1B46A

Oligo-peptide binding protein (oppa) complexed with kpk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
b'ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b46A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b46A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b46A02
2V3TA 3K0VA 4R2BA 2VGQA 1TFDA 1QUIA 4G8NA 5EHSA 5DTBA 2HAVA 4FIMA 4WEPA 5DT6A 5AA1A 4LZ7A 4ZS9A 2Q2AA 3IR1A 4EF1A 5FHOA 5H8FB 1MY4A 4M4GA 3G3KA 5HM4B 4R73A 3N5LA 1DTZA 2DWIA 4F3BA 1ZLQA 5I59A 3O6GA 1P1WA 5CC2A 3VLWA 1CE2A 3TTNA 4DCYA 2QMXA 2I48A 1MXXA 3CI8A 4F3PA 4WKMA 4LZ8A 4OEVA 3ZS6A 4ECFA 4QFNA 2ONSA 3H6WA 2O68A 4HCWA 4GVOA 4FEDA 3FUZA 2XXQA 2REGA 2HZLA 4Q8RA 2H5YA 4ONYA 4C1UA 1VFDA 2ZYKA 3DLNA 4NMYA 4F2QA 3TAJA 4R74A 3PD9A 1FQFA 3KN8A 2OWSA 3LBSA 3RPWA 5H8SA 4QFPA 3QK6A 4KYSA 3K02A 3CVGA 2D21A 4F29A 4UA8A 1YTVA 1JETA 4AQ4A 2WKYA 5J1DA 1QJMA 2XHDA 1BIYA 2WOLA 3W9WA 3RT8A 3RYAA 2PYYA 1LFIA 2IEEA 4IGRA 1JNFA 2Z8EA 3C9HA 1HSEA 1UTHA 1MPDA 3VE1B 1EZ9A 5I56A 3K4UA 4E0WA 4G68A 1XT8A 4FECA 2O7IA 4X48A 2DYXA 4RK2A 1DTGA 2PMSA 1MRPA 5H8NB 1GGGA 4IO7A 3IJXB 2RINA 4R6HA 3M3LA 3RY3A 2E0SA 3MBPA 1SW4A 3CR9A 3PGFA 2XXXA 4RK9A 2RCBA 2Y7WA 1ANFA 3E4RA 3C34A 3PPRA 3CFLA 3S9MC 4PFUA 3TELA 5K2XA 3H03A 3PMVA 4RA1A 3DP4A 4DXCA 1ZKBA 5KZTA 4OMBA 2PVUA 1SI1A 4HCYA 2ZNSA 1J1NA 5H8QB 1JW1A 4F19A 3S4UA 3TTRA 3H6VA 1OQHA 2P0SA 5CRYA 2W7YA 3S9NC 3RTWB 3V83A 3K1NA 4Q0CA 2Q8JA 2XXWA 1MM6A 1MQJA 2F6GA 4I8CA 3LSLA 1EZOA 1ATGA 1ELJA 4POXA 3GBAA 1P1OA 3Q27A 4KI0E 2Q88A 4LUBA 3SETA 5CM6A 1M5FA 3VDFA 3I3VA 4U23A 1B3EA 2I3VA 1IXCA 3T9VA 3CHGA 4FATA 5I59B 1UIUA 3CSBA 2UVGA 1LAGE 3QSLA 5EHMA 2QS1A 5B7DA 5L9SA 5JEIA 3HHGA 5DVFA 3TPAA 4ZE9A 2OWTA 4YKPA 1FQCA 4BDOA 4MF3A 2F7BA 1QKBA 4R9GA 4OENA 2X7QA 3VVDA 4AB6A 4DIGA 4N07A 2O7UA 4KQPA 2WOPA 1MPCA 2E1SA 3C33A 1H45A 4NF4A 3RYBA 1B5HA 3BKIB 4R6KA 2DWJA 5TU0A 5H8HB 3Q28A 4H65A 2I58A 3FJGA 4IO3A 1D3KA 1S9TA 2Z23A 2I6EA 1B3FA 2PX1A 3HPIA 3GBBA 3PV0E 1PC3A 1JQFA 1PBQA 1Y3PA 2ZYMA 3TQLA 1M5DA 1Y3NA 3VV5A 5ITPA 1A7LA 3T66A 3I5OA 4KYDA 3VVEA 2X7PA 2OLBA 3KGCA 1MH4A 4K3FA 4TLLB 3ZKKA 3HN0A 2Y7IA 3TYHA 4YB6A 2GHAA 4EQ7A 4YAHX 3AXFA 4H1XA 4IO5A 3G3HA 1YPNA 4IY5A 3G3FA 1XVXA 4XKRA 3H06B 2DE3A 3DP6A 3EPEA 2R6GE 2QS4A 4OXVA 3TKDA 3TODA 3CFXA 3DRHA 1HSJA 4ELRA 4YKIA 3S9EA 5K2YA 3TCGA 3FV1A 3K6XA 4QF9A 2GRVA 3KZGA 2O84X 2WOKA 4XTCQ 1OLAA 4NF8A 5I2NB 4OETA 2V25A 1H3DA 4IO2A 2F6PA 1URSA 4GXAA 3BFTA 4QFKA 3RT6B 3H4ZA 4F1UA 1LLSA 4THIA 4HTGA 3O2AA 3OOAA 3S2VA 1FQAA 3IB0A 3G3IA 3FVKA 3DELB 3MC2A 4JWOA 3U72A 3IL1B 4TOZA 2F36A 2R9JA 1POTA 4DE8A 4GIZA 4F39A 4H6DA 3KOSA 4R75A 4YICA 3DRIA 4QFOA 2D3IA 1MG1A 1IXHA 1SW1A 1A8EA 2ZYNA 3OSQA 4UACA 3KSJA 2RKMA 1AL3A 4F1VA 1VSOA 2XXUA 3MZBA 3KEIA 4EXLA 5ITOA 1DPEA 2FYIA 5AA4B 2H99A 3O97A 2B3FA 1R1NA 1USYE 3LR1A 1MXZA 1IXGA 3R7XA 3OO8A 1H43A 2DE4A 1B3HA 1FQEA 3O6HA 4GL0A 4OVJA 1QULA 4IO6A 3T96B 1JVYA 3VLVA 1L5TA 4HW8A 3EHSA 4JSDA 4FJPA 1VFEA 1MXWA 1MY1A 5IKBA 5TP9B 4XKQA 4YB7A 1GV8A 2XXTA 2ABHA 4GFRA 1NH8A 2AYSA 1B3LA 4U22A 1POY1 3DRJA 1F9BA 4ZEIA 2G29A 5KDTB 2OZZA 4C1TA 1PB8A 1N04A 3U8QA 2F7AA 1TFAA 2P2AA 4RPNA 4DXUA 3SDFA 4NF4B 2DVCA 3OEMA 4ZEDA 3SERA 3MVZA 3DM0A 3MW0A 2HFBA 5DEXA 4EF2A 2ZMBA 2NUVA 1MY3A 4QSDA 2DQVA 2Q89A 4I62A 3P7IA 5CMKA 3B6WA 4KYEA 5M2VA 3UN6A 1Y3QA 3CG3A 3A3CA 4OHNA 4BDRA 4OTEA 1ZU0A 1GTKA 4GRKA 5KCJA 4ELQA 1BKAA 1LB9A 3FXUA 4R9FA 1FW0A 3VFJA 1I6AA 2F78A 1P1UA 1MXVA 1R9QA 1LSTA 3B6QA 5CMCA 1D4NA 3K6UA 4F2OA 1IZ1A 3IK6B 3MUQA 4LZ5A 1ZBMA 2BJJX 1NH7A 3EF7A 4KPTA 4I1DA 4LA9A 4ND9A 1N0TA 5FHMA 4FEBA 3D4CA 1EU8A 1VE4A 3FATA 2DP8A 2YLNA 4Z7EA 3ECRA 3OEKA 1B52A 2OK2A 5L8DA 4X9TA 4NF8B 3QAXA 2F34A 2PBWA 2GHBA 3ILTB 4YKKA 3N6UA 1Y4CA 1JW4A 1IEJA 4NWDA 2PT2A 4OZ9A 1A54A 2RC8A 5JTYA 1O63A 4MH5A 4H0WA 2RC7A 5ICTA 5A5XB 4DDDA 3PPPA 2RCAA 4QSCA 1B7ZA 1ZMGA 1MXUA 4ELOA 3LVUA 4XKNA 3IO4A 3JZJA 3CIJA 2AL5A 1P1NA 3OO9A 4RYAA 2HCAA 1MS7A 4NF6B 1MDP1 2F8DA 4P11A 1S50A 3R6UA 3OMBA 5HPQA 5I58A 4AB5A 4PE5B 2NWJA 2Z22A 1WODA 5I57A 2OBGA 4TQUQ 4G4PA 4GWOA 3N94A 1SD3A 3T9XB 1OIBA 1LBCA 2NVUB 3U1OA 4KFQA 3RLFE 3SEVA 4EXKA 3E3KA 1RYXA 3EHTA 3PUXE 4H5GA 4ZEFA 1MXYA 4YB5A 1B58A 4GF8A 2XXPA 1I6BA 3MQ9A 3RNNA 1NNPA 4HS7A 3FD3A 3K01A 1B1XA 1SVXB 1OMPA 2QRYA 4BLAA 3U93A 3PMXA 1URGA 4NF5A 3FXQA 1ZIUA 3C35A 3RQTA 2IA4A 2VHAA 3IAZA 2NOOA 4JWYA 1URDA 5DEXB 4OFOA 3V5AA 3L6GA 3Q29A 3OENA 2REJA 3CSGA 3UORA 3LSFB 4G8HA 1US4A 2DS9A 4YU0A 1SYIA 1OLCA 1ZJLA 3FIRA 5BUUA 4MFIA 5KCJB 1I69A 4OYVA 3PPQA 1JVXA 4OFJA 4YMBA 2THIA 2X26A 3HHFA 2UVJA 4IY6A 4JXIA 2ESNA 5H8FA 3FV2A 1Y1MA 1B05A 2XD3A 5BWJA 3RUMA 3O6PA 3T9UA 2F7CA 3R26A 1LCTA 3OXNA 3K00A 4POWA 3FASA 4ZZEA 1WVJA 4G2ZA 1MH3A 3TCFA 1MQIA 1SYHA 1UTHB 3IOUA 4OWDA 4LQ5A 1GVCA 5I56B 4PP0A 3PU5A 1VR5A 3QYTA 1B4HA 3IO6A 1II5A 3TTKA 5AA3A 4G68B 5JK4A 1FTOA 4KHZE 3H3GA 2Y7KA 3GXAA 1MQDA 3QXMA 4ISUA 3DRKA 4C0RA 2HQ0A 5F1QA 2UYEA 3K1MA 1N7XA 4KR5A 1NNFA 2F97A 2AL4A 2FNCA 3IORA 4YMAA 1Y20A 1TXFA 2XX7A 3WAFA 3MP1A 5I2KA 1XOCA 4G8MA 4QHQA 4PETA 2OCUA 2Y84A 3CRBA 2YJPA 3H6TA 1QVSA 2QPQA 3KBRA 3USDA 4O3AA 2XD2A 4IGTA 3F11A 4G77A 4H5FA 3U92A 2VOZA 4ESXA 1O7TA 1I6QA 1USYH 5I58B 3O6IA 2H9BA 2D5WA 3LUYA 4H8IA 1SQYA 3QIMA 1FTKA 2I0BA 5DVIA 3A09A 1GR2A 4LQ2A 2O51A 2DVZA 3VXBA 1B9JA 3H6UA 3SKPA 3N26A 3M3FA 2ZYOA 3PPOA 4U1ZA 2XXRA 1ZTYA 1P1QA 1FTLA 5AA2A 3ONMA 3VVFA 4JSOA 1PB7A 1D9VA 2ZNTA 3FJ7A 1NNKA 3L6HA 3U94A 3OSRA 4QSEA 4DZ1A 4PFWA 4BDMA 1R6ZA 5DVJA 4KCDA 4LONB 3SEYA 4NF5B 4R72A 3C31A 5I84A 3QUFA 1B51A 1IIWA 1Q1KA 2ZXTA 4DXBA 5CMBA 2GFEA 2B4LA 2I4CA 2OJTA 5H8QA 5CBSA 3UIFA 1TWYA 1OQGA 3TEPA 4ELPA 2B65A 1XS5A 3SEXA 3CFZA 3MJNA 4X1BA 2Y7PA 4F18A 2O6AA 5LOMA 1QUJA 4L17A 3KSXA 1UQWA 1B7HA 2I4BA 3IOVA 3SEUA 4DCXA 1XVYA 3D4GA 1Y1ZA 1SI0A 1HSLA 4F22A 1EZPA 3MWBA 2V93A 3FGSA 4ZECA 1AOVA 3I6VA 1Z7ME 2VD3A 3WAEA 1B32A 3BFUA 1D9YA 1MM7A 2CMOA 2XX8A 3UGWA 4F3GA 3SESA 3K6WA 5FTIA 1LAFE 3V89B 2G93A 1KWHA 2I0CA 1B40A 1B2HA 3C4MA 3C32A 4RPOA 1LFHA 1US5A 2RF1A 2QS3A 2UXAA 2H98A 5L9MA 1EH3A 1DOTA 3PUZE 4Q30B 4ZEKA 4PFYA 2XXVA 3S9LC 2AIXA 4O3CA 2VD2A 3MVWA 1M5EA 3FXRA 1NKXA 1PB9A 5AE4A 5H8HA 4NTLA 3KG2A 3FVGA 4LP2B 5I2KB 3IB2A 2QMWA 3FZVA 4H8JA 3ZSFA 5TPAA 1LB8A 3Q25A 4JWXA 4WEDA 3E9XA 3UA8A 1CB6A 4BDLA 2XXHA 3B7DA 4GOTA 1MPBA 3A3UA 3K2DA 3MAMA 4O3BA 5F7VA 3MZ1A 4H67A 1R9LA 1NL5A 3O66A 1SBPA 1IQ7A 2I49A 2A5TA 2PT1A 3PUYE 3LSXA 5ISUA 1A55A 4GQOA 2XXIA 1DMBA 3MP8A 1N3XA 1AH5A 3G7WA 4QRZA 1AIVA 4P0GA 3TFLA 5AA2B 1B5JA 2F35A 3KN7A 4NWCA 1OVBA 2M8CA 5AA2D 3MPKA 4KD5A 1N76A 3GZGA 3PUWE 1OVTA 3THIA 5I2NA 1Q35A 1UTBA 3JYRA 2DWHA 1FQBA 4GD5A 1YCJA 3UK4A 1LCFA 2XXYA 1RKMA 1N3WA 3H7MA 1LAXA 4U1OA 3FTOA 1B7UA 3RN8A 5ICQA 1M5CA 3N6TA 3CG1A 3QUJA 2RC9A 2UYFA 2DXRA 3PD8A 4ESWA 3IOWA 4OQOA 3EHUA 2ANJA 2O69A 2H4IA 4U4XA 4U4SA 4ZDMA 5FTHA 3DRFA 2Y7RA 5HBCA 2H25A 4F1YA 3K6VA 4MBPA 5CI5A 1JW5A 1IXIA 2CZLA 2A5SA 2GH9A 1AMFA 2QSXA 2QJEA 3FVNA 4F31B 4MLVA 4JDFA 3BBRA 1SDXA 5AA4A 1Y4TA 3HSTA 1BP5A 3MPLA 1O64A 2HZKA 5DYHA 4GLIA 1PDAA 4YKJA 3PAMA 4R6YA 2DOJA 4N13A 3KFMA 4OFLA 3OO7A 3PPNA 2VP1A 1FCKA 5FHNA 4KCCA 4I9DA 2V3QA 4PQJA 3IJOB 3T22A 3DP8A 1QUKA 1XHYA 3ILUB 1JEUA 3G3JA 2B3BA 3MP6A 1B6HA 2ALUA 1IITA 3GLBA 4U2RA 4EDPA 5TP9A 4ZEBA 4Z0IA 4WXJA 3HO7A 4LATA 1MQHA 1T0KA 3VLUA 1IUDA 1B4ZA 5CMMA 5KDTA 2I3WA 2QS2A 3MVYA 1B1HA 4FORA 4BDQA 2YPNA 4RJZA 3IX1A 4EUOA 1LFGA 4TLMB 4RNSA 3RGYA 2DWAA 1UIVA 5ELVA 4RXLA 4U21A 1MDQA 2ONKE 3EN3A 3HV1A 1JEVA 3PUVE 5CBRA 4FAJA 3EQ1A 4OERA 2ONRA 1MQGA 2DE2A 5IAIA 2R71A 1QW0A 5TPAB 1Y9UA 3JV9A 3IOTA 3ZKLA 1B0LA 5B70A 1N84A 3PMWA 1NFTA 3TTMA 4JB7A 2B4MA 3TZAA 4RY1A 4F3SA 4YZZA 2V3UA 3C36A 3E13X 1LGBC 3LSWA 1QKAA 5JTYB 2NXOA 3FJMA 3HCQA 3TTLA 1SW5A 3IB1A 3KJ7A 4XXUA 2A5TB 4M1VA 3RTFB 3MVXA 1PBPA 1DSNA 4P0IA 1H76A 1B0HA 1SW2A 3TCHA 4EQBA 4MLQA 4DLDA 2O1LA 3M8UA 3TDJA 4E0XA 1TT1A 1NMUA 4GXSB 4XKPA 1N7WA 1WDNA 2V84A 3SEWA 1FQDA 1B46A 1FTMA 2HAUA 2ZNUA 2DSFA 5I57B 3G3GA 2Z8DA 3ODBA 4N6PA 3TQWA 1UTBB 3UP9A 3W15C 3OELA 1LBBA 1P99A 2P1SA 1NNTA 4R2FA 5H8NA 3MZ9A 3T9HB 1RYOA 2HEUA 4OESA 3V8XB 4NEDA 1BTJA 3OO6A 1S7YA 3KOTA 3DRGA 5A5XA 3W9VA 4X1DA 3FVOA 1Z7NE 3M3KA 4XIGQ 4GL8A 4PFTA 1A8FA 1B5IA 1A99A 4IO4A 3OD7A 4FE8A 2Z8FA 3KJTA 4NF6A 1LAHE 1PEBA 3LC8A 2UVHA 5EYFA 1DPPA 4QFLA 4G68C 3K1PA 4LVQA 3VXCA 4ZE8A 2Q2CA 1H44A 2Q9TA 4OEUA 2QL3A 3KN3A 3TUSA 2UVIA 1MY2A 1FTJA 1A40A 1B3GA 3TMGA 1XC1A 5L9OA 2KLFA 4IB2A 2XX9A 4Q5TA 4EQ9A 1YAEA 4JBZA 2HXWA 3O28A 1BLFA 2F5XA 2O1MA 3T93B 1MY0A 3Q26A 2LAOA 4ZZAA 4NE4A 3O9PA 2FA7A 2DXYA 3O29A 4BDNA 3B6TA 1M5BA
chains in the Genus database with same CATH superfamily
2V3TA 3K0VA 3QMFA 4R2BA 2VGQA 4PBHA 1TFDA 1QUIA 4G8NA 5EHSA 5DTBA 1FPDA 2HAVA 3KC1A 4FIMA 4WEPA 5DT6A 5AA1A 4LZ7A 4ZS9A 2Q2AA 3IR1A 4EF1A 5FHOA 5H8FB 1MY4A 2Y5LA 4M4GA 3G3KA 5HM4B 4R73A 3N5LA 1DTZA 2DWIA 4F3BA 1ZLQA 5I59A 3O6GA 1P1WA 5CC2A 3VLWA 1CE2A 3TTNA 4DCYA 2QMXA 2I48A 1MXXA 3CI8A 4F3PA 2FIEA 4WKMA 2HHMA 4LZ8A 4JVDA 4OEVA 3BIHA 3ZS6A 4ECFA 4QFNA 2ONSA 3H6WA 2O68A 2HPGA 4HCWA 4GVOA 4FEDA 3FUZA 2XXQA 2REGA 4HE1A 3MYUA 2HZLA 4Q8RA 1IMFA 2H5YA 4ONYA 4C1UA 1VFDA 2ZYKA 3DLNA 4NMYA 4F2QA 3TAJA 4R74A 3PD9A 4NGUA 1FQFA 3T1BA 3KN8A 2OWSA 4N81A 3LBSA 3RPWA 5H8SA 4QFPA 3QK6A 4KYSA 3K02A 4QBAA 3CVGA 2D21A 4MAGA 4UA8A 1YTVA 4F29A 1JETA 4AQ4A 5ET5A 1FBPA 2WKYA 5J1DA 1QJMA 2XHDA 1BIYA 2WOLA 3W9WA 4P56A 3RT8A 3RYAA 2PYYA 1LFIA 2IEEA 4IGRA 1JNFA 4GX3A 2Z8EA 3C9HA 1HSEA 1UTHA 1MPDA 4NHBA 3VE1B 1EZ9A 5I56A 4NF0A 3K4UA 4E0WA 2ZZVA 4G68A 1XT8A 4FECA 2O7IA 4X48A 2DYXA 4RK2A 1DTGA 2PMSA 1MRPA 5H8NB 1GGGA 4IO7A 3IJXB 2RINA 4R6HA 3M3LA 3RY3A 2E0SA 3FXBA 3MBPA 4PCDA 1SW4A 1JP4A 3CR9A 4P8BA 1SPIA 3PGFA 2XXXA 4RK9A 5IZ1A 4X04A 2RCBA 5LTCA 2Y7WA 1ANFA 3E4RA 3C34A 3PPRA 3CFLA 3S9MC 4PFUA 3TELA 5K2XA 3H03A 3PMVA 4RA1A 3DP4A 4DXCA 1ZKBA 5KZTA 4OMBA 2PVUA 1SI1A 4HCYA 1NUZA 2ZNSA 1J1NA 5H8QB 1JW1A 4F19A 3S4UA 3TTRA 3H6VA 1LBZA 1OQHA 2P0SA 3A29A 5CRYA 2W7YA 2FBPA 3S9NC 3RTWB 3V83A 1LBXA 3K1NA 4Q0CA 2Q8JA 2XXWA 1MM6A 1MQJA 2F6GA 4I8CA 3LSLA 1EZOA 1ATGA 1ELJA 4P3LA 4PFIA 4POXA 3GBAA 1P1OA 3Q27A 4KI0E 2Q88A 4LUBA 3SETA 2R8TA 5CM6A 1M5FA 1FBCA 3VDFA 3I3VA 4U23A 1B3EA 2I3VA 1IXCA 3T9VA 3CHGA 4FATA 5I59B 1UIUA 3CSBA 2UVGA 1LAGE 1LEVA 3QSLA 5EHMA 4GWYA 2QS1A 3IFCA 5B7DA 5L9SA 5JEIA 3HHGA 5DVFA 3TPAA 4ZE9A 2OWTA 4YKPA 5IM2A 1FQCA 4BDOA 4MF3A 2F7BA 1QKBA 1D9QA 4R9GA 4OENA 2X7QA 3VVDA 4PE3A 4AB6A 4DIGA 4N07A 2XXKA 1NV4A 2O7UA 4KQPA 2WOPA 1MPCA 2E1SA 3C33A 1H45A 4NF4A 3RYBA 1B5HA 3BKIB 4R6KA 2DWJA 5TU0A 1Q9DA 5H8HB 3Q28A 4H65A 2I58A 3FJGA 4IO3A 1D3KA 1S9TA 2Z23A 2I6EA 1B3FA 2PX1A 3HPIA 3GBBA 3PV0E 1PC3A 1JQFA 1PBQA 1Y3PA 2ZYMA 3TQLA 1M5DA 1Y3NA 3VV5A 5ITPA 1A7LA 3T66A 3I5OA 4KYDA 3VVEA 2X7PA 2OLBA 4PAFA 3KGCA 1MH4A 4K3FA 4PGPA 4TLLB 3ZKKA 3HN0A 2Y7IA 3TYHA 4YB6A 2GHAA 4EQ7A 4YAHX 3AXFA 1RDZA 1K9YA 4H1XA 2ZZWA 4IO5A 3G3HA 1YPNA 4IY5A 1KZ8A 4GWUA 3G3FA 5EYGA 1XVXA 5I3SA 4UABA 4XKRA 4N17A 4MX6A 3H06B 2DE3A 3DP6A 3EPEA 2R6GE 2QS4A 4OXVA 3TKDA 3TODA 3CFXA 1FPGA 3DRHA 1HSJA 4ELRA 1G0HA 2WYPA 4PBQA 4N15A 4YKIA 4LN5A 3S9EA 5K2YA 3TCGA 3FV1A 3K6XA 3RPLB 4QF9A 2GRVA 3KZGA 3PTYA 2O84X 2WOKA 4XTCQ 1OLAA 1RDYA 4NF8A 5I2NB 4OETA 2V25A 1H3DA 4IO2A 2F6PA 1URSA 4GXAA 4P1LA 5DW8A 3BFTA 4QFKA 1NI9A 3H4ZA 3RT6B 1LLSA 4F1UA 4THIA 4HTGA 3O2AA 1FSAA 4P1EA 3OOAA 3S2VA 2FVZA 1YYZA 1FQAA 3IB0A 1NUWA 3G3IA 3FVKA 3DELB 3MC2A 4JWOA 3U72A 3IL1B 4TOZA 2F36A 2OWZA 2R9JA 1POTA 4DE8A 4GIZA 4F39A 4P47A 2CZKA 4H6DA 3KOSA 4R75A 4YICA 3DRIA 4QFOA 2D3IA 3HFUA 1MG1A 1IXHA 1SW1A 2XWOA 1A8EA 2ZYNA 3OSQA 4UACA 2QFLA 4MHFA 3KSJA 2QVVA 2RKMA 1AL3A 4F1VA 1VSOA 2XXUA 3MZBA 3KEIA 4EXLA 5ITOA 1DPEA 2FYIA 5AA4B 2H99A 3O97A 2B3FA 1R1NA 1USYE 3LR1A 1MXZA 1IXGA 3R7XA 3OO8A 1H43A 2DE4A 1B3HA 1NV0A 1FQEA 3O6HA 4GL0A 4OVJA 1QULA 2PCRA 4IO6A 3T96B 1NUYA 1JVYA 2WBBA 3VLVA 1CNQA 1L5TA 4HW8A 3EHSA 4PF6A 4MJOA 4JSDA 4FJPA 1VFEA 1MXWA 1MY1A 5IKBA 5TP9B 4XKQA 4YB7A 1GV8A 1LBVA 2XXTA 2ABHA 4GFRA 1NH8A 2AYSA 1B3LA 4U22A 1POY1 3DRJA 1F9BA 2V4CA 4ZEIA 2G29A 1FPIA 5KDTB 2OZZA 4C1TA 1PB8A 1N04A 3U8QA 2F7AA 1TFAA 2P2AA 3GYYA 4RPNA 1FBFA 4DXUA 3SDFA 4NF4B 2DVCA 3OEMA 4ZEDA 3SERA 3MVZA 3DM0A 3MW0A 2HFBA 5DEXA 4EF2A 2ZMBA 3U65A 2NUVA 1MY3A 4QSDA 2DQVA 2Q89A 4I62A 2P3NA 1NV5A 3P7IA 5CMKA 3B6WA 4KYEA 5M2VA 3BIGA 2QVUA 3UN6A 2F3DA 1Y3QA 3CG3A 3A3CA 4OHNA 4BDRA 4OTEA 4GBVA 1ZU0A 1GTKA 4GRKA 5KCJA 1IMBA 4ELQA 1BKAA 1LB9A 3FXUA 5IGAA 4R9FA 1FW0A 3VFJA 1I6AA 2F78A 1P1UA 1MXVA 1R9QA 1LSTA 3B6QA 5CMCA 1D4NA 4AS4A 3K6UA 4MNCA 4F2OA 4H46A 1IZ1A 3IK6B 3MUQA 4LZ5A 1KA1A 1ZBMA 4I3EA 2BJJX 1NH7A 3EF7A 4KPTA 4I1DA 4LA9A 4ND9A 1N0TA 5FHMA 4FEBA 3D4CA 1EU8A 3LV0A 1VE4A 4JVCA 4GBWA 4O7IA 3FATA 2DP8A 2YLNA 4Z7EA 3ECRA 3OEKA 1B52A 2OK2A 1FRPA 5L8DA 4X9TA 3NOHA 4NF8B 3QAXA 2F34A 2PBWA 3E78A 2GHBA 3ILTB 4YKKA 3N6UA 1Y4CA 1JW4A 1IEJA 4NWDA 2PT2A 4OZ9A 4PAKA 1A54A 2RC8A 5JTYA 1O63A 4MH5A 4H0WA 2RC7A 5ICTA 5A5XB 4DDDA 3PPPA 4MNIA 2RCAA 4N8YA 4QSCA 1B7ZA 1ZMGA 1MXUA 4ELOA 4MEVA 3LVUA 4XKNA 3IO4A 3JZJA 3CIJA 2AL5A 1P1NA 2KQZA 3OO9A 4RYAA 2HCAA 1MS7A 4NF6B 1MDP1 2F8DA 4P11A 1S50A 3R6UA 3OMBA 5HPQA 4P9KA 5I58A 4N4UA 4PE5B 4AB5A 3IFAA 2NWJA 2Z22A 1WODA 5I57A 2OBGA 4TQUQ 4XF5A 4G4PA 4O94A 2FIXA 4GWOA 3N94A 1SD3A 3T9XB 1OIBA 1LBCA 2NVUB 3U1OA 4KFQA 3RLFE 3SEVA 4EXKA 3E3KA 1RYXA 3EHTA 4GWWA 3PUXE 4H5GA 4ZEFA 4O7MA 1MXYA 4YB5A 2P3VA 1B58A 4GF8A 2XXPA 1I6BA 3MQ9A 3RNNA 1NNPA 4HS7A 4OVPA 3FD3A 3K01A 2L5VA 1B1XA 1SVXB 1OMPA 2QRYA 4BLAA 3U93A 1IMCA 3PMXA 4JVIA 1URGA 4NQ8A 4NF5A 3FXQA 1ZIUA 3C35A 4PDDA 3RQTA 2IA4A 5IZ3A 2VHAA 2DDKA 3IAZA 2NOOA 4JWYA 1FPFA 1URDA 5DEXB 4OFOA 3V5AA 3L6GA 3Q29A 3OENA 2REJA 3CSGA 3UORA 3LSFB 4PFBA 2HXRA 4G8HA 1US4A 2DS9A 4YU0A 4DI4B 1SYIA 1OLCA 1ZJLA 1NV7A 3FIRA 5BUUA 4MFIA 5KCJB 1I69A 4OYVA 4GX4A 3SZPA 3PPQA 1JVXA 4OFJA 4YMBA 2THIA 2X26A 3HHFA 2UVJA 4IY6A 4JXIA 2ESNA 5H8FA 3FV2A 1Y1MA 4GWXA 1B05A 2XD3A 5BWJA 3RUMA 3O6PA 3T9UA 2F7CA 3R26A 1LCTA 3OXNA 3K00A 4POWA 1EYIA 3FASA 1FPLA 4ZZEA 1WVJA 4G2ZA 1MH3A 3TCFA 1MQIA 1LBWA 1SYHA 1UTHB 3IOUA 4OWDA 4LQ5A 1GVCA 5I56B 4PP0A 3PU5A 4NN3A 1VR5A 3QYTA 4HXVA 1B4HA 3IO6A 3KBZA 1II5A 3TTKA 5AA3A 4G68B 5JK4A 1FTOA 5ET7A 2JJKA 1NV1A 4KHZE 3H3GA 2Y7KA 3GXAA 2VT5A 1MQDA 3QXMA 4ISUA 3DRKA 4C0RA 2HQ0A 5F1QA 2UYEA 3K1MA 1N7XA 4KR5A 1NNFA 2F97A 2AL4A 2FNCA 3IORA 4YMAA 1KA0A 1Y20A 1TXFA 2XX7A 3WAFA 3MP1A 5I2KA 1XOCA 3B50A 4G8MA 4QHQA 4OANA 1FBEA 4PETA 2OCUA 2Y84A 3CRBA 2YJPA 3H6TA 1QVSA 2XWIA 2QPQA 3KBRA 3USDA 3FBPA 5EQ7A 4O3AA 2Y5KA 2XD2A 4MNPA 4IGTA 2ZZXA 3F11A 4G77A 4H5FA 3U92A 2VOZA 4ESXA 1O7TA 2PFZA 1I6QA 1USYH 3ROJA 5I58B 3O6IA 2H9BA 2D5WA 3LUYA 4H8IA 1SQYA 3QIMA 1FTKA 2I0BA 4OVTA 5DVIA 3A09A 1GR2A 4LQ2A 2O51A 2DVZA 3VXBA 1B9JA 3H6UA 4NG7A 3SKPA 3N26A 3M3FA 2ZYOA 3PPOA 4PF8A 4U1ZA 2XXRA 1ZTYA 1P1QA 1FTLA 5AA2A 3ONMA 3VVFA 4JSOA 1PB7A 1D9VA 2PFYA 2ZNTA 3FJ7A 1NNKA 3L6HA 3U94A 3OSRA 4PDHA 4QSEA 4DZ1A 4PFWA 4BDMA 1R6ZA 5DVJA 4KCDA 2WBDA 4LONB 3SEYA 4N6KA 4G61A 4NF5B 4R72A 3C31A 5I84A 3QUFA 1B51A 1IIWA 1Q1KA 2ZXTA 4DXBA 5CMBA 2GFEA 2B4LA 2I4CA 2OJTA 4GWSA 1DBZA 5ESYA 5H8QA 5CBSA 1XI6A 3UIFA 1TWYA 1OQGA 3TEPA 4ELPA 2B65A 1XS5A 3SEXA 3CFZA 3MJNA 4X1BA 2Y7PA 4F18A 2O6AA 5LOMA 1QUJA 1NV6A 4L17A 2CZIA 5J16A 3KSXA 1UQWA 1B7HA 2I4BA 3IOVA 3SEUA 4DCXA 1XVYA 1IMAA 3D4GA 1Y1ZA 1SI0A 1HSLA 4F22A 1EZPA 3MWBA 2V93A 3FGSA 1NUXA 4ZECA 1AOVA 3I6VA 1Z7ME 2OX3A 4NX1A 2VD3A 3WAEA 1B32A 3BFUA 1D9YA 1MM7A 1RDXA 2CMOA 2XX8A 2CZHA 3UGWA 4F3GA 3SESA 1FPEA 3K6WA 5FTIA 1LAFE 3V89B 5I7IA 2G93A 1DCUA 1KWHA 2I0CA 1B40A 1LBYA 1B2HA 4I40A 3C4MA 3C32A 4RPOA 4XFEA 1LFHA 4N91A 1INPA 1US5A 2RF1A 2QS3A 3MSTA 2UXAA 2H98A 5L9MA 1EH3A 1DOTA 3PUZE 4Q30B 4ZEKA 4PFYA 2XXVA 3S9LC 2AIXA 4FBPA 4O3CA 2VD2A 3MVWA 1M5EA 3FXRA 1NKXA 1PB9A 5AE4A 5H8HA 4NTLA 3KG2A 3FVGA 4LP2B 5I2KB 3IB2A 2QMWA 3FZVA 4H8JA 5EQ8A 1FBDA 3LUZA 4PFRA 3ZSFA 5TPAA 1LB8A 4AS5A 3Q25A 4DI3D 4JWXA 4WEDA 3E9XA 3UA8A 4IR8A 5EQ9A 1CB6A 4BDLA 2XA5A 2XXHA 3B7DA 4GOTA 1MPBA 3A3UA 3K2DA 3MAMA 4O3BA 5EYHA 5F7VA 4PTKA 3MZ1A 4H67A 2GQ1A 1R9LA 1NL5A 3O66A 3ISPA 1YXIA 1SBPA 1IQ7A 2I49A 2A5TA 2PT1A 3PUYE 3LSXA 5IZZA 5ISUA 1A55A 2WX9A 4GQOA 4N6DA 2XXIA 1DMBA 3MP8A 1N3XA 4QXDA 1AH5A 3G7WA 4QRZA 1AIVA 4P0GA 3TFLA 5AA2B 1B5JA 4O8MA 2F35A 3KN7A 1OVBA 4NWCA 2M8CA 5AA2D 3MPKA 4KD5A 1N76A 3GZGA 3RPLA 3PUWE 1OVTA 2VPOA 3THIA 5I2NA 2XWVA 1Q35A 1UTBA 3JYRA 2DWHA 1FQBA 4GD5A 1YCJA 3UK4A 1LCFA 1FPBA 2XXYA 1RKMA 1N3WA 3H7MA 4H45A 1LAXA 4U1OA 3FTOA 1B7UA 3RN8A 5ICQA 1M5CA 4MMPA 3N6TA 3CG1A 3QUJA 2RC9A 2UYFA 2DXRA 3PD8A 4ESWA 2QVRA 3IOWA 4OQOA 3EHUA 1EYKA 2ANJA 2O69A 1FBHA 2H4IA 4U4XA 4U4SA 4ZDMA 4I3YA 5FTHA 3DRFA 2Y7RA 5HBCA 2H25A 4F1YA 3K6VA 1DK4A 4MBPA 2Q74A 5CI5A 1JW5A 1IXIA 2CZLA 2A5SA 2GH9A 1NV3A 1AMFA 2QSXA 2QJEA 3FVNA 4F31B 4MCOA 4MLVA 1FBGA 4JDFA 3BBRA 1SDXA 5AA4A 1Y4TA 2VPNA 4PGNA 3HSTA 1BP5A 3MPLA 1O64A 2HZKA 5DYHA 4GLIA 1PDAA 4YKJA 3PAMA 4R6YA 2DOJA 4N13A 3KFMA 4OFLA 3OO7A 3PPNA 2VP1A 1FCKA 5FHNA 4KCCA 5LDZA 1FTAA 4I9DA 2V3QA 4PQJA 3IJOB 3T22A 3DP8A 1QUKA 1XHYA 3ILUB 1JEUA 3G3JA 2B3BA 3MP6A 3D1RA 1B6HA 2ALUA 1IITA 3GLBA 4U2RA 4EDPA 5ET8A 5A5LA 4PC9A 5TP9A 4ZEBA 4Z0IA 4WXJA 3HO7A 4LATA 1MQHA 1T0KA 3VLUA 1FJ6A 4OVSA 1IUDA 1QGXA 1B4ZA 5CMMA 5KDTA 2I3WA 1BK4A 2QS2A 3MVYA 2XWKA 1B1HA 4XEQA 5I5PA 5EQAA 4FORA 4BDQA 2YPNA 4RJZA 5ET6A 4HE0A 2WYKA 3IX1A 4OA4A 4EUOA 4HE2A 1LFGA 1IMDA 3E79A 4TLMB 4RNSA 3RGYA 2DWAA 1UIVA 5ELVA 4RXLA 4U21A 1MDQA 2ONKE 3EN3A 3HV1A 1JEVA 3PUVE 1FPKA 5CBRA 5FBPA 4FAJA 3EQ1A 4GWZA 4OERA 1FPJA 2ONRA 1MQGA 1K9ZA 2DE2A 5IAIA 2R71A 1QW0A 5TPAB 1Y9UA 3JV9A 3IOTA 3ZKLA 1B0LA 3KC0A 5B70A 1N84A 2FHYA 3PMWA 1EYJA 1NFTA 3TTMA 4JB7A 2B4MA 3TZAA 4RY1A 4F3SA 4YZZA 1G0IA 2V3UA 3RYDA 2CEYA 3C36A 3E13X 1LGBC 3LSWA 1QKAA 5JTYB 2NXOA 3FJMA 3HCQA 3TTLA 1SW5A 3IB1A 3KJ7A 4XXUA 2CEXA 2A5TB 1NV2A 4KXPA 4M1VA 3RTFB 3MVXA 1DSNA 1PBPA 4P0IA 1H76A 1B0HA 1SW2A 3TCHA 4NAPA 4GX6A 4EQBA 4MLQA 4DLDA 2O1LA 1IMEA 3M8UA 3TDJA 4E0XA 1TT1A 1NMUA 1YZ0A 4GXSB 4XKPA 4MIJA 1N7WA 2KR0A 1WDNA 2V84A 3SEWA 1FQDA 1B46A 1FTMA 2HAUA 2ZNUA 2DSFA 5I57B 3G3GA 2Z8DA 3ODBA 4N6PA 3TQWA 1UTBB 3UP9A 3W15C 3OELA 1LBBA 1P99A 2P1SA 1NNTA 4R2FA 5H8NA 3MZ9A 1VDWA 2BJIA 3T9HB 4X8RA 1RYOA 2HEUA 4OESA 3V8XB 4NEDA 2WEFA 1BTJA 3B8BA 3OO6A 1S7YA 3KOTA 1FJ9A 3DRGA 5A5XA 3W9VA 4X1DA 4OVQA 3FVOA 1Z7NE 3M3KA 4XIGQ 4GL8A 4PFTA 2MKZA 4OVRA 1A8FA 1B5IA 5T3JA 1A99A 4IO4A 3OD7A 5F24A 4FE8A 2Z8FA 3KJTA 4NF6A 1LAHE 1PEBA 3LC8A 2UVHA 5EYFA 1DPPA 4QFLA 4G68C 3K1PA 2Q8MA 4LVQA 5IZ3B 3VXCA 4ZE8A 2Q2CA 1H44A 2Q9TA 4OEUA 2QL3A 3KN3A 3TUSA 2UVIA 1MY2A 1FTJA 1A40A 1B3GA 3TMGA 1XC1A 5L9OA 2KLFA 4IB2A 2XX9A 4Q5TA 4EQ9A 1YAEA 4JBZA 2F3BA 4N8GA 2HXWA 3O28A 1BLFA 3T0JA 2F5XA 3EKIA 2O1MA 1AWBA 3T93B 1MY0A 3Q26A 2LAOA 4ZZAA 4NE4A 3O9PA 2FA7A 2DXYA 3O29A 4BDNA 4PAIA 3B6TA 1M5BA
chains in the Genus database with same CATH topology
2V3TA 3K0VA 4R2BA 2VGQA 1TFDA 1QUIA 4G8NA 5EHSA 5DTBA 2HAVA 4FIMA 4WEPA 5DT6A 5AA1A 4LZ7A 4ZS9A 2Q2AA 3IR1A 4EF1A 5FHOA 5H8FB 1MY4A 4M4GA 3G3KA 5HM4B 4R73A 3N5LA 1DTZA 2DWIA 4F3BA 1ZLQA 5I59A 3O6GA 1P1WA 5CC2A 3VLWA 1CE2A 3TTNA 4DCYA 2QMXA 2I48A 1MXXA 3CI8A 4F3PA 4WKMA 4LZ8A 4OEVA 3ZS6A 4ECFA 4QFNA 2ONSA 3H6WA 2O68A 4HCWA 4GVOA 4FEDA 3FUZA 2XXQA 2REGA 2HZLA 4Q8RA 2H5YA 4ONYA 4C1UA 1VFDA 2ZYKA 3DLNA 4NMYA 4F2QA 3TAJA 4R74A 3PD9A 1FQFA 3KN8A 2OWSA 3LBSA 3RPWA 5H8SA 4QFPA 3QK6A 4KYSA 3K02A 3CVGA 2D21A 4F29A 4UA8A 1YTVA 1JETA 4AQ4A 2WKYA 5J1DA 1QJMA 2XHDA 1BIYA 2WOLA 3W9WA 3RT8A 3RYAA 2PYYA 1LFIA 2IEEA 4IGRA 1JNFA 2Z8EA 3C9HA 1HSEA 1UTHA 1MPDA 3VE1B 1EZ9A 5I56A 3K4UA 4E0WA 4G68A 1XT8A 4FECA 2O7IA 4X48A 2DYXA 4RK2A 1DTGA 2PMSA 1MRPA 5H8NB 1GGGA 4IO7A 3IJXB 2RINA 4R6HA 3M3LA 3RY3A 2E0SA 3MBPA 1SW4A 3CR9A 3PGFA 2XXXA 4RK9A 2RCBA 2Y7WA 1ANFA 3E4RA 3C34A 3PPRA 3CFLA 3S9MC 4PFUA 3TELA 5K2XA 3H03A 3PMVA 4RA1A 3DP4A 4DXCA 1ZKBA 5KZTA 4OMBA 2PVUA 1SI1A 4HCYA 2ZNSA 1J1NA 5H8QB 1JW1A 4F19A 3S4UA 3TTRA 3H6VA 1OQHA 2P0SA 5CRYA 2W7YA 3S9NC 3RTWB 3V83A 3K1NA 4Q0CA 2Q8JA 2XXWA 1MM6A 1MQJA 2F6GA 4I8CA 3LSLA 1EZOA 1ATGA 1ELJA 4POXA 3GBAA 1P1OA 3Q27A 4KI0E 2Q88A 4LUBA 3SETA 5CM6A 1M5FA 3VDFA 3I3VA 4U23A 1B3EA 2I3VA 1IXCA 3T9VA 3CHGA 4FATA 5I59B 1UIUA 3CSBA 2UVGA 1LAGE 3QSLA 5EHMA 2QS1A 5B7DA 5L9SA 5JEIA 3HHGA 5DVFA 3TPAA 4ZE9A 2OWTA 4YKPA 1FQCA 4BDOA 4MF3A 2F7BA 1QKBA 4R9GA 4OENA 2X7QA 3VVDA 4AB6A 4DIGA 4N07A 2O7UA 4KQPA 2WOPA 1MPCA 2E1SA 3C33A 1H45A 4NF4A 3RYBA 1B5HA 3BKIB 4R6KA 2DWJA 5TU0A 5H8HB 3Q28A 4H65A 2I58A 3FJGA 4IO3A 1D3KA 1S9TA 2Z23A 2I6EA 1B3FA 2PX1A 3HPIA 3GBBA 3PV0E 1PC3A 1JQFA 1PBQA 1Y3PA 2ZYMA 3TQLA 1M5DA 1Y3NA 3VV5A 5ITPA 1A7LA 3T66A 3I5OA 4KYDA 3VVEA 2X7PA 2OLBA 3KGCA 1MH4A 4K3FA 4TLLB 3ZKKA 3HN0A 2Y7IA 3TYHA 4YB6A 2GHAA 4EQ7A 4YAHX 3AXFA 4H1XA 4IO5A 3G3HA 1YPNA 4IY5A 3G3FA 1XVXA 4XKRA 3H06B 2DE3A 3DP6A 3EPEA 2R6GE 2QS4A 4OXVA 3TKDA 3TODA 3CFXA 3DRHA 1HSJA 4ELRA 4YKIA 3S9EA 5K2YA 3TCGA 3FV1A 3K6XA 4QF9A 2GRVA 3KZGA 2O84X 2WOKA 4XTCQ 1OLAA 4NF8A 5I2NB 4OETA 2V25A 1H3DA 4IO2A 2F6PA 1URSA 4GXAA 3BFTA 4QFKA 3RT6B 3H4ZA 4F1UA 1LLSA 4THIA 4HTGA 3O2AA 3OOAA 3S2VA 1FQAA 3IB0A 3G3IA 3FVKA 3DELB 3MC2A 4JWOA 3U72A 3IL1B 4TOZA 2F36A 2R9JA 1POTA 4DE8A 4GIZA 4F39A 4H6DA 3KOSA 4R75A 4YICA 3DRIA 4QFOA 2D3IA 1MG1A 1IXHA 1SW1A 1A8EA 2ZYNA 3OSQA 4UACA 3KSJA 2RKMA 1AL3A 4F1VA 1VSOA 2XXUA 3MZBA 3KEIA 4EXLA 5ITOA 1DPEA 2FYIA 5AA4B 2H99A 3O97A 2B3FA 1R1NA 1USYE 3LR1A 1MXZA 1IXGA 3R7XA 3OO8A 1H43A 2DE4A 1B3HA 1FQEA 3O6HA 4GL0A 4OVJA 1QULA 4IO6A 3T96B 1JVYA 3VLVA 1L5TA 4HW8A 3EHSA 4JSDA 4FJPA 1VFEA 1MXWA 1MY1A 5IKBA 5TP9B 4XKQA 4YB7A 1GV8A 2XXTA 2ABHA 4GFRA 1NH8A 2AYSA 1B3LA 4U22A 1POY1 3DRJA 1F9BA 4ZEIA 2G29A 5KDTB 2OZZA 4C1TA 1PB8A 1N04A 3U8QA 2F7AA 1TFAA 2P2AA 4RPNA 4DXUA 3SDFA 4NF4B 2DVCA 3OEMA 4ZEDA 3SERA 3MVZA 3DM0A 3MW0A 2HFBA 5DEXA 4EF2A 2ZMBA 2NUVA 1MY3A 4QSDA 2DQVA 2Q89A 4I62A 3P7IA 5CMKA 3B6WA 4KYEA 5M2VA 3UN6A 1Y3QA 3CG3A 3A3CA 4OHNA 4BDRA 4OTEA 1ZU0A 1GTKA 4GRKA 5KCJA 4ELQA 1BKAA 1LB9A 3FXUA 4R9FA 1FW0A 3VFJA 1I6AA 2F78A 1P1UA 1MXVA 1R9QA 1LSTA 3B6QA 5CMCA 1D4NA 3K6UA 4F2OA 1IZ1A 3IK6B 3MUQA 4LZ5A 1ZBMA 2BJJX 1NH7A 3EF7A 4KPTA 4I1DA 4LA9A 4ND9A 1N0TA 5FHMA 4FEBA 3D4CA 1EU8A 1VE4A 3FATA 2DP8A 2YLNA 4Z7EA 3ECRA 3OEKA 1B52A 2OK2A 5L8DA 4X9TA 4NF8B 3QAXA 2F34A 2PBWA 2GHBA 3ILTB 4YKKA 3N6UA 1Y4CA 1JW4A 1IEJA 4NWDA 2PT2A 4OZ9A 1A54A 2RC8A 5JTYA 1O63A 4MH5A 4H0WA 2RC7A 5ICTA 5A5XB 4DDDA 3PPPA 2RCAA 4QSCA 1B7ZA 1ZMGA 1MXUA 4ELOA 3LVUA 4XKNA 3IO4A 3JZJA 3CIJA 2AL5A 1P1NA 3OO9A 4RYAA 2HCAA 1MS7A 4NF6B 1MDP1 2F8DA 4P11A 1S50A 3R6UA 3OMBA 5HPQA 5I58A 4AB5A 4PE5B 2NWJA 2Z22A 1WODA 5I57A 2OBGA 4TQUQ 4G4PA 4GWOA 3N94A 1SD3A 3T9XB 1OIBA 1LBCA 2NVUB 3U1OA 4KFQA 3RLFE 3SEVA 4EXKA 3E3KA 1RYXA 3EHTA 3PUXE 4H5GA 4ZEFA 1MXYA 4YB5A 1B58A 4GF8A 2XXPA 1I6BA 3MQ9A 3RNNA 1NNPA 4HS7A 3FD3A 3K01A 1B1XA 1SVXB 1OMPA 2QRYA 4BLAA 3U93A 3PMXA 1URGA 4NF5A 3FXQA 1ZIUA 3C35A 3RQTA 2IA4A 2VHAA 3IAZA 2NOOA 4JWYA 1URDA 5DEXB 4OFOA 3V5AA 3L6GA 3Q29A 3OENA 2REJA 3CSGA 3UORA 3LSFB 4G8HA 1US4A 2DS9A 4YU0A 1SYIA 1OLCA 1ZJLA 3FIRA 5BUUA 4MFIA 5KCJB 1I69A 4OYVA 3PPQA 1JVXA 4OFJA 4YMBA 2THIA 2X26A 3HHFA 2UVJA 4IY6A 4JXIA 2ESNA 5H8FA 3FV2A 1Y1MA 1B05A 2XD3A 5BWJA 3RUMA 3O6PA 3T9UA 2F7CA 3R26A 1LCTA 3OXNA 3K00A 4POWA 3FASA 4ZZEA 1WVJA 4G2ZA 1MH3A 3TCFA 1MQIA 1SYHA 1UTHB 3IOUA 4OWDA 4LQ5A 1GVCA 5I56B 4PP0A 3PU5A 1VR5A 3QYTA 1B4HA 3IO6A 1II5A 3TTKA 5AA3A 4G68B 5JK4A 1FTOA 4KHZE 3H3GA 2Y7KA 3GXAA 1MQDA 3QXMA 4ISUA 3DRKA 4C0RA 2HQ0A 5F1QA 2UYEA 3K1MA 1N7XA 4KR5A 1NNFA 2F97A 2AL4A 2FNCA 3IORA 4YMAA 1Y20A 1TXFA 2XX7A 3WAFA 3MP1A 5I2KA 1XOCA 4G8MA 4QHQA 4PETA 2OCUA 2Y84A 3CRBA 2YJPA 3H6TA 1QVSA 2QPQA 3KBRA 3USDA 4O3AA 2XD2A 4IGTA 3F11A 4G77A 4H5FA 3U92A 2VOZA 4ESXA 1O7TA 1I6QA 1USYH 5I58B 3O6IA 2H9BA 2D5WA 3LUYA 4H8IA 1SQYA 3QIMA 1FTKA 2I0BA 5DVIA 3A09A 1GR2A 4LQ2A 2O51A 2DVZA 3VXBA 1B9JA 3H6UA 3SKPA 3N26A 3M3FA 2ZYOA 3PPOA 4U1ZA 2XXRA 1ZTYA 1P1QA 1FTLA 5AA2A 3ONMA 3VVFA 4JSOA 1PB7A 1D9VA 2ZNTA 3FJ7A 1NNKA 3L6HA 3U94A 3OSRA 4QSEA 4DZ1A 4PFWA 4BDMA 1R6ZA 5DVJA 4KCDA 4LONB 3SEYA 4NF5B 4R72A 3C31A 5I84A 3QUFA 1B51A 1IIWA 1Q1KA 2ZXTA 4DXBA 5CMBA 2GFEA 2B4LA 2I4CA 2OJTA 5H8QA 5CBSA 3UIFA 1TWYA 1OQGA 3TEPA 4ELPA 2B65A 1XS5A 3SEXA 3CFZA 3MJNA 4X1BA 2Y7PA 4F18A 2O6AA 5LOMA 1QUJA 4L17A 3KSXA 1UQWA 1B7HA 2I4BA 3IOVA 3SEUA 4DCXA 1XVYA 3D4GA 1Y1ZA 1SI0A 1HSLA 4F22A 1EZPA 3MWBA 2V93A 3FGSA 4ZECA 1AOVA 3I6VA 1Z7ME 2VD3A 3WAEA 1B32A 3BFUA 1D9YA 1MM7A 2CMOA 2XX8A 3UGWA 4F3GA 3SESA 3K6WA 5FTIA 1LAFE 3V89B 2G93A 1KWHA 2I0CA 1B40A 1B2HA 3C4MA 3C32A 4RPOA 1LFHA 1US5A 2RF1A 2QS3A 2UXAA 2H98A 5L9MA 1EH3A 1DOTA 3PUZE 4Q30B 4ZEKA 4PFYA 2XXVA 3S9LC 2AIXA 4O3CA 2VD2A 3MVWA 1M5EA 3FXRA 1NKXA 1PB9A 5AE4A 5H8HA 4NTLA 3KG2A 3FVGA 4LP2B 5I2KB 3IB2A 2QMWA 3FZVA 4H8JA 3ZSFA 5TPAA 1LB8A 3Q25A 4JWXA 4WEDA 3E9XA 3UA8A 1CB6A 4BDLA 2XXHA 3B7DA 4GOTA 1MPBA 3A3UA 3K2DA 3MAMA 4O3BA 5F7VA 3MZ1A 4H67A 1R9LA 1NL5A 3O66A 1SBPA 1IQ7A 2I49A 2A5TA 2PT1A 3PUYE 3LSXA 5ISUA 1A55A 4GQOA 2XXIA 1DMBA 3MP8A 1N3XA 1AH5A 3G7WA 4QRZA 1AIVA 4P0GA 3TFLA 5AA2B 1B5JA 2F35A 3KN7A 4NWCA 1OVBA 2M8CA 5AA2D 3MPKA 4KD5A 1N76A 3GZGA 3PUWE 1OVTA 3THIA 5I2NA 1Q35A 1UTBA 3JYRA 2DWHA 1FQBA 4GD5A 1YCJA 3UK4A 1LCFA 2XXYA 1RKMA 1N3WA 3H7MA 1LAXA 4U1OA 3FTOA 1B7UA 3RN8A 5ICQA 1M5CA 3N6TA 3CG1A 3QUJA 2RC9A 2UYFA 2DXRA 3PD8A 4ESWA 3IOWA 4OQOA 3EHUA 2ANJA 2O69A 2H4IA 4U4XA 4U4SA 4ZDMA 5FTHA 3DRFA 2Y7RA 5HBCA 2H25A 4F1YA 3K6VA 4MBPA 5CI5A 1JW5A 1IXIA 2CZLA 2A5SA 2GH9A 1AMFA 2QSXA 2QJEA 3FVNA 4F31B 4MLVA 4JDFA 3BBRA 1SDXA 5AA4A 1Y4TA 3HSTA 1BP5A 3MPLA 1O64A 2HZKA 5DYHA 4GLIA 1PDAA 4YKJA 3PAMA 4R6YA 2DOJA 4N13A 3KFMA 4OFLA 3OO7A 3PPNA 2VP1A 1FCKA 5FHNA 4KCCA 4I9DA 2V3QA 4PQJA 3IJOB 3T22A 3DP8A 1QUKA 1XHYA 3ILUB 1JEUA 3G3JA 2B3BA 3MP6A 1B6HA 2ALUA 1IITA 3GLBA 4U2RA 4EDPA 5TP9A 4ZEBA 4Z0IA 4WXJA 3HO7A 4LATA 1MQHA 1T0KA 3VLUA 1IUDA 1B4ZA 5CMMA 5KDTA 2I3WA 2QS2A 3MVYA 1B1HA 4FORA 4BDQA 2YPNA 4RJZA 3IX1A 4EUOA 1LFGA 4TLMB 4RNSA 3RGYA 2DWAA 1UIVA 5ELVA 4RXLA 4U21A 1MDQA 2ONKE 3EN3A 3HV1A 1JEVA 3PUVE 5CBRA 4FAJA 3EQ1A 4OERA 2ONRA 1MQGA 2DE2A 5IAIA 2R71A 1QW0A 5TPAB 1Y9UA 3JV9A 3IOTA 3ZKLA 1B0LA 5B70A 1N84A 3PMWA 1NFTA 3TTMA 4JB7A 2B4MA 3TZAA 4RY1A 4F3SA 4YZZA 2V3UA 3C36A 3E13X 1LGBC 3LSWA 1QKAA 5JTYB 2NXOA 3FJMA 3HCQA 3TTLA 1SW5A 3IB1A 3KJ7A 4XXUA 2A5TB 4M1VA 3RTFB 3MVXA 1PBPA 1DSNA 4P0IA 1H76A 1B0HA 1SW2A 3TCHA 4EQBA 4MLQA 4DLDA 2O1LA 3M8UA 3TDJA 4E0XA 1TT1A 1NMUA 4GXSB 4XKPA 1N7WA 1WDNA 2V84A 3SEWA 1FQDA 1B46A 1FTMA 2HAUA 2ZNUA 2DSFA 5I57B 3G3GA 2Z8DA 3ODBA 4N6PA 3TQWA 1UTBB 3UP9A 3W15C 3OELA 1LBBA 1P99A 2P1SA 1NNTA 4R2FA 5H8NA 3MZ9A 3T9HB 1RYOA 2HEUA 4OESA 3V8XB 4NEDA 1BTJA 3OO6A 1S7YA 3KOTA 3DRGA 5A5XA 3W9VA 4X1DA 3FVOA 1Z7NE 3M3KA 4XIGQ 4GL8A 4PFTA 1A8FA 1B5IA 1A99A 4IO4A 3OD7A 4FE8A 2Z8FA 3KJTA 4NF6A 1LAHE 1PEBA 3LC8A 2UVHA 5EYFA 1DPPA 4QFLA 4G68C 3K1PA 4LVQA 3VXCA 4ZE8A 2Q2CA 1H44A 2Q9TA 4OEUA 2QL3A 3KN3A 3TUSA 2UVIA 1MY2A 1FTJA 1A40A 1B3GA 3TMGA 1XC1A 5L9OA 2KLFA 4IB2A 2XX9A 4Q5TA 4EQ9A 1YAEA 4JBZA 2HXWA 3O28A 1BLFA 2F5XA 2O1MA 3T93B 1MY0A 3Q26A 2LAOA 4ZZAA 4NE4A 3O9PA 2FA7A 2DXYA 3O29A 4BDNA 3B6TA 1M5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3T A;  3K0V A;  4R2B A;  2VGQ A;  1TFD A;  1QUI A;  4G8N A;  5EHS A;  5DTB A;  2HAV A;  4FIM A;  4WEP A;  5DT6 A;  5AA1 A;  4LZ7 A;  4ZS9 A;  2Q2A A;  3IR1 A;  4EF1 A;  5FHO A;  5H8F B;  1MY4 A;  4M4G A;  3G3K A;  5HM4 B;  4R73 A;  3N5L A;  1DTZ A;  2DWI A;  4F3B A;  1ZLQ A;  5I59 A;  3O6G A;  1P1W A;  5CC2 A;  3VLW A;  1CE2 A;  3TTN A;  4DCY A;  2QMX A;  2I48 A;  1MXX A;  3CI8 A;  4F3P A;  4WKM A;  4LZ8 A;  4OEV A;  3ZS6 A;  4ECF A;  4QFN A;  2ONS A;  3H6W A;  2O68 A;  4HCW A;  4GVO A;  4FED A;  3FUZ A;  2XXQ A;  2REG A;  2HZL A;  4Q8R A;  2H5Y A;  4ONY A;  4C1U A;  1VFD A;  2ZYK A;  3DLN A;  4NMY A;  4F2Q A;  3TAJ A;  4R74 A;  3PD9 A;  1FQF A;  3KN8 A;  2OWS A;  3LBS A;  3RPW A;  5H8S A;  4QFP A;  3QK6 A;  4KYS A;  3K02 A;  3CVG A;  2D21 A;  4F29 A;  4UA8 A;  1YTV A;  1JET A;  4AQ4 A;  2WKY A;  5J1D A;  1QJM A;  2XHD A;  1BIY A;  2WOL A;  3W9W A;  3RT8 A;  3RYA A;  2PYY A;  1LFI A;  2IEE A;  4IGR A;  1JNF A;  2Z8E A;  3C9H A;  1HSE A;  1UTH A;  1MPD A;  3VE1 B;  1EZ9 A;  5I56 A;  3K4U A;  4E0W A;  4G68 A;  1XT8 A;  4FEC A;  2O7I A;  4X48 A;  2DYX A;  4RK2 A;  1DTG A;  2PMS A;  1MRP A;  5H8N B;  1GGG A;  4IO7 A;  3IJX B;  2RIN A;  4R6H A;  3M3L A;  3RY3 A;  2E0S A;  3MBP A;  1SW4 A;  3CR9 A;  3PGF A;  2XXX A;  4RK9 A;  2RCB A;  2Y7W A;  1ANF A;  3E4R A;  3C34 A;  3PPR A;  3CFL A;  3S9M C;  4PFU A;  3TEL A;  5K2X A;  3H03 A;  3PMV A;  4RA1 A;  3DP4 A;  4DXC A;  1ZKB A;  5KZT A;  4OMB A;  2PVU A;  1SI1 A;  4HCY A;  2ZNS A;  1J1N A;  5H8Q B;  1JW1 A;  4F19 A;  3S4U A;  3TTR A;  3H6V A;  1OQH A;  2P0S A;  5CRY A;  2W7Y A;  3S9N C;  3RTW B;  3V83 A;  3K1N A;  4Q0C A;  2Q8J A;  2XXW A;  1MM6 A;  1MQJ A;  2F6G A;  4I8C A;  3LSL A;  1EZO A;  1ATG A;  1ELJ A;  4POX A;  3GBA A;  1P1O A;  3Q27 A;  4KI0 E;  2Q88 A;  4LUB A;  3SET A;  5CM6 A;  1M5F A;  3VDF A;  3I3V A;  4U23 A;  1B3E A;  2I3V A;  1IXC A;  3T9V A;  3CHG A;  4FAT A;  5I59 B;  1UIU A;  3CSB A;  2UVG A;  1LAG E;  3QSL A;  5EHM A;  2QS1 A;  5B7D A;  5L9S A;  5JEI A;  3HHG A;  5DVF A;  3TPA A;  4ZE9 A;  2OWT A;  4YKP A;  1FQC A;  4BDO A;  4MF3 A;  2F7B A;  1QKB A;  4R9G A;  4OEN A;  2X7Q A;  3VVD A;  4AB6 A;  4DIG A;  4N07 A;  2O7U A;  4KQP A;  2WOP A;  1MPC A;  2E1S A;  3C33 A;  1H45 A;  4NF4 A;  3RYB A;  1B5H A;  3BKI B;  4R6K A;  2DWJ A;  5TU0 A;  5H8H B;  3Q28 A;  4H65 A;  2I58 A;  3FJG A;  4IO3 A;  1D3K A;  1S9T A;  2Z23 A;  2I6E A;  1B3F A;  2PX1 A;  3HPI A;  3GBB A;  3PV0 E;  1PC3 A;  1JQF A;  1PBQ A;  1Y3P A;  2ZYM A;  3TQL A;  1M5D A;  1Y3N A;  3VV5 A;  5ITP A;  1A7L A;  3T66 A;  3I5O A;  4KYD A;  3VVE A;  2X7P A;  2OLB A;  3KGC A;  1MH4 A;  4K3F A;  4TLL B;  3ZKK A;  3HN0 A;  2Y7I A;  3TYH A;  4YB6 A;  2GHA A;  4EQ7 A;  4YAH X;  3AXF A;  4H1X A;  4IO5 A;  3G3H A;  1YPN A;  4IY5 A;  3G3F A;  1XVX A;  4XKR A;  3H06 B;  2DE3 A;  3DP6 A;  3EPE A;  2R6G E;  2QS4 A;  4OXV A;  3TKD A;  3TOD A;  3CFX A;  3DRH A;  1HSJ A;  4ELR A;  4YKI A;  3S9E A;  5K2Y A;  3TCG A;  3FV1 A;  3K6X A;  4QF9 A;  2GRV A;  3KZG A;  2O84 X;  2WOK A;  4XTC Q;  1OLA A;  4NF8 A;  5I2N B;  4OET A;  2V25 A;  1H3D A;  4IO2 A;  2F6P A;  1URS A;  4GXA A;  3BFT A;  4QFK A;  3RT6 B;  3H4Z A;  4F1U A;  1LLS A;  4THI A;  4HTG A;  3O2A A;  3OOA A;  3S2V A;  1FQA A;  3IB0 A;  3G3I A;  3FVK A;  3DEL B;  3MC2 A;  4JWO A;  3U72 A;  3IL1 B;  4TOZ A;  2F36 A;  2R9J A;  1POT A;  4DE8 A;  4GIZ A;  4F39 A;  4H6D A;  3KOS A;  4R75 A;  4YIC A;  3DRI A;  4QFO A;  2D3I A;  1MG1 A;  1IXH A;  1SW1 A;  1A8E A;  2ZYN A;  3OSQ A;  4UAC A;  3KSJ A;  2RKM A;  1AL3 A;  4F1V A;  1VSO A;  2XXU A;  3MZB A;  3KEI A;  4EXL A;  5ITO A;  1DPE A;  2FYI A;  5AA4 B;  2H99 A;  3O97 A;  2B3F A;  1R1N A;  1USY E;  3LR1 A;  1MXZ A;  1IXG A;  3R7X A;  3OO8 A;  1H43 A;  2DE4 A;  1B3H A;  1FQE A;  3O6H A;  4GL0 A;  4OVJ A;  1QUL A;  4IO6 A;  3T96 B;  1JVY A;  3VLV A;  1L5T A;  4HW8 A;  3EHS A;  4JSD A;  4FJP A;  1VFE A;  1MXW A;  1MY1 A;  5IKB A;  5TP9 B;  4XKQ A;  4YB7 A;  1GV8 A;  2XXT A;  2ABH A;  4GFR A;  1NH8 A;  2AYS A;  1B3L A;  4U22 A;  1POY 1;  3DRJ A;  1F9B A;  4ZEI A;  2G29 A;  5KDT B;  2OZZ A;  4C1T A;  1PB8 A;  1N04 A;  3U8Q A;  2F7A A;  1TFA A;  2P2A A;  4RPN A;  4DXU A;  3SDF A;  4NF4 B;  2DVC A;  3OEM A;  4ZED A;  3SER A;  3MVZ A;  3DM0 A;  3MW0 A;  2HFB A;  5DEX A;  4EF2 A;  2ZMB A;  2NUV A;  1MY3 A;  4QSD A;  2DQV A;  2Q89 A;  4I62 A;  3P7I A;  5CMK A;  3B6W A;  4KYE A;  5M2V A;  3UN6 A;  1Y3Q A;  3CG3 A;  3A3C A;  4OHN A;  4BDR A;  4OTE A;  1ZU0 A;  1GTK A;  4GRK A;  5KCJ A;  4ELQ A;  1BKA A;  1LB9 A;  3FXU A;  4R9F A;  1FW0 A;  3VFJ A;  1I6A A;  2F78 A;  1P1U A;  1MXV A;  1R9Q A;  1LST A;  3B6Q A;  5CMC A;  1D4N A;  3K6U A;  4F2O A;  1IZ1 A;  3IK6 B;  3MUQ A;  4LZ5 A;  1ZBM A;  2BJJ X;  1NH7 A;  3EF7 A;  4KPT A;  4I1D A;  4LA9 A;  4ND9 A;  1N0T A;  5FHM A;  4FEB A;  3D4C A;  1EU8 A;  1VE4 A;  3FAT A;  2DP8 A;  2YLN A;  4Z7E A;  3ECR A;  3OEK A;  1B52 A;  2OK2 A;  5L8D A;  4X9T A;  4NF8 B;  3QAX A;  2F34 A;  2PBW A;  2GHB A;  3ILT B;  4YKK A;  3N6U A;  1Y4C A;  1JW4 A;  1IEJ A;  4NWD A;  2PT2 A;  4OZ9 A;  1A54 A;  2RC8 A;  5JTY A;  1O63 A;  4MH5 A;  4H0W A;  2RC7 A;  5ICT A;  5A5X B;  4DDD A;  3PPP A;  2RCA A;  4QSC A;  1B7Z A;  1ZMG A;  1MXU A;  4ELO A;  3LVU A;  4XKN A;  3IO4 A;  3JZJ A;  3CIJ A;  2AL5 A;  1P1N A;  3OO9 A;  4RYA A;  2HCA A;  1MS7 A;  4NF6 B;  1MDP 1;  2F8D A;  4P11 A;  1S50 A;  3R6U A;  3OMB A;  5HPQ A;  5I58 A;  4AB5 A;  4PE5 B;  2NWJ A;  2Z22 A;  1WOD A;  5I57 A;  2OBG A;  4TQU Q;  4G4P A;  4GWO A;  3N94 A;  1SD3 A;  3T9X B;  1OIB A;  1LBC A;  2NVU B;  3U1O A;  4KFQ A;  3RLF E;  3SEV A;  4EXK A;  3E3K A;  1RYX A;  3EHT A;  3PUX E;  4H5G A;  4ZEF A;  1MXY A;  4YB5 A;  1B58 A;  4GF8 A;  2XXP A;  1I6B A;  3MQ9 A;  3RNN A;  1NNP A;  4HS7 A;  3FD3 A;  3K01 A;  1B1X A;  1SVX B;  1OMP A;  2QRY A;  4BLA A;  3U93 A;  3PMX A;  1URG A;  4NF5 A;  3FXQ A;  1ZIU A;  3C35 A;  3RQT A;  2IA4 A;  2VHA A;  3IAZ A;  2NOO A;  4JWY A;  1URD A;  5DEX B;  4OFO A;  3V5A A;  3L6G A;  3Q29 A;  3OEN A;  2REJ A;  3CSG A;  3UOR A;  3LSF B;  4G8H A;  1US4 A;  2DS9 A;  4YU0 A;  1SYI A;  1OLC A;  1ZJL A;  3FIR A;  5BUU A;  4MFI A;  5KCJ B;  1I69 A;  4OYV A;  3PPQ A;  1JVX A;  4OFJ A;  4YMB A;  2THI A;  2X26 A;  3HHF A;  2UVJ A;  4IY6 A;  4JXI A;  2ESN A;  5H8F A;  3FV2 A;  1Y1M A;  1B05 A;  2XD3 A;  5BWJ A;  3RUM A;  3O6P A;  3T9U A;  2F7C A;  3R26 A;  1LCT A;  3OXN A;  3K00 A;  4POW A;  3FAS A;  4ZZE A;  1WVJ A;  4G2Z A;  1MH3 A;  3TCF A;  1MQI A;  1SYH A;  1UTH B;  3IOU A;  4OWD A;  4LQ5 A;  1GVC A;  5I56 B;  4PP0 A;  3PU5 A;  1VR5 A;  3QYT A;  1B4H A;  3IO6 A;  1II5 A;  3TTK A;  5AA3 A;  4G68 B;  5JK4 A;  1FTO A;  4KHZ E;  3H3G A;  2Y7K A;  3GXA A;  1MQD A;  3QXM A;  4ISU A;  3DRK A;  4C0R A;  2HQ0 A;  5F1Q A;  2UYE A;  3K1M A;  1N7X A;  4KR5 A;  1NNF A;  2F97 A;  2AL4 A;  2FNC A;  3IOR A;  4YMA A;  1Y20 A;  1TXF A;  2XX7 A;  3WAF A;  3MP1 A;  5I2K A;  1XOC A;  4G8M A;  4QHQ A;  4PET A;  2OCU A;  2Y84 A;  3CRB A;  2YJP A;  3H6T A;  1QVS A;  2QPQ A;  3KBR A;  3USD A;  4O3A A;  2XD2 A;  4IGT A;  3F11 A;  4G77 A;  4H5F A;  3U92 A;  2VOZ A;  4ESX A;  1O7T A;  1I6Q A;  1USY H;  5I58 B;  3O6I A;  2H9B A;  2D5W A;  3LUY A;  4H8I A;  1SQY A;  3QIM A;  1FTK A;  2I0B A;  5DVI A;  3A09 A;  1GR2 A;  4LQ2 A;  2O51 A;  2DVZ A;  3VXB A;  1B9J A;  3H6U A;  3SKP A;  3N26 A;  3M3F A;  2ZYO A;  3PPO A;  4U1Z A;  2XXR A;  1ZTY A;  1P1Q A;  1FTL A;  5AA2 A;  3ONM A;  3VVF A;  4JSO A;  1PB7 A;  1D9V A;  2ZNT A;  3FJ7 A;  1NNK A;  3L6H A;  3U94 A;  3OSR A;  4QSE A;  4DZ1 A;  4PFW A;  4BDM A;  1R6Z A;  5DVJ A;  4KCD A;  4LON B;  3SEY A;  4NF5 B;  4R72 A;  3C31 A;  5I84 A;  3QUF A;  1B51 A;  1IIW A;  1Q1K A;  2ZXT A;  4DXB A;  5CMB A;  2GFE A;  2B4L A;  2I4C A;  2OJT A;  5H8Q A;  5CBS A;  3UIF A;  1TWY A;  1OQG A;  3TEP A;  4ELP A;  2B65 A;  1XS5 A;  3SEX A;  3CFZ A;  3MJN A;  4X1B A;  2Y7P A;  4F18 A;  2O6A A;  5LOM A;  1QUJ A;  4L17 A;  3KSX A;  1UQW A;  1B7H A;  2I4B A;  3IOV A;  3SEU A;  4DCX A;  1XVY A;  3D4G A;  1Y1Z A;  1SI0 A;  1HSL A;  4F22 A;  1EZP A;  3MWB A;  2V93 A;  3FGS A;  4ZEC A;  1AOV A;  3I6V A;  1Z7M E;  2VD3 A;  3WAE A;  1B32 A;  3BFU A;  1D9Y A;  1MM7 A;  2CMO A;  2XX8 A;  3UGW A;  4F3G A;  3SES A;  3K6W A;  5FTI A;  1LAF E;  3V89 B;  2G93 A;  1KWH A;  2I0C A;  1B40 A;  1B2H A;  3C4M A;  3C32 A;  4RPO A;  1LFH A;  1US5 A;  2RF1 A;  2QS3 A;  2UXA A;  2H98 A;  5L9M A;  1EH3 A;  1DOT A;  3PUZ E;  4Q30 B;  4ZEK A;  4PFY A;  2XXV A;  3S9L C;  2AIX A;  4O3C A;  2VD2 A;  3MVW A;  1M5E A;  3FXR A;  1NKX A;  1PB9 A;  5AE4 A;  5H8H A;  4NTL A;  3KG2 A;  3FVG A;  4LP2 B;  5I2K B;  3IB2 A;  2QMW A;  3FZV A;  4H8J A;  3ZSF A;  5TPA A;  1LB8 A;  3Q25 A;  4JWX A;  4WED A;  3E9X A;  3UA8 A;  1CB6 A;  4BDL A;  2XXH A;  3B7D A;  4GOT A;  1MPB A;  3A3U A;  3K2D A;  3MAM A;  4O3B A;  5F7V A;  3MZ1 A;  4H67 A;  1R9L A;  1NL5 A;  3O66 A;  1SBP A;  1IQ7 A;  2I49 A;  2A5T A;  2PT1 A;  3PUY E;  3LSX A;  5ISU A;  1A55 A;  4GQO A;  2XXI A;  1DMB A;  3MP8 A;  1N3X A;  1AH5 A;  3G7W A;  4QRZ A;  1AIV A;  4P0G A;  3TFL A;  5AA2 B;  1B5J A;  2F35 A;  3KN7 A;  4NWC A;  1OVB A;  2M8C A;  5AA2 D;  3MPK A;  4KD5 A;  1N76 A;  3GZG A;  3PUW E;  1OVT A;  3THI A;  5I2N A;  1Q35 A;  1UTB A;  3JYR A;  2DWH A;  1FQB A;  4GD5 A;  1YCJ A;  3UK4 A;  1LCF A;  2XXY A;  1RKM A;  1N3W A;  3H7M A;  1LAX A;  4U1O A;  3FTO A;  1B7U A;  3RN8 A;  5ICQ A;  1M5C A;  3N6T A;  3CG1 A;  3QUJ A;  2RC9 A;  2UYF A;  2DXR A;  3PD8 A;  4ESW A;  3IOW A;  4OQO A;  3EHU A;  2ANJ A;  2O69 A;  2H4I A;  4U4X A;  4U4S A;  4ZDM A;  5FTH A;  3DRF A;  2Y7R A;  5HBC A;  2H25 A;  4F1Y A;  3K6V A;  4MBP A;  5CI5 A;  1JW5 A;  1IXI A;  2CZL A;  2A5S A;  2GH9 A;  1AMF A;  2QSX A;  2QJE A;  3FVN A;  4F31 B;  4MLV A;  4JDF A;  3BBR A;  1SDX A;  5AA4 A;  1Y4T A;  3HST A;  1BP5 A;  3MPL A;  1O64 A;  2HZK A;  5DYH A;  4GLI A;  1PDA A;  4YKJ A;  3PAM A;  4R6Y A;  2DOJ A;  4N13 A;  3KFM A;  4OFL A;  3OO7 A;  3PPN A;  2VP1 A;  1FCK A;  5FHN A;  4KCC A;  4I9D A;  2V3Q A;  4PQJ A;  3IJO B;  3T22 A;  3DP8 A;  1QUK A;  1XHY A;  3ILU B;  1JEU A;  3G3J A;  2B3B A;  3MP6 A;  1B6H A;  2ALU A;  1IIT A;  3GLB A;  4U2R A;  4EDP A;  5TP9 A;  4ZEB A;  4Z0I A;  4WXJ A;  3HO7 A;  4LAT A;  1MQH A;  1T0K A;  3VLU A;  1IUD A;  1B4Z A;  5CMM A;  5KDT A;  2I3W A;  2QS2 A;  3MVY A;  1B1H A;  4FOR A;  4BDQ A;  2YPN A;  4RJZ A;  3IX1 A;  4EUO A;  1LFG A;  4TLM B;  4RNS A;  3RGY A;  2DWA A;  1UIV A;  5ELV A;  4RXL A;  4U21 A;  1MDQ A;  2ONK E;  3EN3 A;  3HV1 A;  1JEV A;  3PUV E;  5CBR A;  4FAJ A;  3EQ1 A;  4OER A;  2ONR A;  1MQG A;  2DE2 A;  5IAI A;  2R71 A;  1QW0 A;  5TPA B;  1Y9U A;  3JV9 A;  3IOT A;  3ZKL A;  1B0L A;  5B70 A;  1N84 A;  3PMW A;  1NFT A;  3TTM A;  4JB7 A;  2B4M A;  3TZA A;  4RY1 A;  4F3S A;  4YZZ A;  2V3U A;  3C36 A;  3E13 X;  1LGB C;  3LSW A;  1QKA A;  5JTY B;  2NXO A;  3FJM A;  3HCQ A;  3TTL A;  1SW5 A;  3IB1 A;  3KJ7 A;  4XXU A;  2A5T B;  4M1V A;  3RTF B;  3MVX A;  1PBP A;  1DSN A;  4P0I A;  1H76 A;  1B0H A;  1SW2 A;  3TCH A;  4EQB A;  4MLQ A;  4DLD A;  2O1L A;  3M8U A;  3TDJ A;  4E0X A;  1TT1 A;  1NMU A;  4GXS B;  4XKP A;  1N7W A;  1WDN A;  2V84 A;  3SEW A;  1FQD A;  1B46 A;  1FTM A;  2HAU A;  2ZNU A;  2DSF A;  5I57 B;  3G3G A;  2Z8D A;  3ODB A;  4N6P A;  3TQW A;  1UTB B;  3UP9 A;  3W15 C;  3OEL A;  1LBB A;  1P99 A;  2P1S A;  1NNT A;  4R2F A;  5H8N A;  3MZ9 A;  3T9H B;  1RYO A;  2HEU A;  4OES A;  3V8X B;  4NED A;  1BTJ A;  3OO6 A;  1S7Y A;  3KOT A;  3DRG A;  5A5X A;  3W9V A;  4X1D A;  3FVO A;  1Z7N E;  3M3K A;  4XIG Q;  4GL8 A;  4PFT A;  1A8F A;  1B5I A;  1A99 A;  4IO4 A;  3OD7 A;  4FE8 A;  2Z8F A;  3KJT A;  4NF6 A;  1LAH E;  1PEB A;  3LC8 A;  2UVH A;  5EYF A;  1DPP A;  4QFL A;  4G68 C;  3K1P A;  4LVQ A;  3VXC A;  4ZE8 A;  2Q2C A;  1H44 A;  2Q9T A;  4OEU A;  2QL3 A;  3KN3 A;  3TUS A;  2UVI A;  1MY2 A;  1FTJ A;  1A40 A;  1B3G A;  3TMG A;  1XC1 A;  5L9O A;  2KLF A;  4IB2 A;  2XX9 A;  4Q5T A;  4EQ9 A;  1YAE A;  4JBZ A;  2HXW A;  3O28 A;  1BLF A;  2F5X A;  2O1M A;  3T93 B;  1MY0 A;  3Q26 A;  2LAO A;  4ZZA A;  4NE4 A;  3O9P A;  2FA7 A;  2DXY A;  3O29 A;  4BDN A;  3B6T A;  1M5B A; 
#chains in the Genus database with same CATH topology
 2V3T A;  3K0V A;  3QMF A;  4R2B A;  2VGQ A;  4PBH A;  1TFD A;  1QUI A;  4G8N A;  5EHS A;  5DTB A;  1FPD A;  2HAV A;  3KC1 A;  4FIM A;  4WEP A;  5DT6 A;  5AA1 A;  4LZ7 A;  4ZS9 A;  2Q2A A;  3IR1 A;  4EF1 A;  5FHO A;  5H8F B;  1MY4 A;  2Y5L A;  4M4G A;  3G3K A;  5HM4 B;  4R73 A;  3N5L A;  1DTZ A;  2DWI A;  4F3B A;  1ZLQ A;  5I59 A;  3O6G A;  1P1W A;  5CC2 A;  3VLW A;  1CE2 A;  3TTN A;  4DCY A;  2QMX A;  2I48 A;  1MXX A;  3CI8 A;  4F3P A;  2FIE A;  4WKM A;  2HHM A;  4LZ8 A;  4JVD A;  4OEV A;  3BIH A;  3ZS6 A;  4ECF A;  4QFN A;  2ONS A;  3H6W A;  2O68 A;  2HPG A;  4HCW A;  4GVO A;  4FED A;  3FUZ A;  2XXQ A;  2REG A;  4HE1 A;  3MYU A;  2HZL A;  4Q8R A;  1IMF A;  2H5Y A;  4ONY A;  4C1U A;  1VFD A;  2ZYK A;  3DLN A;  4NMY A;  4F2Q A;  3TAJ A;  4R74 A;  3PD9 A;  4NGU A;  1FQF A;  3T1B A;  3KN8 A;  2OWS A;  4N81 A;  3LBS A;  3RPW A;  5H8S A;  4QFP A;  3QK6 A;  4KYS A;  3K02 A;  4QBA A;  3CVG A;  2D21 A;  4MAG A;  4UA8 A;  1YTV A;  4F29 A;  1JET A;  4AQ4 A;  5ET5 A;  1FBP A;  2WKY A;  5J1D A;  1QJM A;  2XHD A;  1BIY A;  2WOL A;  3W9W A;  4P56 A;  3RT8 A;  3RYA A;  2PYY A;  1LFI A;  2IEE A;  4IGR A;  1JNF A;  4GX3 A;  2Z8E A;  3C9H A;  1HSE A;  1UTH A;  1MPD A;  4NHB A;  3VE1 B;  1EZ9 A;  5I56 A;  4NF0 A;  3K4U A;  4E0W A;  2ZZV A;  4G68 A;  1XT8 A;  4FEC A;  2O7I A;  4X48 A;  2DYX A;  4RK2 A;  1DTG A;  2PMS A;  1MRP A;  5H8N B;  1GGG A;  4IO7 A;  3IJX B;  2RIN A;  4R6H A;  3M3L A;  3RY3 A;  2E0S A;  3FXB A;  3MBP A;  4PCD A;  1SW4 A;  1JP4 A;  3CR9 A;  4P8B A;  1SPI A;  3PGF A;  2XXX A;  4RK9 A;  5IZ1 A;  4X04 A;  2RCB A;  5LTC A;  2Y7W A;  1ANF A;  3E4R A;  3C34 A;  3PPR A;  3CFL A;  3S9M C;  4PFU A;  3TEL A;  5K2X A;  3H03 A;  3PMV A;  4RA1 A;  3DP4 A;  4DXC A;  1ZKB A;  5KZT A;  4OMB A;  2PVU A;  1SI1 A;  4HCY A;  1NUZ A;  2ZNS A;  1J1N A;  5H8Q B;  1JW1 A;  4F19 A;  3S4U A;  3TTR A;  3H6V A;  1LBZ A;  1OQH A;  2P0S A;  3A29 A;  5CRY A;  2W7Y A;  2FBP A;  3S9N C;  3RTW B;  3V83 A;  1LBX A;  3K1N A;  4Q0C A;  2Q8J A;  2XXW A;  1MM6 A;  1MQJ A;  2F6G A;  4I8C A;  3LSL A;  1EZO A;  1ATG A;  1ELJ A;  4P3L A;  4PFI A;  4POX A;  3GBA A;  1P1O A;  3Q27 A;  4KI0 E;  2Q88 A;  4LUB A;  3SET A;  2R8T A;  5CM6 A;  1M5F A;  1FBC A;  3VDF A;  3I3V A;  4U23 A;  1B3E A;  2I3V A;  1IXC A;  3T9V A;  3CHG A;  4FAT A;  5I59 B;  1UIU A;  3CSB A;  2UVG A;  1LAG E;  1LEV A;  3QSL A;  5EHM A;  4GWY A;  2QS1 A;  3IFC A;  5B7D A;  5L9S A;  5JEI A;  3HHG A;  5DVF A;  3TPA A;  4ZE9 A;  2OWT A;  4YKP A;  5IM2 A;  1FQC A;  4BDO A;  4MF3 A;  2F7B A;  1QKB A;  1D9Q A;  4R9G A;  4OEN A;  2X7Q A;  3VVD A;  4PE3 A;  4AB6 A;  4DIG A;  4N07 A;  2XXK A;  1NV4 A;  2O7U A;  4KQP A;  2WOP A;  1MPC A;  2E1S A;  3C33 A;  1H45 A;  4NF4 A;  3RYB A;  1B5H A;  3BKI B;  4R6K A;  2DWJ A;  5TU0 A;  1Q9D A;  5H8H B;  3Q28 A;  4H65 A;  2I58 A;  3FJG A;  4IO3 A;  1D3K A;  1S9T A;  2Z23 A;  2I6E A;  1B3F A;  2PX1 A;  3HPI A;  3GBB A;  3PV0 E;  1PC3 A;  1JQF A;  1PBQ A;  1Y3P A;  2ZYM A;  3TQL A;  1M5D A;  1Y3N A;  3VV5 A;  5ITP A;  1A7L A;  3T66 A;  3I5O A;  4KYD A;  3VVE A;  2X7P A;  2OLB A;  4PAF A;  3KGC A;  1MH4 A;  4K3F A;  4PGP A;  4TLL B;  3ZKK A;  3HN0 A;  2Y7I A;  3TYH A;  4YB6 A;  2GHA A;  4EQ7 A;  4YAH X;  3AXF A;  1RDZ A;  1K9Y A;  4H1X A;  2ZZW A;  4IO5 A;  3G3H A;  1YPN A;  4IY5 A;  1KZ8 A;  4GWU A;  3G3F A;  5EYG A;  1XVX A;  5I3S A;  4UAB A;  4XKR A;  4N17 A;  4MX6 A;  3H06 B;  2DE3 A;  3DP6 A;  3EPE A;  2R6G E;  2QS4 A;  4OXV A;  3TKD A;  3TOD A;  3CFX A;  1FPG A;  3DRH A;  1HSJ A;  4ELR A;  1G0H A;  2WYP A;  4PBQ A;  4N15 A;  4YKI A;  4LN5 A;  3S9E A;  5K2Y A;  3TCG A;  3FV1 A;  3K6X A;  3RPL B;  4QF9 A;  2GRV A;  3KZG A;  3PTY A;  2O84 X;  2WOK A;  4XTC Q;  1OLA A;  1RDY A;  4NF8 A;  5I2N B;  4OET A;  2V25 A;  1H3D A;  4IO2 A;  2F6P A;  1URS A;  4GXA A;  4P1L A;  5DW8 A;  3BFT A;  4QFK A;  1NI9 A;  3H4Z A;  3RT6 B;  1LLS A;  4F1U A;  4THI A;  4HTG A;  3O2A A;  1FSA A;  4P1E A;  3OOA A;  3S2V A;  2FVZ A;  1YYZ A;  1FQA A;  3IB0 A;  1NUW A;  3G3I A;  3FVK A;  3DEL B;  3MC2 A;  4JWO A;  3U72 A;  3IL1 B;  4TOZ A;  2F36 A;  2OWZ A;  2R9J A;  1POT A;  4DE8 A;  4GIZ A;  4F39 A;  4P47 A;  2CZK A;  4H6D A;  3KOS A;  4R75 A;  4YIC A;  3DRI A;  4QFO A;  2D3I A;  3HFU A;  1MG1 A;  1IXH A;  1SW1 A;  2XWO A;  1A8E A;  2ZYN A;  3OSQ A;  4UAC A;  2QFL A;  4MHF A;  3KSJ A;  2QVV A;  2RKM A;  1AL3 A;  4F1V A;  1VSO A;  2XXU A;  3MZB A;  3KEI A;  4EXL A;  5ITO A;  1DPE A;  2FYI A;  5AA4 B;  2H99 A;  3O97 A;  2B3F A;  1R1N A;  1USY E;  3LR1 A;  1MXZ A;  1IXG A;  3R7X A;  3OO8 A;  1H43 A;  2DE4 A;  1B3H A;  1NV0 A;  1FQE A;  3O6H A;  4GL0 A;  4OVJ A;  1QUL A;  2PCR A;  4IO6 A;  3T96 B;  1NUY A;  1JVY A;  2WBB A;  3VLV A;  1CNQ A;  1L5T A;  4HW8 A;  3EHS A;  4PF6 A;  4MJO A;  4JSD A;  4FJP A;  1VFE A;  1MXW A;  1MY1 A;  5IKB A;  5TP9 B;  4XKQ A;  4YB7 A;  1GV8 A;  1LBV A;  2XXT A;  2ABH A;  4GFR A;  1NH8 A;  2AYS A;  1B3L A;  4U22 A;  1POY 1;  3DRJ A;  1F9B A;  2V4C A;  4ZEI A;  2G29 A;  1FPI A;  5KDT B;  2OZZ A;  4C1T A;  1PB8 A;  1N04 A;  3U8Q A;  2F7A A;  1TFA A;  2P2A A;  3GYY A;  4RPN A;  1FBF A;  4DXU A;  3SDF A;  4NF4 B;  2DVC A;  3OEM A;  4ZED A;  3SER A;  3MVZ A;  3DM0 A;  3MW0 A;  2HFB A;  5DEX A;  4EF2 A;  2ZMB A;  3U65 A;  2NUV A;  1MY3 A;  4QSD A;  2DQV A;  2Q89 A;  4I62 A;  2P3N A;  1NV5 A;  3P7I A;  5CMK A;  3B6W A;  4KYE A;  5M2V A;  3BIG A;  2QVU A;  3UN6 A;  2F3D A;  1Y3Q A;  3CG3 A;  3A3C A;  4OHN A;  4BDR A;  4OTE A;  4GBV A;  1ZU0 A;  1GTK A;  4GRK A;  5KCJ A;  1IMB A;  4ELQ A;  1BKA A;  1LB9 A;  3FXU A;  5IGA A;  4R9F A;  1FW0 A;  3VFJ A;  1I6A A;  2F78 A;  1P1U A;  1MXV A;  1R9Q A;  1LST A;  3B6Q A;  5CMC A;  1D4N A;  4AS4 A;  3K6U A;  4MNC A;  4F2O A;  4H46 A;  1IZ1 A;  3IK6 B;  3MUQ A;  4LZ5 A;  1KA1 A;  1ZBM A;  4I3E A;  2BJJ X;  1NH7 A;  3EF7 A;  4KPT A;  4I1D A;  4LA9 A;  4ND9 A;  1N0T A;  5FHM A;  4FEB A;  3D4C A;  1EU8 A;  3LV0 A;  1VE4 A;  4JVC A;  4GBW A;  4O7I A;  3FAT A;  2DP8 A;  2YLN A;  4Z7E A;  3ECR A;  3OEK A;  1B52 A;  2OK2 A;  1FRP A;  5L8D A;  4X9T A;  3NOH A;  4NF8 B;  3QAX A;  2F34 A;  2PBW A;  3E78 A;  2GHB A;  3ILT B;  4YKK A;  3N6U A;  1Y4C A;  1JW4 A;  1IEJ A;  4NWD A;  2PT2 A;  4OZ9 A;  4PAK A;  1A54 A;  2RC8 A;  5JTY A;  1O63 A;  4MH5 A;  4H0W A;  2RC7 A;  5ICT A;  5A5X B;  4DDD A;  3PPP A;  4MNI A;  2RCA A;  4N8Y A;  4QSC A;  1B7Z A;  1ZMG A;  1MXU A;  4ELO A;  4MEV A;  3LVU A;  4XKN A;  3IO4 A;  3JZJ A;  3CIJ A;  2AL5 A;  1P1N A;  2KQZ A;  3OO9 A;  4RYA A;  2HCA A;  1MS7 A;  4NF6 B;  1MDP 1;  2F8D A;  4P11 A;  1S50 A;  3R6U A;  3OMB A;  5HPQ A;  4P9K A;  5I58 A;  4N4U A;  4PE5 B;  4AB5 A;  3IFA A;  2NWJ A;  2Z22 A;  1WOD A;  5I57 A;  2OBG A;  4TQU Q;  4XF5 A;  4G4P A;  4O94 A;  2FIX A;  4GWO A;  3N94 A;  1SD3 A;  3T9X B;  1OIB A;  1LBC A;  2NVU B;  3U1O A;  4KFQ A;  3RLF E;  3SEV A;  4EXK A;  3E3K A;  1RYX A;  3EHT A;  4GWW A;  3PUX E;  4H5G A;  4ZEF A;  4O7M A;  1MXY A;  4YB5 A;  2P3V A;  1B58 A;  4GF8 A;  2XXP A;  1I6B A;  3MQ9 A;  3RNN A;  1NNP A;  4HS7 A;  4OVP A;  3FD3 A;  3K01 A;  2L5V A;  1B1X A;  1SVX B;  1OMP A;  2QRY A;  4BLA A;  3U93 A;  1IMC A;  3PMX A;  4JVI A;  1URG A;  4NQ8 A;  4NF5 A;  3FXQ A;  1ZIU A;  3C35 A;  4PDD A;  3RQT A;  2IA4 A;  5IZ3 A;  2VHA A;  2DDK A;  3IAZ A;  2NOO A;  4JWY A;  1FPF A;  1URD A;  5DEX B;  4OFO A;  3V5A A;  3L6G A;  3Q29 A;  3OEN A;  2REJ A;  3CSG A;  3UOR A;  3LSF B;  4PFB A;  2HXR A;  4G8H A;  1US4 A;  2DS9 A;  4YU0 A;  4DI4 B;  1SYI A;  1OLC A;  1ZJL A;  1NV7 A;  3FIR A;  5BUU A;  4MFI A;  5KCJ B;  1I69 A;  4OYV A;  4GX4 A;  3SZP A;  3PPQ A;  1JVX A;  4OFJ A;  4YMB A;  2THI A;  2X26 A;  3HHF A;  2UVJ A;  4IY6 A;  4JXI A;  2ESN A;  5H8F A;  3FV2 A;  1Y1M A;  4GWX A;  1B05 A;  2XD3 A;  5BWJ A;  3RUM A;  3O6P A;  3T9U A;  2F7C A;  3R26 A;  1LCT A;  3OXN A;  3K00 A;  4POW A;  1EYI A;  3FAS A;  1FPL A;  4ZZE A;  1WVJ A;  4G2Z A;  1MH3 A;  3TCF A;  1MQI A;  1LBW A;  1SYH A;  1UTH B;  3IOU A;  4OWD A;  4LQ5 A;  1GVC A;  5I56 B;  4PP0 A;  3PU5 A;  4NN3 A;  1VR5 A;  3QYT A;  4HXV A;  1B4H A;  3IO6 A;  3KBZ A;  1II5 A;  3TTK A;  5AA3 A;  4G68 B;  5JK4 A;  1FTO A;  5ET7 A;  2JJK A;  1NV1 A;  4KHZ E;  3H3G A;  2Y7K A;  3GXA A;  2VT5 A;  1MQD A;  3QXM A;  4ISU A;  3DRK A;  4C0R A;  2HQ0 A;  5F1Q A;  2UYE A;  3K1M A;  1N7X A;  4KR5 A;  1NNF A;  2F97 A;  2AL4 A;  2FNC A;  3IOR A;  4YMA A;  1KA0 A;  1Y20 A;  1TXF A;  2XX7 A;  3WAF A;  3MP1 A;  5I2K A;  1XOC A;  3B50 A;  4G8M A;  4QHQ A;  4OAN A;  1FBE A;  4PET A;  2OCU A;  2Y84 A;  3CRB A;  2YJP A;  3H6T A;  1QVS A;  2XWI A;  2QPQ A;  3KBR A;  3USD A;  3FBP A;  5EQ7 A;  4O3A A;  2Y5K A;  2XD2 A;  4MNP A;  4IGT A;  2ZZX A;  3F11 A;  4G77 A;  4H5F A;  3U92 A;  2VOZ A;  4ESX A;  1O7T A;  2PFZ A;  1I6Q A;  1USY H;  3ROJ A;  5I58 B;  3O6I A;  2H9B A;  2D5W A;  3LUY A;  4H8I A;  1SQY A;  3QIM A;  1FTK A;  2I0B A;  4OVT A;  5DVI A;  3A09 A;  1GR2 A;  4LQ2 A;  2O51 A;  2DVZ A;  3VXB A;  1B9J A;  3H6U A;  4NG7 A;  3SKP A;  3N26 A;  3M3F A;  2ZYO A;  3PPO A;  4PF8 A;  4U1Z A;  2XXR A;  1ZTY A;  1P1Q A;  1FTL A;  5AA2 A;  3ONM A;  3VVF A;  4JSO A;  1PB7 A;  1D9V A;  2PFY A;  2ZNT A;  3FJ7 A;  1NNK A;  3L6H A;  3U94 A;  3OSR A;  4PDH A;  4QSE A;  4DZ1 A;  4PFW A;  4BDM A;  1R6Z A;  5DVJ A;  4KCD A;  2WBD A;  4LON B;  3SEY A;  4N6K A;  4G61 A;  4NF5 B;  4R72 A;  3C31 A;  5I84 A;  3QUF A;  1B51 A;  1IIW A;  1Q1K A;  2ZXT A;  4DXB A;  5CMB A;  2GFE A;  2B4L A;  2I4C A;  2OJT A;  4GWS A;  1DBZ A;  5ESY A;  5H8Q A;  5CBS A;  1XI6 A;  3UIF A;  1TWY A;  1OQG A;  3TEP A;  4ELP A;  2B65 A;  1XS5 A;  3SEX A;  3CFZ A;  3MJN A;  4X1B A;  2Y7P A;  4F18 A;  2O6A A;  5LOM A;  1QUJ A;  1NV6 A;  4L17 A;  2CZI A;  5J16 A;  3KSX A;  1UQW A;  1B7H A;  2I4B A;  3IOV A;  3SEU A;  4DCX A;  1XVY A;  1IMA A;  3D4G A;  1Y1Z A;  1SI0 A;  1HSL A;  4F22 A;  1EZP A;  3MWB A;  2V93 A;  3FGS A;  1NUX A;  4ZEC A;  1AOV A;  3I6V A;  1Z7M E;  2OX3 A;  4NX1 A;  2VD3 A;  3WAE A;  1B32 A;  3BFU A;  1D9Y A;  1MM7 A;  1RDX A;  2CMO A;  2XX8 A;  2CZH A;  3UGW A;  4F3G A;  3SES A;  1FPE A;  3K6W A;  5FTI A;  1LAF E;  3V89 B;  5I7I A;  2G93 A;  1DCU A;  1KWH A;  2I0C A;  1B40 A;  1LBY A;  1B2H A;  4I40 A;  3C4M A;  3C32 A;  4RPO A;  4XFE A;  1LFH A;  4N91 A;  1INP A;  1US5 A;  2RF1 A;  2QS3 A;  3MST A;  2UXA A;  2H98 A;  5L9M A;  1EH3 A;  1DOT A;  3PUZ E;  4Q30 B;  4ZEK A;  4PFY A;  2XXV A;  3S9L C;  2AIX A;  4FBP A;  4O3C A;  2VD2 A;  3MVW A;  1M5E A;  3FXR A;  1NKX A;  1PB9 A;  5AE4 A;  5H8H A;  4NTL A;  3KG2 A;  3FVG A;  4LP2 B;  5I2K B;  3IB2 A;  2QMW A;  3FZV A;  4H8J A;  5EQ8 A;  1FBD A;  3LUZ A;  4PFR A;  3ZSF A;  5TPA A;  1LB8 A;  4AS5 A;  3Q25 A;  4DI3 D;  4JWX A;  4WED A;  3E9X A;  3UA8 A;  4IR8 A;  5EQ9 A;  1CB6 A;  4BDL A;  2XA5 A;  2XXH A;  3B7D A;  4GOT A;  1MPB A;  3A3U A;  3K2D A;  3MAM A;  4O3B A;  5EYH A;  5F7V A;  4PTK A;  3MZ1 A;  4H67 A;  2GQ1 A;  1R9L A;  1NL5 A;  3O66 A;  3ISP A;  1YXI A;  1SBP A;  1IQ7 A;  2I49 A;  2A5T A;  2PT1 A;  3PUY E;  3LSX A;  5IZZ A;  5ISU A;  1A55 A;  2WX9 A;  4GQO A;  4N6D A;  2XXI A;  1DMB A;  3MP8 A;  1N3X A;  4QXD A;  1AH5 A;  3G7W A;  4QRZ A;  1AIV A;  4P0G A;  3TFL A;  5AA2 B;  1B5J A;  4O8M A;  2F35 A;  3KN7 A;  1OVB A;  4NWC A;  2M8C A;  5AA2 D;  3MPK A;  4KD5 A;  1N76 A;  3GZG A;  3RPL A;  3PUW E;  1OVT A;  2VPO A;  3THI A;  5I2N A;  2XWV A;  1Q35 A;  1UTB A;  3JYR A;  2DWH A;  1FQB A;  4GD5 A;  1YCJ A;  3UK4 A;  1LCF A;  1FPB A;  2XXY A;  1RKM A;  1N3W A;  3H7M A;  4H45 A;  1LAX A;  4U1O A;  3FTO A;  1B7U A;  3RN8 A;  5ICQ A;  1M5C A;  4MMP A;  3N6T A;  3CG1 A;  3QUJ A;  2RC9 A;  2UYF A;  2DXR A;  3PD8 A;  4ESW A;  2QVR A;  3IOW A;  4OQO A;  3EHU A;  1EYK A;  2ANJ A;  2O69 A;  1FBH A;  2H4I A;  4U4X A;  4U4S A;  4ZDM A;  4I3Y A;  5FTH A;  3DRF A;  2Y7R A;  5HBC A;  2H25 A;  4F1Y A;  3K6V A;  1DK4 A;  4MBP A;  2Q74 A;  5CI5 A;  1JW5 A;  1IXI A;  2CZL A;  2A5S A;  2GH9 A;  1NV3 A;  1AMF A;  2QSX A;  2QJE A;  3FVN A;  4F31 B;  4MCO A;  4MLV A;  1FBG A;  4JDF A;  3BBR A;  1SDX A;  5AA4 A;  1Y4T A;  2VPN A;  4PGN A;  3HST A;  1BP5 A;  3MPL A;  1O64 A;  2HZK A;  5DYH A;  4GLI A;  1PDA A;  4YKJ A;  3PAM A;  4R6Y A;  2DOJ A;  4N13 A;  3KFM A;  4OFL A;  3OO7 A;  3PPN A;  2VP1 A;  1FCK A;  5FHN A;  4KCC A;  5LDZ A;  1FTA A;  4I9D A;  2V3Q A;  4PQJ A;  3IJO B;  3T22 A;  3DP8 A;  1QUK A;  1XHY A;  3ILU B;  1JEU A;  3G3J A;  2B3B A;  3MP6 A;  3D1R A;  1B6H A;  2ALU A;  1IIT A;  3GLB A;  4U2R A;  4EDP A;  5ET8 A;  5A5L A;  4PC9 A;  5TP9 A;  4ZEB A;  4Z0I A;  4WXJ A;  3HO7 A;  4LAT A;  1MQH A;  1T0K A;  3VLU A;  1FJ6 A;  4OVS A;  1IUD A;  1QGX A;  1B4Z A;  5CMM A;  5KDT A;  2I3W A;  1BK4 A;  2QS2 A;  3MVY A;  2XWK A;  1B1H A;  4XEQ A;  5I5P A;  5EQA A;  4FOR A;  4BDQ A;  2YPN A;  4RJZ A;  5ET6 A;  4HE0 A;  2WYK A;  3IX1 A;  4OA4 A;  4EUO A;  4HE2 A;  1LFG A;  1IMD A;  3E79 A;  4TLM B;  4RNS A;  3RGY A;  2DWA A;  1UIV A;  5ELV A;  4RXL A;  4U21 A;  1MDQ A;  2ONK E;  3EN3 A;  3HV1 A;  1JEV A;  3PUV E;  1FPK A;  5CBR A;  5FBP A;  4FAJ A;  3EQ1 A;  4GWZ A;  4OER A;  1FPJ A;  2ONR A;  1MQG A;  1K9Z A;  2DE2 A;  5IAI A;  2R71 A;  1QW0 A;  5TPA B;  1Y9U A;  3JV9 A;  3IOT A;  3ZKL A;  1B0L A;  3KC0 A;  5B70 A;  1N84 A;  2FHY A;  3PMW A;  1EYJ A;  1NFT A;  3TTM A;  4JB7 A;  2B4M A;  3TZA A;  4RY1 A;  4F3S A;  4YZZ A;  1G0I A;  2V3U A;  3RYD A;  2CEY A;  3C36 A;  3E13 X;  1LGB C;  3LSW A;  1QKA A;  5JTY B;  2NXO A;  3FJM A;  3HCQ A;  3TTL A;  1SW5 A;  3IB1 A;  3KJ7 A;  4XXU A;  2CEX A;  2A5T B;  1NV2 A;  4KXP A;  4M1V A;  3RTF B;  3MVX A;  1DSN A;  1PBP A;  4P0I A;  1H76 A;  1B0H A;  1SW2 A;  3TCH A;  4NAP A;  4GX6 A;  4EQB A;  4MLQ A;  4DLD A;  2O1L A;  1IME A;  3M8U A;  3TDJ A;  4E0X A;  1TT1 A;  1NMU A;  1YZ0 A;  4GXS B;  4XKP A;  4MIJ A;  1N7W A;  2KR0 A;  1WDN A;  2V84 A;  3SEW A;  1FQD A;  1B46 A;  1FTM A;  2HAU A;  2ZNU A;  2DSF A;  5I57 B;  3G3G A;  2Z8D A;  3ODB A;  4N6P A;  3TQW A;  1UTB B;  3UP9 A;  3W15 C;  3OEL A;  1LBB A;  1P99 A;  2P1S A;  1NNT A;  4R2F A;  5H8N A;  3MZ9 A;  1VDW A;  2BJI A;  3T9H B;  4X8R A;  1RYO A;  2HEU A;  4OES A;  3V8X B;  4NED A;  2WEF A;  1BTJ A;  3B8B A;  3OO6 A;  1S7Y A;  3KOT A;  1FJ9 A;  3DRG A;  5A5X A;  3W9V A;  4X1D A;  4OVQ A;  3FVO A;  1Z7N E;  3M3K A;  4XIG Q;  4GL8 A;  4PFT A;  2MKZ A;  4OVR A;  1A8F A;  1B5I A;  5T3J A;  1A99 A;  4IO4 A;  3OD7 A;  5F24 A;  4FE8 A;  2Z8F A;  3KJT A;  4NF6 A;  1LAH E;  1PEB A;  3LC8 A;  2UVH A;  5EYF A;  1DPP A;  4QFL A;  4G68 C;  3K1P A;  2Q8M A;  4LVQ A;  5IZ3 B;  3VXC A;  4ZE8 A;  2Q2C A;  1H44 A;  2Q9T A;  4OEU A;  2QL3 A;  3KN3 A;  3TUS A;  2UVI A;  1MY2 A;  1FTJ A;  1A40 A;  1B3G A;  3TMG A;  1XC1 A;  5L9O A;  2KLF A;  4IB2 A;  2XX9 A;  4Q5T A;  4EQ9 A;  1YAE A;  4JBZ A;  2F3B A;  4N8G A;  2HXW A;  3O28 A;  1BLF A;  3T0J A;  2F5X A;  3EKI A;  2O1M A;  1AWB A;  3T93 B;  1MY0 A;  3Q26 A;  2LAO A;  4ZZA A;  4NE4 A;  3O9P A;  2FA7 A;  2DXY A;  3O29 A;  4BDN A;  4PAI A;  3B6T A;  1M5B A; 
#chains in the Genus database with same CATH homology
 2V3T A;  3K0V A;  4R2B A;  2VGQ A;  1TFD A;  1QUI A;  4G8N A;  5EHS A;  5DTB A;  2HAV A;  4FIM A;  4WEP A;  5DT6 A;  5AA1 A;  4LZ7 A;  4ZS9 A;  2Q2A A;  3IR1 A;  4EF1 A;  5FHO A;  5H8F B;  1MY4 A;  4M4G A;  3G3K A;  5HM4 B;  4R73 A;  3N5L A;  1DTZ A;  2DWI A;  4F3B A;  1ZLQ A;  5I59 A;  3O6G A;  1P1W A;  5CC2 A;  3VLW A;  1CE2 A;  3TTN A;  4DCY A;  2QMX A;  2I48 A;  1MXX A;  3CI8 A;  4F3P A;  4WKM A;  4LZ8 A;  4OEV A;  3ZS6 A;  4ECF A;  4QFN A;  2ONS A;  3H6W A;  2O68 A;  4HCW A;  4GVO A;  4FED A;  3FUZ A;  2XXQ A;  2REG A;  2HZL A;  4Q8R A;  2H5Y A;  4ONY A;  4C1U A;  1VFD A;  2ZYK A;  3DLN A;  4NMY A;  4F2Q A;  3TAJ A;  4R74 A;  3PD9 A;  1FQF A;  3KN8 A;  2OWS A;  3LBS A;  3RPW A;  5H8S A;  4QFP A;  3QK6 A;  4KYS A;  3K02 A;  3CVG A;  2D21 A;  4F29 A;  4UA8 A;  1YTV A;  1JET A;  4AQ4 A;  2WKY A;  5J1D A;  1QJM A;  2XHD A;  1BIY A;  2WOL A;  3W9W A;  3RT8 A;  3RYA A;  2PYY A;  1LFI A;  2IEE A;  4IGR A;  1JNF A;  2Z8E A;  3C9H A;  1HSE A;  1UTH A;  1MPD A;  3VE1 B;  1EZ9 A;  5I56 A;  3K4U A;  4E0W A;  4G68 A;  1XT8 A;  4FEC A;  2O7I A;  4X48 A;  2DYX A;  4RK2 A;  1DTG A;  2PMS A;  1MRP A;  5H8N B;  1GGG A;  4IO7 A;  3IJX B;  2RIN A;  4R6H A;  3M3L A;  3RY3 A;  2E0S A;  3MBP A;  1SW4 A;  3CR9 A;  3PGF A;  2XXX A;  4RK9 A;  2RCB A;  2Y7W A;  1ANF A;  3E4R A;  3C34 A;  3PPR A;  3CFL A;  3S9M C;  4PFU A;  3TEL A;  5K2X A;  3H03 A;  3PMV A;  4RA1 A;  3DP4 A;  4DXC A;  1ZKB A;  5KZT A;  4OMB A;  2PVU A;  1SI1 A;  4HCY A;  2ZNS A;  1J1N A;  5H8Q B;  1JW1 A;  4F19 A;  3S4U A;  3TTR A;  3H6V A;  1OQH A;  2P0S A;  5CRY A;  2W7Y A;  3S9N C;  3RTW B;  3V83 A;  3K1N A;  4Q0C A;  2Q8J A;  2XXW A;  1MM6 A;  1MQJ A;  2F6G A;  4I8C A;  3LSL A;  1EZO A;  1ATG A;  1ELJ A;  4POX A;  3GBA A;  1P1O A;  3Q27 A;  4KI0 E;  2Q88 A;  4LUB A;  3SET A;  5CM6 A;  1M5F A;  3VDF A;  3I3V A;  4U23 A;  1B3E A;  2I3V A;  1IXC A;  3T9V A;  3CHG A;  4FAT A;  5I59 B;  1UIU A;  3CSB A;  2UVG A;  1LAG E;  3QSL A;  5EHM A;  2QS1 A;  5B7D A;  5L9S A;  5JEI A;  3HHG A;  5DVF A;  3TPA A;  4ZE9 A;  2OWT A;  4YKP A;  1FQC A;  4BDO A;  4MF3 A;  2F7B A;  1QKB A;  4R9G A;  4OEN A;  2X7Q A;  3VVD A;  4AB6 A;  4DIG A;  4N07 A;  2O7U A;  4KQP A;  2WOP A;  1MPC A;  2E1S A;  3C33 A;  1H45 A;  4NF4 A;  3RYB A;  1B5H A;  3BKI B;  4R6K A;  2DWJ A;  5TU0 A;  5H8H B;  3Q28 A;  4H65 A;  2I58 A;  3FJG A;  4IO3 A;  1D3K A;  1S9T A;  2Z23 A;  2I6E A;  1B3F A;  2PX1 A;  3HPI A;  3GBB A;  3PV0 E;  1PC3 A;  1JQF A;  1PBQ A;  1Y3P A;  2ZYM A;  3TQL A;  1M5D A;  1Y3N A;  3VV5 A;  5ITP A;  1A7L A;  3T66 A;  3I5O A;  4KYD A;  3VVE A;  2X7P A;  2OLB A;  3KGC A;  1MH4 A;  4K3F A;  4TLL B;  3ZKK A;  3HN0 A;  2Y7I A;  3TYH A;  4YB6 A;  2GHA A;  4EQ7 A;  4YAH X;  3AXF A;  4H1X A;  4IO5 A;  3G3H A;  1YPN A;  4IY5 A;  3G3F A;  1XVX A;  4XKR A;  3H06 B;  2DE3 A;  3DP6 A;  3EPE A;  2R6G E;  2QS4 A;  4OXV A;  3TKD A;  3TOD A;  3CFX A;  3DRH A;  1HSJ A;  4ELR A;  4YKI A;  3S9E A;  5K2Y A;  3TCG A;  3FV1 A;  3K6X A;  4QF9 A;  2GRV A;  3KZG A;  2O84 X;  2WOK A;  4XTC Q;  1OLA A;  4NF8 A;  5I2N B;  4OET A;  2V25 A;  1H3D A;  4IO2 A;  2F6P A;  1URS A;  4GXA A;  3BFT A;  4QFK A;  3RT6 B;  3H4Z A;  4F1U A;  1LLS A;  4THI A;  4HTG A;  3O2A A;  3OOA A;  3S2V A;  1FQA A;  3IB0 A;  3G3I A;  3FVK A;  3DEL B;  3MC2 A;  4JWO A;  3U72 A;  3IL1 B;  4TOZ A;  2F36 A;  2R9J A;  1POT A;  4DE8 A;  4GIZ A;  4F39 A;  4H6D A;  3KOS A;  4R75 A;  4YIC A;  3DRI A;  4QFO A;  2D3I A;  1MG1 A;  1IXH A;  1SW1 A;  1A8E A;  2ZYN A;  3OSQ A;  4UAC A;  3KSJ A;  2RKM A;  1AL3 A;  4F1V A;  1VSO A;  2XXU A;  3MZB A;  3KEI A;  4EXL A;  5ITO A;  1DPE A;  2FYI A;  5AA4 B;  2H99 A;  3O97 A;  2B3F A;  1R1N A;  1USY E;  3LR1 A;  1MXZ A;  1IXG A;  3R7X A;  3OO8 A;  1H43 A;  2DE4 A;  1B3H A;  1FQE A;  3O6H A;  4GL0 A;  4OVJ A;  1QUL A;  4IO6 A;  3T96 B;  1JVY A;  3VLV A;  1L5T A;  4HW8 A;  3EHS A;  4JSD A;  4FJP A;  1VFE A;  1MXW A;  1MY1 A;  5IKB A;  5TP9 B;  4XKQ A;  4YB7 A;  1GV8 A;  2XXT A;  2ABH A;  4GFR A;  1NH8 A;  2AYS A;  1B3L A;  4U22 A;  1POY 1;  3DRJ A;  1F9B A;  4ZEI A;  2G29 A;  5KDT B;  2OZZ A;  4C1T A;  1PB8 A;  1N04 A;  3U8Q A;  2F7A A;  1TFA A;  2P2A A;  4RPN A;  4DXU A;  3SDF A;  4NF4 B;  2DVC A;  3OEM A;  4ZED A;  3SER A;  3MVZ A;  3DM0 A;  3MW0 A;  2HFB A;  5DEX A;  4EF2 A;  2ZMB A;  2NUV A;  1MY3 A;  4QSD A;  2DQV A;  2Q89 A;  4I62 A;  3P7I A;  5CMK A;  3B6W A;  4KYE A;  5M2V A;  3UN6 A;  1Y3Q A;  3CG3 A;  3A3C A;  4OHN A;  4BDR A;  4OTE A;  1ZU0 A;  1GTK A;  4GRK A;  5KCJ A;  4ELQ A;  1BKA A;  1LB9 A;  3FXU A;  4R9F A;  1FW0 A;  3VFJ A;  1I6A A;  2F78 A;  1P1U A;  1MXV A;  1R9Q A;  1LST A;  3B6Q A;  5CMC A;  1D4N A;  3K6U A;  4F2O A;  1IZ1 A;  3IK6 B;  3MUQ A;  4LZ5 A;  1ZBM A;  2BJJ X;  1NH7 A;  3EF7 A;  4KPT A;  4I1D A;  4LA9 A;  4ND9 A;  1N0T A;  5FHM A;  4FEB A;  3D4C A;  1EU8 A;  1VE4 A;  3FAT A;  2DP8 A;  2YLN A;  4Z7E A;  3ECR A;  3OEK A;  1B52 A;  2OK2 A;  5L8D A;  4X9T A;  4NF8 B;  3QAX A;  2F34 A;  2PBW A;  2GHB A;  3ILT B;  4YKK A;  3N6U A;  1Y4C A;  1JW4 A;  1IEJ A;  4NWD A;  2PT2 A;  4OZ9 A;  1A54 A;  2RC8 A;  5JTY A;  1O63 A;  4MH5 A;  4H0W A;  2RC7 A;  5ICT A;  5A5X B;  4DDD A;  3PPP A;  2RCA A;  4QSC A;  1B7Z A;  1ZMG A;  1MXU A;  4ELO A;  3LVU A;  4XKN A;  3IO4 A;  3JZJ A;  3CIJ A;  2AL5 A;  1P1N A;  3OO9 A;  4RYA A;  2HCA A;  1MS7 A;  4NF6 B;  1MDP 1;  2F8D A;  4P11 A;  1S50 A;  3R6U A;  3OMB A;  5HPQ A;  5I58 A;  4AB5 A;  4PE5 B;  2NWJ A;  2Z22 A;  1WOD A;  5I57 A;  2OBG A;  4TQU Q;  4G4P A;  4GWO A;  3N94 A;  1SD3 A;  3T9X B;  1OIB A;  1LBC A;  2NVU B;  3U1O A;  4KFQ A;  3RLF E;  3SEV A;  4EXK A;  3E3K A;  1RYX A;  3EHT A;  3PUX E;  4H5G A;  4ZEF A;  1MXY A;  4YB5 A;  1B58 A;  4GF8 A;  2XXP A;  1I6B A;  3MQ9 A;  3RNN A;  1NNP A;  4HS7 A;  3FD3 A;  3K01 A;  1B1X A;  1SVX B;  1OMP A;  2QRY A;  4BLA A;  3U93 A;  3PMX A;  1URG A;  4NF5 A;  3FXQ A;  1ZIU A;  3C35 A;  3RQT A;  2IA4 A;  2VHA A;  3IAZ A;  2NOO A;  4JWY A;  1URD A;  5DEX B;  4OFO A;  3V5A A;  3L6G A;  3Q29 A;  3OEN A;  2REJ A;  3CSG A;  3UOR A;  3LSF B;  4G8H A;  1US4 A;  2DS9 A;  4YU0 A;  1SYI A;  1OLC A;  1ZJL A;  3FIR A;  5BUU A;  4MFI A;  5KCJ B;  1I69 A;  4OYV A;  3PPQ A;  1JVX A;  4OFJ A;  4YMB A;  2THI A;  2X26 A;  3HHF A;  2UVJ A;  4IY6 A;  4JXI A;  2ESN A;  5H8F A;  3FV2 A;  1Y1M A;  1B05 A;  2XD3 A;  5BWJ A;  3RUM A;  3O6P A;  3T9U A;  2F7C A;  3R26 A;  1LCT A;  3OXN A;  3K00 A;  4POW A;  3FAS A;  4ZZE A;  1WVJ A;  4G2Z A;  1MH3 A;  3TCF A;  1MQI A;  1SYH A;  1UTH B;  3IOU A;  4OWD A;  4LQ5 A;  1GVC A;  5I56 B;  4PP0 A;  3PU5 A;  1VR5 A;  3QYT A;  1B4H A;  3IO6 A;  1II5 A;  3TTK A;  5AA3 A;  4G68 B;  5JK4 A;  1FTO A;  4KHZ E;  3H3G A;  2Y7K A;  3GXA A;  1MQD A;  3QXM A;  4ISU A;  3DRK A;  4C0R A;  2HQ0 A;  5F1Q A;  2UYE A;  3K1M A;  1N7X A;  4KR5 A;  1NNF A;  2F97 A;  2AL4 A;  2FNC A;  3IOR A;  4YMA A;  1Y20 A;  1TXF A;  2XX7 A;  3WAF A;  3MP1 A;  5I2K A;  1XOC A;  4G8M A;  4QHQ A;  4PET A;  2OCU A;  2Y84 A;  3CRB A;  2YJP A;  3H6T A;  1QVS A;  2QPQ A;  3KBR A;  3USD A;  4O3A A;  2XD2 A;  4IGT A;  3F11 A;  4G77 A;  4H5F A;  3U92 A;  2VOZ A;  4ESX A;  1O7T A;  1I6Q A;  1USY H;  5I58 B;  3O6I A;  2H9B A;  2D5W A;  3LUY A;  4H8I A;  1SQY A;  3QIM A;  1FTK A;  2I0B A;  5DVI A;  3A09 A;  1GR2 A;  4LQ2 A;  2O51 A;  2DVZ A;  3VXB A;  1B9J A;  3H6U A;  3SKP A;  3N26 A;  3M3F A;  2ZYO A;  3PPO A;  4U1Z A;  2XXR A;  1ZTY A;  1P1Q A;  1FTL A;  5AA2 A;  3ONM A;  3VVF A;  4JSO A;  1PB7 A;  1D9V A;  2ZNT A;  3FJ7 A;  1NNK A;  3L6H A;  3U94 A;  3OSR A;  4QSE A;  4DZ1 A;  4PFW A;  4BDM A;  1R6Z A;  5DVJ A;  4KCD A;  4LON B;  3SEY A;  4NF5 B;  4R72 A;  3C31 A;  5I84 A;  3QUF A;  1B51 A;  1IIW A;  1Q1K A;  2ZXT A;  4DXB A;  5CMB A;  2GFE A;  2B4L A;  2I4C A;  2OJT A;  5H8Q A;  5CBS A;  3UIF A;  1TWY A;  1OQG A;  3TEP A;  4ELP A;  2B65 A;  1XS5 A;  3SEX A;  3CFZ A;  3MJN A;  4X1B A;  2Y7P A;  4F18 A;  2O6A A;  5LOM A;  1QUJ A;  4L17 A;  3KSX A;  1UQW A;  1B7H A;  2I4B A;  3IOV A;  3SEU A;  4DCX A;  1XVY A;  3D4G A;  1Y1Z A;  1SI0 A;  1HSL A;  4F22 A;  1EZP A;  3MWB A;  2V93 A;  3FGS A;  4ZEC A;  1AOV A;  3I6V A;  1Z7M E;  2VD3 A;  3WAE A;  1B32 A;  3BFU A;  1D9Y A;  1MM7 A;  2CMO A;  2XX8 A;  3UGW A;  4F3G A;  3SES A;  3K6W A;  5FTI A;  1LAF E;  3V89 B;  2G93 A;  1KWH A;  2I0C A;  1B40 A;  1B2H A;  3C4M A;  3C32 A;  4RPO A;  1LFH A;  1US5 A;  2RF1 A;  2QS3 A;  2UXA A;  2H98 A;  5L9M A;  1EH3 A;  1DOT A;  3PUZ E;  4Q30 B;  4ZEK A;  4PFY A;  2XXV A;  3S9L C;  2AIX A;  4O3C A;  2VD2 A;  3MVW A;  1M5E A;  3FXR A;  1NKX A;  1PB9 A;  5AE4 A;  5H8H A;  4NTL A;  3KG2 A;  3FVG A;  4LP2 B;  5I2K B;  3IB2 A;  2QMW A;  3FZV A;  4H8J A;  3ZSF A;  5TPA A;  1LB8 A;  3Q25 A;  4JWX A;  4WED A;  3E9X A;  3UA8 A;  1CB6 A;  4BDL A;  2XXH A;  3B7D A;  4GOT A;  1MPB A;  3A3U A;  3K2D A;  3MAM A;  4O3B A;  5F7V A;  3MZ1 A;  4H67 A;  1R9L A;  1NL5 A;  3O66 A;  1SBP A;  1IQ7 A;  2I49 A;  2A5T A;  2PT1 A;  3PUY E;  3LSX A;  5ISU A;  1A55 A;  4GQO A;  2XXI A;  1DMB A;  3MP8 A;  1N3X A;  1AH5 A;  3G7W A;  4QRZ A;  1AIV A;  4P0G A;  3TFL A;  5AA2 B;  1B5J A;  2F35 A;  3KN7 A;  4NWC A;  1OVB A;  2M8C A;  5AA2 D;  3MPK A;  4KD5 A;  1N76 A;  3GZG A;  3PUW E;  1OVT A;  3THI A;  5I2N A;  1Q35 A;  1UTB A;  3JYR A;  2DWH A;  1FQB A;  4GD5 A;  1YCJ A;  3UK4 A;  1LCF A;  2XXY A;  1RKM A;  1N3W A;  3H7M A;  1LAX A;  4U1O A;  3FTO A;  1B7U A;  3RN8 A;  5ICQ A;  1M5C A;  3N6T A;  3CG1 A;  3QUJ A;  2RC9 A;  2UYF A;  2DXR A;  3PD8 A;  4ESW A;  3IOW A;  4OQO A;  3EHU A;  2ANJ A;  2O69 A;  2H4I A;  4U4X A;  4U4S A;  4ZDM A;  5FTH A;  3DRF A;  2Y7R A;  5HBC A;  2H25 A;  4F1Y A;  3K6V A;  4MBP A;  5CI5 A;  1JW5 A;  1IXI A;  2CZL A;  2A5S A;  2GH9 A;  1AMF A;  2QSX A;  2QJE A;  3FVN A;  4F31 B;  4MLV A;  4JDF A;  3BBR A;  1SDX A;  5AA4 A;  1Y4T A;  3HST A;  1BP5 A;  3MPL A;  1O64 A;  2HZK A;  5DYH A;  4GLI A;  1PDA A;  4YKJ A;  3PAM A;  4R6Y A;  2DOJ A;  4N13 A;  3KFM A;  4OFL A;  3OO7 A;  3PPN A;  2VP1 A;  1FCK A;  5FHN A;  4KCC A;  4I9D A;  2V3Q A;  4PQJ A;  3IJO B;  3T22 A;  3DP8 A;  1QUK A;  1XHY A;  3ILU B;  1JEU A;  3G3J A;  2B3B A;  3MP6 A;  1B6H A;  2ALU A;  1IIT A;  3GLB A;  4U2R A;  4EDP A;  5TP9 A;  4ZEB A;  4Z0I A;  4WXJ A;  3HO7 A;  4LAT A;  1MQH A;  1T0K A;  3VLU A;  1IUD A;  1B4Z A;  5CMM A;  5KDT A;  2I3W A;  2QS2 A;  3MVY A;  1B1H A;  4FOR A;  4BDQ A;  2YPN A;  4RJZ A;  3IX1 A;  4EUO A;  1LFG A;  4TLM B;  4RNS A;  3RGY A;  2DWA A;  1UIV A;  5ELV A;  4RXL A;  4U21 A;  1MDQ A;  2ONK E;  3EN3 A;  3HV1 A;  1JEV A;  3PUV E;  5CBR A;  4FAJ A;  3EQ1 A;  4OER A;  2ONR A;  1MQG A;  2DE2 A;  5IAI A;  2R71 A;  1QW0 A;  5TPA B;  1Y9U A;  3JV9 A;  3IOT A;  3ZKL A;  1B0L A;  5B70 A;  1N84 A;  3PMW A;  1NFT A;  3TTM A;  4JB7 A;  2B4M A;  3TZA A;  4RY1 A;  4F3S A;  4YZZ A;  2V3U A;  3C36 A;  3E13 X;  1LGB C;  3LSW A;  1QKA A;  5JTY B;  2NXO A;  3FJM A;  3HCQ A;  3TTL A;  1SW5 A;  3IB1 A;  3KJ7 A;  4XXU A;  2A5T B;  4M1V A;  3RTF B;  3MVX A;  1PBP A;  1DSN A;  4P0I A;  1H76 A;  1B0H A;  1SW2 A;  3TCH A;  4EQB A;  4MLQ A;  4DLD A;  2O1L A;  3M8U A;  3TDJ A;  4E0X A;  1TT1 A;  1NMU A;  4GXS B;  4XKP A;  1N7W A;  1WDN A;  2V84 A;  3SEW A;  1FQD A;  1B46 A;  1FTM A;  2HAU A;  2ZNU A;  2DSF A;  5I57 B;  3G3G A;  2Z8D A;  3ODB A;  4N6P A;  3TQW A;  1UTB B;  3UP9 A;  3W15 C;  3OEL A;  1LBB A;  1P99 A;  2P1S A;  1NNT A;  4R2F A;  5H8N A;  3MZ9 A;  3T9H B;  1RYO A;  2HEU A;  4OES A;  3V8X B;  4NED A;  1BTJ A;  3OO6 A;  1S7Y A;  3KOT A;  3DRG A;  5A5X A;  3W9V A;  4X1D A;  3FVO A;  1Z7N E;  3M3K A;  4XIG Q;  4GL8 A;  4PFT A;  1A8F A;  1B5I A;  1A99 A;  4IO4 A;  3OD7 A;  4FE8 A;  2Z8F A;  3KJT A;  4NF6 A;  1LAH E;  1PEB A;  3LC8 A;  2UVH A;  5EYF A;  1DPP A;  4QFL A;  4G68 C;  3K1P A;  4LVQ A;  3VXC A;  4ZE8 A;  2Q2C A;  1H44 A;  2Q9T A;  4OEU A;  2QL3 A;  3KN3 A;  3TUS A;  2UVI A;  1MY2 A;  1FTJ A;  1A40 A;  1B3G A;  3TMG A;  1XC1 A;  5L9O A;  2KLF A;  4IB2 A;  2XX9 A;  4Q5T A;  4EQ9 A;  1YAE A;  4JBZ A;  2HXW A;  3O28 A;  1BLF A;  2F5X A;  2O1M A;  3T93 B;  1MY0 A;  3Q26 A;  2LAO A;  4ZZA A;  4NE4 A;  3O9P A;  2FA7 A;  2DXY A;  3O29 A;  4BDN A;  3B6T A;  1M5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...