXHA 3KJ7A 1LCFA 3SDFA 1EU8A 2QPQA 3T93B 1M5DA 1NMUA 3DRFA 1OVBA 5EHMA 1TWYA 4ZE8A 4EUOA 1UTHB 1ZBMA 5BWJA 4X1DA 2OJTA 2E1SA 4LZ8A 2RC9A 3C32A 4PFYA 3A3UA 1SW4A 1UTHA 4RJZA 4F22A 2I0CA 4N07A 3FASA 3OXNA 3VVFA 1YAEA 4LA9A 1LCTA 1RKMA 3FVGA 2Z23A 3HHGA 3B6TA 3ILUB 1P1OA 2GFEA 4I8CA 2Z8EA 5LOMA 1AIVA 1MRPA 3DRIA 2PVUA 4YB7A 3TCFA 3VV5A 3U1OA 3HSTA 5CMMA 1JW4A 4G8MA 5H8NB 1GR2A 4U21A 4E0WA 4DXCA 1SW5A 4H5FA 3V8XB 4OZ9A 4ZZEA 1QKAA 3P7IA 1JETA 2V25A 2OCUA 2V3QA 3KBRA 4F2OA 2H99A 3KN8A 1B2HA 3IORA 4FEBA 4OERA 4I62A 2M8CA 1B58A 1ZU0A 1JVYA 2ONKE 3W9VA 2I3VA 2UVIA 5DVJA 3R26A 3F11A 4OHNA 4XKPA 2ZNSA 4DDDA 3BKIB 1UQWA 1DTZA 2XXIA 3PUWE 3PUVE 3KGCA 3USDA 3IJXB 4H6DA 4QSCA 1SD3A 2DXRA 4RPNA 3C9HA 5KZTA 1LB8A 4F39A 1QKBA 2F7BA 3FUZA 3RY3A 3MC2A 1M5BA 1B32A 3I6VA 2WKYA 4LUBA 4F1VA 3TFLA 5L8DA 1S9TA 4LVQA 2NUVA 1Z7NE 3KOTA 3U94A 2B65A 2DE4A 1NH8A 1B3HA 3GZGA 3ZSFA 4QHQA 3TAJA 1IXGA 5EHSA 1LFHA 1PC3A 2ZNTA 4GFRA 4WXJA 3H3GA 4U22A 1XHYA 5L9SA 4YB5A 3PD9A 3LBSA 3LR1A 1QULA 3RTWB 1Y20A 3T9UA 3FJ7A 3HCQA 5TU0A 3LC8A 3QK6A 4XKQA 1B7HA 1M5FA 1H43A 1JW1A 1A8FA 5FHOA 4F19A 4C1UA 2O84X 4R73A 4E0XA 3EPEA 3V89B 3DLNA 3HHFA 1I6BA 3H4ZA 1Y3QA 4NWCA 3K6XA 2NXOA 4H1XA 3QYTA 3MP8A 3O6PA 4LQ2A 4F3PA 1A54A 4GOTA 3PV0E 4OEUA 4Q0CA 4LQ5A 4FATA 3E13X 5A5XA 3TCGA 4R6KA 3RT8A 2P1SA 1FTMA 5TP9B 3QUJA 1B4HA 3H06B 2I58A 2XXQA 1A7LA 4QRZA 5AA1A 1B4ZA 2Z8DA 2Q8JA 4F3GA 2DVCA 3MZ1A 1MY4A 5TP9A 3LUYA 1WVJA 3CFLA 2ALUA 5I56B 3D4CA 3TTLA 1LGBC 4QF9A 2F78A 1B40A 3FVKA 3IB2A 2Q88A 3PAMA 1PBPA 1NL5A 5FHNA 1AOVA 4OXVA 1NNFA 1N3WA 3RPWA 4OVJA 3PPPA 1MXYA 1B6HA 1GTKA 1SQYA 4Q8RA 1OLAA 5KCJA 5K2YA 3O6IA 2HCAA 5ELVA 3CG1A 2YLNA 5CM6A 3PMWA 4BLAA 3T9VA 2AL4A 4H67A 2V84A 4RK2A 3EF7A 3VLWA 1Y3PA 3S9MC 5ITOA 1B3FA 4ESWA 2Z22A 1B52A 4GD5A 1D9VA 4ZEIA 1UIVA 4R9FA 4ELQA 1BLFA 5I2NA 4EDPA 2F5XA 2Z8FA 2QSXA 3MJNA 3MPKA 5DEXB 3B6WA 2QS1A 3OEKA 1JEUA 3MAMA 2ZMBA 5CBSA 3S9NC 1Y4TA 3KN3A 1IXIA 4GRKA 5DEXA 1N7XA 3IL1B 4RNSA 3D4GA 4H5GA 2XXHA 4RXLA 3TZAA 4YKKA 5AA2A 3CSGA 1NKXA 3LSFB 1AL3A 4TLLB 4NWDA 1FQEA 4WEDA 1HSEA 4IO3A 2O68A 4GF8A 4U1OA 5ICTA 4Z0IA 4OQOA 4KYDA 3U92A 3MPLA 2UYEA 3QAXA 4ELOA 2I4CA 5HM4B 1F9BA 3T9HB 3TPAA 3IB0A 4OMBA 3MW0A 3EHSA 4L17A 1MQGA 4FJPA 4QFKA 3OOAA 4BDQA 3TELA 1I69A 3PMVA 2DVZA 1LFGA 3KEIA 2KLFA 1NFTA 1FCKA 2REJA 3OELA 2ZYKA 4NE4A 4G2ZA 1P99A 1OQHA 4ZS9A 5HBCA 1TFAA 2REGA 3GBBA 3TKDA 2H5YA 3N6UA 2DWJA 1JQFA 1QW0A 5TPAB 2OZZA 4MFIA 4X48A 3KFMA 4K3FA 3ZS6A 3TTRA 3ODBA 3PPNA 3G3IA 2OBGA 1M5EA 2PMSA 5I2KB 3FTOA 3C33A 3SEUA 2UVJA 1EZPA 3CSBA 2VP1A 1VFDA 3VXCA 4FAJA 3FV2A 3FVOA 5I2KA 1MQJA 4KCCA 2O7UA 2VD2A 1MY1A 3KJTA 2B4MA 3O9PA 2YPNA 1A55A 4KPTA 3CRBA 1AMFA 1D9YA 4BDMA 3HPIA 2AL5A 4IO4A 3IJOB 4XKNA 3THIA 5BUUA 4DIGA 3DM0A 3K02A 4QSDA 4N13A 2HXWA 3WAEA 4ZECA 2O51A 2ZYOA 2A5TA 3TTKA 3BFUA 1BP5A 4HW8A 1DPEA 3QXMA 4KI0E 3O29A 5H8FB 1P1WA 2XX8A 3E9XA 3U8QA 4AQ4A 3SERA 1S7YA 2Y84A 1R9LA 4QFNA 2Y7IA 3W15C 1LBCA 3G3GA 3VE1B 1Q35A 3LSXA 2XXVA 1WDNA 1B51A 1VFEA 4THIA 5H8QB 4FORA 3JZJA 1FW0A 3CG3A 3C31A 3IOTA 3SETA 3K6UA 2V3TA 2DWHA 2I48A 1H45A 2RF1A 2V93A 3DRKA 4YB6A 5H8QA 1PB7A 3UIFA 2FNCA 3N26A 1CE2A 3M3LA 2LAOA 2ZXTA 4GVOA 4F29A 3WAFA 1LFIA 5H8NA 1QUJA 1P1NA 1ZMGA 4ZEFA 3A3CA 3GXAA 4LZ7A 1QUKA 4JDFA 4MH5A 3IX1A 3S2VA 2ZNUA 3HO7A 4C0RA 1ZIUA 2B3FA 3DRHA 1URDA 3RTFB 3K1NA 4OETA 3KSJA 3GLBA 3H7MA 2H98A 3IOWA 3MP1A 4FE8A 3M8UA 3U72A 1LAHE 4Q5TA 4IO5A 4QFOA 3AXFA 5CC2A 1LAFE 3O6HA 5CMCA 4ZE9A 1BKAA 4BDLA 3SESA 1SBPA 3K0VA 1FTLA 4F31B 2F34A 5HPQA 3EHTA 4EQBA 4EQ7A 4GXAA 1DMBA 3RUMA 1MM7A 2XX7A 4U23A 4IGTA 1Y9UA 3V83A 1N0TA 3MP6A 1TT1A 3RLFE 5CI5A 3E4RA 1MDQA 1MXVA 1T0KA 5ISUA 1H3DA 5CMBA 1MG1A 2QS3A 4FEDA 1YTVA 4ZZAA 4O3CA 3RQTA 4OTEA 2XXWA 1JVXA 2THIA 3PUYE 1ZLQA 4MLVA 4ND9A 3K00A 2F7CA 4R9GA 5J1DA 3S4UA 3O2AA 1SW1A 3Q29A 2Y7KA 1PB8A 4NTLA 2DWAA 4WEPA 1EH3A 2HFBA 3O28A 1P1UA 3PU5A 2QL3A 2QMXA 4NMYA 5L9MA 2HQ0A 1SYHA 4I9DA 1MXXA 4QSEA 1D3KA 1ZJLA 4GXSB 1MPCA 1O64A 3PPRA 2CMOA 2GHBA 2I49A 1I6AA 4AB5A 4IGRA 4YKPA 4KQPA 4PFWA 3ILTB 4IB2A 3RYBA 1ANFA 3MVYA 4KYSA 1XT8A 3IK6B 4JWOA 4M1VA 2HAVA 2Y7WA 3B7DA 3S9LC 1Y1ZA 4QFPA 2GRVA 1FTKA 2O1MA 4IO2A 1SDXA 3HN0A 3CFZA 4GWOA 1FQDA 1EZOA 1US4A 3FXQA 3EHUA 4OENA 3TCHA 2DXYA 2ZYMA 5K2XA 4KD5A 2XD3A 3I5OA 2XXRA 5I56A 5IKBA 2DWIA 2F36A 2F7AA 4BDOA 1URGA 1MM6A 4JWYA 1B9JA 1LLSA 4PQJA 4JBZA 2DSFA 2IA4A 3SEWA 4OYVA 2F97A 2PX1A 1IZ1A 4YMAA 4XXUA 1SI1A 2PYYA 4U4XA 1YCJA 3O6GA 3SEVA 1YPNA 1USYE 1JEVA 2X7QA 1UTBB 2VOZA 3K01A 2X26A 3QUFA 1LAXA 4TOZA 2D5WA 1MPBA 3A09A 1HSJA 5CBRA 2RC7A 1US5A 1B3GA 1UTBA 2X7PA 2O69A 1B1HA 3W9WA 4O3BA 2HZKA 5DYHA 2ZYNA 3TTNA 3DRGA 2QMWA 3N5LA 3SKPA 2Y7RA 3FD3A 3TYHA 2F35A 1IEJA 4RK9A 1POY1 2F8DA 2VGQA 4UACA 4POWA 1ELJA 4RA1A 3RGYA 2P0SA 3TDJA 1KWHA 4XTCQ 3IAZA 1QJMA 5ICQA 4PFUA 3QIMA 1SI0A 1MH4A 1OMPA 3JV9A 3ZKLA 1HSLA 1N04A 1VE4A 4LP2B 2H9BA 3FV1A 2QRYA 1MXZA 4GL0A 3T96B 1URSA 4R6HA 3UORA 1NNKA 1A40A 2RKMA 1AH5A 4M4GA 3ONMA 2O1LA 1SW2A 1XOCA 1GV8A 4GL8A 4DXBA 1O63A 2AYSA 3JYRA 5F7VA 3UK4A 4KR5A 4Z7EA 1NH7A 1FQCA 3C36A
chains in the Genus database with same CATH superfamily
2B3BA 3BBRA 2ONSA 5T3JA 1VR5A 2F6GA 2OWSA 3TEPA 2H4IA 4BDNA 1DSNA 3OMBA 5ITPA 2OK2A 2UXAA 3Q26A 5TPAA 3K1PA 4G68C 4FIMA 3SEYA 4EF1A 3M3KA 3QSLA 2GH9A 5AE4A 4YKIA 1FPFA 4POXA 1II5A 4C1TA 1R1NA 5LTCA 5EYHA 4R74A 2ZZWA 4GLIA 4XIGQ 4YICA 4O3AA 4RPOA 2UVHA 4MIJA 4G8NA 3C4MA 1UIUA 5EYFA 4PCDA 1DPPA 1NV1A 3KG2A 3MZ9A 3VFJA 1LBVA 3PPQA 4HCWA 2PBWA 4EQ9A 5AA4B 4U1ZA 2KR0A 3CR9A 4N6PA 1ATGA 4ISUA 3T66A 3TODA 3IOUA 1LBBA 4IY6A 1MQDA 1NI9A 4NF8B 2HEUA 1N3XA 4RY1A 5AA4A 3K6WA 1CB6A 3UN6A 1ZKBA 5IGAA 1R6ZA 1B05A 4I1DA 4N4UA 3FXUA 4QBAA 2DOJA 3EQ1A 3G3FA 4GWYA 4NF8A 4YAHX 3T9XB 1XC1A 4GIZA 1TXFA 3MBPA 1DTGA 2QS4A 2R9JA 5H8FA 3CFXA 2ANJA 5FTIA 4H8JA 4LATA 5I3SA 1JW5A 3MZBA 2W7YA 1SVXB 2ABHA 4AS5A 5IAIA 4PETA 3O66A 2CZLA 1N84A 2NWJA 2Q89A 3U93A 1FQFA 1XS5A 1Y3NA 3KSXA 4HS7A 3E3KA 4H65A 2DE2A 3N6TA 4LZ5A 1A8EA 1IIWA 2OWTA 4R2FA 2FYIA 3K2DA 2XXTA 4PDDA 3RYAA 3IOVA 4NEDA 4DCYA 1N7WA 4ZEBA 4U4SA 1B3LA 4P0IA 3RYDA 4OEVA 1MPDA 3IR1A 3FVNA 3G3JA 4N15A 2DQVA 4IY5A 1L5TA 3FJGA 3SEXA 3UP9A 5ET6A 3FGSA 4IO7A 1IUDA 3H6TA 4G68B 4NF5B 3T0JA 2R6GE 3TQWA 1QVSA 5I5PA 3PGFA 2DP8A 5I59B 5KDTB 2DS9A 1USYH 3VVDA 4ZEDA 4JSOA 1EZ9A 4KFQA 3E79A 3S9EA 4G68A 3ZKKA 4NF5A 4OFOA 3IFAA 3VVEA 4PP0A 1PB9A 4R6YA 3FJMA 5H8SA 1MY3A 2ZZVA 2MKZA 5I59A 1B5HA 5KDTA 1B0LA 1Y4CA 4ELRA 1LB9A 1OQGA 4F1YA 4IO6A 2BJIA 4DCXA 4R72A 3LSLA 4MBPA 3MVWA 4F3SA 2NVUB 1B46A 3OO7A 1M5CA 1B7UA 1PBQA 5DVFA 2G93A 1AWBA 3IO4A 4XEQA 4YZZA 1FPBA 1MH3A 2A5SA 5B70A 5DT6A 1FTOA 3DRJA 5DVIA 1GVCA 3K4UA 3R6UA 4BDRA 3Q27A 1FJ6A 3C34A 2UYFA 1BTJA 3DP6A 2Q2AA 4PFIA 2V4CA 4N8YA 2VHAA 1FBCA 2HHMA 3UA8A 3O97A 2FA7A 1D4NA 1P1QA 1QGXA 3OENA 2XA5A 4G8HA 2B4LA 5AA3A 2GHAA 2QJEA 4I3YA 4QFLA 2AIXA 3DELB 1OLCA 4X1BA 5JK4A 1O7TA 1LSTA 2XXUA 1IMFA 5DTBA 4NF6B 2RINA 3T1BA 3VDFA 4PFTA 2PFYA 2F3DA 4DZ1A 1R9QA 3TTMA 1KA1A 3MWBA 4ZEKA 1H44A 5AA2D 1QUIA 4NF6A 5A5XB 4OFJA 1GGGA 3MVZA 2UVGA 1VDWA 4DXUA 4F3BA 1B1XA 4OFLA 2D3IA 2XX9A 3M3FA 4G4PA 4F2QA 5F24A 4ELPA 4X9TA 2Y7PA 4R2BA 2VPNA 1A99A 4F18A 4U2RA 2I4BA 4UA8A 3VXBA 3UGWA 4F1UA 5FTHA 4OESA 4P0GA 3OD7A 4ZDMA 3Q28A 3FXBA 3DP4A 2RCBA 4GQOA 5JTYB 4P11A 1MXWA 2WEFA 3OSQA 3RPLA 3OSRA 4KHZE 4NG7A 2WOLA 3MYUA 1MDP1 3OO8A 5CMKA 1ZTYA 3KZGA 5JTYA 3PMXA 3TUSA 4FECA 4YKJA 5KCJB 5I57B 3OO9A 1I6QA 2WBDA 2QFLA 4NGUA 1PDAA 3B6QA 4DE8A 3LSWA 1DOTA 4JB7A 5I57A 2G29A 1XI6A 1Z7ME 4WKMA 1J1NA 1IMCA 4X8RA 4N6DA 3CHGA 1LBXA 3PPOA 4PE3A 1EYJA 4G77A 1SYIA 5I2NB 2ONRA 2BJJX 2D21A 2XWKA 2RCAA 1FQBA 3PD8A 1VSOA 1IQ7A 1OVTA 2RC8A 4PBHA 2R71A 1MQIA 5H8HB 4LONB 3LVUA 4AB6A 4EXLA 1WODA 3PUXE 1PEBA 3G3KA 1B5JA 3V5AA 3CI8A 1MQHA 5H8HA 4YMBA 2HZLA 3H6WA 2HAUA 1Q1KA 4HTGA 4EXKA 2XHDA 2Q9TA 2WOPA 5CRYA 3BFTA 3ECRA 1D9QA 4ONYA 4KYEA 2XXPA 5AA2B 2E0SA 3K1MA 1N76A 2O7IA 2ESNA 3IB1A 2XD2A 4ESXA 2I3WA 3CIJA 3PUZE 1RYOA 1IXCA 1B3EA 3VLUA 3VLVA 3T22A 4TQUQ 4JXIA 4P47A 1H76A 2VD3A 1XVXA 2QS2A 2V3UA 4DLDA 3MQ9A 1POTA 2Q2CA 4YU0A 1JNFA 1MY0A 4HCYA 3L6GA 3L6HA 2XXYA 5B7DA 3C35A 5JEIA 3H6UA 2I0BA 2H25A 1FQAA 3HV1A 4Q30B 4P9KA 3CVGA 5L9OA 1NNTA 4JWXA 3IFCA 1LAGE 2WX9A 1RYXA 1FRPA 3G7WA 4OWDA 3TQLA 4GWWA 4HE2A 3Q25A 5IZ3A 2OLBA 1RDYA 5FHMA 4XKRA 4H8IA 3G3HA 5M2VA 4PE5B 3RNNA 1IITA 1SPIA 5ESYA 3MVXA 5F1QA 1NNPA 2DE3A 2P2AA 2P3NA 4PGPA 3KN7A 4R75A 4MLQA 4PGNA 2F6PA 3FIRA 3GBAA 1B0HA 4NF4B 1MY2A 1OIBA 3FATA 3MUQA 1B7ZA 2PT1A 1Y1MA 3N94A 1NV2A 3H03A 1FTJA 1S50A 1IMDA 3EN3A 2PT2A 4NF4A 4H0WA 3K6VA 4RYAA 3RT6B 3KOSA 2YJPA 4QXDA 1MS7A 2I6EA 2NOOA 3IO6A 3OEMA 4MF3A 2WOKA 1FPKA 3RN8A 2PCRA 3R7XA 5I58B 4EF2A 5I84A 1BIYA 4PFRA 3DP8A 2HPGA 2IEEA 4TLMB 1XVYA 2DYXA 1B5IA 4ECFA 5FBPA 1MXUA 2O6AA 5I58A 4KCDA 1TFDA 2A5TB 4AS4A 4IR8A 3I3VA 3OO6A 3FXRA 3TMGA 3H6VA 4JSDA 2XXXA 3B50A 1CNQA 3FZVA 1IXHA 3KJ7A 1LCFA 3SDFA 1EU8A 2QPQA 1G0HA 3T93B 1M5DA 1NMUA 3DRFA 2OX3A 1OVBA 5EHMA 1TWYA 4ZE8A 4EUOA 1UTHB 4KXPA 1ZBMA 5EQ7A 5BWJA 4X1DA 2OJTA 2E1SA 4LZ8A 2RC9A 3C32A 4GX4A 4OVQA 4PFYA 3A3UA 1SW4A 1UTHA 2OWZA 4RJZA 4F22A 2I0CA 4N07A 3FASA 2QVUA 3OXNA 3VVFA 1YAEA 4LA9A 1LCTA 1RKMA 3FVGA 4GBWA 2Z23A 3SZPA 3HHGA 3B6TA 3ILUB 3KBZA 1P1OA 2GFEA 4I8CA 2Z8EA 2KQZA 5LOMA 4X04A 1AIVA 1MRPA 3DRIA 2PVUA 4YB7A 3TCFA 3VV5A 3U1OA 3HSTA 5CMMA 1JW4A 4G8MA 5H8NB 1GR2A 4U21A 4E0WA 4DXCA 1SW5A 4H5FA 3V8XB 2Q74A 4OZ9A 4ZZEA 1QKAA 4PBQA 4MEVA 3P7IA 4P8BA 1JETA 2V25A 2OCUA 2V3QA 3KBRA 4F2OA 2H99A 3KN8A 1NV4A 1B2HA 3IORA 4FEBA 4OERA 4I62A 2M8CA 5A5LA 1LBWA 1B58A 1ZU0A 1JVYA 2ONKE 3W9VA 2I3VA 2UVIA 4PTKA 5DVJA 3R26A 3F11A 2FVZA 4PAKA 4OHNA 4PF8A 4XKPA 1EYKA 2ZNSA 4DDDA 4GX6A 3BKIB 1UQWA 1DTZA 2XXIA 3PUWE 3PUVE 3KGCA 3USDA 3IJXB 4H6DA 4QSCA 1SD3A 2DXRA 4RPNA 3C9HA 5KZTA 1LB8A 4XF5A 4F39A 1QKBA 2Y5LA 4O7IA 2F7BA 1FBGA 3FUZA 3RY3A 1FBFA 5I7IA 3MC2A 1M5BA 1B32A 3I6VA 2WKYA 4LUBA 4F1VA 3TFLA 5L8DA 1S9TA 4LVQA 2NUVA 1Z7NE 3KOTA 3FBPA 3U94A 2B65A 1Q9DA 2DE4A 4FBPA 1NH8A 1B3HA 3GZGA 3ZSFA 4QHQA 3TAJA 1IXGA 1LBZA 5EHSA 4N91A 1YZ0A 1FBPA 1LFHA 1PC3A 2ZNTA 4GFRA 4WXJA 3H3GA 1KZ8A 4U22A 1XHYA 5L9SA 4YB5A 3PD9A 3LBSA 3LR1A 1QULA 3RTWB 1Y20A 3T9UA 3FJ7A 3HCQA 5TU0A 3LC8A 3QK6A 4XKQA 4OA4A 1B7HA 1M5FA 1H43A 1JW1A 1A8FA 5FHOA 4F19A 4C1UA 2O84X 4R73A 4E0XA 3KC1A 3EPEA 3V89B 3DLNA 3HHFA 1I6BA 2CEXA 3H4ZA 5IZZA 1Y3QA 4NWCA 1NV5A 3K6XA 2NXOA 4H1XA 3QYTA 4JVIA 3MP8A 3O6PA 4LQ2A 4F3PA 1FPIA 1A54A 3NOHA 4GOTA 3PV0E 4OEUA 4Q0CA 4HE0A 4LQ5A 4FATA 3E13X 5A5XA 3TCGA 4R6KA 3RT8A 2P1SA 1FTMA 5TP9B 3QUJA 1B4HA 3H06B 4I40A 2I58A 2XXQA 1A7LA 1BK4A 4QRZA 5AA1A 1B4ZA 4MNIA 2Z8DA 2Q8JA 4F3GA 2DVCA 3MZ1A 4PFBA 4GWUA 1MY4A 5TP9A 3LUYA 4H46A 1WVJA 3CFLA 2ALUA 5I56B 3D4CA 3TTLA 1LGBC 4QF9A 2F78A 1B40A 3FVKA 3IB2A 2Q88A 3GYYA 3PAMA 1PBPA 4PC9A 1NL5A 5FHNA 1AOVA 4OXVA 1NNFA 5ET8A 1FSAA 1N3WA 3RPWA 4OVJA 4UABA 4GWSA 3PPPA 1MXYA 1NUZA 1B6HA 1GTKA 3BIGA 1SQYA 4Q8RA 1OLAA 4N8GA 5KCJA 5K2YA 3O6IA 2HCAA 5ELVA 3CG1A 5EQ8A 2ZZXA 2YLNA 2L5VA 5CM6A 3PMWA 4BLAA 3T9VA 2AL4A 4H67A 2V84A 4MNPA 4RK2A 3EF7A 3VLWA 1Y3PA 3S9MC 5ITOA 1B3FA 4ESWA 2Z22A 1B52A 4GD5A 1D9VA 4ZEIA 2VPOA 1UIVA 4R9FA 4ELQA 1BLFA 5I2NA 4NX1A 4EDPA 2F5XA 2Z8FA 2QSXA 3MJNA 3MPKA 4OVSA 2VT5A 5DEXB 2XWIA 1IMEA 3B6WA 2QS1A 3OEKA 1JEUA 3MAMA 2FIXA 2ZMBA 5CBSA 3S9NC 1Y4TA 3KN3A 1IXIA 4GRKA 5DEXA 1N7XA 4NAPA 5ET5A 3IL1B 4RNSA 2HXRA 3D4GA 4H5GA 2CEYA 2XXHA 4RXLA 3TZAA 4YKKA 5AA2A 4G61A 3CSGA 1FTAA 1NKXA 3LSFB 1AL3A 2XXKA 4TLLB 4NWDA 1FQEA 4WEDA 1HSEA 4IO3A 2O68A 2JJKA 4GF8A 4U1OA 5ICTA 4P3LA 4OQOA 4Z0IA 4KYDA 4LN5A 3U92A 3MPLA 2UYEA 4GWZA 3QAXA 4ELOA 2I4CA 5HM4B 1F9BA 3T9HB 3TPAA 3IB0A 4N81A 4OMBA 3MW0A 3EHSA 4GX3A 4L17A 1MQGA 4FJPA 4QFKA 3OOAA 4BDQA 3TELA 1I69A 3PMVA 2DVZA 1FPEA 1LFGA 3KEIA 4HE1A 2KLFA 1NFTA 4N6KA 3MSTA 1LEVA 1FCKA 2REJA 3OELA 2PFZA 4H45A 2ZYKA 4NE4A 4G2ZA 1P99A 1OQHA 4ZS9A 4JVDA 5HBCA 1TFAA 3QMFA 3KC0A 2REGA 2CZKA 3GBBA 3TKDA 4O7MA 2H5YA 3N6UA 2DWJA 1JQFA 1QW0A 5TPAB 2OZZA 4MFIA 4X48A 3KFMA 4K3FA 4MHFA 3ZS6A 3TTRA 3ODBA 3PPNA 3G3IA 4XFEA 2OBGA 4I3EA 4N17A 1M5EA 2PMSA 5I2KB 3FTOA 3C33A 4PAIA 3SEUA 2UVJA 1EZPA 5IZ1A 3CSBA 2VP1A 4MNCA 1VFDA 3VXCA 4FAJA 3FV2A 3FVOA 5I2KA 1MQJA 4KCCA 2O7UA 2VD2A 1MY1A 3KJTA 2B4MA 2R8TA 3O9PA 2YPNA 1A55A 4KPTA 1FPGA 3CRBA 1AMFA 1D9YA 4BDMA 4NQ8A 3HPIA 2AL5A 4IO4A 3IJOB 4XKNA 1KA0A 3THIA 5BUUA 4DIGA 1DBZA 1K9ZA 3DM0A 3K02A 4QSDA 4N13A 2HXWA 3WAEA 4ZECA 2O51A 2ZYOA 5IM2A 2A5TA 3TTKA 3BFUA 1BP5A 4O8MA 4HW8A 1DPEA 3QXMA 4KI0E 4P56A 3O29A 5H8FB 1P1WA 2XX8A 3E9XA 1FBEA 3ISPA 3U8QA 5DW8A 1FBHA 4AQ4A 3SERA 1S7YA 3A29A 2Y84A 1R9LA 4QFNA 2Y7IA 3W15C 1LBCA 3G3GA 3VE1B 1Q35A 3LSXA 2CZIA 2XXVA 1WDNA 1B51A 1VFEA 4THIA 4GBVA 5H8QB 4FORA 3EKIA 3JZJA 1FPJA 1FW0A 3CG3A 3C31A 4PF6A 3IOTA 3SETA 3K6UA 2V3TA 2GQ1A 2DWHA 4MCOA 2I48A 1H45A 2RF1A 2V93A 3DRKA 4YB6A 5H8QA 1PB7A 3UIFA 2FNCA 3N26A 1CE2A 3M3LA 2LAOA 2ZXTA 1YXIA 4GVOA 4F29A 3WAFA 1DCUA 1G0IA 1LFIA 5H8NA 1QUJA 1P1NA 1ZMGA 2QVVA 4P1LA 3A3CA 4ZEFA 3GXAA 4LZ7A 1QUKA 4JDFA 4MH5A 4HXVA 3IX1A 3S2VA 2ZNUA 3HO7A 4C0RA 1ZIUA 2B3FA 3DRHA 1INPA 1URDA 3RTFB 3K1NA 1LBYA 4OETA 3KSJA 3GLBA 3H7MA 2Q8MA 2H98A 5J16A 3IOWA 3MP1A 1RDZA 4FE8A 3M8UA 1NV3A 3U72A 1LAHE 1JP4A 4Q5TA 4IO5A 4QFOA 3AXFA 5CC2A 4JVCA 1LAFE 3O6HA 5CMCA 1IMAA 4ZE9A 1BKAA 5ET7A 4BDLA 3SESA 1SBPA 3K0VA 1FTLA 4F31B 2F34A 5HPQA 3EHTA 4EQBA 1NV6A 4EQ7A 4GXAA 1DMBA 4OANA 3B8BA 3RUMA 1MM7A 2XX7A 4U23A 4IGTA 1Y9UA 2XWOA 3V83A 1N0TA 3MP6A 1TT1A 3RLFE 2DDKA 5CI5A 3E4RA 1MDQA 1MXVA 1T0KA 5ISUA 1H3DA 5CMBA 4DI3D 1MG1A 2QS3A 4FEDA 4P1EA 1YTVA 4ZZAA 1YYZA 4O3CA 3RQTA 4OTEA 2XXWA 1JVXA 2THIA 3PUYE 1ZLQA 4MLVA 4ND9A 3K00A 3PTYA 2F7CA 4R9GA 5J1DA 3S4UA 3O2AA 1SW1A 5LDZA 3LUZA 3Q29A 1IMBA 2Y7KA 1PB8A 4NTLA 2DWAA 4WEPA 1EH3A 2HFBA 3O28A 4OVRA 1NV0A 1K9YA 5EYGA 1P1UA 1RDXA 2QL3A 2QMXA 3PU5A 4NMYA 5L9MA 2HQ0A 1SYHA 4I9DA 1MXXA 4QSEA 1D3KA 1ZJLA 4GXSB 1MPCA 1O64A 3PPRA 2CMOA 2GHBA 2I49A 1I6AA 4AB5A 1NUYA 4IGRA 4YKPA 2FHYA 4PFWA 4KQPA 3ILTB 3HFUA 4IB2A 3RYBA 1ANFA 3MVYA 4KYSA 1XT8A 3IK6B 4JWOA 4M1VA 2HAVA 2Y7WA 3B7DA 3S9LC 1Y1ZA 4QFPA 2GRVA 1FTKA 2O1MA 4IO2A 1SDXA 3HN0A 3CFZA 4GWOA 1FQDA 1EZOA 1US4A 3FXQA 3EHUA 3RPLB 4OVTA 2WYKA 4OENA 3TCHA 1FJ9A 2DXYA 2ZYMA 2WBBA 5K2XA 3E78A 4KD5A 2XD3A 3I5OA 2XXRA 5I56A 4NN3A 4NHBA 4PAFA 3D1RA 1DK4A 1NUWA 5IKBA 2WYPA 2DWIA 2F36A 2F7AA 2FBPA 4BDOA 4GWXA 1URGA 1MM6A 4JWYA 2XWVA 1B9JA 1LLSA 3LV0A 4PQJA 4JBZA 1FBDA 2DSFA 2IA4A 3SEWA 4OYVA 2F97A 2PX1A 1IZ1A 4YMAA 4XXUA 4DI4B 1SI1A 2PYYA 4U4XA 1YCJA 3O6GA 3SEVA 1YPNA 1USYE 2QVRA 1JEVA 2P3VA 2X7QA 1UTBB 2VOZA 3K01A 2X26A 3QUFA 4NF0A 4MX6A 1LAXA 2CZHA 2FIEA 4TOZA 2D5WA 1MPBA 3A09A 1HSJA 5CBRA 2RC7A 1US5A 1NUXA 1B3GA 1UTBA 2X7PA 2O69A 3ROJA 1B1HA 3W9WA 4O3BA 2HZKA 5DYHA 2ZYNA 3DRGA 3TTNA 2QMWA 3N5LA 3SKPA 2Y7RA 3FD3A 3TYHA 2F35A 1IEJA 4RK9A 1POY1 3U65A 2F8DA 2VGQA 4UACA 4POWA 1ELJA 4RA1A 3RGYA 2P0SA 4OVPA 3TDJA 2Y5KA 1KWHA 4XTCQ 3IAZA 1QJMA 5ICQA 4PFUA 3QIMA 1SI0A 2F3BA 4PDHA 1MH4A 1OMPA 3JV9A 3ZKLA 1HSLA 1N04A 1VE4A 4LP2B 4MMPA 2H9BA 3FV1A 5EQ9A 2QRYA 1MXZA 4GL0A 3T96B 1URSA 4R6HA 3UORA 3BIHA 1NNKA 1A40A 2RKMA 4MJOA 1AH5A 4M4GA 1EYIA 5IZ3B 3ONMA 2O1LA 1SW2A 1FPDA 1XOCA 1GV8A 4GL8A 4DXBA 1O63A 2AYSA 3JYRA 4MAGA 5F7VA 3UK4A 1NV7A 5EQAA 4KR5A 4O94A 4Z7EA 1NH7A 1FQCA 3C36A 1FPLA
chains in the Genus database with same CATH topology
2B3BA 3BBRA 2ONSA 1VR5A 2F6GA 2OWSA 3TEPA 2H4IA 4BDNA 1DSNA 3OMBA 5ITPA 2OK2A 2UXAA 3Q26A 5TPAA 3K1PA 4G68C 4FIMA 3SEYA 4EF1A 3M3KA 3QSLA 2GH9A 5AE4A 4YKIA 4POXA 1II5A 4C1TA 1R1NA 4R74A 4GLIA 4XIGQ 4YICA 4O3AA 4RPOA 2UVHA 4G8NA 3C4MA 1UIUA 5EYFA 1DPPA 3KG2A 3MZ9A 3VFJA 3PPQA 4HCWA 2PBWA 4EQ9A 5AA4B 4U1ZA 3CR9A 4N6PA 1ATGA 4ISUA 3T66A 3TODA 3IOUA 1LBBA 4IY6A 1MQDA 4NF8B 2HEUA 1N3XA 4RY1A 5AA4A 3K6WA 1CB6A 3UN6A 1ZKBA 1R6ZA 1B05A 4I1DA 3FXUA 2DOJA 3EQ1A 3G3FA 4NF8A 4YAHX 3T9XB 1XC1A 4GIZA 1TXFA 3MBPA 1DTGA 2QS4A 2R9JA 5H8FA 3CFXA 2ANJA 5FTIA 4H8JA 4LATA 1JW5A 3MZBA 2W7YA 1SVXB 2ABHA 5IAIA 4PETA 3O66A 2CZLA 1N84A 2NWJA 2Q89A 3U93A 1FQFA 1XS5A 1Y3NA 3KSXA 4HS7A 3E3KA 4H65A 2DE2A 3N6TA 4LZ5A 1A8EA 1IIWA 2OWTA 4R2FA 2FYIA 3K2DA 2XXTA 3RYAA 3IOVA 4NEDA 4DCYA 1N7WA 4ZEBA 4U4SA 1B3LA 4P0IA 4OEVA 1MPDA 3IR1A 3FVNA 3G3JA 2DQVA 4IY5A 1L5TA 3FJGA 3SEXA 3UP9A 3FGSA 4IO7A 1IUDA 3H6TA 4G68B 4NF5B 2R6GE 3TQWA 1QVSA 3PGFA 2DP8A 5I59B 5KDTB 2DS9A 1USYH 3VVDA 4ZEDA 4JSOA 1EZ9A 4KFQA 3S9EA 4G68A 3ZKKA 4NF5A 4OFOA 3VVEA 4PP0A 1PB9A 4R6YA 3FJMA 5H8SA 1MY3A 5I59A 1B5HA 5KDTA 1B0LA 1Y4CA 4ELRA 1LB9A 1OQGA 4F1YA 4IO6A 4DCXA 4R72A 3LSLA 4MBPA 3MVWA 4F3SA 2NVUB 1B46A 3OO7A 1M5CA 1B7UA 1PBQA 5DVFA 2G93A 3IO4A 4YZZA 1MH3A 2A5SA 5B70A 5DT6A 1FTOA 3DRJA 5DVIA 1GVCA 3K4UA 3R6UA 4BDRA 3Q27A 3C34A 2UYFA 1BTJA 3DP6A 2Q2AA 2VHAA 3UA8A 3O97A 2FA7A 1D4NA 1P1QA 3OENA 4G8HA 2B4LA 5AA3A 2GHAA 2QJEA 4QFLA 2AIXA 3DELB 1OLCA 4X1BA 5JK4A 1O7TA 1LSTA 2XXUA 5DTBA 4NF6B 2RINA 3VDFA 4PFTA 4DZ1A 1R9QA 3TTMA 3MWBA 4ZEKA 1H44A 5AA2D 1QUIA 4NF6A 5A5XB 4OFJA 1GGGA 3MVZA 2UVGA 4DXUA 4F3BA 1B1XA 4OFLA 2D3IA 2XX9A 3M3FA 4G4PA 4F2QA 4ELPA 4X9TA 2Y7PA 4R2BA 1A99A 4F18A 4U2RA 2I4BA 4UA8A 3VXBA 3UGWA 4F1UA 5FTHA 4OESA 4P0GA 3OD7A 4ZDMA 3Q28A 3DP4A 2RCBA 4GQOA 5JTYB 4P11A 1MXWA 3OSQA 3OSRA 4KHZE 2WOLA 1MDP1 3OO8A 5CMKA 1ZTYA 3KZGA 5JTYA 3PMXA 3TUSA 4FECA 4YKJA 5KCJB 5I57B 3OO9A 1I6QA 1PDAA 3B6QA 4DE8A 3LSWA 1DOTA 4JB7A 5I57A 2G29A 1Z7ME 4WKMA 1J1NA 3CHGA 3PPOA 4G77A 1SYIA 5I2NB 2ONRA 2BJJX 2D21A 2RCAA 1FQBA 3PD8A 1VSOA 1IQ7A 1OVTA 2RC8A 2R71A 1MQIA 5H8HB 4LONB 3LVUA 4AB6A 4EXLA 1WODA 3PUXE 1PEBA 3G3KA 1B5JA 3V5AA 3CI8A 1MQHA 5H8HA 4YMBA 2HZLA 3H6WA 2HAUA 1Q1KA 4HTGA 4EXKA 2XHDA 2Q9TA 2WOPA 5CRYA 3BFTA 3ECRA 4ONYA 4KYEA 2XXPA 5AA2B 2E0SA 3K1MA 1N76A 2O7IA 2ESNA 3IB1A 2XD2A 4ESXA 2I3WA 3CIJA 3PUZE 1RYOA 1IXCA 1B3EA 3VLUA 3VLVA 3T22A 4TQUQ 4JXIA 1H76A 2VD3A 1XVXA 2QS2A 2V3UA 4DLDA 3MQ9A 1POTA 2Q2CA 4YU0A 1JNFA 1MY0A 4HCYA 3L6GA 3L6HA 2XXYA 5B7DA 3C35A 5JEIA 3H6UA 2I0BA 2H25A 1FQAA 3HV1A 4Q30B 3CVGA 5L9OA 1NNTA 4JWXA 1LAGE 1RYXA 4OWDA 3G7WA 3TQLA 3Q25A 2OLBA 5FHMA 4XKRA 4H8IA 3G3HA 5M2VA 4PE5B 3RNNA 1IITA 3MVXA 5F1QA 1NNPA 2DE3A 2P2AA 3KN7A 4R75A 4MLQA 2F6PA 3FIRA 3GBAA 1B0HA 4NF4B 1MY2A 1OIBA 3FATA 3MUQA 1B7ZA 2PT1A 1Y1MA 3N94A 3H03A 1FTJA 1S50A 3EN3A 2PT2A 4NF4A 4H0WA 3K6VA 4RYAA 3RT6B 3KOSA 2YJPA 1MS7A 2I6EA 2NOOA 3IO6A 3OEMA 4MF3A 2WOKA 3RN8A 3R7XA 5I58B 4EF2A 5I84A 1BIYA 3DP8A 2IEEA 4TLMB 1XVYA 2DYXA 1B5IA 4ECFA 1MXUA 2O6AA 5I58A 4KCDA 1TFDA 2A5TB 3I3VA 3OO6A 3FXRA 3TMGA 3H6VA 4JSDA 2XXXA 3FZVA 1IXHA 3KJ7A 1LCFA 3SDFA 1EU8A 2QPQA 3T93B 1M5DA 1NMUA 3DRFA 1OVBA 5EHMA 1TWYA 4ZE8A 4EUOA 1UTHB 1ZBMA 5BWJA 4X1DA 2OJTA 2E1SA 4LZ8A 2RC9A 3C32A 4PFYA 3A3UA 1SW4A 1UTHA 4RJZA 4F22A 2I0CA 4N07A 3FASA 3OXNA 3VVFA 1YAEA 4LA9A 1LCTA 1RKMA 3FVGA 2Z23A 3HHGA 3B6TA 3ILUB 1P1OA 2GFEA 4I8CA 2Z8EA 5LOMA 1AIVA 1MRPA 3DRIA 2PVUA 4YB7A 3TCFA 3VV5A 3U1OA 3HSTA 5CMMA 1JW4A 4G8MA 5H8NB 1GR2A 4U21A 4E0WA 4DXCA 1SW5A 4H5FA 3V8XB 4OZ9A 4ZZEA 1QKAA 3P7IA 1JETA 2V25A 2OCUA 2V3QA 3KBRA 4F2OA 2H99A 3KN8A 1B2HA 3IORA 4FEBA 4OERA 4I62A 2M8CA 1B58A 1ZU0A 1JVYA 2ONKE 3W9VA 2I3VA 2UVIA 5DVJA 3R26A 3F11A 4OHNA 4XKPA 2ZNSA 4DDDA 3BKIB 1UQWA 1DTZA 2XXIA 3PUWE 3PUVE 3KGCA 3USDA 3IJXB 4H6DA 4QSCA 1SD3A 2DXRA 4RPNA 3C9HA 5KZTA 1LB8A 4F39A 1QKBA 2F7BA 3FUZA 3RY3A 3MC2A 1M5BA 1B32A 3I6VA 2WKYA 4LUBA 4F1VA 3TFLA 5L8DA 1S9TA 4LVQA 2NUVA 1Z7NE 3KOTA 3U94A 2B65A 2DE4A 1NH8A 1B3HA 3GZGA 3ZSFA 4QHQA 3TAJA 1IXGA 5EHSA 1LFHA 1PC3A 2ZNTA 4GFRA 4WXJA 3H3GA 4U22A 1XHYA 5L9SA 4YB5A 3PD9A 3LBSA 3LR1A 1QULA 3RTWB 1Y20A 3T9UA 3FJ7A 3HCQA 5TU0A 3LC8A 3QK6A 4XKQA 1B7HA 1M5FA 1H43A 1JW1A 1A8FA 5FHOA 4F19A 4C1UA 2O84X 4R73A 4E0XA 3EPEA 3V89B 3DLNA 3HHFA 1I6BA 3H4ZA 1Y3QA 4NWCA 3K6XA 2NXOA 4H1XA 3QYTA 3MP8A 3O6PA 4LQ2A 4F3PA 1A54A 4GOTA 3PV0E 4OEUA 4Q0CA 4LQ5A 4FATA 3E13X 5A5XA 3TCGA 4R6KA 3RT8A 2P1SA 1FTMA 5TP9B 3QUJA 1B4HA 3H06B 2I58A 2XXQA 1A7LA 4QRZA 5AA1A 1B4ZA 2Z8DA 2Q8JA 4F3GA 2DVCA 3MZ1A 1MY4A 5TP9A 3LUYA 1WVJA 3CFLA 2ALUA 5I56B 3D4CA 3TTLA 1LGBC 4QF9A 2F78A 1B40A 3FVKA 3IB2A 2Q88A 3PAMA 1PBPA 1NL5A 5FHNA 1AOVA 4OXVA 1NNFA 1N3WA 3RPWA 4OVJA 3PPPA 1MXYA 1B6HA 1GTKA 1SQYA 4Q8RA 1OLAA 5KCJA 5K2YA 3O6IA 2HCAA 5ELVA 3CG1A 2YLNA 5CM6A 3PMWA 4BLAA 3T9VA 2AL4A 4H67A 2V84A 4RK2A 3EF7A 3VLWA 1Y3PA 3S9MC 5ITOA 1B3FA 4ESWA 2Z22A 1B52A 4GD5A 1D9VA 4ZEIA 1UIVA 4R9FA 4ELQA 1BLFA 5I2NA 4EDPA 2F5XA 2Z8FA 2QSXA 3MJNA 3MPKA 5DEXB 3B6WA 2QS1A 3OEKA 1JEUA 3MAMA 2ZMBA 5CBSA 3S9NC 1Y4TA 3KN3A 1IXIA 4GRKA 5DEXA 1N7XA 3IL1B 4RNSA 3D4GA 4H5GA 2XXHA 4RXLA 3TZAA 4YKKA 5AA2A 3CSGA 1NKXA 3LSFB 1AL3A 4TLLB 4NWDA 1FQEA 4WEDA 1HSEA 4IO3A 2O68A 4GF8A 4U1OA 5ICTA 4Z0IA 4OQOA 4KYDA 3U92A 3MPLA 2UYEA 3QAXA 4ELOA 2I4CA 5HM4B 1F9BA 3T9HB 3TPAA 3IB0A 4OMBA 3MW0A 3EHSA 4L17A 1MQGA 4FJPA 4QFKA 3OOAA 4BDQA 3TELA 1I69A 3PMVA 2DVZA 1LFGA 3KEIA 2KLFA 1NFTA 1FCKA 2REJA 3OELA 2ZYKA 4NE4A 4G2ZA 1P99A 1OQHA 4ZS9A 5HBCA 1TFAA 2REGA 3GBBA 3TKDA 2H5YA 3N6UA 2DWJA 1JQFA 1QW0A 5TPAB 2OZZA 4MFIA 4X48A 3KFMA 4K3FA 3ZS6A 3TTRA 3ODBA 3PPNA 3G3IA 2OBGA 1M5EA 2PMSA 5I2KB 3FTOA 3C33A 3SEUA 2UVJA 1EZPA 3CSBA 2VP1A 1VFDA 3VXCA 4FAJA 3FV2A 3FVOA 5I2KA 1MQJA 4KCCA 2O7UA 2VD2A 1MY1A 3KJTA 2B4MA 3O9PA 2YPNA 1A55A 4KPTA 3CRBA 1AMFA 1D9YA 4BDMA 3HPIA 2AL5A 4IO4A 3IJOB 4XKNA 3THIA 5BUUA 4DIGA 3DM0A 3K02A 4QSDA 4N13A 2HXWA 3WAEA 4ZECA 2O51A 2ZYOA 2A5TA 3TTKA 3BFUA 1BP5A 4HW8A 1DPEA 3QXMA 4KI0E 3O29A 5H8FB 1P1WA 2XX8A 3E9XA 3U8QA 4AQ4A 3SERA 1S7YA 2Y84A 1R9LA 4QFNA 2Y7IA 3W15C 1LBCA 3G3GA 3VE1B 1Q35A 3LSXA 2XXVA 1WDNA 1B51A 1VFEA 4THIA 5H8QB 4FORA 3JZJA 1FW0A 3CG3A 3C31A 3IOTA 3SETA 3K6UA 2V3TA 2DWHA 2I48A 1H45A 2RF1A 2V93A 3DRKA 4YB6A 5H8QA 1PB7A 3UIFA 2FNCA 3N26A 1CE2A 3M3LA 2LAOA 2ZXTA 4GVOA 4F29A 3WAFA 1LFIA 5H8NA 1QUJA 1P1NA 1ZMGA 4ZEFA 3A3CA 3GXAA 4LZ7A 1QUKA 4JDFA 4MH5A 3IX1A 3S2VA 2ZNUA 3HO7A 4C0RA 1ZIUA 2B3FA 3DRHA 1URDA 3RTFB 3K1NA 4OETA 3KSJA 3GLBA 3H7MA 2H98A 3IOWA 3MP1A 4FE8A 3M8UA 3U72A 1LAHE 4Q5TA 4IO5A 4QFOA 3AXFA 5CC2A 1LAFE 3O6HA 5CMCA 4ZE9A 1BKAA 4BDLA 3SESA 1SBPA 3K0VA 1FTLA 4F31B 2F34A 5HPQA 3EHTA 4EQBA 4EQ7A 4GXAA 1DMBA 3RUMA 1MM7A 2XX7A 4U23A 4IGTA 1Y9UA 3V83A 1N0TA 3MP6A 1TT1A 3RLFE 5CI5A 3E4RA 1MDQA 1MXVA 1T0KA 5ISUA 1H3DA 5CMBA 1MG1A 2QS3A 4FEDA 1YTVA 4ZZAA 4O3CA 3RQTA 4OTEA 2XXWA 1JVXA 2THIA 3PUYE 1ZLQA 4MLVA 4ND9A 3K00A 2F7CA 4R9GA 5J1DA 3S4UA 3O2AA 1SW1A 3Q29A 2Y7KA 1PB8A 4NTLA 2DWAA 4WEPA 1EH3A 2HFBA 3O28A 1P1UA 3PU5A 2QL3A 2QMXA 4NMYA 5L9MA 2HQ0A 1SYHA 4I9DA 1MXXA 4QSEA 1D3KA 1ZJLA 4GXSB 1MPCA 1O64A 3PPRA 2CMOA 2GHBA 2I49A 1I6AA 4AB5A 4IGRA 4YKPA 4KQPA 4PFWA 3ILTB 4IB2A 3RYBA 1ANFA 3MVYA 4KYSA 1XT8A 3IK6B 4JWOA 4M1VA 2HAVA 2Y7WA 3B7DA 3S9LC 1Y1ZA 4QFPA 2GRVA 1FTKA 2O1MA 4IO2A 1SDXA 3HN0A 3CFZA 4GWOA 1FQDA 1EZOA 1US4A 3FXQA 3EHUA 4OENA 3TCHA 2DXYA 2ZYMA 5K2XA 4KD5A 2XD3A 3I5OA 2XXRA 5I56A 5IKBA 2DWIA 2F36A 2F7AA 4BDOA 1URGA 1MM6A 4JWYA 1B9JA 1LLSA 4PQJA 4JBZA 2DSFA 2IA4A 3SEWA 4OYVA 2F97A 2PX1A 1IZ1A 4YMAA 4XXUA 1SI1A 2PYYA 4U4XA 1YCJA 3O6GA 3SEVA 1YPNA 1USYE 1JEVA 2X7QA 1UTBB 2VOZA 3K01A 2X26A 3QUFA 1LAXA 4TOZA 2D5WA 1MPBA 3A09A 1HSJA 5CBRA 2RC7A 1US5A 1B3GA 1UTBA 2X7PA 2O69A 1B1HA 3W9WA 4O3BA 2HZKA 5DYHA 2ZYNA 3TTNA 3DRGA 2QMWA 3N5LA 3SKPA 2Y7RA 3FD3A 3TYHA 2F35A 1IEJA 4RK9A 1POY1 2F8DA 2VGQA 4UACA 4POWA 1ELJA 4RA1A 3RGYA 2P0SA 3TDJA 1KWHA 4XTCQ 3IAZA 1QJMA 5ICQA 4PFUA 3QIMA 1SI0A 1MH4A 1OMPA 3JV9A 3ZKLA 1HSLA 1N04A 1VE4A 4LP2B 2H9BA 3FV1A 2QRYA 1MXZA 4GL0A 3T96B 1URSA 4R6HA 3UORA 1NNKA 1A40A 2RKMA 1AH5A 4M4GA 3ONMA 2O1LA 1SW2A 1XOCA 1GV8A 4GL8A 4DXBA 1O63A 2AYSA 3JYRA 5F7VA 3UK4A 4KR5A 4Z7EA 1NH7A 1FQCA 3C36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3B A;  3BBR A;  2ONS A;  1VR5 A;  2F6G A;  2OWS A;  3TEP A;  2H4I A;  4BDN A;  1DSN A;  3OMB A;  5ITP A;  2OK2 A;  2UXA A;  3Q26 A;  5TPA A;  3K1P A;  4G68 C;  4FIM A;  3SEY A;  4EF1 A;  3M3K A;  3QSL A;  2GH9 A;  5AE4 A;  4YKI A;  4POX A;  1II5 A;  4C1T A;  1R1N A;  4R74 A;  4GLI A;  4XIG Q;  4YIC A;  4O3A A;  4RPO A;  2UVH A;  4G8N A;  3C4M A;  1UIU A;  5EYF A;  1DPP A;  3KG2 A;  3MZ9 A;  3VFJ A;  3PPQ A;  4HCW A;  2PBW A;  4EQ9 A;  5AA4 B;  4U1Z A;  3CR9 A;  4N6P A;  1ATG A;  4ISU A;  3T66 A;  3TOD A;  3IOU A;  1LBB A;  4IY6 A;  1MQD A;  4NF8 B;  2HEU A;  1N3X A;  4RY1 A;  5AA4 A;  3K6W A;  1CB6 A;  3UN6 A;  1ZKB A;  1R6Z A;  1B05 A;  4I1D A;  3FXU A;  2DOJ A;  3EQ1 A;  3G3F A;  4NF8 A;  4YAH X;  3T9X B;  1XC1 A;  4GIZ A;  1TXF A;  3MBP A;  1DTG A;  2QS4 A;  2R9J A;  5H8F A;  3CFX A;  2ANJ A;  5FTI A;  4H8J A;  4LAT A;  1JW5 A;  3MZB A;  2W7Y A;  1SVX B;  2ABH A;  5IAI A;  4PET A;  3O66 A;  2CZL A;  1N84 A;  2NWJ A;  2Q89 A;  3U93 A;  1FQF A;  1XS5 A;  1Y3N A;  3KSX A;  4HS7 A;  3E3K A;  4H65 A;  2DE2 A;  3N6T A;  4LZ5 A;  1A8E A;  1IIW A;  2OWT A;  4R2F A;  2FYI A;  3K2D A;  2XXT A;  3RYA A;  3IOV A;  4NED A;  4DCY A;  1N7W A;  4ZEB A;  4U4S A;  1B3L A;  4P0I A;  4OEV A;  1MPD A;  3IR1 A;  3FVN A;  3G3J A;  2DQV A;  4IY5 A;  1L5T A;  3FJG A;  3SEX A;  3UP9 A;  3FGS A;  4IO7 A;  1IUD A;  3H6T A;  4G68 B;  4NF5 B;  2R6G E;  3TQW A;  1QVS A;  3PGF A;  2DP8 A;  5I59 B;  5KDT B;  2DS9 A;  1USY H;  3VVD A;  4ZED A;  4JSO A;  1EZ9 A;  4KFQ A;  3S9E A;  4G68 A;  3ZKK A;  4NF5 A;  4OFO A;  3VVE A;  4PP0 A;  1PB9 A;  4R6Y A;  3FJM A;  5H8S A;  1MY3 A;  5I59 A;  1B5H A;  5KDT A;  1B0L A;  1Y4C A;  4ELR A;  1LB9 A;  1OQG A;  4F1Y A;  4IO6 A;  4DCX A;  4R72 A;  3LSL A;  4MBP A;  3MVW A;  4F3S A;  2NVU B;  1B46 A;  3OO7 A;  1M5C A;  1B7U A;  1PBQ A;  5DVF A;  2G93 A;  3IO4 A;  4YZZ A;  1MH3 A;  2A5S A;  5B70 A;  5DT6 A;  1FTO A;  3DRJ A;  5DVI A;  1GVC A;  3K4U A;  3R6U A;  4BDR A;  3Q27 A;  3C34 A;  2UYF A;  1BTJ A;  3DP6 A;  2Q2A A;  2VHA A;  3UA8 A;  3O97 A;  2FA7 A;  1D4N A;  1P1Q A;  3OEN A;  4G8H A;  2B4L A;  5AA3 A;  2GHA A;  2QJE A;  4QFL A;  2AIX A;  3DEL B;  1OLC A;  4X1B A;  5JK4 A;  1O7T A;  1LST A;  2XXU A;  5DTB A;  4NF6 B;  2RIN A;  3VDF A;  4PFT A;  4DZ1 A;  1R9Q A;  3TTM A;  3MWB A;  4ZEK A;  1H44 A;  5AA2 D;  1QUI A;  4NF6 A;  5A5X B;  4OFJ A;  1GGG A;  3MVZ A;  2UVG A;  4DXU A;  4F3B A;  1B1X A;  4OFL A;  2D3I A;  2XX9 A;  3M3F A;  4G4P A;  4F2Q A;  4ELP A;  4X9T A;  2Y7P A;  4R2B A;  1A99 A;  4F18 A;  4U2R A;  2I4B A;  4UA8 A;  3VXB A;  3UGW A;  4F1U A;  5FTH A;  4OES A;  4P0G A;  3OD7 A;  4ZDM A;  3Q28 A;  3DP4 A;  2RCB A;  4GQO A;  5JTY B;  4P11 A;  1MXW A;  3OSQ A;  3OSR A;  4KHZ E;  2WOL A;  1MDP 1;  3OO8 A;  5CMK A;  1ZTY A;  3KZG A;  5JTY A;  3PMX A;  3TUS A;  4FEC A;  4YKJ A;  5KCJ B;  5I57 B;  3OO9 A;  1I6Q A;  1PDA A;  3B6Q A;  4DE8 A;  3LSW A;  1DOT A;  4JB7 A;  5I57 A;  2G29 A;  1Z7M E;  4WKM A;  1J1N A;  3CHG A;  3PPO A;  4G77 A;  1SYI A;  5I2N B;  2ONR A;  2BJJ X;  2D21 A;  2RCA A;  1FQB A;  3PD8 A;  1VSO A;  1IQ7 A;  1OVT A;  2RC8 A;  2R71 A;  1MQI A;  5H8H B;  4LON B;  3LVU A;  4AB6 A;  4EXL A;  1WOD A;  3PUX E;  1PEB A;  3G3K A;  1B5J A;  3V5A A;  3CI8 A;  1MQH A;  5H8H A;  4YMB A;  2HZL A;  3H6W A;  2HAU A;  1Q1K A;  4HTG A;  4EXK A;  2XHD A;  2Q9T A;  2WOP A;  5CRY A;  3BFT A;  3ECR A;  4ONY A;  4KYE A;  2XXP A;  5AA2 B;  2E0S A;  3K1M A;  1N76 A;  2O7I A;  2ESN A;  3IB1 A;  2XD2 A;  4ESX A;  2I3W A;  3CIJ A;  3PUZ E;  1RYO A;  1IXC A;  1B3E A;  3VLU A;  3VLV A;  3T22 A;  4TQU Q;  4JXI A;  1H76 A;  2VD3 A;  1XVX A;  2QS2 A;  2V3U A;  4DLD A;  3MQ9 A;  1POT A;  2Q2C A;  4YU0 A;  1JNF A;  1MY0 A;  4HCY A;  3L6G A;  3L6H A;  2XXY A;  5B7D A;  3C35 A;  5JEI A;  3H6U A;  2I0B A;  2H25 A;  1FQA A;  3HV1 A;  4Q30 B;  3CVG A;  5L9O A;  1NNT A;  4JWX A;  1LAG E;  1RYX A;  4OWD A;  3G7W A;  3TQL A;  3Q25 A;  2OLB A;  5FHM A;  4XKR A;  4H8I A;  3G3H A;  5M2V A;  4PE5 B;  3RNN A;  1IIT A;  3MVX A;  5F1Q A;  1NNP A;  2DE3 A;  2P2A A;  3KN7 A;  4R75 A;  4MLQ A;  2F6P A;  3FIR A;  3GBA A;  1B0H A;  4NF4 B;  1MY2 A;  1OIB A;  3FAT A;  3MUQ A;  1B7Z A;  2PT1 A;  1Y1M A;  3N94 A;  3H03 A;  1FTJ A;  1S50 A;  3EN3 A;  2PT2 A;  4NF4 A;  4H0W A;  3K6V A;  4RYA A;  3RT6 B;  3KOS A;  2YJP A;  1MS7 A;  2I6E A;  2NOO A;  3IO6 A;  3OEM A;  4MF3 A;  2WOK A;  3RN8 A;  3R7X A;  5I58 B;  4EF2 A;  5I84 A;  1BIY A;  3DP8 A;  2IEE A;  4TLM B;  1XVY A;  2DYX A;  1B5I A;  4ECF A;  1MXU A;  2O6A A;  5I58 A;  4KCD A;  1TFD A;  2A5T B;  3I3V A;  3OO6 A;  3FXR A;  3TMG A;  3H6V A;  4JSD A;  2XXX A;  3FZV A;  1IXH A;  3KJ7 A;  1LCF A;  3SDF A;  1EU8 A;  2QPQ A;  3T93 B;  1M5D A;  1NMU A;  3DRF A;  1OVB A;  5EHM A;  1TWY A;  4ZE8 A;  4EUO A;  1UTH B;  1ZBM A;  5BWJ A;  4X1D A;  2OJT A;  2E1S A;  4LZ8 A;  2RC9 A;  3C32 A;  4PFY A;  3A3U A;  1SW4 A;  1UTH A;  4RJZ A;  4F22 A;  2I0C A;  4N07 A;  3FAS A;  3OXN A;  3VVF A;  1YAE A;  4LA9 A;  1LCT A;  1RKM A;  3FVG A;  2Z23 A;  3HHG A;  3B6T A;  3ILU B;  1P1O A;  2GFE A;  4I8C A;  2Z8E A;  5LOM A;  1AIV A;  1MRP A;  3DRI A;  2PVU A;  4YB7 A;  3TCF A;  3VV5 A;  3U1O A;  3HST A;  5CMM A;  1JW4 A;  4G8M A;  5H8N B;  1GR2 A;  4U21 A;  4E0W A;  4DXC A;  1SW5 A;  4H5F A;  3V8X B;  4OZ9 A;  4ZZE A;  1QKA A;  3P7I A;  1JET A;  2V25 A;  2OCU A;  2V3Q A;  3KBR A;  4F2O A;  2H99 A;  3KN8 A;  1B2H A;  3IOR A;  4FEB A;  4OER A;  4I62 A;  2M8C A;  1B58 A;  1ZU0 A;  1JVY A;  2ONK E;  3W9V A;  2I3V A;  2UVI A;  5DVJ A;  3R26 A;  3F11 A;  4OHN A;  4XKP A;  2ZNS A;  4DDD A;  3BKI B;  1UQW A;  1DTZ A;  2XXI A;  3PUW E;  3PUV E;  3KGC A;  3USD A;  3IJX B;  4H6D A;  4QSC A;  1SD3 A;  2DXR A;  4RPN A;  3C9H A;  5KZT A;  1LB8 A;  4F39 A;  1QKB A;  2F7B A;  3FUZ A;  3RY3 A;  3MC2 A;  1M5B A;  1B32 A;  3I6V A;  2WKY A;  4LUB A;  4F1V A;  3TFL A;  5L8D A;  1S9T A;  4LVQ A;  2NUV A;  1Z7N E;  3KOT A;  3U94 A;  2B65 A;  2DE4 A;  1NH8 A;  1B3H A;  3GZG A;  3ZSF A;  4QHQ A;  3TAJ A;  1IXG A;  5EHS A;  1LFH A;  1PC3 A;  2ZNT A;  4GFR A;  4WXJ A;  3H3G A;  4U22 A;  1XHY A;  5L9S A;  4YB5 A;  3PD9 A;  3LBS A;  3LR1 A;  1QUL A;  3RTW B;  1Y20 A;  3T9U A;  3FJ7 A;  3HCQ A;  5TU0 A;  3LC8 A;  3QK6 A;  4XKQ A;  1B7H A;  1M5F A;  1H43 A;  1JW1 A;  1A8F A;  5FHO A;  4F19 A;  4C1U A;  2O84 X;  4R73 A;  4E0X A;  3EPE A;  3V89 B;  3DLN A;  3HHF A;  1I6B A;  3H4Z A;  1Y3Q A;  4NWC A;  3K6X A;  2NXO A;  4H1X A;  3QYT A;  3MP8 A;  3O6P A;  4LQ2 A;  4F3P A;  1A54 A;  4GOT A;  3PV0 E;  4OEU A;  4Q0C A;  4LQ5 A;  4FAT A;  3E13 X;  5A5X A;  3TCG A;  4R6K A;  3RT8 A;  2P1S A;  1FTM A;  5TP9 B;  3QUJ A;  1B4H A;  3H06 B;  2I58 A;  2XXQ A;  1A7L A;  4QRZ A;  5AA1 A;  1B4Z A;  2Z8D A;  2Q8J A;  4F3G A;  2DVC A;  3MZ1 A;  1MY4 A;  5TP9 A;  3LUY A;  1WVJ A;  3CFL A;  2ALU A;  5I56 B;  3D4C A;  3TTL A;  1LGB C;  4QF9 A;  2F78 A;  1B40 A;  3FVK A;  3IB2 A;  2Q88 A;  3PAM A;  1PBP A;  1NL5 A;  5FHN A;  1AOV A;  4OXV A;  1NNF A;  1N3W A;  3RPW A;  4OVJ A;  3PPP A;  1MXY A;  1B6H A;  1GTK A;  1SQY A;  4Q8R A;  1OLA A;  5KCJ A;  5K2Y A;  3O6I A;  2HCA A;  5ELV A;  3CG1 A;  2YLN A;  5CM6 A;  3PMW A;  4BLA A;  3T9V A;  2AL4 A;  4H67 A;  2V84 A;  4RK2 A;  3EF7 A;  3VLW A;  1Y3P A;  3S9M C;  5ITO A;  1B3F A;  4ESW A;  2Z22 A;  1B52 A;  4GD5 A;  1D9V A;  4ZEI A;  1UIV A;  4R9F A;  4ELQ A;  1BLF A;  5I2N A;  4EDP A;  2F5X A;  2Z8F A;  2QSX A;  3MJN A;  3MPK A;  5DEX B;  3B6W A;  2QS1 A;  3OEK A;  1JEU A;  3MAM A;  2ZMB A;  5CBS A;  3S9N C;  1Y4T A;  3KN3 A;  1IXI A;  4GRK A;  5DEX A;  1N7X A;  3IL1 B;  4RNS A;  3D4G A;  4H5G A;  2XXH A;  4RXL A;  3TZA A;  4YKK A;  5AA2 A;  3CSG A;  1NKX A;  3LSF B;  1AL3 A;  4TLL B;  4NWD A;  1FQE A;  4WED A;  1HSE A;  4IO3 A;  2O68 A;  4GF8 A;  4U1O A;  5ICT A;  4Z0I A;  4OQO A;  4KYD A;  3U92 A;  3MPL A;  2UYE A;  3QAX A;  4ELO A;  2I4C A;  5HM4 B;  1F9B A;  3T9H B;  3TPA A;  3IB0 A;  4OMB A;  3MW0 A;  3EHS A;  4L17 A;  1MQG A;  4FJP A;  4QFK A;  3OOA A;  4BDQ A;  3TEL A;  1I69 A;  3PMV A;  2DVZ A;  1LFG A;  3KEI A;  2KLF A;  1NFT A;  1FCK A;  2REJ A;  3OEL A;  2ZYK A;  4NE4 A;  4G2Z A;  1P99 A;  1OQH A;  4ZS9 A;  5HBC A;  1TFA A;  2REG A;  3GBB A;  3TKD A;  2H5Y A;  3N6U A;  2DWJ A;  1JQF A;  1QW0 A;  5TPA B;  2OZZ A;  4MFI A;  4X48 A;  3KFM A;  4K3F A;  3ZS6 A;  3TTR A;  3ODB A;  3PPN A;  3G3I A;  2OBG A;  1M5E A;  2PMS A;  5I2K B;  3FTO A;  3C33 A;  3SEU A;  2UVJ A;  1EZP A;  3CSB A;  2VP1 A;  1VFD A;  3VXC A;  4FAJ A;  3FV2 A;  3FVO A;  5I2K A;  1MQJ A;  4KCC A;  2O7U A;  2VD2 A;  1MY1 A;  3KJT A;  2B4M A;  3O9P A;  2YPN A;  1A55 A;  4KPT A;  3CRB A;  1AMF A;  1D9Y A;  4BDM A;  3HPI A;  2AL5 A;  4IO4 A;  3IJO B;  4XKN A;  3THI A;  5BUU A;  4DIG A;  3DM0 A;  3K02 A;  4QSD A;  4N13 A;  2HXW A;  3WAE A;  4ZEC A;  2O51 A;  2ZYO A;  2A5T A;  3TTK A;  3BFU A;  1BP5 A;  4HW8 A;  1DPE A;  3QXM A;  4KI0 E;  3O29 A;  5H8F B;  1P1W A;  2XX8 A;  3E9X A;  3U8Q A;  4AQ4 A;  3SER A;  1S7Y A;  2Y84 A;  1R9L A;  4QFN A;  2Y7I A;  3W15 C;  1LBC A;  3G3G A;  3VE1 B;  1Q35 A;  3LSX A;  2XXV A;  1WDN A;  1B51 A;  1VFE A;  4THI A;  5H8Q B;  4FOR A;  3JZJ A;  1FW0 A;  3CG3 A;  3C31 A;  3IOT A;  3SET A;  3K6U A;  2V3T A;  2DWH A;  2I48 A;  1H45 A;  2RF1 A;  2V93 A;  3DRK A;  4YB6 A;  5H8Q A;  1PB7 A;  3UIF A;  2FNC A;  3N26 A;  1CE2 A;  3M3L A;  2LAO A;  2ZXT A;  4GVO A;  4F29 A;  3WAF A;  1LFI A;  5H8N A;  1QUJ A;  1P1N A;  1ZMG A;  4ZEF A;  3A3C A;  3GXA A;  4LZ7 A;  1QUK A;  4JDF A;  4MH5 A;  3IX1 A;  3S2V A;  2ZNU A;  3HO7 A;  4C0R A;  1ZIU A;  2B3F A;  3DRH A;  1URD A;  3RTF B;  3K1N A;  4OET A;  3KSJ A;  3GLB A;  3H7M A;  2H98 A;  3IOW A;  3MP1 A;  4FE8 A;  3M8U A;  3U72 A;  1LAH E;  4Q5T A;  4IO5 A;  4QFO A;  3AXF A;  5CC2 A;  1LAF E;  3O6H A;  5CMC A;  4ZE9 A;  1BKA A;  4BDL A;  3SES A;  1SBP A;  3K0V A;  1FTL A;  4F31 B;  2F34 A;  5HPQ A;  3EHT A;  4EQB A;  4EQ7 A;  4GXA A;  1DMB A;  3RUM A;  1MM7 A;  2XX7 A;  4U23 A;  4IGT A;  1Y9U A;  3V83 A;  1N0T A;  3MP6 A;  1TT1 A;  3RLF E;  5CI5 A;  3E4R A;  1MDQ A;  1MXV A;  1T0K A;  5ISU A;  1H3D A;  5CMB A;  1MG1 A;  2QS3 A;  4FED A;  1YTV A;  4ZZA A;  4O3C A;  3RQT A;  4OTE A;  2XXW A;  1JVX A;  2THI A;  3PUY E;  1ZLQ A;  4MLV A;  4ND9 A;  3K00 A;  2F7C A;  4R9G A;  5J1D A;  3S4U A;  3O2A A;  1SW1 A;  3Q29 A;  2Y7K A;  1PB8 A;  4NTL A;  2DWA A;  4WEP A;  1EH3 A;  2HFB A;  3O28 A;  1P1U A;  3PU5 A;  2QL3 A;  2QMX A;  4NMY A;  5L9M A;  2HQ0 A;  1SYH A;  4I9D A;  1MXX A;  4QSE A;  1D3K A;  1ZJL A;  4GXS B;  1MPC A;  1O64 A;  3PPR A;  2CMO A;  2GHB A;  2I49 A;  1I6A A;  4AB5 A;  4IGR A;  4YKP A;  4KQP A;  4PFW A;  3ILT B;  4IB2 A;  3RYB A;  1ANF A;  3MVY A;  4KYS A;  1XT8 A;  3IK6 B;  4JWO A;  4M1V A;  2HAV A;  2Y7W A;  3B7D A;  3S9L C;  1Y1Z A;  4QFP A;  2GRV A;  1FTK A;  2O1M A;  4IO2 A;  1SDX A;  3HN0 A;  3CFZ A;  4GWO A;  1FQD A;  1EZO A;  1US4 A;  3FXQ A;  3EHU A;  4OEN A;  3TCH A;  2DXY A;  2ZYM A;  5K2X A;  4KD5 A;  2XD3 A;  3I5O A;  2XXR A;  5I56 A;  5IKB A;  2DWI A;  2F36 A;  2F7A A;  4BDO A;  1URG A;  1MM6 A;  4JWY A;  1B9J A;  1LLS A;  4PQJ A;  4JBZ A;  2DSF A;  2IA4 A;  3SEW A;  4OYV A;  2F97 A;  2PX1 A;  1IZ1 A;  4YMA A;  4XXU A;  1SI1 A;  2PYY A;  4U4X A;  1YCJ A;  3O6G A;  3SEV A;  1YPN A;  1USY E;  1JEV A;  2X7Q A;  1UTB B;  2VOZ A;  3K01 A;  2X26 A;  3QUF A;  1LAX A;  4TOZ A;  2D5W A;  1MPB A;  3A09 A;  1HSJ A;  5CBR A;  2RC7 A;  1US5 A;  1B3G A;  1UTB A;  2X7P A;  2O69 A;  1B1H A;  3W9W A;  4O3B A;  2HZK A;  5DYH A;  2ZYN A;  3TTN A;  3DRG A;  2QMW A;  3N5L A;  3SKP A;  2Y7R A;  3FD3 A;  3TYH A;  2F35 A;  1IEJ A;  4RK9 A;  1POY 1;  2F8D A;  2VGQ A;  4UAC A;  4POW A;  1ELJ A;  4RA1 A;  3RGY A;  2P0S A;  3TDJ A;  1KWH A;  4XTC Q;  3IAZ A;  1QJM A;  5ICQ A;  4PFU A;  3QIM A;  1SI0 A;  1MH4 A;  1OMP A;  3JV9 A;  3ZKL A;  1HSL A;  1N04 A;  1VE4 A;  4LP2 B;  2H9B A;  3FV1 A;  2QRY A;  1MXZ A;  4GL0 A;  3T96 B;  1URS A;  4R6H A;  3UOR A;  1NNK A;  1A40 A;  2RKM A;  1AH5 A;  4M4G A;  3ONM A;  2O1L A;  1SW2 A;  1XOC A;  1GV8 A;  4GL8 A;  4DXB A;  1O63 A;  2AYS A;  3JYR A;  5F7V A;  3UK4 A;  4KR5 A;  4Z7E A;  1NH7 A;  1FQC A;  3C36 A; 
#chains in the Genus database with same CATH topology
 2B3B A;  3BBR A;  2ONS A;  5T3J A;  1VR5 A;  2F6G A;  2OWS A;  3TEP A;  2H4I A;  4BDN A;  1DSN A;  3OMB A;  5ITP A;  2OK2 A;  2UXA A;  3Q26 A;  5TPA A;  3K1P A;  4G68 C;  4FIM A;  3SEY A;  4EF1 A;  3M3K A;  3QSL A;  2GH9 A;  5AE4 A;  4YKI A;  1FPF A;  4POX A;  1II5 A;  4C1T A;  1R1N A;  5LTC A;  5EYH A;  4R74 A;  2ZZW A;  4GLI A;  4XIG Q;  4YIC A;  4O3A A;  4RPO A;  2UVH A;  4MIJ A;  4G8N A;  3C4M A;  1UIU A;  5EYF A;  4PCD A;  1DPP A;  1NV1 A;  3KG2 A;  3MZ9 A;  3VFJ A;  1LBV A;  3PPQ A;  4HCW A;  2PBW A;  4EQ9 A;  5AA4 B;  4U1Z A;  2KR0 A;  3CR9 A;  4N6P A;  1ATG A;  4ISU A;  3T66 A;  3TOD A;  3IOU A;  1LBB A;  4IY6 A;  1MQD A;  1NI9 A;  4NF8 B;  2HEU A;  1N3X A;  4RY1 A;  5AA4 A;  3K6W A;  1CB6 A;  3UN6 A;  1ZKB A;  5IGA A;  1R6Z A;  1B05 A;  4I1D A;  4N4U A;  3FXU A;  4QBA A;  2DOJ A;  3EQ1 A;  3G3F A;  4GWY A;  4NF8 A;  4YAH X;  3T9X B;  1XC1 A;  4GIZ A;  1TXF A;  3MBP A;  1DTG A;  2QS4 A;  2R9J A;  5H8F A;  3CFX A;  2ANJ A;  5FTI A;  4H8J A;  4LAT A;  5I3S A;  1JW5 A;  3MZB A;  2W7Y A;  1SVX B;  2ABH A;  4AS5 A;  5IAI A;  4PET A;  3O66 A;  2CZL A;  1N84 A;  2NWJ A;  2Q89 A;  3U93 A;  1FQF A;  1XS5 A;  1Y3N A;  3KSX A;  4HS7 A;  3E3K A;  4H65 A;  2DE2 A;  3N6T A;  4LZ5 A;  1A8E A;  1IIW A;  2OWT A;  4R2F A;  2FYI A;  3K2D A;  2XXT A;  4PDD A;  3RYA A;  3IOV A;  4NED A;  4DCY A;  1N7W A;  4ZEB A;  4U4S A;  1B3L A;  4P0I A;  3RYD A;  4OEV A;  1MPD A;  3IR1 A;  3FVN A;  3G3J A;  4N15 A;  2DQV A;  4IY5 A;  1L5T A;  3FJG A;  3SEX A;  3UP9 A;  5ET6 A;  3FGS A;  4IO7 A;  1IUD A;  3H6T A;  4G68 B;  4NF5 B;  3T0J A;  2R6G E;  3TQW A;  1QVS A;  5I5P A;  3PGF A;  2DP8 A;  5I59 B;  5KDT B;  2DS9 A;  1USY H;  3VVD A;  4ZED A;  4JSO A;  1EZ9 A;  4KFQ A;  3E79 A;  3S9E A;  4G68 A;  3ZKK A;  4NF5 A;  4OFO A;  3IFA A;  3VVE A;  4PP0 A;  1PB9 A;  4R6Y A;  3FJM A;  5H8S A;  1MY3 A;  2ZZV A;  2MKZ A;  5I59 A;  1B5H A;  5KDT A;  1B0L A;  1Y4C A;  4ELR A;  1LB9 A;  1OQG A;  4F1Y A;  4IO6 A;  2BJI A;  4DCX A;  4R72 A;  3LSL A;  4MBP A;  3MVW A;  4F3S A;  2NVU B;  1B46 A;  3OO7 A;  1M5C A;  1B7U A;  1PBQ A;  5DVF A;  2G93 A;  1AWB A;  3IO4 A;  4XEQ A;  4YZZ A;  1FPB A;  1MH3 A;  2A5S A;  5B70 A;  5DT6 A;  1FTO A;  3DRJ A;  5DVI A;  1GVC A;  3K4U A;  3R6U A;  4BDR A;  3Q27 A;  1FJ6 A;  3C34 A;  2UYF A;  1BTJ A;  3DP6 A;  2Q2A A;  4PFI A;  2V4C A;  4N8Y A;  2VHA A;  1FBC A;  2HHM A;  3UA8 A;  3O97 A;  2FA7 A;  1D4N A;  1P1Q A;  1QGX A;  3OEN A;  2XA5 A;  4G8H A;  2B4L A;  5AA3 A;  2GHA A;  2QJE A;  4I3Y A;  4QFL A;  2AIX A;  3DEL B;  1OLC A;  4X1B A;  5JK4 A;  1O7T A;  1LST A;  2XXU A;  1IMF A;  5DTB A;  4NF6 B;  2RIN A;  3T1B A;  3VDF A;  4PFT A;  2PFY A;  2F3D A;  4DZ1 A;  1R9Q A;  3TTM A;  1KA1 A;  3MWB A;  4ZEK A;  1H44 A;  5AA2 D;  1QUI A;  4NF6 A;  5A5X B;  4OFJ A;  1GGG A;  3MVZ A;  2UVG A;  1VDW A;  4DXU A;  4F3B A;  1B1X A;  4OFL A;  2D3I A;  2XX9 A;  3M3F A;  4G4P A;  4F2Q A;  5F24 A;  4ELP A;  4X9T A;  2Y7P A;  4R2B A;  2VPN A;  1A99 A;  4F18 A;  4U2R A;  2I4B A;  4UA8 A;  3VXB A;  3UGW A;  4F1U A;  5FTH A;  4OES A;  4P0G A;  3OD7 A;  4ZDM A;  3Q28 A;  3FXB A;  3DP4 A;  2RCB A;  4GQO A;  5JTY B;  4P11 A;  1MXW A;  2WEF A;  3OSQ A;  3RPL A;  3OSR A;  4KHZ E;  4NG7 A;  2WOL A;  3MYU A;  1MDP 1;  3OO8 A;  5CMK A;  1ZTY A;  3KZG A;  5JTY A;  3PMX A;  3TUS A;  4FEC A;  4YKJ A;  5KCJ B;  5I57 B;  3OO9 A;  1I6Q A;  2WBD A;  2QFL A;  4NGU A;  1PDA A;  3B6Q A;  4DE8 A;  3LSW A;  1DOT A;  4JB7 A;  5I57 A;  2G29 A;  1XI6 A;  1Z7M E;  4WKM A;  1J1N A;  1IMC A;  4X8R A;  4N6D A;  3CHG A;  1LBX A;  3PPO A;  4PE3 A;  1EYJ A;  4G77 A;  1SYI A;  5I2N B;  2ONR A;  2BJJ X;  2D21 A;  2XWK A;  2RCA A;  1FQB A;  3PD8 A;  1VSO A;  1IQ7 A;  1OVT A;  2RC8 A;  4PBH A;  2R71 A;  1MQI A;  5H8H B;  4LON B;  3LVU A;  4AB6 A;  4EXL A;  1WOD A;  3PUX E;  1PEB A;  3G3K A;  1B5J A;  3V5A A;  3CI8 A;  1MQH A;  5H8H A;  4YMB A;  2HZL A;  3H6W A;  2HAU A;  1Q1K A;  4HTG A;  4EXK A;  2XHD A;  2Q9T A;  2WOP A;  5CRY A;  3BFT A;  3ECR A;  1D9Q A;  4ONY A;  4KYE A;  2XXP A;  5AA2 B;  2E0S A;  3K1M A;  1N76 A;  2O7I A;  2ESN A;  3IB1 A;  2XD2 A;  4ESX A;  2I3W A;  3CIJ A;  3PUZ E;  1RYO A;  1IXC A;  1B3E A;  3VLU A;  3VLV A;  3T22 A;  4TQU Q;  4JXI A;  4P47 A;  1H76 A;  2VD3 A;  1XVX A;  2QS2 A;  2V3U A;  4DLD A;  3MQ9 A;  1POT A;  2Q2C A;  4YU0 A;  1JNF A;  1MY0 A;  4HCY A;  3L6G A;  3L6H A;  2XXY A;  5B7D A;  3C35 A;  5JEI A;  3H6U A;  2I0B A;  2H25 A;  1FQA A;  3HV1 A;  4Q30 B;  4P9K A;  3CVG A;  5L9O A;  1NNT A;  4JWX A;  3IFC A;  1LAG E;  2WX9 A;  1RYX A;  1FRP A;  3G7W A;  4OWD A;  3TQL A;  4GWW A;  4HE2 A;  3Q25 A;  5IZ3 A;  2OLB A;  1RDY A;  5FHM A;  4XKR A;  4H8I A;  3G3H A;  5M2V A;  4PE5 B;  3RNN A;  1IIT A;  1SPI A;  5ESY A;  3MVX A;  5F1Q A;  1NNP A;  2DE3 A;  2P2A A;  2P3N A;  4PGP A;  3KN7 A;  4R75 A;  4MLQ A;  4PGN A;  2F6P A;  3FIR A;  3GBA A;  1B0H A;  4NF4 B;  1MY2 A;  1OIB A;  3FAT A;  3MUQ A;  1B7Z A;  2PT1 A;  1Y1M A;  3N94 A;  1NV2 A;  3H03 A;  1FTJ A;  1S50 A;  1IMD A;  3EN3 A;  2PT2 A;  4NF4 A;  4H0W A;  3K6V A;  4RYA A;  3RT6 B;  3KOS A;  2YJP A;  4QXD A;  1MS7 A;  2I6E A;  2NOO A;  3IO6 A;  3OEM A;  4MF3 A;  2WOK A;  1FPK A;  3RN8 A;  2PCR A;  3R7X A;  5I58 B;  4EF2 A;  5I84 A;  1BIY A;  4PFR A;  3DP8 A;  2HPG A;  2IEE A;  4TLM B;  1XVY A;  2DYX A;  1B5I A;  4ECF A;  5FBP A;  1MXU A;  2O6A A;  5I58 A;  4KCD A;  1TFD A;  2A5T B;  4AS4 A;  4IR8 A;  3I3V A;  3OO6 A;  3FXR A;  3TMG A;  3H6V A;  4JSD A;  2XXX A;  3B50 A;  1CNQ A;  3FZV A;  1IXH A;  3KJ7 A;  1LCF A;  3SDF A;  1EU8 A;  2QPQ A;  1G0H A;  3T93 B;  1M5D A;  1NMU A;  3DRF A;  2OX3 A;  1OVB A;  5EHM A;  1TWY A;  4ZE8 A;  4EUO A;  1UTH B;  4KXP A;  1ZBM A;  5EQ7 A;  5BWJ A;  4X1D A;  2OJT A;  2E1S A;  4LZ8 A;  2RC9 A;  3C32 A;  4GX4 A;  4OVQ A;  4PFY A;  3A3U A;  1SW4 A;  1UTH A;  2OWZ A;  4RJZ A;  4F22 A;  2I0C A;  4N07 A;  3FAS A;  2QVU A;  3OXN A;  3VVF A;  1YAE A;  4LA9 A;  1LCT A;  1RKM A;  3FVG A;  4GBW A;  2Z23 A;  3SZP A;  3HHG A;  3B6T A;  3ILU B;  3KBZ A;  1P1O A;  2GFE A;  4I8C A;  2Z8E A;  2KQZ A;  5LOM A;  4X04 A;  1AIV A;  1MRP A;  3DRI A;  2PVU A;  4YB7 A;  3TCF A;  3VV5 A;  3U1O A;  3HST A;  5CMM A;  1JW4 A;  4G8M A;  5H8N B;  1GR2 A;  4U21 A;  4E0W A;  4DXC A;  1SW5 A;  4H5F A;  3V8X B;  2Q74 A;  4OZ9 A;  4ZZE A;  1QKA A;  4PBQ A;  4MEV A;  3P7I A;  4P8B A;  1JET A;  2V25 A;  2OCU A;  2V3Q A;  3KBR A;  4F2O A;  2H99 A;  3KN8 A;  1NV4 A;  1B2H A;  3IOR A;  4FEB A;  4OER A;  4I62 A;  2M8C A;  5A5L A;  1LBW A;  1B58 A;  1ZU0 A;  1JVY A;  2ONK E;  3W9V A;  2I3V A;  2UVI A;  4PTK A;  5DVJ A;  3R26 A;  3F11 A;  2FVZ A;  4PAK A;  4OHN A;  4PF8 A;  4XKP A;  1EYK A;  2ZNS A;  4DDD A;  4GX6 A;  3BKI B;  1UQW A;  1DTZ A;  2XXI A;  3PUW E;  3PUV E;  3KGC A;  3USD A;  3IJX B;  4H6D A;  4QSC A;  1SD3 A;  2DXR A;  4RPN A;  3C9H A;  5KZT A;  1LB8 A;  4XF5 A;  4F39 A;  1QKB A;  2Y5L A;  4O7I A;  2F7B A;  1FBG A;  3FUZ A;  3RY3 A;  1FBF A;  5I7I A;  3MC2 A;  1M5B A;  1B32 A;  3I6V A;  2WKY A;  4LUB A;  4F1V A;  3TFL A;  5L8D A;  1S9T A;  4LVQ A;  2NUV A;  1Z7N E;  3KOT A;  3FBP A;  3U94 A;  2B65 A;  1Q9D A;  2DE4 A;  4FBP A;  1NH8 A;  1B3H A;  3GZG A;  3ZSF A;  4QHQ A;  3TAJ A;  1IXG A;  1LBZ A;  5EHS A;  4N91 A;  1YZ0 A;  1FBP A;  1LFH A;  1PC3 A;  2ZNT A;  4GFR A;  4WXJ A;  3H3G A;  1KZ8 A;  4U22 A;  1XHY A;  5L9S A;  4YB5 A;  3PD9 A;  3LBS A;  3LR1 A;  1QUL A;  3RTW B;  1Y20 A;  3T9U A;  3FJ7 A;  3HCQ A;  5TU0 A;  3LC8 A;  3QK6 A;  4XKQ A;  4OA4 A;  1B7H A;  1M5F A;  1H43 A;  1JW1 A;  1A8F A;  5FHO A;  4F19 A;  4C1U A;  2O84 X;  4R73 A;  4E0X A;  3KC1 A;  3EPE A;  3V89 B;  3DLN A;  3HHF A;  1I6B A;  2CEX A;  3H4Z A;  5IZZ A;  1Y3Q A;  4NWC A;  1NV5 A;  3K6X A;  2NXO A;  4H1X A;  3QYT A;  4JVI A;  3MP8 A;  3O6P A;  4LQ2 A;  4F3P A;  1FPI A;  1A54 A;  3NOH A;  4GOT A;  3PV0 E;  4OEU A;  4Q0C A;  4HE0 A;  4LQ5 A;  4FAT A;  3E13 X;  5A5X A;  3TCG A;  4R6K A;  3RT8 A;  2P1S A;  1FTM A;  5TP9 B;  3QUJ A;  1B4H A;  3H06 B;  4I40 A;  2I58 A;  2XXQ A;  1A7L A;  1BK4 A;  4QRZ A;  5AA1 A;  1B4Z A;  4MNI A;  2Z8D A;  2Q8J A;  4F3G A;  2DVC A;  3MZ1 A;  4PFB A;  4GWU A;  1MY4 A;  5TP9 A;  3LUY A;  4H46 A;  1WVJ A;  3CFL A;  2ALU A;  5I56 B;  3D4C A;  3TTL A;  1LGB C;  4QF9 A;  2F78 A;  1B40 A;  3FVK A;  3IB2 A;  2Q88 A;  3GYY A;  3PAM A;  1PBP A;  4PC9 A;  1NL5 A;  5FHN A;  1AOV A;  4OXV A;  1NNF A;  5ET8 A;  1FSA A;  1N3W A;  3RPW A;  4OVJ A;  4UAB A;  4GWS A;  3PPP A;  1MXY A;  1NUZ A;  1B6H A;  1GTK A;  3BIG A;  1SQY A;  4Q8R A;  1OLA A;  4N8G A;  5KCJ A;  5K2Y A;  3O6I A;  2HCA A;  5ELV A;  3CG1 A;  5EQ8 A;  2ZZX A;  2YLN A;  2L5V A;  5CM6 A;  3PMW A;  4BLA A;  3T9V A;  2AL4 A;  4H67 A;  2V84 A;  4MNP A;  4RK2 A;  3EF7 A;  3VLW A;  1Y3P A;  3S9M C;  5ITO A;  1B3F A;  4ESW A;  2Z22 A;  1B52 A;  4GD5 A;  1D9V A;  4ZEI A;  2VPO A;  1UIV A;  4R9F A;  4ELQ A;  1BLF A;  5I2N A;  4NX1 A;  4EDP A;  2F5X A;  2Z8F A;  2QSX A;  3MJN A;  3MPK A;  4OVS A;  2VT5 A;  5DEX B;  2XWI A;  1IME A;  3B6W A;  2QS1 A;  3OEK A;  1JEU A;  3MAM A;  2FIX A;  2ZMB A;  5CBS A;  3S9N C;  1Y4T A;  3KN3 A;  1IXI A;  4GRK A;  5DEX A;  1N7X A;  4NAP A;  5ET5 A;  3IL1 B;  4RNS A;  2HXR A;  3D4G A;  4H5G A;  2CEY A;  2XXH A;  4RXL A;  3TZA A;  4YKK A;  5AA2 A;  4G61 A;  3CSG A;  1FTA A;  1NKX A;  3LSF B;  1AL3 A;  2XXK A;  4TLL B;  4NWD A;  1FQE A;  4WED A;  1HSE A;  4IO3 A;  2O68 A;  2JJK A;  4GF8 A;  4U1O A;  5ICT A;  4P3L A;  4OQO A;  4Z0I A;  4KYD A;  4LN5 A;  3U92 A;  3MPL A;  2UYE A;  4GWZ A;  3QAX A;  4ELO A;  2I4C A;  5HM4 B;  1F9B A;  3T9H B;  3TPA A;  3IB0 A;  4N81 A;  4OMB A;  3MW0 A;  3EHS A;  4GX3 A;  4L17 A;  1MQG A;  4FJP A;  4QFK A;  3OOA A;  4BDQ A;  3TEL A;  1I69 A;  3PMV A;  2DVZ A;  1FPE A;  1LFG A;  3KEI A;  4HE1 A;  2KLF A;  1NFT A;  4N6K A;  3MST A;  1LEV A;  1FCK A;  2REJ A;  3OEL A;  2PFZ A;  4H45 A;  2ZYK A;  4NE4 A;  4G2Z A;  1P99 A;  1OQH A;  4ZS9 A;  4JVD A;  5HBC A;  1TFA A;  3QMF A;  3KC0 A;  2REG A;  2CZK A;  3GBB A;  3TKD A;  4O7M A;  2H5Y A;  3N6U A;  2DWJ A;  1JQF A;  1QW0 A;  5TPA B;  2OZZ A;  4MFI A;  4X48 A;  3KFM A;  4K3F A;  4MHF A;  3ZS6 A;  3TTR A;  3ODB A;  3PPN A;  3G3I A;  4XFE A;  2OBG A;  4I3E A;  4N17 A;  1M5E A;  2PMS A;  5I2K B;  3FTO A;  3C33 A;  4PAI A;  3SEU A;  2UVJ A;  1EZP A;  5IZ1 A;  3CSB A;  2VP1 A;  4MNC A;  1VFD A;  3VXC A;  4FAJ A;  3FV2 A;  3FVO A;  5I2K A;  1MQJ A;  4KCC A;  2O7U A;  2VD2 A;  1MY1 A;  3KJT A;  2B4M A;  2R8T A;  3O9P A;  2YPN A;  1A55 A;  4KPT A;  1FPG A;  3CRB A;  1AMF A;  1D9Y A;  4BDM A;  4NQ8 A;  3HPI A;  2AL5 A;  4IO4 A;  3IJO B;  4XKN A;  1KA0 A;  3THI A;  5BUU A;  4DIG A;  1DBZ A;  1K9Z A;  3DM0 A;  3K02 A;  4QSD A;  4N13 A;  2HXW A;  3WAE A;  4ZEC A;  2O51 A;  2ZYO A;  5IM2 A;  2A5T A;  3TTK A;  3BFU A;  1BP5 A;  4O8M A;  4HW8 A;  1DPE A;  3QXM A;  4KI0 E;  4P56 A;  3O29 A;  5H8F B;  1P1W A;  2XX8 A;  3E9X A;  1FBE A;  3ISP A;  3U8Q A;  5DW8 A;  1FBH A;  4AQ4 A;  3SER A;  1S7Y A;  3A29 A;  2Y84 A;  1R9L A;  4QFN A;  2Y7I A;  3W15 C;  1LBC A;  3G3G A;  3VE1 B;  1Q35 A;  3LSX A;  2CZI A;  2XXV A;  1WDN A;  1B51 A;  1VFE A;  4THI A;  4GBV A;  5H8Q B;  4FOR A;  3EKI A;  3JZJ A;  1FPJ A;  1FW0 A;  3CG3 A;  3C31 A;  4PF6 A;  3IOT A;  3SET A;  3K6U A;  2V3T A;  2GQ1 A;  2DWH A;  4MCO A;  2I48 A;  1H45 A;  2RF1 A;  2V93 A;  3DRK A;  4YB6 A;  5H8Q A;  1PB7 A;  3UIF A;  2FNC A;  3N26 A;  1CE2 A;  3M3L A;  2LAO A;  2ZXT A;  1YXI A;  4GVO A;  4F29 A;  3WAF A;  1DCU A;  1G0I A;  1LFI A;  5H8N A;  1QUJ A;  1P1N A;  1ZMG A;  2QVV A;  4P1L A;  3A3C A;  4ZEF A;  3GXA A;  4LZ7 A;  1QUK A;  4JDF A;  4MH5 A;  4HXV A;  3IX1 A;  3S2V A;  2ZNU A;  3HO7 A;  4C0R A;  1ZIU A;  2B3F A;  3DRH A;  1INP A;  1URD A;  3RTF B;  3K1N A;  1LBY A;  4OET A;  3KSJ A;  3GLB A;  3H7M A;  2Q8M A;  2H98 A;  5J16 A;  3IOW A;  3MP1 A;  1RDZ A;  4FE8 A;  3M8U A;  1NV3 A;  3U72 A;  1LAH E;  1JP4 A;  4Q5T A;  4IO5 A;  4QFO A;  3AXF A;  5CC2 A;  4JVC A;  1LAF E;  3O6H A;  5CMC A;  1IMA A;  4ZE9 A;  1BKA A;  5ET7 A;  4BDL A;  3SES A;  1SBP A;  3K0V A;  1FTL A;  4F31 B;  2F34 A;  5HPQ A;  3EHT A;  4EQB A;  1NV6 A;  4EQ7 A;  4GXA A;  1DMB A;  4OAN A;  3B8B A;  3RUM A;  1MM7 A;  2XX7 A;  4U23 A;  4IGT A;  1Y9U A;  2XWO A;  3V83 A;  1N0T A;  3MP6 A;  1TT1 A;  3RLF E;  2DDK A;  5CI5 A;  3E4R A;  1MDQ A;  1MXV A;  1T0K A;  5ISU A;  1H3D A;  5CMB A;  4DI3 D;  1MG1 A;  2QS3 A;  4FED A;  4P1E A;  1YTV A;  4ZZA A;  1YYZ A;  4O3C A;  3RQT A;  4OTE A;  2XXW A;  1JVX A;  2THI A;  3PUY E;  1ZLQ A;  4MLV A;  4ND9 A;  3K00 A;  3PTY A;  2F7C A;  4R9G A;  5J1D A;  3S4U A;  3O2A A;  1SW1 A;  5LDZ A;  3LUZ A;  3Q29 A;  1IMB A;  2Y7K A;  1PB8 A;  4NTL A;  2DWA A;  4WEP A;  1EH3 A;  2HFB A;  3O28 A;  4OVR A;  1NV0 A;  1K9Y A;  5EYG A;  1P1U A;  1RDX A;  2QL3 A;  2QMX A;  3PU5 A;  4NMY A;  5L9M A;  2HQ0 A;  1SYH A;  4I9D A;  1MXX A;  4QSE A;  1D3K A;  1ZJL A;  4GXS B;  1MPC A;  1O64 A;  3PPR A;  2CMO A;  2GHB A;  2I49 A;  1I6A A;  4AB5 A;  1NUY A;  4IGR A;  4YKP A;  2FHY A;  4PFW A;  4KQP A;  3ILT B;  3HFU A;  4IB2 A;  3RYB A;  1ANF A;  3MVY A;  4KYS A;  1XT8 A;  3IK6 B;  4JWO A;  4M1V A;  2HAV A;  2Y7W A;  3B7D A;  3S9L C;  1Y1Z A;  4QFP A;  2GRV A;  1FTK A;  2O1M A;  4IO2 A;  1SDX A;  3HN0 A;  3CFZ A;  4GWO A;  1FQD A;  1EZO A;  1US4 A;  3FXQ A;  3EHU A;  3RPL B;  4OVT A;  2WYK A;  4OEN A;  3TCH A;  1FJ9 A;  2DXY A;  2ZYM A;  2WBB A;  5K2X A;  3E78 A;  4KD5 A;  2XD3 A;  3I5O A;  2XXR A;  5I56 A;  4NN3 A;  4NHB A;  4PAF A;  3D1R A;  1DK4 A;  1NUW A;  5IKB A;  2WYP A;  2DWI A;  2F36 A;  2F7A A;  2FBP A;  4BDO A;  4GWX A;  1URG A;  1MM6 A;  4JWY A;  2XWV A;  1B9J A;  1LLS A;  3LV0 A;  4PQJ A;  4JBZ A;  1FBD A;  2DSF A;  2IA4 A;  3SEW A;  4OYV A;  2F97 A;  2PX1 A;  1IZ1 A;  4YMA A;  4XXU A;  4DI4 B;  1SI1 A;  2PYY A;  4U4X A;  1YCJ A;  3O6G A;  3SEV A;  1YPN A;  1USY E;  2QVR A;  1JEV A;  2P3V A;  2X7Q A;  1UTB B;  2VOZ A;  3K01 A;  2X26 A;  3QUF A;  4NF0 A;  4MX6 A;  1LAX A;  2CZH A;  2FIE A;  4TOZ A;  2D5W A;  1MPB A;  3A09 A;  1HSJ A;  5CBR A;  2RC7 A;  1US5 A;  1NUX A;  1B3G A;  1UTB A;  2X7P A;  2O69 A;  3ROJ A;  1B1H A;  3W9W A;  4O3B A;  2HZK A;  5DYH A;  2ZYN A;  3DRG A;  3TTN A;  2QMW A;  3N5L A;  3SKP A;  2Y7R A;  3FD3 A;  3TYH A;  2F35 A;  1IEJ A;  4RK9 A;  1POY 1;  3U65 A;  2F8D A;  2VGQ A;  4UAC A;  4POW A;  1ELJ A;  4RA1 A;  3RGY A;  2P0S A;  4OVP A;  3TDJ A;  2Y5K A;  1KWH A;  4XTC Q;  3IAZ A;  1QJM A;  5ICQ A;  4PFU A;  3QIM A;  1SI0 A;  2F3B A;  4PDH A;  1MH4 A;  1OMP A;  3JV9 A;  3ZKL A;  1HSL A;  1N04 A;  1VE4 A;  4LP2 B;  4MMP A;  2H9B A;  3FV1 A;  5EQ9 A;  2QRY A;  1MXZ A;  4GL0 A;  3T96 B;  1URS A;  4R6H A;  3UOR A;  3BIH A;  1NNK A;  1A40 A;  2RKM A;  4MJO A;  1AH5 A;  4M4G A;  1EYI A;  5IZ3 B;  3ONM A;  2O1L A;  1SW2 A;  1FPD A;  1XOC A;  1GV8 A;  4GL8 A;  4DXB A;  1O63 A;  2AYS A;  3JYR A;  4MAG A;  5F7V A;  3UK4 A;  1NV7 A;  5EQA A;  4KR5 A;  4O94 A;  4Z7E A;  1NH7 A;  1FQC A;  3C36 A;  1FPL A; 
#chains in the Genus database with same CATH homology
 2B3B A;  3BBR A;  2ONS A;  1VR5 A;  2F6G A;  2OWS A;  3TEP A;  2H4I A;  4BDN A;  1DSN A;  3OMB A;  5ITP A;  2OK2 A;  2UXA A;  3Q26 A;  5TPA A;  3K1P A;  4G68 C;  4FIM A;  3SEY A;  4EF1 A;  3M3K A;  3QSL A;  2GH9 A;  5AE4 A;  4YKI A;  4POX A;  1II5 A;  4C1T A;  1R1N A;  4R74 A;  4GLI A;  4XIG Q;  4YIC A;  4O3A A;  4RPO A;  2UVH A;  4G8N A;  3C4M A;  1UIU A;  5EYF A;  1DPP A;  3KG2 A;  3MZ9 A;  3VFJ A;  3PPQ A;  4HCW A;  2PBW A;  4EQ9 A;  5AA4 B;  4U1Z A;  3CR9 A;  4N6P A;  1ATG A;  4ISU A;  3T66 A;  3TOD A;  3IOU A;  1LBB A;  4IY6 A;  1MQD A;  4NF8 B;  2HEU A;  1N3X A;  4RY1 A;  5AA4 A;  3K6W A;  1CB6 A;  3UN6 A;  1ZKB A;  1R6Z A;  1B05 A;  4I1D A;  3FXU A;  2DOJ A;  3EQ1 A;  3G3F A;  4NF8 A;  4YAH X;  3T9X B;  1XC1 A;  4GIZ A;  1TXF A;  3MBP A;  1DTG A;  2QS4 A;  2R9J A;  5H8F A;  3CFX A;  2ANJ A;  5FTI A;  4H8J A;  4LAT A;  1JW5 A;  3MZB A;  2W7Y A;  1SVX B;  2ABH A;  5IAI A;  4PET A;  3O66 A;  2CZL A;  1N84 A;  2NWJ A;  2Q89 A;  3U93 A;  1FQF A;  1XS5 A;  1Y3N A;  3KSX A;  4HS7 A;  3E3K A;  4H65 A;  2DE2 A;  3N6T A;  4LZ5 A;  1A8E A;  1IIW A;  2OWT A;  4R2F A;  2FYI A;  3K2D A;  2XXT A;  3RYA A;  3IOV A;  4NED A;  4DCY A;  1N7W A;  4ZEB A;  4U4S A;  1B3L A;  4P0I A;  4OEV A;  1MPD A;  3IR1 A;  3FVN A;  3G3J A;  2DQV A;  4IY5 A;  1L5T A;  3FJG A;  3SEX A;  3UP9 A;  3FGS A;  4IO7 A;  1IUD A;  3H6T A;  4G68 B;  4NF5 B;  2R6G E;  3TQW A;  1QVS A;  3PGF A;  2DP8 A;  5I59 B;  5KDT B;  2DS9 A;  1USY H;  3VVD A;  4ZED A;  4JSO A;  1EZ9 A;  4KFQ A;  3S9E A;  4G68 A;  3ZKK A;  4NF5 A;  4OFO A;  3VVE A;  4PP0 A;  1PB9 A;  4R6Y A;  3FJM A;  5H8S A;  1MY3 A;  5I59 A;  1B5H A;  5KDT A;  1B0L A;  1Y4C A;  4ELR A;  1LB9 A;  1OQG A;  4F1Y A;  4IO6 A;  4DCX A;  4R72 A;  3LSL A;  4MBP A;  3MVW A;  4F3S A;  2NVU B;  1B46 A;  3OO7 A;  1M5C A;  1B7U A;  1PBQ A;  5DVF A;  2G93 A;  3IO4 A;  4YZZ A;  1MH3 A;  2A5S A;  5B70 A;  5DT6 A;  1FTO A;  3DRJ A;  5DVI A;  1GVC A;  3K4U A;  3R6U A;  4BDR A;  3Q27 A;  3C34 A;  2UYF A;  1BTJ A;  3DP6 A;  2Q2A A;  2VHA A;  3UA8 A;  3O97 A;  2FA7 A;  1D4N A;  1P1Q A;  3OEN A;  4G8H A;  2B4L A;  5AA3 A;  2GHA A;  2QJE A;  4QFL A;  2AIX A;  3DEL B;  1OLC A;  4X1B A;  5JK4 A;  1O7T A;  1LST A;  2XXU A;  5DTB A;  4NF6 B;  2RIN A;  3VDF A;  4PFT A;  4DZ1 A;  1R9Q A;  3TTM A;  3MWB A;  4ZEK A;  1H44 A;  5AA2 D;  1QUI A;  4NF6 A;  5A5X B;  4OFJ A;  1GGG A;  3MVZ A;  2UVG A;  4DXU A;  4F3B A;  1B1X A;  4OFL A;  2D3I A;  2XX9 A;  3M3F A;  4G4P A;  4F2Q A;  4ELP A;  4X9T A;  2Y7P A;  4R2B A;  1A99 A;  4F18 A;  4U2R A;  2I4B A;  4UA8 A;  3VXB A;  3UGW A;  4F1U A;  5FTH A;  4OES A;  4P0G A;  3OD7 A;  4ZDM A;  3Q28 A;  3DP4 A;  2RCB A;  4GQO A;  5JTY B;  4P11 A;  1MXW A;  3OSQ A;  3OSR A;  4KHZ E;  2WOL A;  1MDP 1;  3OO8 A;  5CMK A;  1ZTY A;  3KZG A;  5JTY A;  3PMX A;  3TUS A;  4FEC A;  4YKJ A;  5KCJ B;  5I57 B;  3OO9 A;  1I6Q A;  1PDA A;  3B6Q A;  4DE8 A;  3LSW A;  1DOT A;  4JB7 A;  5I57 A;  2G29 A;  1Z7M E;  4WKM A;  1J1N A;  3CHG A;  3PPO A;  4G77 A;  1SYI A;  5I2N B;  2ONR A;  2BJJ X;  2D21 A;  2RCA A;  1FQB A;  3PD8 A;  1VSO A;  1IQ7 A;  1OVT A;  2RC8 A;  2R71 A;  1MQI A;  5H8H B;  4LON B;  3LVU A;  4AB6 A;  4EXL A;  1WOD A;  3PUX E;  1PEB A;  3G3K A;  1B5J A;  3V5A A;  3CI8 A;  1MQH A;  5H8H A;  4YMB A;  2HZL A;  3H6W A;  2HAU A;  1Q1K A;  4HTG A;  4EXK A;  2XHD A;  2Q9T A;  2WOP A;  5CRY A;  3BFT A;  3ECR A;  4ONY A;  4KYE A;  2XXP A;  5AA2 B;  2E0S A;  3K1M A;  1N76 A;  2O7I A;  2ESN A;  3IB1 A;  2XD2 A;  4ESX A;  2I3W A;  3CIJ A;  3PUZ E;  1RYO A;  1IXC A;  1B3E A;  3VLU A;  3VLV A;  3T22 A;  4TQU Q;  4JXI A;  1H76 A;  2VD3 A;  1XVX A;  2QS2 A;  2V3U A;  4DLD A;  3MQ9 A;  1POT A;  2Q2C A;  4YU0 A;  1JNF A;  1MY0 A;  4HCY A;  3L6G A;  3L6H A;  2XXY A;  5B7D A;  3C35 A;  5JEI A;  3H6U A;  2I0B A;  2H25 A;  1FQA A;  3HV1 A;  4Q30 B;  3CVG A;  5L9O A;  1NNT A;  4JWX A;  1LAG E;  1RYX A;  4OWD A;  3G7W A;  3TQL A;  3Q25 A;  2OLB A;  5FHM A;  4XKR A;  4H8I A;  3G3H A;  5M2V A;  4PE5 B;  3RNN A;  1IIT A;  3MVX A;  5F1Q A;  1NNP A;  2DE3 A;  2P2A A;  3KN7 A;  4R75 A;  4MLQ A;  2F6P A;  3FIR A;  3GBA A;  1B0H A;  4NF4 B;  1MY2 A;  1OIB A;  3FAT A;  3MUQ A;  1B7Z A;  2PT1 A;  1Y1M A;  3N94 A;  3H03 A;  1FTJ A;  1S50 A;  3EN3 A;  2PT2 A;  4NF4 A;  4H0W A;  3K6V A;  4RYA A;  3RT6 B;  3KOS A;  2YJP A;  1MS7 A;  2I6E A;  2NOO A;  3IO6 A;  3OEM A;  4MF3 A;  2WOK A;  3RN8 A;  3R7X A;  5I58 B;  4EF2 A;  5I84 A;  1BIY A;  3DP8 A;  2IEE A;  4TLM B;  1XVY A;  2DYX A;  1B5I A;  4ECF A;  1MXU A;  2O6A A;  5I58 A;  4KCD A;  1TFD A;  2A5T B;  3I3V A;  3OO6 A;  3FXR A;  3TMG A;  3H6V A;  4JSD A;  2XXX A;  3FZV A;  1IXH A;  3KJ7 A;  1LCF A;  3SDF A;  1EU8 A;  2QPQ A;  3T93 B;  1M5D A;  1NMU A;  3DRF A;  1OVB A;  5EHM A;  1TWY A;  4ZE8 A;  4EUO A;  1UTH B;  1ZBM A;  5BWJ A;  4X1D A;  2OJT A;  2E1S A;  4LZ8 A;  2RC9 A;  3C32 A;  4PFY A;  3A3U A;  1SW4 A;  1UTH A;  4RJZ A;  4F22 A;  2I0C A;  4N07 A;  3FAS A;  3OXN A;  3VVF A;  1YAE A;  4LA9 A;  1LCT A;  1RKM A;  3FVG A;  2Z23 A;  3HHG A;  3B6T A;  3ILU B;  1P1O A;  2GFE A;  4I8C A;  2Z8E A;  5LOM A;  1AIV A;  1MRP A;  3DRI A;  2PVU A;  4YB7 A;  3TCF A;  3VV5 A;  3U1O A;  3HST A;  5CMM A;  1JW4 A;  4G8M A;  5H8N B;  1GR2 A;  4U21 A;  4E0W A;  4DXC A;  1SW5 A;  4H5F A;  3V8X B;  4OZ9 A;  4ZZE A;  1QKA A;  3P7I A;  1JET A;  2V25 A;  2OCU A;  2V3Q A;  3KBR A;  4F2O A;  2H99 A;  3KN8 A;  1B2H A;  3IOR A;  4FEB A;  4OER A;  4I62 A;  2M8C A;  1B58 A;  1ZU0 A;  1JVY A;  2ONK E;  3W9V A;  2I3V A;  2UVI A;  5DVJ A;  3R26 A;  3F11 A;  4OHN A;  4XKP A;  2ZNS A;  4DDD A;  3BKI B;  1UQW A;  1DTZ A;  2XXI A;  3PUW E;  3PUV E;  3KGC A;  3USD A;  3IJX B;  4H6D A;  4QSC A;  1SD3 A;  2DXR A;  4RPN A;  3C9H A;  5KZT A;  1LB8 A;  4F39 A;  1QKB A;  2F7B A;  3FUZ A;  3RY3 A;  3MC2 A;  1M5B A;  1B32 A;  3I6V A;  2WKY A;  4LUB A;  4F1V A;  3TFL A;  5L8D A;  1S9T A;  4LVQ A;  2NUV A;  1Z7N E;  3KOT A;  3U94 A;  2B65 A;  2DE4 A;  1NH8 A;  1B3H A;  3GZG A;  3ZSF A;  4QHQ A;  3TAJ A;  1IXG A;  5EHS A;  1LFH A;  1PC3 A;  2ZNT A;  4GFR A;  4WXJ A;  3H3G A;  4U22 A;  1XHY A;  5L9S A;  4YB5 A;  3PD9 A;  3LBS A;  3LR1 A;  1QUL A;  3RTW B;  1Y20 A;  3T9U A;  3FJ7 A;  3HCQ A;  5TU0 A;  3LC8 A;  3QK6 A;  4XKQ A;  1B7H A;  1M5F A;  1H43 A;  1JW1 A;  1A8F A;  5FHO A;  4F19 A;  4C1U A;  2O84 X;  4R73 A;  4E0X A;  3EPE A;  3V89 B;  3DLN A;  3HHF A;  1I6B A;  3H4Z A;  1Y3Q A;  4NWC A;  3K6X A;  2NXO A;  4H1X A;  3QYT A;  3MP8 A;  3O6P A;  4LQ2 A;  4F3P A;  1A54 A;  4GOT A;  3PV0 E;  4OEU A;  4Q0C A;  4LQ5 A;  4FAT A;  3E13 X;  5A5X A;  3TCG A;  4R6K A;  3RT8 A;  2P1S A;  1FTM A;  5TP9 B;  3QUJ A;  1B4H A;  3H06 B;  2I58 A;  2XXQ A;  1A7L A;  4QRZ A;  5AA1 A;  1B4Z A;  2Z8D A;  2Q8J A;  4F3G A;  2DVC A;  3MZ1 A;  1MY4 A;  5TP9 A;  3LUY A;  1WVJ A;  3CFL A;  2ALU A;  5I56 B;  3D4C A;  3TTL A;  1LGB C;  4QF9 A;  2F78 A;  1B40 A;  3FVK A;  3IB2 A;  2Q88 A;  3PAM A;  1PBP A;  1NL5 A;  5FHN A;  1AOV A;  4OXV A;  1NNF A;  1N3W A;  3RPW A;  4OVJ A;  3PPP A;  1MXY A;  1B6H A;  1GTK A;  1SQY A;  4Q8R A;  1OLA A;  5KCJ A;  5K2Y A;  3O6I A;  2HCA A;  5ELV A;  3CG1 A;  2YLN A;  5CM6 A;  3PMW A;  4BLA A;  3T9V A;  2AL4 A;  4H67 A;  2V84 A;  4RK2 A;  3EF7 A;  3VLW A;  1Y3P A;  3S9M C;  5ITO A;  1B3F A;  4ESW A;  2Z22 A;  1B52 A;  4GD5 A;  1D9V A;  4ZEI A;  1UIV A;  4R9F A;  4ELQ A;  1BLF A;  5I2N A;  4EDP A;  2F5X A;  2Z8F A;  2QSX A;  3MJN A;  3MPK A;  5DEX B;  3B6W A;  2QS1 A;  3OEK A;  1JEU A;  3MAM A;  2ZMB A;  5CBS A;  3S9N C;  1Y4T A;  3KN3 A;  1IXI A;  4GRK A;  5DEX A;  1N7X A;  3IL1 B;  4RNS A;  3D4G A;  4H5G A;  2XXH A;  4RXL A;  3TZA A;  4YKK A;  5AA2 A;  3CSG A;  1NKX A;  3LSF B;  1AL3 A;  4TLL B;  4NWD A;  1FQE A;  4WED A;  1HSE A;  4IO3 A;  2O68 A;  4GF8 A;  4U1O A;  5ICT A;  4Z0I A;  4OQO A;  4KYD A;  3U92 A;  3MPL A;  2UYE A;  3QAX A;  4ELO A;  2I4C A;  5HM4 B;  1F9B A;  3T9H B;  3TPA A;  3IB0 A;  4OMB A;  3MW0 A;  3EHS A;  4L17 A;  1MQG A;  4FJP A;  4QFK A;  3OOA A;  4BDQ A;  3TEL A;  1I69 A;  3PMV A;  2DVZ A;  1LFG A;  3KEI A;  2KLF A;  1NFT A;  1FCK A;  2REJ A;  3OEL A;  2ZYK A;  4NE4 A;  4G2Z A;  1P99 A;  1OQH A;  4ZS9 A;  5HBC A;  1TFA A;  2REG A;  3GBB A;  3TKD A;  2H5Y A;  3N6U A;  2DWJ A;  1JQF A;  1QW0 A;  5TPA B;  2OZZ A;  4MFI A;  4X48 A;  3KFM A;  4K3F A;  3ZS6 A;  3TTR A;  3ODB A;  3PPN A;  3G3I A;  2OBG A;  1M5E A;  2PMS A;  5I2K B;  3FTO A;  3C33 A;  3SEU A;  2UVJ A;  1EZP A;  3CSB A;  2VP1 A;  1VFD A;  3VXC A;  4FAJ A;  3FV2 A;  3FVO A;  5I2K A;  1MQJ A;  4KCC A;  2O7U A;  2VD2 A;  1MY1 A;  3KJT A;  2B4M A;  3O9P A;  2YPN A;  1A55 A;  4KPT A;  3CRB A;  1AMF A;  1D9Y A;  4BDM A;  3HPI A;  2AL5 A;  4IO4 A;  3IJO B;  4XKN A;  3THI A;  5BUU A;  4DIG A;  3DM0 A;  3K02 A;  4QSD A;  4N13 A;  2HXW A;  3WAE A;  4ZEC A;  2O51 A;  2ZYO A;  2A5T A;  3TTK A;  3BFU A;  1BP5 A;  4HW8 A;  1DPE A;  3QXM A;  4KI0 E;  3O29 A;  5H8F B;  1P1W A;  2XX8 A;  3E9X A;  3U8Q A;  4AQ4 A;  3SER A;  1S7Y A;  2Y84 A;  1R9L A;  4QFN A;  2Y7I A;  3W15 C;  1LBC A;  3G3G A;  3VE1 B;  1Q35 A;  3LSX A;  2XXV A;  1WDN A;  1B51 A;  1VFE A;  4THI A;  5H8Q B;  4FOR A;  3JZJ A;  1FW0 A;  3CG3 A;  3C31 A;  3IOT A;  3SET A;  3K6U A;  2V3T A;  2DWH A;  2I48 A;  1H45 A;  2RF1 A;  2V93 A;  3DRK A;  4YB6 A;  5H8Q A;  1PB7 A;  3UIF A;  2FNC A;  3N26 A;  1CE2 A;  3M3L A;  2LAO A;  2ZXT A;  4GVO A;  4F29 A;  3WAF A;  1LFI A;  5H8N A;  1QUJ A;  1P1N A;  1ZMG A;  4ZEF A;  3A3C A;  3GXA A;  4LZ7 A;  1QUK A;  4JDF A;  4MH5 A;  3IX1 A;  3S2V A;  2ZNU A;  3HO7 A;  4C0R A;  1ZIU A;  2B3F A;  3DRH A;  1URD A;  3RTF B;  3K1N A;  4OET A;  3KSJ A;  3GLB A;  3H7M A;  2H98 A;  3IOW A;  3MP1 A;  4FE8 A;  3M8U A;  3U72 A;  1LAH E;  4Q5T A;  4IO5 A;  4QFO A;  3AXF A;  5CC2 A;  1LAF E;  3O6H A;  5CMC A;  4ZE9 A;  1BKA A;  4BDL A;  3SES A;  1SBP A;  3K0V A;  1FTL A;  4F31 B;  2F34 A;  5HPQ A;  3EHT A;  4EQB A;  4EQ7 A;  4GXA A;  1DMB A;  3RUM A;  1MM7 A;  2XX7 A;  4U23 A;  4IGT A;  1Y9U A;  3V83 A;  1N0T A;  3MP6 A;  1TT1 A;  3RLF E;  5CI5 A;  3E4R A;  1MDQ A;  1MXV A;  1T0K A;  5ISU A;  1H3D A;  5CMB A;  1MG1 A;  2QS3 A;  4FED A;  1YTV A;  4ZZA A;  4O3C A;  3RQT A;  4OTE A;  2XXW A;  1JVX A;  2THI A;  3PUY E;  1ZLQ A;  4MLV A;  4ND9 A;  3K00 A;  2F7C A;  4R9G A;  5J1D A;  3S4U A;  3O2A A;  1SW1 A;  3Q29 A;  2Y7K A;  1PB8 A;  4NTL A;  2DWA A;  4WEP A;  1EH3 A;  2HFB A;  3O28 A;  1P1U A;  3PU5 A;  2QL3 A;  2QMX A;  4NMY A;  5L9M A;  2HQ0 A;  1SYH A;  4I9D A;  1MXX A;  4QSE A;  1D3K A;  1ZJL A;  4GXS B;  1MPC A;  1O64 A;  3PPR A;  2CMO A;  2GHB A;  2I49 A;  1I6A A;  4AB5 A;  4IGR A;  4YKP A;  4KQP A;  4PFW A;  3ILT B;  4IB2 A;  3RYB A;  1ANF A;  3MVY A;  4KYS A;  1XT8 A;  3IK6 B;  4JWO A;  4M1V A;  2HAV A;  2Y7W A;  3B7D A;  3S9L C;  1Y1Z A;  4QFP A;  2GRV A;  1FTK A;  2O1M A;  4IO2 A;  1SDX A;  3HN0 A;  3CFZ A;  4GWO A;  1FQD A;  1EZO A;  1US4 A;  3FXQ A;  3EHU A;  4OEN A;  3TCH A;  2DXY A;  2ZYM A;  5K2X A;  4KD5 A;  2XD3 A;  3I5O A;  2XXR A;  5I56 A;  5IKB A;  2DWI A;  2F36 A;  2F7A A;  4BDO A;  1URG A;  1MM6 A;  4JWY A;  1B9J A;  1LLS A;  4PQJ A;  4JBZ A;  2DSF A;  2IA4 A;  3SEW A;  4OYV A;  2F97 A;  2PX1 A;  1IZ1 A;  4YMA A;  4XXU A;  1SI1 A;  2PYY A;  4U4X A;  1YCJ A;  3O6G A;  3SEV A;  1YPN A;  1USY E;  1JEV A;  2X7Q A;  1UTB B;  2VOZ A;  3K01 A;  2X26 A;  3QUF A;  1LAX A;  4TOZ A;  2D5W A;  1MPB A;  3A09 A;  1HSJ A;  5CBR A;  2RC7 A;  1US5 A;  1B3G A;  1UTB A;  2X7P A;  2O69 A;  1B1H A;  3W9W A;  4O3B A;  2HZK A;  5DYH A;  2ZYN A;  3TTN A;  3DRG A;  2QMW A;  3N5L A;  3SKP A;  2Y7R A;  3FD3 A;  3TYH A;  2F35 A;  1IEJ A;  4RK9 A;  1POY 1;  2F8D A;  2VGQ A;  4UAC A;  4POW A;  1ELJ A;  4RA1 A;  3RGY A;  2P0S A;  3TDJ A;  1KWH A;  4XTC Q;  3IAZ A;  1QJM A;  5ICQ A;  4PFU A;  3QIM A;  1SI0 A;  1MH4 A;  1OMP A;  3JV9 A;  3ZKL A;  1HSL A;  1N04 A;  1VE4 A;  4LP2 B;  2H9B A;  3FV1 A;  2QRY A;  1MXZ A;  4GL0 A;  3T96 B;  1URS A;  4R6H A;  3UOR A;  1NNK A;  1A40 A;  2RKM A;  1AH5 A;  4M4G A;  3ONM A;  2O1L A;  1SW2 A;  1XOC A;  1GV8 A;  4GL8 A;  4DXB A;  1O63 A;  2AYS A;  3JYR A;  5F7V A;  3UK4 A;  4KR5 A;  4Z7E A;  1NH7 A;  1FQC A;  3C36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...