1B46A

Oligo-peptide binding protein (oppa) complexed with kpk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b46A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b46A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b46A02
4G4PA 3PGFA 1N7WA 5CBSA 3OO6A 5DVIA 4F39A 4QFKA 2V3UA 2XX8A 3WAFA 2I4CA 5TU0A 1YTVA 4G2ZA 3DRFA 4X9TA 3SEVA 4YMAA 2I3VA 3LBSA 2H9BA 3VDFA 3ZKKA 4BDMA 3ZS6A 1N3XA 3FV1A 3IB0A 5TPAA 5CI5A 3N94A 2DYXA 3EPEA 4PFWA 5TPAB 3HCQA 1H3DA 4YB6A 5I56B 3EN3A 3O97A 2O84X 3USDA 1TFDA 4R2BA 3CHGA 4DXCA 5L9SA 1NFTA 2Y7PA 1JW1A 2P2AA 1XS5A 2WOLA 4TLLB 5LOMA 2Z8EA 4MLVA 2Z22A 2DXRA 5AA2A 4NF4A 3Q27A 3UN6A 2DS9A 3W9WA 4GVOA 4PP0A 3TELA 2Q2CA 2ZYNA 3PPPA 2PVUA 2XXRA 5CMMA 1Y1MA 1B7ZA 3K1PA 3JV9A 5AA1A 4QFLA 3L6GA 4GRKA 1AMFA 4C1UA 1FTLA 4G8HA 4QF9A 1FTMA 1Q35A 3T9XB 3RLFE 1FW0A 1MQJA 4JWXA 3GBBA 4U23A 1XC1A 2R71A 1IXCA 3MPKA 2LAOA 1LLSA 4EQ7A 1FTKA 1MH3A 4U21A 2OWTA 2THIA 2E1SA 2FA7A 2NXOA 3BBRA 3WAEA 2UVJA 4OFJA 4YKJA 4DCYA 5CMKA 3C36A 4GWOA 3MUQA 5H8NB 1SW4A 3B6TA 1NL5A 3O6IA 2OLBA 1MDP1 1URGA 3DLNA 1B32A 3G3FA 2QS3A 3PUXE 3UP9A 2Z23A 1L5TA 3IAZA 4OWDA 2I48A 1NNKA 3MVZA 2DOJA 1MM6A 5DT6A 4KI0E 2REJA 4QHQA 4JWOA 3DP6A 3ECRA 3MWBA 3PD9A 3VVDA 5AA3A 3FJ7A 4IO5A 4F18A 3O2AA 4BLAA 4ELOA 4IGTA 1CB6A 3TDJA 1GR2A 5H8SA 2Q8JA 5HPQA 3TCHA 1SI1A 3E3KA 1MG1A 1JVXA 3MPLA 3O9PA 2OK2A 4I8CA 1Y4TA 2I58A 3C4MA 1SW1A 3H06B 3F11A 2O51A 1WVJA 1OQHA 3PMWA 2ZYOA 1EZOA 1B3HA 2I0CA 5DYHA 5I84A 4OETA 1P1OA 4G68B 3MZ1A 3VVFA 3LSWA 2XXHA 3TAJA 4KYDA 3BFUA 4X1BA 4OEUA 3OSQA 3VVEA 4LA9A 1B3GA 2UVGA 4O3CA 4BDNA 3IB2A 1LAGE 3CG1A 2Y7KA 4ZDMA 2HFBA 3MP8A 4FE8A 4OHNA 4PQJA 2VP1A 2XXXA 5DVJA 4POXA 1GVCA 4GFRA 4IO7A 3TPAA 1FCKA 4GIZA 3PV0E 4I62A 3MP1A 3IL1B 4F1YA 3I3VA 3C33A 1ZKBA 2XXUA 2DVCA 3FXRA 4DE8A 3CIJA 3OELA 2QS2A 3PAMA 2OJTA 2F7CA 4LZ7A 3HHGA 2DWAA 5FHMA 4DLDA 4AB5A 1IITA 2O1LA 4QFNA 2QRYA 3G3JA 4IO3A 5AA4A 1ZTYA 2O69A 3IK6B 1T0KA 4LONB 1JQFA 1TFAA 2DE4A 4DZ1A 3Q26A 2YLNA 5ITPA 1FQEA 3OO9A 3TTNA 1UIUA 1PB9A 3E13X 1B51A 1JNFA 3K6WA 1MRPA 4KPTA 2D3IA 3E9XA 4YU0A 2DP8A 3UGWA 3MJNA 1URDA 1XVYA 1N76A 1PB7A 3N5LA 2DXYA 4JSOA 4NTLA 3C31A 1II5A 2HAUA 1DPPA 4R74A 3PPNA 1IQ7A 4KCDA 3LSFB 1AOVA 5JTYA 4RPNA 3ODBA 4LZ5A 1LCTA 2E0SA 4LP2B 3SDFA 5H8FA 1MY4A 1LFGA 4KD5A 5I59A 2DWIA 1EU8A 3BKIB 1M5DA 5H8FB 4MF3A 3RY3A 3O29A 3HO7A 3KJ7A 4H0WA 2H4IA 5A5XB 4U22A 4F3BA 1LB8A 3U72A 1DPEA 5JK4A 4RA1A 2HAVA 2RKMA 1BTJA 4XKRA 4ZS9A 1OQGA 3RT6B 2QL3A 3M8UA 3S9EA 4NF6B 4R6HA 1JETA 3B6QA 1MH4A 3HV1A 3AXFA 3VV5A 2YPNA 5K2YA 3C35A 4TLMB 2RC8A 4LQ2A 3FTOA 1UTBB 3VXBA 4O3AA 1SW2A 2B4MA 1US4A 4EUOA 3RYBA 3FVNA 2A5TB 1TT1A 1TWYA 4NE4A 2GHBA 1MY0A 1H76A 3IJXB 1NH7A 1Y1ZA 1OIBA 4IO6A 1B3LA 2HQ0A 3M3LA 1ZJLA 2F35A 5ITOA 3IOUA 3KG2A 3FXQA 4FIMA 3G3HA 3IB1A 2H98A 3ILTB 2I49A 4ZECA 3CSBA 4LUBA 3TQWA 4K3FA 2M8CA 1B0LA 3DRGA 5DEXA 3SEUA 1USYH 5DEXB 2AIXA 4C0RA 1N3WA 1MXYA 5K2XA 2D21A 2H5YA 3KOSA 4RPOA 2Z8FA 3U94A 2RCBA 5F7VA 3JZJA 5KCJA 4OZ9A 3SETA 1Q1KA 1N84A 5KCJB 1JW5A 2VD3A 4NEDA 3H6TA 3G3GA 4L17A 4YMBA 5IKBA 3TZAA 3FD3A 2VGQA 3SERA 3G7WA 3O6PA 4NWCA 4NF8A 2B4LA 4N13A 2PMSA 1QUJA 5I58A 1SYHA 1LSTA 4NF8B 4R6KA 5DTBA 5I58B 5FTIA 3VE1B 4PFTA 4IY5A 1JEUA 3KSJA 4TQUQ 2WOPA 3S9NC 3MC2A 4FATA 4KCCA 3JYRA 4BDRA 5I56A 2R6GE 2HCAA 2PBWA 5FHOA 1LAXA 3T9UA 1B0HA 4JB7A 2GFEA 4ISUA 3OXNA 1YCJA 1BKAA 4OEVA 1R6ZA 5FHNA 4ZEDA 3K01A 1URSA 1B52A 1P1UA 1LAFE 3ONMA 3CSGA 2CZLA 4GD5A 1NNTA 4JWYA 1Y4CA 4OFOA 1POTA 4HS7A 3ZSFA 4RK9A 3IO6A 1B3FA 2W7YA 3DM0A 1EH3A 4GXSB 3UK4A 2I4BA 3PD8A 4THIA 4YB5A 4OQOA 3KJTA 2BJJX 5DVFA 1DTZA 4DDDA 3O66A 3RQTA 3TEPA 3CRBA 3DRHA 4JBZA 3CFZA 4POWA 3TQLA 4P0IA 3K0VA 3K6XA 4GQOA 2DE2A 1ZLQA 4MLQA 3RTWB 4FORA 1MPCA 1B40A 4HTGA 4N07A 2Y7RA 3OEKA 4X1DA 3CFLA 5H8NA 2FYIA 4ZZAA 3KGCA 3QK6A 2XXVA 2GH9A 3H3GA 2ALUA 2DSFA 1B7HA 1BIYA 4BDQA 3H4ZA 3T22A 3H03A 3BFTA 5KZTA 2UVIA 2H99A 3TTMA 4LQ5A 1Y3PA 1UIVA 1BP5A 1LGBC 3HSTA 2ANJA 4KYSA 3U8QA 1DMBA 1MQHA 1OMPA 1S7YA 3PMVA 4ECFA 4H6DA 1YAEA 1VFEA 4F19A 1B7UA 1D4NA 1D3KA 1PBQA 4I9DA 2IA4A 1LB9A 3TYHA 5J1DA 4U1OA 2GHAA 4LZ8A 2G29A 3FGSA 3L6HA 3IOWA 3RPWA 2QJEA 4KYEA 2D5WA 3VFJA 1MPBA 3S4UA 4OFLA 1FTOA 1B3EA 2F7BA 1M5CA 4OMBA 2I6EA 1BLFA 2OWSA 3FVGA 2QSXA 3O6HA 4WKMA 3DRJA 2XXIA 3U92A 1CE2A 4JSDA 4G68A 3LR1A 3RNNA 3QIMA 1A8FA 4JXIA 1PBPA 3DELB 4AQ4A 4JDFA 4EDPA 1XVXA 2Z8DA 4YZZA 3THIA 2PYYA 4PE5B 3B6WA 2REGA 4ZZEA 3KSXA 3RN8A 4XKQA 4IO4A 3K02A 4KFQA 5I57B 1MQDA 3MZ9A 2F36A 1SVXB 3FV2A 2ONRA 2ABHA 1OLAA 4OESA 3E4RA 4RY1A 5B7DA 2HXWA 5EHMA 5ELVA 1DTGA 4G77A 1LAHE 2P0SA 1R9LA 1ATGA 2RC9A 4OXVA 3KN3A 3TFLA 3DRKA 1A40A 4ZEKA 1EZ9A 5ICTA 2X7PA 1PDAA 2NUVA 5CRYA 4HCWA 5HM4B 4F3GA 1A55A 1B2HA 1VE4A 3UORA 4ZEFA 1IIWA 3QSLA 4H8JA 3R6UA 2XXTA 1IXHA 4Q8RA 3LSXA 1FTJA 3TCGA 1WDNA 2Q88A 4I1DA 3SKPA 3FATA 1A8EA 1ELJA 3CG3A 2UVHA 1I6AA 1QKAA 2I3WA 5BWJA 2WOKA 2ZYKA 4H5GA 4XIGQ 1FQDA 5CBRA 4F29A 2PT2A 3T9HB 1ZIUA 1SQYA 1PB8A 4EF2A 4DXBA 3KFMA 5CMCA 3VXCA 5A5XA 4MFIA 1D9VA 3QXMA 1P1NA 2XXPA 4F3SA 4ELPA 2VD2A 3Q25A 4BDLA 1XT8A 1H43A 2PX1A 1VSOA 5BUUA 3FZVA 4OERA 1H45A 4F22A 4NF6A 4YAHX 1ZBMA 5I2NB 3T66A 4G8NA 3W15C 4WXJA 3FJMA 3OO7A 3PPOA 2F5XA 4F1VA 2UYEA 3D4CA 4QSCA 3N6UA 5M2VA 1JVYA 3HN0A 1UTBA 2Y7WA 2F78A 1MXZA 3EHSA 3MW0A 1USYE 3W9VA 2A5TA 1S50A 1MY1A 1MQIA 3LUYA 2QS1A 1M5BA 4Q0CA 5EHSA 5L8DA 3OSRA 1UQWA 1MY2A 4XKNA 1SD3A 4KQPA 5JEIA 3DRIA 4R2FA 2DWHA 1FQFA 4WEPA 3SEXA 4Q30B 4FAJA 4RXLA 1Y3QA 2DWJA 1A99A 2R9JA 2F6PA 4R73A 3B7DA 3PMXA 3A09A 4M1VA 4QSEA 1MXUA 4H67A 3RUMA 1HSEA 5ISUA 3UIFA 3GLBA 3N26A 3GBAA 3TMGA 2DVZA 3V89B 4NF5A 2QMWA 3VLWA 3Q29A 1P99A 4ONYA 1MY3A 3QAXA 4NF5B 3V5AA 3IOVA 4M4GA 1GTKA 3U93A 3V83A 2OZZA 3KZGA 2X7QA 4FEDA 4DXUA 2O1MA 3N6TA 2B3FA 3K00A 5H8HA 3MVYA 2O6AA 4IY6A 2KLFA 4MH5A 1AIVA 4ZEIA 5H8HB 4E0XA 3M3KA 2ONSA 2XD3A 5I2KA 3MP6A 1NNFA 5H8QA 5I2KB 3R7XA 3MZBA 1Z7ME 1VFDA 5H8QB 3MVWA 3Q28A 1B4HA 1ZU0A 3IJOB 1QJMA 5KDTA 1B05A 1FQAA 5KDTB 4XTCQ 4R9FA 3DP4A 4YKIA 4NWDA 4ZE9A 3FVKA 1MM7A 3CVGA 2AL4A 4F2QA 3G3IA 1DSNA 3I5OA 3PUVE 1B6HA 3MQ9A 3LSLA 1P1WA 3ILUB 3FASA 4ZEBA 1OVBA 3C32A 3KN8A 1B4ZA 5TP9A 5AA2D 1LBBA 5TP9B 4HCYA 2XD2A 3IO4A 3O28A 3TKDA 3LC8A 3T96B 3MAMA 5AA2B 3SEWA 4NF4B 1SDXA 4F1UA 3A3CA 4GF8A 1KWHA 2F7AA 1RKMA 2F34A 3IOTA 2X26A 4P11A 1XHYA 4R6YA 3PUWE 1Y9UA 2QS4A 2G93A 5IAIA 1NMUA 5CM6A 4R75A 3I6VA 4U4XA 1TXFA 4XXUA 3OD7A 2RF1A 2RCAA 1MQGA 1QVSA 3G3KA 1DOTA 4YICA 1B5IA 1QKBA 3P7IA 3T93B 4EXLA 4GL8A 3SEYA 4UACA 3C34A 1YPNA 3A3UA 4HW8A 3S9MC 3DP8A 4GOTA 4G68C 1B46A 1RYOA 2ESNA 3OEMA 3K1NA 4IB2A 3FJGA 4H8IA 4H5FA 2AYSA 3PPQA 5AE4A 3TTRA 4NMYA 1SI0A 1J1NA 1SBPA 2O68A 2P1SA 1SW5A 4PFYA 3RYAA 4ZE8A 1M5FA 1NKXA 1POY1 3PU5A 1Y20A 1WODA 2B65A 2A5SA 4OENA 1IUDA 3EF7A 4EQ9A 1JEVA 1A7LA 2GRVA 1A54A 1QUKA 1R1NA 2DE3A 3VLVA 3QUFA 2Y7IA 4IGRA 2PT1A 3H6VA 1D9YA 3VLUA 5FTHA 3UA8A 4WEDA 1R9QA 4QSDA 1B9JA 3S2VA 4BDOA 1MPDA 4U1ZA 5B70A 3K4UA 1XOCA 4YKPA 4RJZA 1MXVA 4ND9A 4U4SA 5I57A 3FXUA 3K6VA 2XXWA 3EHUA 2OCUA 2UYFA 3MVXA 4MBPA 1AL3A 3M3FA 3FUZA 3K6UA 4DIGA 3GXAA 2ONKE 1ANFA 1QULA 3CI8A 3R26A 2H25A 3KBRA 1O7TA 1SYIA 1VR5A 4UA8A 1QW0A 1B5JA 1PEBA 4RYAA 4EQBA 3TCFA 1JW4A 4PFUA 4YKKA 5EYFA 2V3TA 4Q5TA 4RNSA 4IO2A 3MBPA 1HSLA 3K2DA 3TTLA 3TTKA 1O64A 1LCFA 2XXYA 2ZYMA 4OTEA 3RTFB 3V8XB 3O6GA 3FVOA 4P0GA 4X48A 1IXGA 2F97A 3S9LC 3QYTA 4GL0A 5CMBA 5CC2A 3PUYE 3OMBA 4PETA 2F8DA 2HZLA 1LFIA 1I6BA 3KEIA 1I69A 3HPIA 1ZMGA 5AA4B 3H7MA 3RGYA 2XXQA 1LFHA 1O63A 4E0WA 1QUIA 4QRZA 5F1QA 2NWJA 2O7IA 4DCXA 5L9OA 1Y3NA 4ELRA 3D4GA 4GXAA 3LVUA 2QPQA 2V3QA 3KOTA 1RYXA 1GV8A 2Q9TA 1EZPA 3IR1A 1NH8A 1B1HA 2AL5A 3H6UA 4Z0IA 4F31B 1FQBA 2Q89A 1OLCA 2Q2AA 4N6PA 1Z7NE 1PC3A 3EQ1A 4GLIA 5JTYB 4C1TA 2RINA 1LBCA 3TUSA 4FJPA 4Z7EA 1IZ1A 4LATA 4O3BA 3TODA 5I59B 4OYVA 3KN7A 2VHAA 2ZMBA 3SESA 4FECA 3GZGA 3H6WA 1UTHA 5I2NA 1P1QA 3EHTA 2XX9A 1UTHB 3CR9A 1M5EA 4QFPA 1N7XA 1MXWA 1MDQA 3PPRA 3CFXA 2XX7A 1S9TA 2NOOA 4F2OA 2IEEA 2B3BA 2YJPA 1F9BA 2O7UA 1MXXA 4OVJA 2OBGA 2ZNTA 4EF1A 4R9GA 4AB6A 1US5A 1N04A 5L9MA 4ELQA 2NVUB 1MS7A 3IX1A 2CMOA 2V25A 1HSJA 1FQCA 4EXKA 2F6GA 4F3PA 5HBCA 1OVTA 1GGGA 2RC7A 3U1OA 3OO8A 2ZNSA 2XHDA 1IXIA 2I0BA 4ESWA 2Y84A 1B5HA 4KR5A 1AH5A 4G8MA 2VOZA 3PUZE 1IEJA 4LVQA 4R72A 2HZKA 4U2RA 3HHFA 1N0TA 4YB7A 4QFOA 1B58A 3OOAA 2V84A 2FNCA 2UXAA 3FIRA 4TOZA 4RK2A 2WKYA 1I6QA 3OENA 2V93A 4H1XA 5ICQA 1B1XA 3ZKLA 4H65A 3QUJA 2DQVA 3C9HA 3IORA 4KHZE 1NNPA 4ESXA 4XKPA 3RT8A 2ZNUA 2HEUA 2QMXA 1H44A 3T9VA 4FEBA 2ZXTA 3K1MA
chains in the Genus database with same CATH superfamily
4G4PA 4HXVA 3PGFA 2QVVA 1N7WA 5CBSA 3OO6A 5DVIA 4F39A 4QFKA 2V3UA 2XX8A 3WAFA 3FXBA 2I4CA 3E79A 5TU0A 2WBBA 1YTVA 4G2ZA 3DRFA 4X9TA 2BJIA 3SEVA 4O8MA 4YMAA 2I3VA 3LBSA 1AWBA 2H9BA 3VDFA 3ZKKA 4BDMA 4N4UA 3ZS6A 5I7IA 1N3XA 3FV1A 3IB0A 5TPAA 5CI5A 3N94A 2DYXA 3EPEA 4PFWA 1LEVA 5TPAB 3HCQA 1H3DA 4YB6A 5I56B 3EN3A 1LBZA 3O97A 2O84X 3USDA 1TFDA 2DDKA 4R2BA 3CHGA 3EKIA 4DXCA 5L9SA 1NFTA 2Y7PA 1JW1A 2P2AA 1XS5A 2WOLA 4TLLB 1G0HA 5LOMA 2Z8EA 3ISPA 4MLVA 2Z22A 2DXRA 5AA2A 4NF4A 3Q27A 3UN6A 2DS9A 3W9WA 4GVOA 4PP0A 3TELA 2Q2CA 2ZYNA 3PPPA 2PVUA 2XXRA 5CMMA 1Y1MA 4NGUA 1B7ZA 1LBYA 2PFZA 3JV9A 3K1PA 5AA1A 4QFLA 2P3NA 3L6GA 4GRKA 1AMFA 4C1UA 1FTLA 4G8HA 4QF9A 4OVPA 1FTMA 1Q35A 3T9XB 3RLFE 5LDZA 1FW0A 1MQJA 4JWXA 3GBBA 4U23A 1FBEA 1XC1A 2R71A 1FBPA 3E78A 4X8RA 1IXCA 3MPKA 2LAOA 1LLSA 4PAKA 1FPBA 4EQ7A 2XWOA 1FTKA 1MH3A 4U21A 2OWTA 2THIA 2E1SA 1XI6A 2FA7A 2NXOA 3BBRA 3WAEA 2UVJA 4OFJA 4YKJA 1FJ6A 4DCYA 5CMKA 3T1BA 3C36A 4GWOA 3MUQA 5H8NB 1SW4A 3B6TA 2HHMA 4GX4A 1NL5A 3O6IA 2OLBA 1MDP1 1FBDA 1URGA 3DLNA 1B32A 3G3FA 2QS3A 3PUXE 3UP9A 2Z23A 1L5TA 3IAZA 4OWDA 2I48A 1NNKA 3MVZA 2DOJA 1MM6A 5DT6A 4KI0E 4GWXA 2REJA 4QHQA 4JWOA 3DP6A 3ECRA 3MWBA 3PD9A 3VVDA 4FBPA 5AA3A 3FJ7A 4IO5A 4F18A 1YXIA 3O2AA 4BLAA 4ELOA 4IGTA 1CB6A 3TDJA 1GR2A 5H8SA 2Q8JA 4PFIA 5LTCA 5HPQA 3TCHA 1SI1A 1NV1A 2MKZA 3E3KA 1MG1A 1JVXA 3MPLA 1DK4A 4PE3A 4UABA 3O9PA 2OK2A 4I8CA 1Y4TA 2I58A 3C4MA 1SW1A 3H06B 2XA5A 2O51A 3F11A 4GBWA 1WVJA 1OQHA 3PMWA 2ZYOA 4O94A 4P1EA 5I5PA 1EZOA 4QBAA 1B3HA 2I0CA 2QVRA 5DYHA 5I84A 4OETA 1P1OA 1K9YA 4G68B 4H45A 3MZ1A 3VVFA 3LSWA 2XXHA 3TAJA 5IM2A 4KYDA 3BFUA 4X1BA 4OEUA 3OSQA 3VVEA 4LA9A 1B3GA 2UVGA 4O3CA 4BDNA 3IB2A 1LAGE 3CG1A 2Y7KA 4ZDMA 2HFBA 2Q74A 3MP8A 4FE8A 4OHNA 4PQJA 2VP1A 2XXXA 5DVJA 4POXA 1GVCA 4GFRA 2Y5LA 4IO7A 3TPAA 1FCKA 4GIZA 1IMEA 3PV0E 4I62A 3MP1A 3IL1B 1FPGA 4F1YA 3I3VA 3C33A 1ZKBA 2XXUA 2DVCA 3FXRA 4DE8A 3CIJA 3OELA 2QS2A 3PAMA 2OJTA 2F7CA 4LZ7A 3HHGA 2DWAA 5FHMA 4DLDA 5EYHA 4PDDA 4AB5A 4P1LA 5EQ8A 1IITA 2O1LA 4QFNA 2QRYA 2WBDA 3G3JA 4IO3A 5AA4A 1ZTYA 2O69A 4MNPA 4H46A 3IK6B 1INPA 1T0KA 4LONB 1JQFA 4N6KA 1TFAA 2P3VA 2DE4A 4DZ1A 3Q26A 2YLNA 5ITPA 1FQEA 3OO9A 3TTNA 1UIUA 1PB9A 3E13X 1B51A 1JNFA 1FPDA 2V4CA 3K6WA 1MRPA 4KPTA 2D3IA 3E9XA 4YU0A 2DP8A 3UGWA 3MJNA 1URDA 1XVYA 5ET8A 1N76A 1PB7A 3MYUA 3N5LA 2DXYA 4JSOA 4NTLA 3C31A 1II5A 1RDXA 2HAUA 1DPPA 4R74A 3PPNA 1IQ7A 4KCDA 3LSFB 3LV0A 1AOVA 5JTYA 4RPNA 3ODBA 2Y5KA 4LZ5A 1LCTA 4OANA 2E0SA 4LP2B 3KC1A 3SDFA 4DI4B 5H8FA 1MY4A 1LFGA 4KD5A 5I59A 1LBVA 2DWIA 1EU8A 3BKIB 1M5DA 5H8FB 4MF3A 3RY3A 4MIJA 5ESYA 3O29A 3HO7A 3KJ7A 4H0WA 2PFYA 2H4IA 5A5XB 3QMFA 4U22A 3FBPA 4F3BA 4N8GA 1LB8A 3D1RA 3U72A 1DPEA 5JK4A 4RA1A 2CZKA 2HAVA 2RKMA 1BTJA 4XKRA 4ZS9A 1OQGA 3RT6B 2QL3A 3M8UA 3S9EA 4NF6B 4R6HA 1JETA 4PTKA 3B6QA 1MH4A 4HE0A 1G0IA 3HV1A 3AXFA 3VV5A 2OWZA 2YPNA 5K2YA 3C35A 4TLMB 1FJ9A 2RC8A 4LQ2A 3FTOA 1NUYA 1FPLA 1UTBB 3VXBA 4O3AA 1SW2A 4XFEA 2B4MA 1US4A 4EUOA 3RYBA 3FVNA 2A5TB 1TT1A 1TWYA 4I3YA 4NE4A 2GHBA 1MY0A 1H76A 3IJXB 1NH7A 1Y1ZA 1OIBA 4IO6A 1B3LA 2HQ0A 1SPIA 3M3LA 1LBWA 1ZJLA 2F35A 5ITOA 4GX6A 3IOUA 3KG2A 3FXQA 4FIMA 3G3HA 3IB1A 2H98A 3ILTB 2I49A 4ZECA 1LBXA 3CSBA 4LUBA 3TQWA 4K3FA 2M8CA 4P9KA 1B0LA 3DRGA 5DW8A 5DEXA 3SEUA 1USYH 5DEXB 2AIXA 5I3SA 4C0RA 4XEQA 1N3WA 1MXYA 5K2XA 2D21A 2H5YA 3KOSA 4RPOA 1YYZA 2Z8FA 3U94A 2RCBA 5F7VA 3JZJA 1NV0A 5KCJA 4OZ9A 3SETA 1Q1KA 1N84A 5KCJB 1JW5A 2VD3A 4NEDA 3H6TA 3G3GA 4L17A 4YMBA 2FVZA 5IKBA 3TZAA 3FD3A 2FHYA 2VGQA 5FBPA 3SERA 3G7WA 3O6PA 4P3LA 4NWCA 4NF8A 2B4LA 4N13A 2PMSA 1QUJA 5I58A 1SYHA 1FBHA 1LSTA 4NF8B 4R6KA 5DTBA 5I58B 1DBZA 5FTIA 3VE1B 1FRPA 4PFTA 4IY5A 1JEUA 3KSJA 4TQUQ 4P8BA 3U65A 2WOPA 3S9NC 3MC2A 4FATA 4KCCA 3JYRA 4BDRA 5I56A 2R6GE 4GWSA 2HCAA 2PBWA 5FHOA 1LAXA 3T9UA 1B0HA 4JB7A 2GFEA 4ISUA 3OXNA 1YCJA 1BKAA 4OEVA 2ZZXA 3LUZA 1R6ZA 5FHNA 4ZEDA 3K01A 1URSA 4MHFA 3BIGA 1B52A 1P1UA 1KA0A 1LAFE 3ONMA 3CSGA 2CZLA 4GD5A 1NNTA 1CNQA 4JWYA 1Y4CA 4OFOA 1POTA 3RPLB 4HS7A 4XF5A 3ZSFA 4RK9A 3IO6A 1KZ8A 1B3FA 2W7YA 3DM0A 1EH3A 1NUWA 4GXSB 3UK4A 1NUZA 1DCUA 2I4BA 5J16A 3PD8A 4THIA 4YB5A 4OQOA 3KJTA 2BJJX 5DVFA 1DTZA 4DDDA 3O66A 3RQTA 2ZZVA 3TEPA 3CRBA 3DRHA 4JBZA 4N17A 3CFZA 4POWA 3TQLA 4P0IA 3K0VA 3K6XA 4GQOA 4MAGA 2DE2A 1ZLQA 4MLQA 3RTWB 4FORA 1MPCA 1B40A 4HTGA 4N07A 2Y7RA 1FBCA 4NX1A 3OEKA 4X1DA 3CFLA 5H8NA 2FYIA 4ZZAA 2XWIA 3KGCA 3QK6A 2XXVA 2GH9A 3H3GA 2ALUA 4GWUA 4NHBA 2DSFA 1B7HA 1BIYA 4BDQA 3H4ZA 3T22A 3H03A 3BFTA 5KZTA 2UVIA 2H99A 3TTMA 3NOHA 4LQ5A 3KBZA 1Y3PA 1UIVA 3PTYA 1BP5A 1LGBC 2KR0A 5IZ1A 3HSTA 2ANJA 4KYSA 3U8QA 1DMBA 1MQHA 1OMPA 1S7YA 3PMVA 4ECFA 4H6DA 1YAEA 1VFEA 4F19A 1B7UA 1D4NA 4OVTA 1D3KA 1PBQA 4I9DA 2IA4A 1LB9A 3TYHA 5J1DA 4U1OA 2GHAA 4LZ8A 4NQ8A 2G29A 4HE1A 3FGSA 3L6HA 3IOWA 3RPWA 2QJEA 4KYEA 2D5WA 3VFJA 1MPBA 3S4UA 4OFLA 1FTOA 1B3EA 2F7BA 1M5CA 4OMBA 2I6EA 1BLFA 2OWSA 3FVGA 1FPIA 2QSXA 3O6HA 4WKMA 3DRJA 2XXIA 3U92A 1CE2A 4JSDA 4G68A 3LR1A 4GWYA 3RNNA 3QIMA 1A8FA 4JXIA 1PBPA 3DELB 4AQ4A 4I40A 4JDFA 4EDPA 1XVXA 2Z8DA 4YZZA 3THIA 2PYYA 4PE5B 3B6WA 2REGA 2WYPA 4ZZEA 3KSXA 3RN8A 4XKQA 4IO4A 3K02A 4KFQA 5I57B 1EYKA 1MQDA 3MZ9A 2F36A 1SVXB 3FV2A 4P47A 2ONRA 2ABHA 1OLAA 4OESA 3E4RA 4RY1A 5B7DA 2HXWA 5EHMA 1NV5A 5ELVA 1DTGA 2VPNA 4G77A 3B8BA 1LAHE 2P0SA 4JVDA 1NI9A 1R9LA 1ATGA 2RC9A 4MJOA 4OXVA 3KN3A 3TFLA 3DRKA 1A40A 4ZEKA 1EZ9A 5ICTA 2X7PA 1PDAA 2NUVA 4KXPA 4NAPA 4HCWA 5CRYA 5HM4B 4F3GA 1A55A 4MMPA 1B2HA 1NV2A 4QXDA 1VE4A 4NF0A 3UORA 4ZEFA 1IIWA 3QSLA 4H8JA 3R6UA 2XXTA 1IXHA 4Q8RA 3LSXA 1FTJA 3TCGA 1WDNA 2Q88A 4I1DA 3SKPA 3FATA 1A8EA 1ELJA 3CG3A 2UVHA 1IMDA 1I6AA 1QKAA 1QGXA 2I3WA 4NN3A 5BWJA 2WOKA 2ZYKA 4H5GA 1NUXA 2R8TA 4XIGQ 2VPOA 1FQDA 5CBRA 4F29A 2PT2A 3T9HB 1ZIUA 3IFAA 1SQYA 4N15A 1PB8A 4EF2A 4DXBA 3KFMA 5CMCA 3VXCA 5A5XA 4MFIA 1D9VA 1RDZA 3QXMA 1P1NA 2XXPA 4F3SA 4ELPA 4PF8A 5ET5A 2VD2A 3Q25A 4BDLA 4N81A 1FPJA 4PGPA 5IZ3A 1XT8A 1H43A 2PX1A 5IZ3B 4IR8A 1VSOA 5BUUA 3FZVA 4OERA 1H45A 4O7MA 4F22A 4NF6A 4YAHX 1ZBMA 5I2NB 3T66A 4G8NA 3W15C 4WXJA 3FJMA 3OO7A 3PPOA 2F5XA 4F1VA 2UYEA 3D4CA 4QSCA 3N6UA 5M2VA 1JVYA 3HN0A 2HPGA 4I3EA 1UTBA 2Y7WA 2F78A 1MXZA 3EHSA 3MW0A 2WYKA 1USYE 3W9VA 2A5TA 1S50A 1MY1A 1MQIA 3LUYA 2QS1A 1M5BA 4Q0CA 5EHSA 2WX9A 2XWVA 5L8DA 3OSRA 4GX3A 1UQWA 1MY2A 4XKNA 1SD3A 4KQPA 5JEIA 3DRIA 1D9QA 4R2FA 2DWHA 1FQFA 4HE2A 4WEPA 3SEXA 2GQ1A 4Q30B 4FAJA 4RXLA 1Y3QA 2DWJA 1A99A 2R9JA 2F6PA 4R73A 3B7DA 3PMXA 2Q8MA 3A09A 4M1VA 3KC0A 4QSEA 1MXUA 4H67A 3RUMA 5EQ7A 1HSEA 5EQAA 5ISUA 3UIFA 3GLBA 3N26A 3GBAA 4P56A 2QFLA 3TMGA 2DVZA 3V89B 4NF5A 2QMWA 3VLWA 3Q29A 1P99A 4ONYA 1MY3A 3QAXA 1RDYA 1FTAA 4NF5B 3V5AA 4O7IA 3IOVA 4M4GA 1GTKA 3U93A 4PDHA 1FSAA 3V83A 2OZZA 3KZGA 2X7QA 4FEDA 4DXUA 2O1MA 3N6TA 1FPFA 2B3FA 3K00A 5H8HA 3MVYA 2O6AA 4IY6A 2KLFA 4MH5A 1AIVA 4X04A 4ZEIA 5H8HB 4E0XA 3M3KA 2ONSA 2XD3A 5I2KA 3MP6A 1NNFA 5H8QA 5I2KB 3R7XA 3MZBA 1Z7ME 1VFDA 5H8QB 3MVWA 3Q28A 1B4HA 1ZU0A 1NV7A 3IJOB 1QJMA 5KDTA 2CZHA 1B05A 1FQAA 5KDTB 4XTCQ 4R9FA 3DP4A 4YKIA 2JJKA 4NWDA 4ZE9A 3FVKA 1MM7A 3GYYA 3CVGA 2AL4A 4F2QA 3G3IA 1DSNA 3I5OA 3PUVE 1B6HA 3MQ9A 3LSLA 3RPLA 1P1WA 3ILUB 3FASA 4ZEBA 2WEFA 1OVBA 3C32A 3KN8A 4OVQA 1B4ZA 5TP9A 5AA2D 1LBBA 5TP9B 4HCYA 2XD2A 3IO4A 3O28A 4MX6A 2VT5A 3TKDA 3LC8A 3T96B 3MAMA 5AA2B 4G61A 3SEWA 4NF4B 1SDXA 4F1UA 3A3CA 4GF8A 1KWHA 2HXRA 2F7AA 1RKMA 2F34A 4GWZA 3IOTA 2X26A 4P11A 1XHYA 4R6YA 4PGNA 2FIEA 3PUWE 1Y9UA 2QS4A 2G93A 5IAIA 4AS4A 1NMUA 5CM6A 1NV3A 5ET6A 4R75A 3I6VA 4U4XA 1TXFA 4XXUA 3OD7A 2RF1A 2RCAA 1MQGA 1QVSA 3G3KA 1DOTA 4YICA 1B5IA 1QKBA 3P7IA 3T93B 4EXLA 4GL8A 3SEYA 4UACA 3C34A 1YPNA 3A3UA 4HW8A 2F3DA 3S9MC 3DP8A 4GOTA 4G68C 1B46A 1RYOA 5T3JA 2ESNA 3OEMA 3K1NA 4IB2A 3FJGA 1JP4A 4H8IA 4H5FA 2AYSA 2FIXA 3PPQA 5AE4A 3TTRA 4NMYA 1FPKA 2FBPA 1SI0A 1J1NA 1SBPA 2O68A 2P1SA 1NV4A 1SW5A 4PAFA 4PFYA 3RYAA 4PBHA 4N6DA 4ZE8A 1M5FA 1NKXA 1VDWA 1POY1 1YZ0A 3PU5A 1Y20A 4PAIA 1WODA 2B65A 2A5SA 4OENA 1IUDA 1EYJA 3EF7A 4EQ9A 1JEVA 1A7LA 2GRVA 1A54A 1QUKA 1R1NA 2DE3A 3VLVA 4GWWA 4JVIA 3QUFA 2Y7IA 4IGRA 2PT1A 3H6VA 1D9YA 3VLUA 5FTHA 3UA8A 4WEDA 4PCDA 1R9QA 4QSDA 1B9JA 1FPEA 3S2VA 4BDOA 1MPDA 4U1ZA 5B70A 3K4UA 1XOCA 4AS5A 5IGAA 4YKPA 1EYIA 1FBFA 4MNCA 4RJZA 1MXVA 4ND9A 4U4SA 5I57A 3FXUA 3K6VA 2XXWA 3EHUA 2OCUA 2UYFA 3MVXA 4MBPA 1AL3A 3M3FA 4MCOA 3FUZA 3K6UA 4DIGA 3GXAA 2ONKE 1ANFA 1QULA 3CI8A 3R26A 4NG7A 2H25A 4LN5A 5EQ9A 3KBRA 1O7TA 1SYIA 1VR5A 4UA8A 1QW0A 1B5JA 1PEBA 4RYAA 4EQBA 3TCFA 1JW4A 4PFUA 4YKKA 5EYFA 2V3TA 4Q5TA 4RNSA 4IO2A 3MBPA 5IZZA 1HSLA 3K2DA 3TTLA 3TTKA 1O64A 1LCFA 2XXYA 2ZYMA 3ROJA 4OTEA 3RTFB 3O6GA 3V8XB 3FVOA 4P0GA 4X48A 1IXGA 2F97A 1NV6A 3QYTA 3S9LC 4GL0A 5CMBA 5CC2A 3PUYE 3OMBA 4PF6A 4PETA 2F8DA 2HZLA 4JVCA 1IMAA 1LFIA 1IMFA 1I6BA 3KEIA 1I69A 3HPIA 1ZMGA 5AA4B 3H7MA 3RGYA 2XXQA 2ZZWA 4MEVA 1LFHA 1O63A 2PCRA 4MNIA 1IMBA 4E0WA 1QUIA 4QRZA 5F1QA 2NWJA 2O7IA 4DCXA 5L9OA 1BK4A 1Y3NA 4ELRA 3D4GA 4GXAA 3LVUA 2QPQA 4N8YA 2V3QA 1K9ZA 1KA1A 2KQZA 3KOTA 1RYXA 1GV8A 2Q9TA 2CZIA 1EZPA 2L5VA 3IR1A 1IMCA 1NH8A 1B1HA 2AL5A 3H6UA 4Z0IA 2F3BA 4F31B 1FQBA 2Q89A 1OLCA 2Q2AA 4N6PA 1Z7NE 1PC3A 3RYDA 5F24A 4DI3D 3EQ1A 4GLIA 2CEXA 4PBQA 5JTYB 4C1TA 2RINA 1LBCA 3TUSA 4OA4A 4FJPA 4Z7EA 1IZ1A 3A29A 4LATA 4O3BA 3TODA 5I59B 4OYVA 3KN7A 2VHAA 2ZMBA 3SESA 4FECA 3GZGA 3H6WA 1UTHA 5I2NA 1P1QA 3EHTA 2XX9A 1UTHB 3CR9A 3HFUA 1M5EA 4QFPA 1N7XA 1MXWA 1MDQA 3PPRA 3CFXA 2XX7A 1S9TA 4GBVA 3MSTA 2NOOA 5ET7A 2XWKA 4F2OA 2IEEA 2B3BA 2YJPA 1F9BA 2O7UA 1MXXA 4OVJA 2QVUA 2OBGA 3B50A 2ZNTA 4EF1A 4R9GA 4AB6A 1US5A 1N04A 5L9MA 4PC9A 5EYGA 4ELQA 2NVUB 1MS7A 3IX1A 2CMOA 2V25A 3IFCA 1HSJA 4PFRA 2OX3A 1FQCA 4EXKA 2F6GA 4F3PA 1Q9DA 5HBCA 1OVTA 1GGGA 2RC7A 3U1OA 3OO8A 2ZNSA 2XHDA 1IXIA 2I0BA 4ESWA 1FBGA 2Y84A 1B5HA 4KR5A 1AH5A 2CEYA 4G8MA 4OVSA 2VOZA 3PUZE 1IEJA 4LVQA 4R72A 2HZKA 4U2RA 3HHFA 1N0TA 4YB7A 4QFOA 1B58A 3BIHA 3OOAA 2V84A 2FNCA 2UXAA 3FIRA 4N91A 4TOZA 5A5LA 4RK2A 2WKYA 1I6QA 3OENA 2V93A 4H1XA 5ICQA 1B1XA 4PFBA 3T0JA 3ZKLA 4H65A 3QUJA 2DQVA 3C9HA 3IORA 3SZPA 4KHZE 1NNPA 4ESXA 4XKPA 3RT8A 2XXKA 2ZNUA 2HEUA 2QMXA 1H44A 3T9VA 4FEBA 4OVRA 2ZXTA 3K1MA
chains in the Genus database with same CATH topology
4G4PA 3PGFA 1N7WA 5CBSA 3OO6A 5DVIA 4F39A 4QFKA 2V3UA 2XX8A 3WAFA 2I4CA 5TU0A 1YTVA 4G2ZA 3DRFA 4X9TA 3SEVA 4YMAA 2I3VA 3LBSA 2H9BA 3VDFA 3ZKKA 4BDMA 3ZS6A 1N3XA 3FV1A 3IB0A 5TPAA 5CI5A 3N94A 2DYXA 3EPEA 4PFWA 5TPAB 3HCQA 1H3DA 4YB6A 5I56B 3EN3A 3O97A 2O84X 3USDA 1TFDA 4R2BA 3CHGA 4DXCA 5L9SA 1NFTA 2Y7PA 1JW1A 2P2AA 1XS5A 2WOLA 4TLLB 5LOMA 2Z8EA 4MLVA 2Z22A 2DXRA 5AA2A 4NF4A 3Q27A 3UN6A 2DS9A 3W9WA 4GVOA 4PP0A 3TELA 2Q2CA 2ZYNA 3PPPA 2PVUA 2XXRA 5CMMA 1Y1MA 1B7ZA 3K1PA 3JV9A 5AA1A 4QFLA 3L6GA 4GRKA 1AMFA 4C1UA 1FTLA 4G8HA 4QF9A 1FTMA 1Q35A 3T9XB 3RLFE 1FW0A 1MQJA 4JWXA 3GBBA 4U23A 1XC1A 2R71A 1IXCA 3MPKA 2LAOA 1LLSA 4EQ7A 1FTKA 1MH3A 4U21A 2OWTA 2THIA 2E1SA 2FA7A 2NXOA 3BBRA 3WAEA 2UVJA 4OFJA 4YKJA 4DCYA 5CMKA 3C36A 4GWOA 3MUQA 5H8NB 1SW4A 3B6TA 1NL5A 3O6IA 2OLBA 1MDP1 1URGA 3DLNA 1B32A 3G3FA 2QS3A 3PUXE 3UP9A 2Z23A 1L5TA 3IAZA 4OWDA 2I48A 1NNKA 3MVZA 2DOJA 1MM6A 5DT6A 4KI0E 2REJA 4QHQA 4JWOA 3DP6A 3ECRA 3MWBA 3PD9A 3VVDA 5AA3A 3FJ7A 4IO5A 4F18A 3O2AA 4BLAA 4ELOA 4IGTA 1CB6A 3TDJA 1GR2A 5H8SA 2Q8JA 5HPQA 3TCHA 1SI1A 3E3KA 1MG1A 1JVXA 3MPLA 3O9PA 2OK2A 4I8CA 1Y4TA 2I58A 3C4MA 1SW1A 3H06B 3F11A 2O51A 1WVJA 1OQHA 3PMWA 2ZYOA 1EZOA 1B3HA 2I0CA 5DYHA 5I84A 4OETA 1P1OA 4G68B 3MZ1A 3VVFA 3LSWA 2XXHA 3TAJA 4KYDA 3BFUA 4X1BA 4OEUA 3OSQA 3VVEA 4LA9A 1B3GA 2UVGA 4O3CA 4BDNA 3IB2A 1LAGE 3CG1A 2Y7KA 4ZDMA 2HFBA 3MP8A 4FE8A 4OHNA 4PQJA 2VP1A 2XXXA 5DVJA 4POXA 1GVCA 4GFRA 4IO7A 3TPAA 1FCKA 4GIZA 3PV0E 4I62A 3MP1A 3IL1B 4F1YA 3I3VA 3C33A 1ZKBA 2XXUA 2DVCA 3FXRA 4DE8A 3CIJA 3OELA 2QS2A 3PAMA 2OJTA 2F7CA 4LZ7A 3HHGA 2DWAA 5FHMA 4DLDA 4AB5A 1IITA 2O1LA 4QFNA 2QRYA 3G3JA 4IO3A 5AA4A 1ZTYA 2O69A 3IK6B 1T0KA 4LONB 1JQFA 1TFAA 2DE4A 4DZ1A 3Q26A 2YLNA 5ITPA 1FQEA 3OO9A 3TTNA 1UIUA 1PB9A 3E13X 1B51A 1JNFA 3K6WA 1MRPA 4KPTA 2D3IA 3E9XA 4YU0A 2DP8A 3UGWA 3MJNA 1URDA 1XVYA 1N76A 1PB7A 3N5LA 2DXYA 4JSOA 4NTLA 3C31A 1II5A 2HAUA 1DPPA 4R74A 3PPNA 1IQ7A 4KCDA 3LSFB 1AOVA 5JTYA 4RPNA 3ODBA 4LZ5A 1LCTA 2E0SA 4LP2B 3SDFA 5H8FA 1MY4A 1LFGA 4KD5A 5I59A 2DWIA 1EU8A 3BKIB 1M5DA 5H8FB 4MF3A 3RY3A 3O29A 3HO7A 3KJ7A 4H0WA 2H4IA 5A5XB 4U22A 4F3BA 1LB8A 3U72A 1DPEA 5JK4A 4RA1A 2HAVA 2RKMA 1BTJA 4XKRA 4ZS9A 1OQGA 3RT6B 2QL3A 3M8UA 3S9EA 4NF6B 4R6HA 1JETA 3B6QA 1MH4A 3HV1A 3AXFA 3VV5A 2YPNA 5K2YA 3C35A 4TLMB 2RC8A 4LQ2A 3FTOA 1UTBB 3VXBA 4O3AA 1SW2A 2B4MA 1US4A 4EUOA 3RYBA 3FVNA 2A5TB 1TT1A 1TWYA 4NE4A 2GHBA 1MY0A 1H76A 3IJXB 1NH7A 1Y1ZA 1OIBA 4IO6A 1B3LA 2HQ0A 3M3LA 1ZJLA 2F35A 5ITOA 3IOUA 3KG2A 3FXQA 4FIMA 3G3HA 3IB1A 2H98A 3ILTB 2I49A 4ZECA 3CSBA 4LUBA 3TQWA 4K3FA 2M8CA 1B0LA 3DRGA 5DEXA 3SEUA 1USYH 5DEXB 2AIXA 4C0RA 1N3WA 1MXYA 5K2XA 2D21A 2H5YA 3KOSA 4RPOA 2Z8FA 3U94A 2RCBA 5F7VA 3JZJA 5KCJA 4OZ9A 3SETA 1Q1KA 1N84A 5KCJB 1JW5A 2VD3A 4NEDA 3H6TA 3G3GA 4L17A 4YMBA 5IKBA 3TZAA 3FD3A 2VGQA 3SERA 3G7WA 3O6PA 4NWCA 4NF8A 2B4LA 4N13A 2PMSA 1QUJA 5I58A 1SYHA 1LSTA 4NF8B 4R6KA 5DTBA 5I58B 5FTIA 3VE1B 4PFTA 4IY5A 1JEUA 3KSJA 4TQUQ 2WOPA 3S9NC 3MC2A 4FATA 4KCCA 3JYRA 4BDRA 5I56A 2R6GE 2HCAA 2PBWA 5FHOA 1LAXA 3T9UA 1B0HA 4JB7A 2GFEA 4ISUA 3OXNA 1YCJA 1BKAA 4OEVA 1R6ZA 5FHNA 4ZEDA 3K01A 1URSA 1B52A 1P1UA 1LAFE 3ONMA 3CSGA 2CZLA 4GD5A 1NNTA 4JWYA 1Y4CA 4OFOA 1POTA 4HS7A 3ZSFA 4RK9A 3IO6A 1B3FA 2W7YA 3DM0A 1EH3A 4GXSB 3UK4A 2I4BA 3PD8A 4THIA 4YB5A 4OQOA 3KJTA 2BJJX 5DVFA 1DTZA 4DDDA 3O66A 3RQTA 3TEPA 3CRBA 3DRHA 4JBZA 3CFZA 4POWA 3TQLA 4P0IA 3K0VA 3K6XA 4GQOA 2DE2A 1ZLQA 4MLQA 3RTWB 4FORA 1MPCA 1B40A 4HTGA 4N07A 2Y7RA 3OEKA 4X1DA 3CFLA 5H8NA 2FYIA 4ZZAA 3KGCA 3QK6A 2XXVA 2GH9A 3H3GA 2ALUA 2DSFA 1B7HA 1BIYA 4BDQA 3H4ZA 3T22A 3H03A 3BFTA 5KZTA 2UVIA 2H99A 3TTMA 4LQ5A 1Y3PA 1UIVA 1BP5A 1LGBC 3HSTA 2ANJA 4KYSA 3U8QA 1DMBA 1MQHA 1OMPA 1S7YA 3PMVA 4ECFA 4H6DA 1YAEA 1VFEA 4F19A 1B7UA 1D4NA 1D3KA 1PBQA 4I9DA 2IA4A 1LB9A 3TYHA 5J1DA 4U1OA 2GHAA 4LZ8A 2G29A 3FGSA 3L6HA 3IOWA 3RPWA 2QJEA 4KYEA 2D5WA 3VFJA 1MPBA 3S4UA 4OFLA 1FTOA 1B3EA 2F7BA 1M5CA 4OMBA 2I6EA 1BLFA 2OWSA 3FVGA 2QSXA 3O6HA 4WKMA 3DRJA 2XXIA 3U92A 1CE2A 4JSDA 4G68A 3LR1A 3RNNA 3QIMA 1A8FA 4JXIA 1PBPA 3DELB 4AQ4A 4JDFA 4EDPA 1XVXA 2Z8DA 4YZZA 3THIA 2PYYA 4PE5B 3B6WA 2REGA 4ZZEA 3KSXA 3RN8A 4XKQA 4IO4A 3K02A 4KFQA 5I57B 1MQDA 3MZ9A 2F36A 1SVXB 3FV2A 2ONRA 2ABHA 1OLAA 4OESA 3E4RA 4RY1A 5B7DA 2HXWA 5EHMA 5ELVA 1DTGA 4G77A 1LAHE 2P0SA 1R9LA 1ATGA 2RC9A 4OXVA 3KN3A 3TFLA 3DRKA 1A40A 4ZEKA 1EZ9A 5ICTA 2X7PA 1PDAA 2NUVA 5CRYA 4HCWA 5HM4B 4F3GA 1A55A 1B2HA 1VE4A 3UORA 4ZEFA 1IIWA 3QSLA 4H8JA 3R6UA 2XXTA 1IXHA 4Q8RA 3LSXA 1FTJA 3TCGA 1WDNA 2Q88A 4I1DA 3SKPA 3FATA 1A8EA 1ELJA 3CG3A 2UVHA 1I6AA 1QKAA 2I3WA 5BWJA 2WOKA 2ZYKA 4H5GA 4XIGQ 1FQDA 5CBRA 4F29A 2PT2A 3T9HB 1ZIUA 1SQYA 1PB8A 4EF2A 4DXBA 3KFMA 5CMCA 3VXCA 5A5XA 4MFIA 1D9VA 3QXMA 1P1NA 2XXPA 4F3SA 4ELPA 2VD2A 3Q25A 4BDLA 1XT8A 1H43A 2PX1A 1VSOA 5BUUA 3FZVA 4OERA 1H45A 4F22A 4NF6A 4YAHX 1ZBMA 5I2NB 3T66A 4G8NA 3W15C 4WXJA 3FJMA 3OO7A 3PPOA 2F5XA 4F1VA 2UYEA 3D4CA 4QSCA 3N6UA 5M2VA 1JVYA 3HN0A 1UTBA 2Y7WA 2F78A 1MXZA 3EHSA 3MW0A 1USYE 3W9VA 2A5TA 1S50A 1MY1A 1MQIA 3LUYA 2QS1A 1M5BA 4Q0CA 5EHSA 5L8DA 3OSRA 1UQWA 1MY2A 4XKNA 1SD3A 4KQPA 5JEIA 3DRIA 4R2FA 2DWHA 1FQFA 4WEPA 3SEXA 4Q30B 4FAJA 4RXLA 1Y3QA 2DWJA 1A99A 2R9JA 2F6PA 4R73A 3B7DA 3PMXA 3A09A 4M1VA 4QSEA 1MXUA 4H67A 3RUMA 1HSEA 5ISUA 3UIFA 3GLBA 3N26A 3GBAA 3TMGA 2DVZA 3V89B 4NF5A 2QMWA 3VLWA 3Q29A 1P99A 4ONYA 1MY3A 3QAXA 4NF5B 3V5AA 3IOVA 4M4GA 1GTKA 3U93A 3V83A 2OZZA 3KZGA 2X7QA 4FEDA 4DXUA 2O1MA 3N6TA 2B3FA 3K00A 5H8HA 3MVYA 2O6AA 4IY6A 2KLFA 4MH5A 1AIVA 4ZEIA 5H8HB 4E0XA 3M3KA 2ONSA 2XD3A 5I2KA 3MP6A 1NNFA 5H8QA 5I2KB 3R7XA 3MZBA 1Z7ME 1VFDA 5H8QB 3MVWA 3Q28A 1B4HA 1ZU0A 3IJOB 1QJMA 5KDTA 1B05A 1FQAA 5KDTB 4XTCQ 4R9FA 3DP4A 4YKIA 4NWDA 4ZE9A 3FVKA 1MM7A 3CVGA 2AL4A 4F2QA 3G3IA 1DSNA 3I5OA 3PUVE 1B6HA 3MQ9A 3LSLA 1P1WA 3ILUB 3FASA 4ZEBA 1OVBA 3C32A 3KN8A 1B4ZA 5TP9A 5AA2D 1LBBA 5TP9B 4HCYA 2XD2A 3IO4A 3O28A 3TKDA 3LC8A 3T96B 3MAMA 5AA2B 3SEWA 4NF4B 1SDXA 4F1UA 3A3CA 4GF8A 1KWHA 2F7AA 1RKMA 2F34A 3IOTA 2X26A 4P11A 1XHYA 4R6YA 3PUWE 1Y9UA 2QS4A 2G93A 5IAIA 1NMUA 5CM6A 4R75A 3I6VA 4U4XA 1TXFA 4XXUA 3OD7A 2RF1A 2RCAA 1MQGA 1QVSA 3G3KA 1DOTA 4YICA 1B5IA 1QKBA 3P7IA 3T93B 4EXLA 4GL8A 3SEYA 4UACA 3C34A 1YPNA 3A3UA 4HW8A 3S9MC 3DP8A 4GOTA 4G68C 1B46A 1RYOA 2ESNA 3OEMA 3K1NA 4IB2A 3FJGA 4H8IA 4H5FA 2AYSA 3PPQA 5AE4A 3TTRA 4NMYA 1SI0A 1J1NA 1SBPA 2O68A 2P1SA 1SW5A 4PFYA 3RYAA 4ZE8A 1M5FA 1NKXA 1POY1 3PU5A 1Y20A 1WODA 2B65A 2A5SA 4OENA 1IUDA 3EF7A 4EQ9A 1JEVA 1A7LA 2GRVA 1A54A 1QUKA 1R1NA 2DE3A 3VLVA 3QUFA 2Y7IA 4IGRA 2PT1A 3H6VA 1D9YA 3VLUA 5FTHA 3UA8A 4WEDA 1R9QA 4QSDA 1B9JA 3S2VA 4BDOA 1MPDA 4U1ZA 5B70A 3K4UA 1XOCA 4YKPA 4RJZA 1MXVA 4ND9A 4U4SA 5I57A 3FXUA 3K6VA 2XXWA 3EHUA 2OCUA 2UYFA 3MVXA 4MBPA 1AL3A 3M3FA 3FUZA 3K6UA 4DIGA 3GXAA 2ONKE 1ANFA 1QULA 3CI8A 3R26A 2H25A 3KBRA 1O7TA 1SYIA 1VR5A 4UA8A 1QW0A 1B5JA 1PEBA 4RYAA 4EQBA 3TCFA 1JW4A 4PFUA 4YKKA 5EYFA 2V3TA 4Q5TA 4RNSA 4IO2A 3MBPA 1HSLA 3K2DA 3TTLA 3TTKA 1O64A 1LCFA 2XXYA 2ZYMA 4OTEA 3RTFB 3V8XB 3O6GA 3FVOA 4P0GA 4X48A 1IXGA 2F97A 3S9LC 3QYTA 4GL0A 5CMBA 5CC2A 3PUYE 3OMBA 4PETA 2F8DA 2HZLA 1LFIA 1I6BA 3KEIA 1I69A 3HPIA 1ZMGA 5AA4B 3H7MA 3RGYA 2XXQA 1LFHA 1O63A 4E0WA 1QUIA 4QRZA 5F1QA 2NWJA 2O7IA 4DCXA 5L9OA 1Y3NA 4ELRA 3D4GA 4GXAA 3LVUA 2QPQA 2V3QA 3KOTA 1RYXA 1GV8A 2Q9TA 1EZPA 3IR1A 1NH8A 1B1HA 2AL5A 3H6UA 4Z0IA 4F31B 1FQBA 2Q89A 1OLCA 2Q2AA 4N6PA 1Z7NE 1PC3A 3EQ1A 4GLIA 5JTYB 4C1TA 2RINA 1LBCA 3TUSA 4FJPA 4Z7EA 1IZ1A 4LATA 4O3BA 3TODA 5I59B 4OYVA 3KN7A 2VHAA 2ZMBA 3SESA 4FECA 3GZGA 3H6WA 1UTHA 5I2NA 1P1QA 3EHTA 2XX9A 1UTHB 3CR9A 1M5EA 4QFPA 1N7XA 1MXWA 1MDQA 3PPRA 3CFXA 2XX7A 1S9TA 2NOOA 4F2OA 2IEEA 2B3BA 2YJPA 1F9BA 2O7UA 1MXXA 4OVJA 2OBGA 2ZNTA 4EF1A 4R9GA 4AB6A 1US5A 1N04A 5L9MA 4ELQA 2NVUB 1MS7A 3IX1A 2CMOA 2V25A 1HSJA 1FQCA 4EXKA 2F6GA 4F3PA 5HBCA 1OVTA 1GGGA 2RC7A 3U1OA 3OO8A 2ZNSA 2XHDA 1IXIA 2I0BA 4ESWA 2Y84A 1B5HA 4KR5A 1AH5A 4G8MA 2VOZA 3PUZE 1IEJA 4LVQA 4R72A 2HZKA 4U2RA 3HHFA 1N0TA 4YB7A 4QFOA 1B58A 3OOAA 2V84A 2FNCA 2UXAA 3FIRA 4TOZA 4RK2A 2WKYA 1I6QA 3OENA 2V93A 4H1XA 5ICQA 1B1XA 3ZKLA 4H65A 3QUJA 2DQVA 3C9HA 3IORA 4KHZE 1NNPA 4ESXA 4XKPA 3RT8A 2ZNUA 2HEUA 2QMXA 1H44A 3T9VA 4FEBA 2ZXTA 3K1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4P A;  3PGF A;  1N7W A;  5CBS A;  3OO6 A;  5DVI A;  4F39 A;  4QFK A;  2V3U A;  2XX8 A;  3WAF A;  2I4C A;  5TU0 A;  1YTV A;  4G2Z A;  3DRF A;  4X9T A;  3SEV A;  4YMA A;  2I3V A;  3LBS A;  2H9B A;  3VDF A;  3ZKK A;  4BDM A;  3ZS6 A;  1N3X A;  3FV1 A;  3IB0 A;  5TPA A;  5CI5 A;  3N94 A;  2DYX A;  3EPE A;  4PFW A;  5TPA B;  3HCQ A;  1H3D A;  4YB6 A;  5I56 B;  3EN3 A;  3O97 A;  2O84 X;  3USD A;  1TFD A;  4R2B A;  3CHG A;  4DXC A;  5L9S A;  1NFT A;  2Y7P A;  1JW1 A;  2P2A A;  1XS5 A;  2WOL A;  4TLL B;  5LOM A;  2Z8E A;  4MLV A;  2Z22 A;  2DXR A;  5AA2 A;  4NF4 A;  3Q27 A;  3UN6 A;  2DS9 A;  3W9W A;  4GVO A;  4PP0 A;  3TEL A;  2Q2C A;  2ZYN A;  3PPP A;  2PVU A;  2XXR A;  5CMM A;  1Y1M A;  1B7Z A;  3K1P A;  3JV9 A;  5AA1 A;  4QFL A;  3L6G A;  4GRK A;  1AMF A;  4C1U A;  1FTL A;  4G8H A;  4QF9 A;  1FTM A;  1Q35 A;  3T9X B;  3RLF E;  1FW0 A;  1MQJ A;  4JWX A;  3GBB A;  4U23 A;  1XC1 A;  2R71 A;  1IXC A;  3MPK A;  2LAO A;  1LLS A;  4EQ7 A;  1FTK A;  1MH3 A;  4U21 A;  2OWT A;  2THI A;  2E1S A;  2FA7 A;  2NXO A;  3BBR A;  3WAE A;  2UVJ A;  4OFJ A;  4YKJ A;  4DCY A;  5CMK A;  3C36 A;  4GWO A;  3MUQ A;  5H8N B;  1SW4 A;  3B6T A;  1NL5 A;  3O6I A;  2OLB A;  1MDP 1;  1URG A;  3DLN A;  1B32 A;  3G3F A;  2QS3 A;  3PUX E;  3UP9 A;  2Z23 A;  1L5T A;  3IAZ A;  4OWD A;  2I48 A;  1NNK A;  3MVZ A;  2DOJ A;  1MM6 A;  5DT6 A;  4KI0 E;  2REJ A;  4QHQ A;  4JWO A;  3DP6 A;  3ECR A;  3MWB A;  3PD9 A;  3VVD A;  5AA3 A;  3FJ7 A;  4IO5 A;  4F18 A;  3O2A A;  4BLA A;  4ELO A;  4IGT A;  1CB6 A;  3TDJ A;  1GR2 A;  5H8S A;  2Q8J A;  5HPQ A;  3TCH A;  1SI1 A;  3E3K A;  1MG1 A;  1JVX A;  3MPL A;  3O9P A;  2OK2 A;  4I8C A;  1Y4T A;  2I58 A;  3C4M A;  1SW1 A;  3H06 B;  3F11 A;  2O51 A;  1WVJ A;  1OQH A;  3PMW A;  2ZYO A;  1EZO A;  1B3H A;  2I0C A;  5DYH A;  5I84 A;  4OET A;  1P1O A;  4G68 B;  3MZ1 A;  3VVF A;  3LSW A;  2XXH A;  3TAJ A;  4KYD A;  3BFU A;  4X1B A;  4OEU A;  3OSQ A;  3VVE A;  4LA9 A;  1B3G A;  2UVG A;  4O3C A;  4BDN A;  3IB2 A;  1LAG E;  3CG1 A;  2Y7K A;  4ZDM A;  2HFB A;  3MP8 A;  4FE8 A;  4OHN A;  4PQJ A;  2VP1 A;  2XXX A;  5DVJ A;  4POX A;  1GVC A;  4GFR A;  4IO7 A;  3TPA A;  1FCK A;  4GIZ A;  3PV0 E;  4I62 A;  3MP1 A;  3IL1 B;  4F1Y A;  3I3V A;  3C33 A;  1ZKB A;  2XXU A;  2DVC A;  3FXR A;  4DE8 A;  3CIJ A;  3OEL A;  2QS2 A;  3PAM A;  2OJT A;  2F7C A;  4LZ7 A;  3HHG A;  2DWA A;  5FHM A;  4DLD A;  4AB5 A;  1IIT A;  2O1L A;  4QFN A;  2QRY A;  3G3J A;  4IO3 A;  5AA4 A;  1ZTY A;  2O69 A;  3IK6 B;  1T0K A;  4LON B;  1JQF A;  1TFA A;  2DE4 A;  4DZ1 A;  3Q26 A;  2YLN A;  5ITP A;  1FQE A;  3OO9 A;  3TTN A;  1UIU A;  1PB9 A;  3E13 X;  1B51 A;  1JNF A;  3K6W A;  1MRP A;  4KPT A;  2D3I A;  3E9X A;  4YU0 A;  2DP8 A;  3UGW A;  3MJN A;  1URD A;  1XVY A;  1N76 A;  1PB7 A;  3N5L A;  2DXY A;  4JSO A;  4NTL A;  3C31 A;  1II5 A;  2HAU A;  1DPP A;  4R74 A;  3PPN A;  1IQ7 A;  4KCD A;  3LSF B;  1AOV A;  5JTY A;  4RPN A;  3ODB A;  4LZ5 A;  1LCT A;  2E0S A;  4LP2 B;  3SDF A;  5H8F A;  1MY4 A;  1LFG A;  4KD5 A;  5I59 A;  2DWI A;  1EU8 A;  3BKI B;  1M5D A;  5H8F B;  4MF3 A;  3RY3 A;  3O29 A;  3HO7 A;  3KJ7 A;  4H0W A;  2H4I A;  5A5X B;  4U22 A;  4F3B A;  1LB8 A;  3U72 A;  1DPE A;  5JK4 A;  4RA1 A;  2HAV A;  2RKM A;  1BTJ A;  4XKR A;  4ZS9 A;  1OQG A;  3RT6 B;  2QL3 A;  3M8U A;  3S9E A;  4NF6 B;  4R6H A;  1JET A;  3B6Q A;  1MH4 A;  3HV1 A;  3AXF A;  3VV5 A;  2YPN A;  5K2Y A;  3C35 A;  4TLM B;  2RC8 A;  4LQ2 A;  3FTO A;  1UTB B;  3VXB A;  4O3A A;  1SW2 A;  2B4M A;  1US4 A;  4EUO A;  3RYB A;  3FVN A;  2A5T B;  1TT1 A;  1TWY A;  4NE4 A;  2GHB A;  1MY0 A;  1H76 A;  3IJX B;  1NH7 A;  1Y1Z A;  1OIB A;  4IO6 A;  1B3L A;  2HQ0 A;  3M3L A;  1ZJL A;  2F35 A;  5ITO A;  3IOU A;  3KG2 A;  3FXQ A;  4FIM A;  3G3H A;  3IB1 A;  2H98 A;  3ILT B;  2I49 A;  4ZEC A;  3CSB A;  4LUB A;  3TQW A;  4K3F A;  2M8C A;  1B0L A;  3DRG A;  5DEX A;  3SEU A;  1USY H;  5DEX B;  2AIX A;  4C0R A;  1N3W A;  1MXY A;  5K2X A;  2D21 A;  2H5Y A;  3KOS A;  4RPO A;  2Z8F A;  3U94 A;  2RCB A;  5F7V A;  3JZJ A;  5KCJ A;  4OZ9 A;  3SET A;  1Q1K A;  1N84 A;  5KCJ B;  1JW5 A;  2VD3 A;  4NED A;  3H6T A;  3G3G A;  4L17 A;  4YMB A;  5IKB A;  3TZA A;  3FD3 A;  2VGQ A;  3SER A;  3G7W A;  3O6P A;  4NWC A;  4NF8 A;  2B4L A;  4N13 A;  2PMS A;  1QUJ A;  5I58 A;  1SYH A;  1LST A;  4NF8 B;  4R6K A;  5DTB A;  5I58 B;  5FTI A;  3VE1 B;  4PFT A;  4IY5 A;  1JEU A;  3KSJ A;  4TQU Q;  2WOP A;  3S9N C;  3MC2 A;  4FAT A;  4KCC A;  3JYR A;  4BDR A;  5I56 A;  2R6G E;  2HCA A;  2PBW A;  5FHO A;  1LAX A;  3T9U A;  1B0H A;  4JB7 A;  2GFE A;  4ISU A;  3OXN A;  1YCJ A;  1BKA A;  4OEV A;  1R6Z A;  5FHN A;  4ZED A;  3K01 A;  1URS A;  1B52 A;  1P1U A;  1LAF E;  3ONM A;  3CSG A;  2CZL A;  4GD5 A;  1NNT A;  4JWY A;  1Y4C A;  4OFO A;  1POT A;  4HS7 A;  3ZSF A;  4RK9 A;  3IO6 A;  1B3F A;  2W7Y A;  3DM0 A;  1EH3 A;  4GXS B;  3UK4 A;  2I4B A;  3PD8 A;  4THI A;  4YB5 A;  4OQO A;  3KJT A;  2BJJ X;  5DVF A;  1DTZ A;  4DDD A;  3O66 A;  3RQT A;  3TEP A;  3CRB A;  3DRH A;  4JBZ A;  3CFZ A;  4POW A;  3TQL A;  4P0I A;  3K0V A;  3K6X A;  4GQO A;  2DE2 A;  1ZLQ A;  4MLQ A;  3RTW B;  4FOR A;  1MPC A;  1B40 A;  4HTG A;  4N07 A;  2Y7R A;  3OEK A;  4X1D A;  3CFL A;  5H8N A;  2FYI A;  4ZZA A;  3KGC A;  3QK6 A;  2XXV A;  2GH9 A;  3H3G A;  2ALU A;  2DSF A;  1B7H A;  1BIY A;  4BDQ A;  3H4Z A;  3T22 A;  3H03 A;  3BFT A;  5KZT A;  2UVI A;  2H99 A;  3TTM A;  4LQ5 A;  1Y3P A;  1UIV A;  1BP5 A;  1LGB C;  3HST A;  2ANJ A;  4KYS A;  3U8Q A;  1DMB A;  1MQH A;  1OMP A;  1S7Y A;  3PMV A;  4ECF A;  4H6D A;  1YAE A;  1VFE A;  4F19 A;  1B7U A;  1D4N A;  1D3K A;  1PBQ A;  4I9D A;  2IA4 A;  1LB9 A;  3TYH A;  5J1D A;  4U1O A;  2GHA A;  4LZ8 A;  2G29 A;  3FGS A;  3L6H A;  3IOW A;  3RPW A;  2QJE A;  4KYE A;  2D5W A;  3VFJ A;  1MPB A;  3S4U A;  4OFL A;  1FTO A;  1B3E A;  2F7B A;  1M5C A;  4OMB A;  2I6E A;  1BLF A;  2OWS A;  3FVG A;  2QSX A;  3O6H A;  4WKM A;  3DRJ A;  2XXI A;  3U92 A;  1CE2 A;  4JSD A;  4G68 A;  3LR1 A;  3RNN A;  3QIM A;  1A8F A;  4JXI A;  1PBP A;  3DEL B;  4AQ4 A;  4JDF A;  4EDP A;  1XVX A;  2Z8D A;  4YZZ A;  3THI A;  2PYY A;  4PE5 B;  3B6W A;  2REG A;  4ZZE A;  3KSX A;  3RN8 A;  4XKQ A;  4IO4 A;  3K02 A;  4KFQ A;  5I57 B;  1MQD A;  3MZ9 A;  2F36 A;  1SVX B;  3FV2 A;  2ONR A;  2ABH A;  1OLA A;  4OES A;  3E4R A;  4RY1 A;  5B7D A;  2HXW A;  5EHM A;  5ELV A;  1DTG A;  4G77 A;  1LAH E;  2P0S A;  1R9L A;  1ATG A;  2RC9 A;  4OXV A;  3KN3 A;  3TFL A;  3DRK A;  1A40 A;  4ZEK A;  1EZ9 A;  5ICT A;  2X7P A;  1PDA A;  2NUV A;  5CRY A;  4HCW A;  5HM4 B;  4F3G A;  1A55 A;  1B2H A;  1VE4 A;  3UOR A;  4ZEF A;  1IIW A;  3QSL A;  4H8J A;  3R6U A;  2XXT A;  1IXH A;  4Q8R A;  3LSX A;  1FTJ A;  3TCG A;  1WDN A;  2Q88 A;  4I1D A;  3SKP A;  3FAT A;  1A8E A;  1ELJ A;  3CG3 A;  2UVH A;  1I6A A;  1QKA A;  2I3W A;  5BWJ A;  2WOK A;  2ZYK A;  4H5G A;  4XIG Q;  1FQD A;  5CBR A;  4F29 A;  2PT2 A;  3T9H B;  1ZIU A;  1SQY A;  1PB8 A;  4EF2 A;  4DXB A;  3KFM A;  5CMC A;  3VXC A;  5A5X A;  4MFI A;  1D9V A;  3QXM A;  1P1N A;  2XXP A;  4F3S A;  4ELP A;  2VD2 A;  3Q25 A;  4BDL A;  1XT8 A;  1H43 A;  2PX1 A;  1VSO A;  5BUU A;  3FZV A;  4OER A;  1H45 A;  4F22 A;  4NF6 A;  4YAH X;  1ZBM A;  5I2N B;  3T66 A;  4G8N A;  3W15 C;  4WXJ A;  3FJM A;  3OO7 A;  3PPO A;  2F5X A;  4F1V A;  2UYE A;  3D4C A;  4QSC A;  3N6U A;  5M2V A;  1JVY A;  3HN0 A;  1UTB A;  2Y7W A;  2F78 A;  1MXZ A;  3EHS A;  3MW0 A;  1USY E;  3W9V A;  2A5T A;  1S50 A;  1MY1 A;  1MQI A;  3LUY A;  2QS1 A;  1M5B A;  4Q0C A;  5EHS A;  5L8D A;  3OSR A;  1UQW A;  1MY2 A;  4XKN A;  1SD3 A;  4KQP A;  5JEI A;  3DRI A;  4R2F A;  2DWH A;  1FQF A;  4WEP A;  3SEX A;  4Q30 B;  4FAJ A;  4RXL A;  1Y3Q A;  2DWJ A;  1A99 A;  2R9J A;  2F6P A;  4R73 A;  3B7D A;  3PMX A;  3A09 A;  4M1V A;  4QSE A;  1MXU A;  4H67 A;  3RUM A;  1HSE A;  5ISU A;  3UIF A;  3GLB A;  3N26 A;  3GBA A;  3TMG A;  2DVZ A;  3V89 B;  4NF5 A;  2QMW A;  3VLW A;  3Q29 A;  1P99 A;  4ONY A;  1MY3 A;  3QAX A;  4NF5 B;  3V5A A;  3IOV A;  4M4G A;  1GTK A;  3U93 A;  3V83 A;  2OZZ A;  3KZG A;  2X7Q A;  4FED A;  4DXU A;  2O1M A;  3N6T A;  2B3F A;  3K00 A;  5H8H A;  3MVY A;  2O6A A;  4IY6 A;  2KLF A;  4MH5 A;  1AIV A;  4ZEI A;  5H8H B;  4E0X A;  3M3K A;  2ONS A;  2XD3 A;  5I2K A;  3MP6 A;  1NNF A;  5H8Q A;  5I2K B;  3R7X A;  3MZB A;  1Z7M E;  1VFD A;  5H8Q B;  3MVW A;  3Q28 A;  1B4H A;  1ZU0 A;  3IJO B;  1QJM A;  5KDT A;  1B05 A;  1FQA A;  5KDT B;  4XTC Q;  4R9F A;  3DP4 A;  4YKI A;  4NWD A;  4ZE9 A;  3FVK A;  1MM7 A;  3CVG A;  2AL4 A;  4F2Q A;  3G3I A;  1DSN A;  3I5O A;  3PUV E;  1B6H A;  3MQ9 A;  3LSL A;  1P1W A;  3ILU B;  3FAS A;  4ZEB A;  1OVB A;  3C32 A;  3KN8 A;  1B4Z A;  5TP9 A;  5AA2 D;  1LBB A;  5TP9 B;  4HCY A;  2XD2 A;  3IO4 A;  3O28 A;  3TKD A;  3LC8 A;  3T96 B;  3MAM A;  5AA2 B;  3SEW A;  4NF4 B;  1SDX A;  4F1U A;  3A3C A;  4GF8 A;  1KWH A;  2F7A A;  1RKM A;  2F34 A;  3IOT A;  2X26 A;  4P11 A;  1XHY A;  4R6Y A;  3PUW E;  1Y9U A;  2QS4 A;  2G93 A;  5IAI A;  1NMU A;  5CM6 A;  4R75 A;  3I6V A;  4U4X A;  1TXF A;  4XXU A;  3OD7 A;  2RF1 A;  2RCA A;  1MQG A;  1QVS A;  3G3K A;  1DOT A;  4YIC A;  1B5I A;  1QKB A;  3P7I A;  3T93 B;  4EXL A;  4GL8 A;  3SEY A;  4UAC A;  3C34 A;  1YPN A;  3A3U A;  4HW8 A;  3S9M C;  3DP8 A;  4GOT A;  4G68 C;  1B46 A;  1RYO A;  2ESN A;  3OEM A;  3K1N A;  4IB2 A;  3FJG A;  4H8I A;  4H5F A;  2AYS A;  3PPQ A;  5AE4 A;  3TTR A;  4NMY A;  1SI0 A;  1J1N A;  1SBP A;  2O68 A;  2P1S A;  1SW5 A;  4PFY A;  3RYA A;  4ZE8 A;  1M5F A;  1NKX A;  1POY 1;  3PU5 A;  1Y20 A;  1WOD A;  2B65 A;  2A5S A;  4OEN A;  1IUD A;  3EF7 A;  4EQ9 A;  1JEV A;  1A7L A;  2GRV A;  1A54 A;  1QUK A;  1R1N A;  2DE3 A;  3VLV A;  3QUF A;  2Y7I A;  4IGR A;  2PT1 A;  3H6V A;  1D9Y A;  3VLU A;  5FTH A;  3UA8 A;  4WED A;  1R9Q A;  4QSD A;  1B9J A;  3S2V A;  4BDO A;  1MPD A;  4U1Z A;  5B70 A;  3K4U A;  1XOC A;  4YKP A;  4RJZ A;  1MXV A;  4ND9 A;  4U4S A;  5I57 A;  3FXU A;  3K6V A;  2XXW A;  3EHU A;  2OCU A;  2UYF A;  3MVX A;  4MBP A;  1AL3 A;  3M3F A;  3FUZ A;  3K6U A;  4DIG A;  3GXA A;  2ONK E;  1ANF A;  1QUL A;  3CI8 A;  3R26 A;  2H25 A;  3KBR A;  1O7T A;  1SYI A;  1VR5 A;  4UA8 A;  1QW0 A;  1B5J A;  1PEB A;  4RYA A;  4EQB A;  3TCF A;  1JW4 A;  4PFU A;  4YKK A;  5EYF A;  2V3T A;  4Q5T A;  4RNS A;  4IO2 A;  3MBP A;  1HSL A;  3K2D A;  3TTL A;  3TTK A;  1O64 A;  1LCF A;  2XXY A;  2ZYM A;  4OTE A;  3RTF B;  3V8X B;  3O6G A;  3FVO A;  4P0G A;  4X48 A;  1IXG A;  2F97 A;  3S9L C;  3QYT A;  4GL0 A;  5CMB A;  5CC2 A;  3PUY E;  3OMB A;  4PET A;  2F8D A;  2HZL A;  1LFI A;  1I6B A;  3KEI A;  1I69 A;  3HPI A;  1ZMG A;  5AA4 B;  3H7M A;  3RGY A;  2XXQ A;  1LFH A;  1O63 A;  4E0W A;  1QUI A;  4QRZ A;  5F1Q A;  2NWJ A;  2O7I A;  4DCX A;  5L9O A;  1Y3N A;  4ELR A;  3D4G A;  4GXA A;  3LVU A;  2QPQ A;  2V3Q A;  3KOT A;  1RYX A;  1GV8 A;  2Q9T A;  1EZP A;  3IR1 A;  1NH8 A;  1B1H A;  2AL5 A;  3H6U A;  4Z0I A;  4F31 B;  1FQB A;  2Q89 A;  1OLC A;  2Q2A A;  4N6P A;  1Z7N E;  1PC3 A;  3EQ1 A;  4GLI A;  5JTY B;  4C1T A;  2RIN A;  1LBC A;  3TUS A;  4FJP A;  4Z7E A;  1IZ1 A;  4LAT A;  4O3B A;  3TOD A;  5I59 B;  4OYV A;  3KN7 A;  2VHA A;  2ZMB A;  3SES A;  4FEC A;  3GZG A;  3H6W A;  1UTH A;  5I2N A;  1P1Q A;  3EHT A;  2XX9 A;  1UTH B;  3CR9 A;  1M5E A;  4QFP A;  1N7X A;  1MXW A;  1MDQ A;  3PPR A;  3CFX A;  2XX7 A;  1S9T A;  2NOO A;  4F2O A;  2IEE A;  2B3B A;  2YJP A;  1F9B A;  2O7U A;  1MXX A;  4OVJ A;  2OBG A;  2ZNT A;  4EF1 A;  4R9G A;  4AB6 A;  1US5 A;  1N04 A;  5L9M A;  4ELQ A;  2NVU B;  1MS7 A;  3IX1 A;  2CMO A;  2V25 A;  1HSJ A;  1FQC A;  4EXK A;  2F6G A;  4F3P A;  5HBC A;  1OVT A;  1GGG A;  2RC7 A;  3U1O A;  3OO8 A;  2ZNS A;  2XHD A;  1IXI A;  2I0B A;  4ESW A;  2Y84 A;  1B5H A;  4KR5 A;  1AH5 A;  4G8M A;  2VOZ A;  3PUZ E;  1IEJ A;  4LVQ A;  4R72 A;  2HZK A;  4U2R A;  3HHF A;  1N0T A;  4YB7 A;  4QFO A;  1B58 A;  3OOA A;  2V84 A;  2FNC A;  2UXA A;  3FIR A;  4TOZ A;  4RK2 A;  2WKY A;  1I6Q A;  3OEN A;  2V93 A;  4H1X A;  5ICQ A;  1B1X A;  3ZKL A;  4H65 A;  3QUJ A;  2DQV A;  3C9H A;  3IOR A;  4KHZ E;  1NNP A;  4ESX A;  4XKP A;  3RT8 A;  2ZNU A;  2HEU A;  2QMX A;  1H44 A;  3T9V A;  4FEB A;  2ZXT A;  3K1M A; 
#chains in the Genus database with same CATH topology
 4G4P A;  4HXV A;  3PGF A;  2QVV A;  1N7W A;  5CBS A;  3OO6 A;  5DVI A;  4F39 A;  4QFK A;  2V3U A;  2XX8 A;  3WAF A;  3FXB A;  2I4C A;  3E79 A;  5TU0 A;  2WBB A;  1YTV A;  4G2Z A;  3DRF A;  4X9T A;  2BJI A;  3SEV A;  4O8M A;  4YMA A;  2I3V A;  3LBS A;  1AWB A;  2H9B A;  3VDF A;  3ZKK A;  4BDM A;  4N4U A;  3ZS6 A;  5I7I A;  1N3X A;  3FV1 A;  3IB0 A;  5TPA A;  5CI5 A;  3N94 A;  2DYX A;  3EPE A;  4PFW A;  1LEV A;  5TPA B;  3HCQ A;  1H3D A;  4YB6 A;  5I56 B;  3EN3 A;  1LBZ A;  3O97 A;  2O84 X;  3USD A;  1TFD A;  2DDK A;  4R2B A;  3CHG A;  3EKI A;  4DXC A;  5L9S A;  1NFT A;  2Y7P A;  1JW1 A;  2P2A A;  1XS5 A;  2WOL A;  4TLL B;  1G0H A;  5LOM A;  2Z8E A;  3ISP A;  4MLV A;  2Z22 A;  2DXR A;  5AA2 A;  4NF4 A;  3Q27 A;  3UN6 A;  2DS9 A;  3W9W A;  4GVO A;  4PP0 A;  3TEL A;  2Q2C A;  2ZYN A;  3PPP A;  2PVU A;  2XXR A;  5CMM A;  1Y1M A;  4NGU A;  1B7Z A;  1LBY A;  2PFZ A;  3JV9 A;  3K1P A;  5AA1 A;  4QFL A;  2P3N A;  3L6G A;  4GRK A;  1AMF A;  4C1U A;  1FTL A;  4G8H A;  4QF9 A;  4OVP A;  1FTM A;  1Q35 A;  3T9X B;  3RLF E;  5LDZ A;  1FW0 A;  1MQJ A;  4JWX A;  3GBB A;  4U23 A;  1FBE A;  1XC1 A;  2R71 A;  1FBP A;  3E78 A;  4X8R A;  1IXC A;  3MPK A;  2LAO A;  1LLS A;  4PAK A;  1FPB A;  4EQ7 A;  2XWO A;  1FTK A;  1MH3 A;  4U21 A;  2OWT A;  2THI A;  2E1S A;  1XI6 A;  2FA7 A;  2NXO A;  3BBR A;  3WAE A;  2UVJ A;  4OFJ A;  4YKJ A;  1FJ6 A;  4DCY A;  5CMK A;  3T1B A;  3C36 A;  4GWO A;  3MUQ A;  5H8N B;  1SW4 A;  3B6T A;  2HHM A;  4GX4 A;  1NL5 A;  3O6I A;  2OLB A;  1MDP 1;  1FBD A;  1URG A;  3DLN A;  1B32 A;  3G3F A;  2QS3 A;  3PUX E;  3UP9 A;  2Z23 A;  1L5T A;  3IAZ A;  4OWD A;  2I48 A;  1NNK A;  3MVZ A;  2DOJ A;  1MM6 A;  5DT6 A;  4KI0 E;  4GWX A;  2REJ A;  4QHQ A;  4JWO A;  3DP6 A;  3ECR A;  3MWB A;  3PD9 A;  3VVD A;  4FBP A;  5AA3 A;  3FJ7 A;  4IO5 A;  4F18 A;  1YXI A;  3O2A A;  4BLA A;  4ELO A;  4IGT A;  1CB6 A;  3TDJ A;  1GR2 A;  5H8S A;  2Q8J A;  4PFI A;  5LTC A;  5HPQ A;  3TCH A;  1SI1 A;  1NV1 A;  2MKZ A;  3E3K A;  1MG1 A;  1JVX A;  3MPL A;  1DK4 A;  4PE3 A;  4UAB A;  3O9P A;  2OK2 A;  4I8C A;  1Y4T A;  2I58 A;  3C4M A;  1SW1 A;  3H06 B;  2XA5 A;  2O51 A;  3F11 A;  4GBW A;  1WVJ A;  1OQH A;  3PMW A;  2ZYO A;  4O94 A;  4P1E A;  5I5P A;  1EZO A;  4QBA A;  1B3H A;  2I0C A;  2QVR A;  5DYH A;  5I84 A;  4OET A;  1P1O A;  1K9Y A;  4G68 B;  4H45 A;  3MZ1 A;  3VVF A;  3LSW A;  2XXH A;  3TAJ A;  5IM2 A;  4KYD A;  3BFU A;  4X1B A;  4OEU A;  3OSQ A;  3VVE A;  4LA9 A;  1B3G A;  2UVG A;  4O3C A;  4BDN A;  3IB2 A;  1LAG E;  3CG1 A;  2Y7K A;  4ZDM A;  2HFB A;  2Q74 A;  3MP8 A;  4FE8 A;  4OHN A;  4PQJ A;  2VP1 A;  2XXX A;  5DVJ A;  4POX A;  1GVC A;  4GFR A;  2Y5L A;  4IO7 A;  3TPA A;  1FCK A;  4GIZ A;  1IME A;  3PV0 E;  4I62 A;  3MP1 A;  3IL1 B;  1FPG A;  4F1Y A;  3I3V A;  3C33 A;  1ZKB A;  2XXU A;  2DVC A;  3FXR A;  4DE8 A;  3CIJ A;  3OEL A;  2QS2 A;  3PAM A;  2OJT A;  2F7C A;  4LZ7 A;  3HHG A;  2DWA A;  5FHM A;  4DLD A;  5EYH A;  4PDD A;  4AB5 A;  4P1L A;  5EQ8 A;  1IIT A;  2O1L A;  4QFN A;  2QRY A;  2WBD A;  3G3J A;  4IO3 A;  5AA4 A;  1ZTY A;  2O69 A;  4MNP A;  4H46 A;  3IK6 B;  1INP A;  1T0K A;  4LON B;  1JQF A;  4N6K A;  1TFA A;  2P3V A;  2DE4 A;  4DZ1 A;  3Q26 A;  2YLN A;  5ITP A;  1FQE A;  3OO9 A;  3TTN A;  1UIU A;  1PB9 A;  3E13 X;  1B51 A;  1JNF A;  1FPD A;  2V4C A;  3K6W A;  1MRP A;  4KPT A;  2D3I A;  3E9X A;  4YU0 A;  2DP8 A;  3UGW A;  3MJN A;  1URD A;  1XVY A;  5ET8 A;  1N76 A;  1PB7 A;  3MYU A;  3N5L A;  2DXY A;  4JSO A;  4NTL A;  3C31 A;  1II5 A;  1RDX A;  2HAU A;  1DPP A;  4R74 A;  3PPN A;  1IQ7 A;  4KCD A;  3LSF B;  3LV0 A;  1AOV A;  5JTY A;  4RPN A;  3ODB A;  2Y5K A;  4LZ5 A;  1LCT A;  4OAN A;  2E0S A;  4LP2 B;  3KC1 A;  3SDF A;  4DI4 B;  5H8F A;  1MY4 A;  1LFG A;  4KD5 A;  5I59 A;  1LBV A;  2DWI A;  1EU8 A;  3BKI B;  1M5D A;  5H8F B;  4MF3 A;  3RY3 A;  4MIJ A;  5ESY A;  3O29 A;  3HO7 A;  3KJ7 A;  4H0W A;  2PFY A;  2H4I A;  5A5X B;  3QMF A;  4U22 A;  3FBP A;  4F3B A;  4N8G A;  1LB8 A;  3D1R A;  3U72 A;  1DPE A;  5JK4 A;  4RA1 A;  2CZK A;  2HAV A;  2RKM A;  1BTJ A;  4XKR A;  4ZS9 A;  1OQG A;  3RT6 B;  2QL3 A;  3M8U A;  3S9E A;  4NF6 B;  4R6H A;  1JET A;  4PTK A;  3B6Q A;  1MH4 A;  4HE0 A;  1G0I A;  3HV1 A;  3AXF A;  3VV5 A;  2OWZ A;  2YPN A;  5K2Y A;  3C35 A;  4TLM B;  1FJ9 A;  2RC8 A;  4LQ2 A;  3FTO A;  1NUY A;  1FPL A;  1UTB B;  3VXB A;  4O3A A;  1SW2 A;  4XFE A;  2B4M A;  1US4 A;  4EUO A;  3RYB A;  3FVN A;  2A5T B;  1TT1 A;  1TWY A;  4I3Y A;  4NE4 A;  2GHB A;  1MY0 A;  1H76 A;  3IJX B;  1NH7 A;  1Y1Z A;  1OIB A;  4IO6 A;  1B3L A;  2HQ0 A;  1SPI A;  3M3L A;  1LBW A;  1ZJL A;  2F35 A;  5ITO A;  4GX6 A;  3IOU A;  3KG2 A;  3FXQ A;  4FIM A;  3G3H A;  3IB1 A;  2H98 A;  3ILT B;  2I49 A;  4ZEC A;  1LBX A;  3CSB A;  4LUB A;  3TQW A;  4K3F A;  2M8C A;  4P9K A;  1B0L A;  3DRG A;  5DW8 A;  5DEX A;  3SEU A;  1USY H;  5DEX B;  2AIX A;  5I3S A;  4C0R A;  4XEQ A;  1N3W A;  1MXY A;  5K2X A;  2D21 A;  2H5Y A;  3KOS A;  4RPO A;  1YYZ A;  2Z8F A;  3U94 A;  2RCB A;  5F7V A;  3JZJ A;  1NV0 A;  5KCJ A;  4OZ9 A;  3SET A;  1Q1K A;  1N84 A;  5KCJ B;  1JW5 A;  2VD3 A;  4NED A;  3H6T A;  3G3G A;  4L17 A;  4YMB A;  2FVZ A;  5IKB A;  3TZA A;  3FD3 A;  2FHY A;  2VGQ A;  5FBP A;  3SER A;  3G7W A;  3O6P A;  4P3L A;  4NWC A;  4NF8 A;  2B4L A;  4N13 A;  2PMS A;  1QUJ A;  5I58 A;  1SYH A;  1FBH A;  1LST A;  4NF8 B;  4R6K A;  5DTB A;  5I58 B;  1DBZ A;  5FTI A;  3VE1 B;  1FRP A;  4PFT A;  4IY5 A;  1JEU A;  3KSJ A;  4TQU Q;  4P8B A;  3U65 A;  2WOP A;  3S9N C;  3MC2 A;  4FAT A;  4KCC A;  3JYR A;  4BDR A;  5I56 A;  2R6G E;  4GWS A;  2HCA A;  2PBW A;  5FHO A;  1LAX A;  3T9U A;  1B0H A;  4JB7 A;  2GFE A;  4ISU A;  3OXN A;  1YCJ A;  1BKA A;  4OEV A;  2ZZX A;  3LUZ A;  1R6Z A;  5FHN A;  4ZED A;  3K01 A;  1URS A;  4MHF A;  3BIG A;  1B52 A;  1P1U A;  1KA0 A;  1LAF E;  3ONM A;  3CSG A;  2CZL A;  4GD5 A;  1NNT A;  1CNQ A;  4JWY A;  1Y4C A;  4OFO A;  1POT A;  3RPL B;  4HS7 A;  4XF5 A;  3ZSF A;  4RK9 A;  3IO6 A;  1KZ8 A;  1B3F A;  2W7Y A;  3DM0 A;  1EH3 A;  1NUW A;  4GXS B;  3UK4 A;  1NUZ A;  1DCU A;  2I4B A;  5J16 A;  3PD8 A;  4THI A;  4YB5 A;  4OQO A;  3KJT A;  2BJJ X;  5DVF A;  1DTZ A;  4DDD A;  3O66 A;  3RQT A;  2ZZV A;  3TEP A;  3CRB A;  3DRH A;  4JBZ A;  4N17 A;  3CFZ A;  4POW A;  3TQL A;  4P0I A;  3K0V A;  3K6X A;  4GQO A;  4MAG A;  2DE2 A;  1ZLQ A;  4MLQ A;  3RTW B;  4FOR A;  1MPC A;  1B40 A;  4HTG A;  4N07 A;  2Y7R A;  1FBC A;  4NX1 A;  3OEK A;  4X1D A;  3CFL A;  5H8N A;  2FYI A;  4ZZA A;  2XWI A;  3KGC A;  3QK6 A;  2XXV A;  2GH9 A;  3H3G A;  2ALU A;  4GWU A;  4NHB A;  2DSF A;  1B7H A;  1BIY A;  4BDQ A;  3H4Z A;  3T22 A;  3H03 A;  3BFT A;  5KZT A;  2UVI A;  2H99 A;  3TTM A;  3NOH A;  4LQ5 A;  3KBZ A;  1Y3P A;  1UIV A;  3PTY A;  1BP5 A;  1LGB C;  2KR0 A;  5IZ1 A;  3HST A;  2ANJ A;  4KYS A;  3U8Q A;  1DMB A;  1MQH A;  1OMP A;  1S7Y A;  3PMV A;  4ECF A;  4H6D A;  1YAE A;  1VFE A;  4F19 A;  1B7U A;  1D4N A;  4OVT A;  1D3K A;  1PBQ A;  4I9D A;  2IA4 A;  1LB9 A;  3TYH A;  5J1D A;  4U1O A;  2GHA A;  4LZ8 A;  4NQ8 A;  2G29 A;  4HE1 A;  3FGS A;  3L6H A;  3IOW A;  3RPW A;  2QJE A;  4KYE A;  2D5W A;  3VFJ A;  1MPB A;  3S4U A;  4OFL A;  1FTO A;  1B3E A;  2F7B A;  1M5C A;  4OMB A;  2I6E A;  1BLF A;  2OWS A;  3FVG A;  1FPI A;  2QSX A;  3O6H A;  4WKM A;  3DRJ A;  2XXI A;  3U92 A;  1CE2 A;  4JSD A;  4G68 A;  3LR1 A;  4GWY A;  3RNN A;  3QIM A;  1A8F A;  4JXI A;  1PBP A;  3DEL B;  4AQ4 A;  4I40 A;  4JDF A;  4EDP A;  1XVX A;  2Z8D A;  4YZZ A;  3THI A;  2PYY A;  4PE5 B;  3B6W A;  2REG A;  2WYP A;  4ZZE A;  3KSX A;  3RN8 A;  4XKQ A;  4IO4 A;  3K02 A;  4KFQ A;  5I57 B;  1EYK A;  1MQD A;  3MZ9 A;  2F36 A;  1SVX B;  3FV2 A;  4P47 A;  2ONR A;  2ABH A;  1OLA A;  4OES A;  3E4R A;  4RY1 A;  5B7D A;  2HXW A;  5EHM A;  1NV5 A;  5ELV A;  1DTG A;  2VPN A;  4G77 A;  3B8B A;  1LAH E;  2P0S A;  4JVD A;  1NI9 A;  1R9L A;  1ATG A;  2RC9 A;  4MJO A;  4OXV A;  3KN3 A;  3TFL A;  3DRK A;  1A40 A;  4ZEK A;  1EZ9 A;  5ICT A;  2X7P A;  1PDA A;  2NUV A;  4KXP A;  4NAP A;  4HCW A;  5CRY A;  5HM4 B;  4F3G A;  1A55 A;  4MMP A;  1B2H A;  1NV2 A;  4QXD A;  1VE4 A;  4NF0 A;  3UOR A;  4ZEF A;  1IIW A;  3QSL A;  4H8J A;  3R6U A;  2XXT A;  1IXH A;  4Q8R A;  3LSX A;  1FTJ A;  3TCG A;  1WDN A;  2Q88 A;  4I1D A;  3SKP A;  3FAT A;  1A8E A;  1ELJ A;  3CG3 A;  2UVH A;  1IMD A;  1I6A A;  1QKA A;  1QGX A;  2I3W A;  4NN3 A;  5BWJ A;  2WOK A;  2ZYK A;  4H5G A;  1NUX A;  2R8T A;  4XIG Q;  2VPO A;  1FQD A;  5CBR A;  4F29 A;  2PT2 A;  3T9H B;  1ZIU A;  3IFA A;  1SQY A;  4N15 A;  1PB8 A;  4EF2 A;  4DXB A;  3KFM A;  5CMC A;  3VXC A;  5A5X A;  4MFI A;  1D9V A;  1RDZ A;  3QXM A;  1P1N A;  2XXP A;  4F3S A;  4ELP A;  4PF8 A;  5ET5 A;  2VD2 A;  3Q25 A;  4BDL A;  4N81 A;  1FPJ A;  4PGP A;  5IZ3 A;  1XT8 A;  1H43 A;  2PX1 A;  5IZ3 B;  4IR8 A;  1VSO A;  5BUU A;  3FZV A;  4OER A;  1H45 A;  4O7M A;  4F22 A;  4NF6 A;  4YAH X;  1ZBM A;  5I2N B;  3T66 A;  4G8N A;  3W15 C;  4WXJ A;  3FJM A;  3OO7 A;  3PPO A;  2F5X A;  4F1V A;  2UYE A;  3D4C A;  4QSC A;  3N6U A;  5M2V A;  1JVY A;  3HN0 A;  2HPG A;  4I3E A;  1UTB A;  2Y7W A;  2F78 A;  1MXZ A;  3EHS A;  3MW0 A;  2WYK A;  1USY E;  3W9V A;  2A5T A;  1S50 A;  1MY1 A;  1MQI A;  3LUY A;  2QS1 A;  1M5B A;  4Q0C A;  5EHS A;  2WX9 A;  2XWV A;  5L8D A;  3OSR A;  4GX3 A;  1UQW A;  1MY2 A;  4XKN A;  1SD3 A;  4KQP A;  5JEI A;  3DRI A;  1D9Q A;  4R2F A;  2DWH A;  1FQF A;  4HE2 A;  4WEP A;  3SEX A;  2GQ1 A;  4Q30 B;  4FAJ A;  4RXL A;  1Y3Q A;  2DWJ A;  1A99 A;  2R9J A;  2F6P A;  4R73 A;  3B7D A;  3PMX A;  2Q8M A;  3A09 A;  4M1V A;  3KC0 A;  4QSE A;  1MXU A;  4H67 A;  3RUM A;  5EQ7 A;  1HSE A;  5EQA A;  5ISU A;  3UIF A;  3GLB A;  3N26 A;  3GBA A;  4P56 A;  2QFL A;  3TMG A;  2DVZ A;  3V89 B;  4NF5 A;  2QMW A;  3VLW A;  3Q29 A;  1P99 A;  4ONY A;  1MY3 A;  3QAX A;  1RDY A;  1FTA A;  4NF5 B;  3V5A A;  4O7I A;  3IOV A;  4M4G A;  1GTK A;  3U93 A;  4PDH A;  1FSA A;  3V83 A;  2OZZ A;  3KZG A;  2X7Q A;  4FED A;  4DXU A;  2O1M A;  3N6T A;  1FPF A;  2B3F A;  3K00 A;  5H8H A;  3MVY A;  2O6A A;  4IY6 A;  2KLF A;  4MH5 A;  1AIV A;  4X04 A;  4ZEI A;  5H8H B;  4E0X A;  3M3K A;  2ONS A;  2XD3 A;  5I2K A;  3MP6 A;  1NNF A;  5H8Q A;  5I2K B;  3R7X A;  3MZB A;  1Z7M E;  1VFD A;  5H8Q B;  3MVW A;  3Q28 A;  1B4H A;  1ZU0 A;  1NV7 A;  3IJO B;  1QJM A;  5KDT A;  2CZH A;  1B05 A;  1FQA A;  5KDT B;  4XTC Q;  4R9F A;  3DP4 A;  4YKI A;  2JJK A;  4NWD A;  4ZE9 A;  3FVK A;  1MM7 A;  3GYY A;  3CVG A;  2AL4 A;  4F2Q A;  3G3I A;  1DSN A;  3I5O A;  3PUV E;  1B6H A;  3MQ9 A;  3LSL A;  3RPL A;  1P1W A;  3ILU B;  3FAS A;  4ZEB A;  2WEF A;  1OVB A;  3C32 A;  3KN8 A;  4OVQ A;  1B4Z A;  5TP9 A;  5AA2 D;  1LBB A;  5TP9 B;  4HCY A;  2XD2 A;  3IO4 A;  3O28 A;  4MX6 A;  2VT5 A;  3TKD A;  3LC8 A;  3T96 B;  3MAM A;  5AA2 B;  4G61 A;  3SEW A;  4NF4 B;  1SDX A;  4F1U A;  3A3C A;  4GF8 A;  1KWH A;  2HXR A;  2F7A A;  1RKM A;  2F34 A;  4GWZ A;  3IOT A;  2X26 A;  4P11 A;  1XHY A;  4R6Y A;  4PGN A;  2FIE A;  3PUW E;  1Y9U A;  2QS4 A;  2G93 A;  5IAI A;  4AS4 A;  1NMU A;  5CM6 A;  1NV3 A;  5ET6 A;  4R75 A;  3I6V A;  4U4X A;  1TXF A;  4XXU A;  3OD7 A;  2RF1 A;  2RCA A;  1MQG A;  1QVS A;  3G3K A;  1DOT A;  4YIC A;  1B5I A;  1QKB A;  3P7I A;  3T93 B;  4EXL A;  4GL8 A;  3SEY A;  4UAC A;  3C34 A;  1YPN A;  3A3U A;  4HW8 A;  2F3D A;  3S9M C;  3DP8 A;  4GOT A;  4G68 C;  1B46 A;  1RYO A;  5T3J A;  2ESN A;  3OEM A;  3K1N A;  4IB2 A;  3FJG A;  1JP4 A;  4H8I A;  4H5F A;  2AYS A;  2FIX A;  3PPQ A;  5AE4 A;  3TTR A;  4NMY A;  1FPK A;  2FBP A;  1SI0 A;  1J1N A;  1SBP A;  2O68 A;  2P1S A;  1NV4 A;  1SW5 A;  4PAF A;  4PFY A;  3RYA A;  4PBH A;  4N6D A;  4ZE8 A;  1M5F A;  1NKX A;  1VDW A;  1POY 1;  1YZ0 A;  3PU5 A;  1Y20 A;  4PAI A;  1WOD A;  2B65 A;  2A5S A;  4OEN A;  1IUD A;  1EYJ A;  3EF7 A;  4EQ9 A;  1JEV A;  1A7L A;  2GRV A;  1A54 A;  1QUK A;  1R1N A;  2DE3 A;  3VLV A;  4GWW A;  4JVI A;  3QUF A;  2Y7I A;  4IGR A;  2PT1 A;  3H6V A;  1D9Y A;  3VLU A;  5FTH A;  3UA8 A;  4WED A;  4PCD A;  1R9Q A;  4QSD A;  1B9J A;  1FPE A;  3S2V A;  4BDO A;  1MPD A;  4U1Z A;  5B70 A;  3K4U A;  1XOC A;  4AS5 A;  5IGA A;  4YKP A;  1EYI A;  1FBF A;  4MNC A;  4RJZ A;  1MXV A;  4ND9 A;  4U4S A;  5I57 A;  3FXU A;  3K6V A;  2XXW A;  3EHU A;  2OCU A;  2UYF A;  3MVX A;  4MBP A;  1AL3 A;  3M3F A;  4MCO A;  3FUZ A;  3K6U A;  4DIG A;  3GXA A;  2ONK E;  1ANF A;  1QUL A;  3CI8 A;  3R26 A;  4NG7 A;  2H25 A;  4LN5 A;  5EQ9 A;  3KBR A;  1O7T A;  1SYI A;  1VR5 A;  4UA8 A;  1QW0 A;  1B5J A;  1PEB A;  4RYA A;  4EQB A;  3TCF A;  1JW4 A;  4PFU A;  4YKK A;  5EYF A;  2V3T A;  4Q5T A;  4RNS A;  4IO2 A;  3MBP A;  5IZZ A;  1HSL A;  3K2D A;  3TTL A;  3TTK A;  1O64 A;  1LCF A;  2XXY A;  2ZYM A;  3ROJ A;  4OTE A;  3RTF B;  3O6G A;  3V8X B;  3FVO A;  4P0G A;  4X48 A;  1IXG A;  2F97 A;  1NV6 A;  3QYT A;  3S9L C;  4GL0 A;  5CMB A;  5CC2 A;  3PUY E;  3OMB A;  4PF6 A;  4PET A;  2F8D A;  2HZL A;  4JVC A;  1IMA A;  1LFI A;  1IMF A;  1I6B A;  3KEI A;  1I69 A;  3HPI A;  1ZMG A;  5AA4 B;  3H7M A;  3RGY A;  2XXQ A;  2ZZW A;  4MEV A;  1LFH A;  1O63 A;  2PCR A;  4MNI A;  1IMB A;  4E0W A;  1QUI A;  4QRZ A;  5F1Q A;  2NWJ A;  2O7I A;  4DCX A;  5L9O A;  1BK4 A;  1Y3N A;  4ELR A;  3D4G A;  4GXA A;  3LVU A;  2QPQ A;  4N8Y A;  2V3Q A;  1K9Z A;  1KA1 A;  2KQZ A;  3KOT A;  1RYX A;  1GV8 A;  2Q9T A;  2CZI A;  1EZP A;  2L5V A;  3IR1 A;  1IMC A;  1NH8 A;  1B1H A;  2AL5 A;  3H6U A;  4Z0I A;  2F3B A;  4F31 B;  1FQB A;  2Q89 A;  1OLC A;  2Q2A A;  4N6P A;  1Z7N E;  1PC3 A;  3RYD A;  5F24 A;  4DI3 D;  3EQ1 A;  4GLI A;  2CEX A;  4PBQ A;  5JTY B;  4C1T A;  2RIN A;  1LBC A;  3TUS A;  4OA4 A;  4FJP A;  4Z7E A;  1IZ1 A;  3A29 A;  4LAT A;  4O3B A;  3TOD A;  5I59 B;  4OYV A;  3KN7 A;  2VHA A;  2ZMB A;  3SES A;  4FEC A;  3GZG A;  3H6W A;  1UTH A;  5I2N A;  1P1Q A;  3EHT A;  2XX9 A;  1UTH B;  3CR9 A;  3HFU A;  1M5E A;  4QFP A;  1N7X A;  1MXW A;  1MDQ A;  3PPR A;  3CFX A;  2XX7 A;  1S9T A;  4GBV A;  3MST A;  2NOO A;  5ET7 A;  2XWK A;  4F2O A;  2IEE A;  2B3B A;  2YJP A;  1F9B A;  2O7U A;  1MXX A;  4OVJ A;  2QVU A;  2OBG A;  3B50 A;  2ZNT A;  4EF1 A;  4R9G A;  4AB6 A;  1US5 A;  1N04 A;  5L9M A;  4PC9 A;  5EYG A;  4ELQ A;  2NVU B;  1MS7 A;  3IX1 A;  2CMO A;  2V25 A;  3IFC A;  1HSJ A;  4PFR A;  2OX3 A;  1FQC A;  4EXK A;  2F6G A;  4F3P A;  1Q9D A;  5HBC A;  1OVT A;  1GGG A;  2RC7 A;  3U1O A;  3OO8 A;  2ZNS A;  2XHD A;  1IXI A;  2I0B A;  4ESW A;  1FBG A;  2Y84 A;  1B5H A;  4KR5 A;  1AH5 A;  2CEY A;  4G8M A;  4OVS A;  2VOZ A;  3PUZ E;  1IEJ A;  4LVQ A;  4R72 A;  2HZK A;  4U2R A;  3HHF A;  1N0T A;  4YB7 A;  4QFO A;  1B58 A;  3BIH A;  3OOA A;  2V84 A;  2FNC A;  2UXA A;  3FIR A;  4N91 A;  4TOZ A;  5A5L A;  4RK2 A;  2WKY A;  1I6Q A;  3OEN A;  2V93 A;  4H1X A;  5ICQ A;  1B1X A;  4PFB A;  3T0J A;  3ZKL A;  4H65 A;  3QUJ A;  2DQV A;  3C9H A;  3IOR A;  3SZP A;  4KHZ E;  1NNP A;  4ESX A;  4XKP A;  3RT8 A;  2XXK A;  2ZNU A;  2HEU A;  2QMX A;  1H44 A;  3T9V A;  4FEB A;  4OVR A;  2ZXT A;  3K1M A; 
#chains in the Genus database with same CATH homology
 4G4P A;  3PGF A;  1N7W A;  5CBS A;  3OO6 A;  5DVI A;  4F39 A;  4QFK A;  2V3U A;  2XX8 A;  3WAF A;  2I4C A;  5TU0 A;  1YTV A;  4G2Z A;  3DRF A;  4X9T A;  3SEV A;  4YMA A;  2I3V A;  3LBS A;  2H9B A;  3VDF A;  3ZKK A;  4BDM A;  3ZS6 A;  1N3X A;  3FV1 A;  3IB0 A;  5TPA A;  5CI5 A;  3N94 A;  2DYX A;  3EPE A;  4PFW A;  5TPA B;  3HCQ A;  1H3D A;  4YB6 A;  5I56 B;  3EN3 A;  3O97 A;  2O84 X;  3USD A;  1TFD A;  4R2B A;  3CHG A;  4DXC A;  5L9S A;  1NFT A;  2Y7P A;  1JW1 A;  2P2A A;  1XS5 A;  2WOL A;  4TLL B;  5LOM A;  2Z8E A;  4MLV A;  2Z22 A;  2DXR A;  5AA2 A;  4NF4 A;  3Q27 A;  3UN6 A;  2DS9 A;  3W9W A;  4GVO A;  4PP0 A;  3TEL A;  2Q2C A;  2ZYN A;  3PPP A;  2PVU A;  2XXR A;  5CMM A;  1Y1M A;  1B7Z A;  3K1P A;  3JV9 A;  5AA1 A;  4QFL A;  3L6G A;  4GRK A;  1AMF A;  4C1U A;  1FTL A;  4G8H A;  4QF9 A;  1FTM A;  1Q35 A;  3T9X B;  3RLF E;  1FW0 A;  1MQJ A;  4JWX A;  3GBB A;  4U23 A;  1XC1 A;  2R71 A;  1IXC A;  3MPK A;  2LAO A;  1LLS A;  4EQ7 A;  1FTK A;  1MH3 A;  4U21 A;  2OWT A;  2THI A;  2E1S A;  2FA7 A;  2NXO A;  3BBR A;  3WAE A;  2UVJ A;  4OFJ A;  4YKJ A;  4DCY A;  5CMK A;  3C36 A;  4GWO A;  3MUQ A;  5H8N B;  1SW4 A;  3B6T A;  1NL5 A;  3O6I A;  2OLB A;  1MDP 1;  1URG A;  3DLN A;  1B32 A;  3G3F A;  2QS3 A;  3PUX E;  3UP9 A;  2Z23 A;  1L5T A;  3IAZ A;  4OWD A;  2I48 A;  1NNK A;  3MVZ A;  2DOJ A;  1MM6 A;  5DT6 A;  4KI0 E;  2REJ A;  4QHQ A;  4JWO A;  3DP6 A;  3ECR A;  3MWB A;  3PD9 A;  3VVD A;  5AA3 A;  3FJ7 A;  4IO5 A;  4F18 A;  3O2A A;  4BLA A;  4ELO A;  4IGT A;  1CB6 A;  3TDJ A;  1GR2 A;  5H8S A;  2Q8J A;  5HPQ A;  3TCH A;  1SI1 A;  3E3K A;  1MG1 A;  1JVX A;  3MPL A;  3O9P A;  2OK2 A;  4I8C A;  1Y4T A;  2I58 A;  3C4M A;  1SW1 A;  3H06 B;  3F11 A;  2O51 A;  1WVJ A;  1OQH A;  3PMW A;  2ZYO A;  1EZO A;  1B3H A;  2I0C A;  5DYH A;  5I84 A;  4OET A;  1P1O A;  4G68 B;  3MZ1 A;  3VVF A;  3LSW A;  2XXH A;  3TAJ A;  4KYD A;  3BFU A;  4X1B A;  4OEU A;  3OSQ A;  3VVE A;  4LA9 A;  1B3G A;  2UVG A;  4O3C A;  4BDN A;  3IB2 A;  1LAG E;  3CG1 A;  2Y7K A;  4ZDM A;  2HFB A;  3MP8 A;  4FE8 A;  4OHN A;  4PQJ A;  2VP1 A;  2XXX A;  5DVJ A;  4POX A;  1GVC A;  4GFR A;  4IO7 A;  3TPA A;  1FCK A;  4GIZ A;  3PV0 E;  4I62 A;  3MP1 A;  3IL1 B;  4F1Y A;  3I3V A;  3C33 A;  1ZKB A;  2XXU A;  2DVC A;  3FXR A;  4DE8 A;  3CIJ A;  3OEL A;  2QS2 A;  3PAM A;  2OJT A;  2F7C A;  4LZ7 A;  3HHG A;  2DWA A;  5FHM A;  4DLD A;  4AB5 A;  1IIT A;  2O1L A;  4QFN A;  2QRY A;  3G3J A;  4IO3 A;  5AA4 A;  1ZTY A;  2O69 A;  3IK6 B;  1T0K A;  4LON B;  1JQF A;  1TFA A;  2DE4 A;  4DZ1 A;  3Q26 A;  2YLN A;  5ITP A;  1FQE A;  3OO9 A;  3TTN A;  1UIU A;  1PB9 A;  3E13 X;  1B51 A;  1JNF A;  3K6W A;  1MRP A;  4KPT A;  2D3I A;  3E9X A;  4YU0 A;  2DP8 A;  3UGW A;  3MJN A;  1URD A;  1XVY A;  1N76 A;  1PB7 A;  3N5L A;  2DXY A;  4JSO A;  4NTL A;  3C31 A;  1II5 A;  2HAU A;  1DPP A;  4R74 A;  3PPN A;  1IQ7 A;  4KCD A;  3LSF B;  1AOV A;  5JTY A;  4RPN A;  3ODB A;  4LZ5 A;  1LCT A;  2E0S A;  4LP2 B;  3SDF A;  5H8F A;  1MY4 A;  1LFG A;  4KD5 A;  5I59 A;  2DWI A;  1EU8 A;  3BKI B;  1M5D A;  5H8F B;  4MF3 A;  3RY3 A;  3O29 A;  3HO7 A;  3KJ7 A;  4H0W A;  2H4I A;  5A5X B;  4U22 A;  4F3B A;  1LB8 A;  3U72 A;  1DPE A;  5JK4 A;  4RA1 A;  2HAV A;  2RKM A;  1BTJ A;  4XKR A;  4ZS9 A;  1OQG A;  3RT6 B;  2QL3 A;  3M8U A;  3S9E A;  4NF6 B;  4R6H A;  1JET A;  3B6Q A;  1MH4 A;  3HV1 A;  3AXF A;  3VV5 A;  2YPN A;  5K2Y A;  3C35 A;  4TLM B;  2RC8 A;  4LQ2 A;  3FTO A;  1UTB B;  3VXB A;  4O3A A;  1SW2 A;  2B4M A;  1US4 A;  4EUO A;  3RYB A;  3FVN A;  2A5T B;  1TT1 A;  1TWY A;  4NE4 A;  2GHB A;  1MY0 A;  1H76 A;  3IJX B;  1NH7 A;  1Y1Z A;  1OIB A;  4IO6 A;  1B3L A;  2HQ0 A;  3M3L A;  1ZJL A;  2F35 A;  5ITO A;  3IOU A;  3KG2 A;  3FXQ A;  4FIM A;  3G3H A;  3IB1 A;  2H98 A;  3ILT B;  2I49 A;  4ZEC A;  3CSB A;  4LUB A;  3TQW A;  4K3F A;  2M8C A;  1B0L A;  3DRG A;  5DEX A;  3SEU A;  1USY H;  5DEX B;  2AIX A;  4C0R A;  1N3W A;  1MXY A;  5K2X A;  2D21 A;  2H5Y A;  3KOS A;  4RPO A;  2Z8F A;  3U94 A;  2RCB A;  5F7V A;  3JZJ A;  5KCJ A;  4OZ9 A;  3SET A;  1Q1K A;  1N84 A;  5KCJ B;  1JW5 A;  2VD3 A;  4NED A;  3H6T A;  3G3G A;  4L17 A;  4YMB A;  5IKB A;  3TZA A;  3FD3 A;  2VGQ A;  3SER A;  3G7W A;  3O6P A;  4NWC A;  4NF8 A;  2B4L A;  4N13 A;  2PMS A;  1QUJ A;  5I58 A;  1SYH A;  1LST A;  4NF8 B;  4R6K A;  5DTB A;  5I58 B;  5FTI A;  3VE1 B;  4PFT A;  4IY5 A;  1JEU A;  3KSJ A;  4TQU Q;  2WOP A;  3S9N C;  3MC2 A;  4FAT A;  4KCC A;  3JYR A;  4BDR A;  5I56 A;  2R6G E;  2HCA A;  2PBW A;  5FHO A;  1LAX A;  3T9U A;  1B0H A;  4JB7 A;  2GFE A;  4ISU A;  3OXN A;  1YCJ A;  1BKA A;  4OEV A;  1R6Z A;  5FHN A;  4ZED A;  3K01 A;  1URS A;  1B52 A;  1P1U A;  1LAF E;  3ONM A;  3CSG A;  2CZL A;  4GD5 A;  1NNT A;  4JWY A;  1Y4C A;  4OFO A;  1POT A;  4HS7 A;  3ZSF A;  4RK9 A;  3IO6 A;  1B3F A;  2W7Y A;  3DM0 A;  1EH3 A;  4GXS B;  3UK4 A;  2I4B A;  3PD8 A;  4THI A;  4YB5 A;  4OQO A;  3KJT A;  2BJJ X;  5DVF A;  1DTZ A;  4DDD A;  3O66 A;  3RQT A;  3TEP A;  3CRB A;  3DRH A;  4JBZ A;  3CFZ A;  4POW A;  3TQL A;  4P0I A;  3K0V A;  3K6X A;  4GQO A;  2DE2 A;  1ZLQ A;  4MLQ A;  3RTW B;  4FOR A;  1MPC A;  1B40 A;  4HTG A;  4N07 A;  2Y7R A;  3OEK A;  4X1D A;  3CFL A;  5H8N A;  2FYI A;  4ZZA A;  3KGC A;  3QK6 A;  2XXV A;  2GH9 A;  3H3G A;  2ALU A;  2DSF A;  1B7H A;  1BIY A;  4BDQ A;  3H4Z A;  3T22 A;  3H03 A;  3BFT A;  5KZT A;  2UVI A;  2H99 A;  3TTM A;  4LQ5 A;  1Y3P A;  1UIV A;  1BP5 A;  1LGB C;  3HST A;  2ANJ A;  4KYS A;  3U8Q A;  1DMB A;  1MQH A;  1OMP A;  1S7Y A;  3PMV A;  4ECF A;  4H6D A;  1YAE A;  1VFE A;  4F19 A;  1B7U A;  1D4N A;  1D3K A;  1PBQ A;  4I9D A;  2IA4 A;  1LB9 A;  3TYH A;  5J1D A;  4U1O A;  2GHA A;  4LZ8 A;  2G29 A;  3FGS A;  3L6H A;  3IOW A;  3RPW A;  2QJE A;  4KYE A;  2D5W A;  3VFJ A;  1MPB A;  3S4U A;  4OFL A;  1FTO A;  1B3E A;  2F7B A;  1M5C A;  4OMB A;  2I6E A;  1BLF A;  2OWS A;  3FVG A;  2QSX A;  3O6H A;  4WKM A;  3DRJ A;  2XXI A;  3U92 A;  1CE2 A;  4JSD A;  4G68 A;  3LR1 A;  3RNN A;  3QIM A;  1A8F A;  4JXI A;  1PBP A;  3DEL B;  4AQ4 A;  4JDF A;  4EDP A;  1XVX A;  2Z8D A;  4YZZ A;  3THI A;  2PYY A;  4PE5 B;  3B6W A;  2REG A;  4ZZE A;  3KSX A;  3RN8 A;  4XKQ A;  4IO4 A;  3K02 A;  4KFQ A;  5I57 B;  1MQD A;  3MZ9 A;  2F36 A;  1SVX B;  3FV2 A;  2ONR A;  2ABH A;  1OLA A;  4OES A;  3E4R A;  4RY1 A;  5B7D A;  2HXW A;  5EHM A;  5ELV A;  1DTG A;  4G77 A;  1LAH E;  2P0S A;  1R9L A;  1ATG A;  2RC9 A;  4OXV A;  3KN3 A;  3TFL A;  3DRK A;  1A40 A;  4ZEK A;  1EZ9 A;  5ICT A;  2X7P A;  1PDA A;  2NUV A;  5CRY A;  4HCW A;  5HM4 B;  4F3G A;  1A55 A;  1B2H A;  1VE4 A;  3UOR A;  4ZEF A;  1IIW A;  3QSL A;  4H8J A;  3R6U A;  2XXT A;  1IXH A;  4Q8R A;  3LSX A;  1FTJ A;  3TCG A;  1WDN A;  2Q88 A;  4I1D A;  3SKP A;  3FAT A;  1A8E A;  1ELJ A;  3CG3 A;  2UVH A;  1I6A A;  1QKA A;  2I3W A;  5BWJ A;  2WOK A;  2ZYK A;  4H5G A;  4XIG Q;  1FQD A;  5CBR A;  4F29 A;  2PT2 A;  3T9H B;  1ZIU A;  1SQY A;  1PB8 A;  4EF2 A;  4DXB A;  3KFM A;  5CMC A;  3VXC A;  5A5X A;  4MFI A;  1D9V A;  3QXM A;  1P1N A;  2XXP A;  4F3S A;  4ELP A;  2VD2 A;  3Q25 A;  4BDL A;  1XT8 A;  1H43 A;  2PX1 A;  1VSO A;  5BUU A;  3FZV A;  4OER A;  1H45 A;  4F22 A;  4NF6 A;  4YAH X;  1ZBM A;  5I2N B;  3T66 A;  4G8N A;  3W15 C;  4WXJ A;  3FJM A;  3OO7 A;  3PPO A;  2F5X A;  4F1V A;  2UYE A;  3D4C A;  4QSC A;  3N6U A;  5M2V A;  1JVY A;  3HN0 A;  1UTB A;  2Y7W A;  2F78 A;  1MXZ A;  3EHS A;  3MW0 A;  1USY E;  3W9V A;  2A5T A;  1S50 A;  1MY1 A;  1MQI A;  3LUY A;  2QS1 A;  1M5B A;  4Q0C A;  5EHS A;  5L8D A;  3OSR A;  1UQW A;  1MY2 A;  4XKN A;  1SD3 A;  4KQP A;  5JEI A;  3DRI A;  4R2F A;  2DWH A;  1FQF A;  4WEP A;  3SEX A;  4Q30 B;  4FAJ A;  4RXL A;  1Y3Q A;  2DWJ A;  1A99 A;  2R9J A;  2F6P A;  4R73 A;  3B7D A;  3PMX A;  3A09 A;  4M1V A;  4QSE A;  1MXU A;  4H67 A;  3RUM A;  1HSE A;  5ISU A;  3UIF A;  3GLB A;  3N26 A;  3GBA A;  3TMG A;  2DVZ A;  3V89 B;  4NF5 A;  2QMW A;  3VLW A;  3Q29 A;  1P99 A;  4ONY A;  1MY3 A;  3QAX A;  4NF5 B;  3V5A A;  3IOV A;  4M4G A;  1GTK A;  3U93 A;  3V83 A;  2OZZ A;  3KZG A;  2X7Q A;  4FED A;  4DXU A;  2O1M A;  3N6T A;  2B3F A;  3K00 A;  5H8H A;  3MVY A;  2O6A A;  4IY6 A;  2KLF A;  4MH5 A;  1AIV A;  4ZEI A;  5H8H B;  4E0X A;  3M3K A;  2ONS A;  2XD3 A;  5I2K A;  3MP6 A;  1NNF A;  5H8Q A;  5I2K B;  3R7X A;  3MZB A;  1Z7M E;  1VFD A;  5H8Q B;  3MVW A;  3Q28 A;  1B4H A;  1ZU0 A;  3IJO B;  1QJM A;  5KDT A;  1B05 A;  1FQA A;  5KDT B;  4XTC Q;  4R9F A;  3DP4 A;  4YKI A;  4NWD A;  4ZE9 A;  3FVK A;  1MM7 A;  3CVG A;  2AL4 A;  4F2Q A;  3G3I A;  1DSN A;  3I5O A;  3PUV E;  1B6H A;  3MQ9 A;  3LSL A;  1P1W A;  3ILU B;  3FAS A;  4ZEB A;  1OVB A;  3C32 A;  3KN8 A;  1B4Z A;  5TP9 A;  5AA2 D;  1LBB A;  5TP9 B;  4HCY A;  2XD2 A;  3IO4 A;  3O28 A;  3TKD A;  3LC8 A;  3T96 B;  3MAM A;  5AA2 B;  3SEW A;  4NF4 B;  1SDX A;  4F1U A;  3A3C A;  4GF8 A;  1KWH A;  2F7A A;  1RKM A;  2F34 A;  3IOT A;  2X26 A;  4P11 A;  1XHY A;  4R6Y A;  3PUW E;  1Y9U A;  2QS4 A;  2G93 A;  5IAI A;  1NMU A;  5CM6 A;  4R75 A;  3I6V A;  4U4X A;  1TXF A;  4XXU A;  3OD7 A;  2RF1 A;  2RCA A;  1MQG A;  1QVS A;  3G3K A;  1DOT A;  4YIC A;  1B5I A;  1QKB A;  3P7I A;  3T93 B;  4EXL A;  4GL8 A;  3SEY A;  4UAC A;  3C34 A;  1YPN A;  3A3U A;  4HW8 A;  3S9M C;  3DP8 A;  4GOT A;  4G68 C;  1B46 A;  1RYO A;  2ESN A;  3OEM A;  3K1N A;  4IB2 A;  3FJG A;  4H8I A;  4H5F A;  2AYS A;  3PPQ A;  5AE4 A;  3TTR A;  4NMY A;  1SI0 A;  1J1N A;  1SBP A;  2O68 A;  2P1S A;  1SW5 A;  4PFY A;  3RYA A;  4ZE8 A;  1M5F A;  1NKX A;  1POY 1;  3PU5 A;  1Y20 A;  1WOD A;  2B65 A;  2A5S A;  4OEN A;  1IUD A;  3EF7 A;  4EQ9 A;  1JEV A;  1A7L A;  2GRV A;  1A54 A;  1QUK A;  1R1N A;  2DE3 A;  3VLV A;  3QUF A;  2Y7I A;  4IGR A;  2PT1 A;  3H6V A;  1D9Y A;  3VLU A;  5FTH A;  3UA8 A;  4WED A;  1R9Q A;  4QSD A;  1B9J A;  3S2V A;  4BDO A;  1MPD A;  4U1Z A;  5B70 A;  3K4U A;  1XOC A;  4YKP A;  4RJZ A;  1MXV A;  4ND9 A;  4U4S A;  5I57 A;  3FXU A;  3K6V A;  2XXW A;  3EHU A;  2OCU A;  2UYF A;  3MVX A;  4MBP A;  1AL3 A;  3M3F A;  3FUZ A;  3K6U A;  4DIG A;  3GXA A;  2ONK E;  1ANF A;  1QUL A;  3CI8 A;  3R26 A;  2H25 A;  3KBR A;  1O7T A;  1SYI A;  1VR5 A;  4UA8 A;  1QW0 A;  1B5J A;  1PEB A;  4RYA A;  4EQB A;  3TCF A;  1JW4 A;  4PFU A;  4YKK A;  5EYF A;  2V3T A;  4Q5T A;  4RNS A;  4IO2 A;  3MBP A;  1HSL A;  3K2D A;  3TTL A;  3TTK A;  1O64 A;  1LCF A;  2XXY A;  2ZYM A;  4OTE A;  3RTF B;  3V8X B;  3O6G A;  3FVO A;  4P0G A;  4X48 A;  1IXG A;  2F97 A;  3S9L C;  3QYT A;  4GL0 A;  5CMB A;  5CC2 A;  3PUY E;  3OMB A;  4PET A;  2F8D A;  2HZL A;  1LFI A;  1I6B A;  3KEI A;  1I69 A;  3HPI A;  1ZMG A;  5AA4 B;  3H7M A;  3RGY A;  2XXQ A;  1LFH A;  1O63 A;  4E0W A;  1QUI A;  4QRZ A;  5F1Q A;  2NWJ A;  2O7I A;  4DCX A;  5L9O A;  1Y3N A;  4ELR A;  3D4G A;  4GXA A;  3LVU A;  2QPQ A;  2V3Q A;  3KOT A;  1RYX A;  1GV8 A;  2Q9T A;  1EZP A;  3IR1 A;  1NH8 A;  1B1H A;  2AL5 A;  3H6U A;  4Z0I A;  4F31 B;  1FQB A;  2Q89 A;  1OLC A;  2Q2A A;  4N6P A;  1Z7N E;  1PC3 A;  3EQ1 A;  4GLI A;  5JTY B;  4C1T A;  2RIN A;  1LBC A;  3TUS A;  4FJP A;  4Z7E A;  1IZ1 A;  4LAT A;  4O3B A;  3TOD A;  5I59 B;  4OYV A;  3KN7 A;  2VHA A;  2ZMB A;  3SES A;  4FEC A;  3GZG A;  3H6W A;  1UTH A;  5I2N A;  1P1Q A;  3EHT A;  2XX9 A;  1UTH B;  3CR9 A;  1M5E A;  4QFP A;  1N7X A;  1MXW A;  1MDQ A;  3PPR A;  3CFX A;  2XX7 A;  1S9T A;  2NOO A;  4F2O A;  2IEE A;  2B3B A;  2YJP A;  1F9B A;  2O7U A;  1MXX A;  4OVJ A;  2OBG A;  2ZNT A;  4EF1 A;  4R9G A;  4AB6 A;  1US5 A;  1N04 A;  5L9M A;  4ELQ A;  2NVU B;  1MS7 A;  3IX1 A;  2CMO A;  2V25 A;  1HSJ A;  1FQC A;  4EXK A;  2F6G A;  4F3P A;  5HBC A;  1OVT A;  1GGG A;  2RC7 A;  3U1O A;  3OO8 A;  2ZNS A;  2XHD A;  1IXI A;  2I0B A;  4ESW A;  2Y84 A;  1B5H A;  4KR5 A;  1AH5 A;  4G8M A;  2VOZ A;  3PUZ E;  1IEJ A;  4LVQ A;  4R72 A;  2HZK A;  4U2R A;  3HHF A;  1N0T A;  4YB7 A;  4QFO A;  1B58 A;  3OOA A;  2V84 A;  2FNC A;  2UXA A;  3FIR A;  4TOZ A;  4RK2 A;  2WKY A;  1I6Q A;  3OEN A;  2V93 A;  4H1X A;  5ICQ A;  1B1X A;  3ZKL A;  4H65 A;  3QUJ A;  2DQV A;  3C9H A;  3IOR A;  4KHZ E;  1NNP A;  4ESX A;  4XKP A;  3RT8 A;  2ZNU A;  2HEU A;  2QMX A;  1H44 A;  3T9V A;  4FEB A;  2ZXT A;  3K1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...