1B46A

Oligo-peptide binding protein (oppa) complexed with kpk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b46A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b46A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b46A02
4ISUA 1TFAA 3K2DA 4Q0CA 4OESA 3T66A 3PUWE 1MQDA 4F1UA 2O7IA 2XXPA 5H8HB 2XX7A 3PD9A 2PT2A 2I3WA 2D3IA 2I4BA 1OLAA 2DWAA 3Q28A 3G3GA 3GXAA 1I6BA 1HSLA 2DE2A 4NMYA 1SI1A 2NWJA 3USDA 1QKAA 4GFRA 1TXFA 5DVIA 4NF4B 4GF8A 1JW1A 3PMVA 2Z8FA 4QRZA 1M5FA 3G3IA 1OLCA 3Q29A 1XVXA 4NF5A 5AA2A 4IY6A 4YB5A 3KGCA 2F7AA 4F39A 3EHSA 1EZ9A 4U1ZA 1O64A 2XXIA 3GBAA 3VV5A 1ANFA 1FTLA 2QJEA 3ZKKA 2DWJA 4I9DA 1LSTA 3M3KA 3MPKA 1IXIA 1Y20A 4OQOA 5BWJA 4IO7A 4MF3A 3B6TA 4H6DA 2WOKA 5CMKA 1LFHA 3CHGA 2FA7A 3CG3A 5CMMA 4QFOA 2RC9A 2ZXTA 3CFZA 4OEUA 5AA1A 4KYDA 2THIA 1DMBA 1EZPA 3TQWA 1B1XA 1A8FA 5K2YA 4YB7A 4R6YA 3IOUA 5DEXB 3SEVA 3ZS6A 5F1QA 3OD7A 1LCFA 2D5WA 2A5SA 3LSWA 1N3WA 1F9BA 4LZ7A 2B4LA 3O6PA 4ZEBA 4RXLA 3OMBA 3VVDA 2DS9A 2M8CA 4R75A 2ZNUA 1VFEA 3DRKA 4OHNA 2OJTA 4KQPA 1Y1MA 3K6VA 4UACA 2QS3A 2UYFA 4ONYA 3H03A 1QUIA 5H8NA 4WXJA 4JSOA 4TQUQ 1B4HA 2GHBA 3KSJA 2HFBA 4OZ9A 4XKNA 2V84A 4IO6A 5I56A 1M5CA 1AH5A 3ODBA 5KDTA 1PB8A 4EDPA 1B5HA 2X7PA 1R9QA 4MBPA 3M8UA 3DELB 4O3AA 5FHNA 3K1PA 1J1NA 1DTGA 3IOWA 4QFKA 2AYSA 1RYOA 5I57A 2F78A 4G8HA 3T9UA 1A7LA 1RYXA 5HPQA 5AA2D 1B1HA 1LFIA 3LR1A 2RC7A 3KG2A 4NWCA 4U1OA 1B0LA 1QKBA 1B32A 3KN7A 3MJNA 5L8DA 3VDFA 3MC2A 3VXBA 4JWOA 1SW4A 2A5TA 3DM0A 2DP8A 1M5EA 4NWDA 1R1NA 2VP1A 4TLMB 2YPNA 1SQYA 4JWYA 1B3EA 1OQHA 2XXYA 4YZZA 1TFDA 4BDMA 2UVJA 4C1TA 4JSDA 4G68C 4EUOA 4ESXA 4G68A 1P1WA 1MH3A 5CC2A 2D21A 3LC8A 4LATA 2AL4A 1DOTA 1BTJA 5ELVA 5JTYA 4RNSA 3IX1A 4R72A 3TPAA 2WKYA 4AB6A 4GLIA 3VLWA 2QMXA 3K4UA 2HZLA 4DDDA 1SYHA 3CSGA 2ZMBA 1OMPA 3CI8A 4UA8A 5B7DA 3HSTA 1B3HA 3JYRA 1OQGA 3EPEA 3RTFB 4PP0A 1CE2A 5DVJA 4HCYA 3CFXA 2HEUA 3C9HA 5AA4A 5TPAB 2DOJA 4C0RA 2DE3A 4TOZA 2KLFA 2H99A 3V8XB 1MY3A 2X7QA 2XX8A 1D9YA 4IO2A 3JZJA 1POTA 1JETA 3E4RA 3ILTB 1MM6A 1UTHA 1MM7A 1IXGA 3WAEA 3T9XB 1VFDA 4F2QA 3KJ7A 3TCFA 3E9XA 3H7MA 4GQOA 2Y7WA 2ONSA 1B3LA 2PYYA 5A5XA 3DP4A 3R7XA 1FCKA 3N5LA 1A40A 3EF7A 4ZEIA 4OERA 5FHMA 2H4IA 5CBSA 5I59B 1USYE 4FIMA 1SW2A 1YPNA 4ZE8A 3P7IA 4I62A 3C4MA 4GWOA 4EF2A 3C34A 3FVKA 1IUDA 1SDXA 1FTMA 2ESNA 1P1QA 2XX9A 3OEKA 2DVZA 4RJZA 3U94A 5DTBA 1LB8A 1N3XA 3VVFA 1P99A 4QSEA 5AA3A 1LAHE 5ICQA 1B40A 4MH5A 1JEVA 3UN6A 4ZE9A 2VD3A 1KWHA 2XXUA 3U92A 2YLNA 1NFTA 1NNKA 1P1UA 5CMCA 1B2HA 1L5TA 3FXQA 4AB5A 3MZ9A 3DRFA 4XXUA 3CIJA 3DRIA 2I48A 3G3KA 2WOPA 5M2VA 1GV8A 3PPQA 4F29A 2PBWA 3KOSA 1IXCA 4ZEDA 3MQ9A 3QK6A 1SW1A 4WEDA 1OVBA 3PD8A 3E3KA 2PVUA 4OETA 4LONB 2V3TA 3MPLA 3S2VA 3EN3A 2DXRA 1FQBA 4POWA 3RQTA 3KOTA 5CM6A 1XT8A 4ZZEA 4Q8RA 5H8QA 3C33A 4H67A 4LA9A 5I58A 5CMBA 1URGA 1UTBB 2QMWA 4YU0A 3RYAA 4IGTA 4F1VA 1BP5A 1FQEA 4XKRA 3UGWA 3HO7A 3QXMA 3TDJA 3B6WA 4BDQA 3AXFA 4BDNA 1URSA 1Z7ME 1PC3A 4GL0A 3K6UA 4NF6B 1IZ1A 2RCAA 3CG1A 1MQJA 3L6HA 3OO7A 5FTIA 2B3FA 2A5TB 4YMAA 4R9FA 3IR1A 1QJMA 4P0GA 4YICA 5H8FA 3H6UA 1MXXA 3K01A 1QULA 3T96B 3MW0A 4PE5B 3H6WA 2Z22A 4XTCQ 4ND9A 2RCBA 2Z8DA 5HBCA 2V3QA 3CVGA 5TU0A 3A3UA 4DE8A 5JTYB 1D3KA 1Q1KA 1AL3A 1B7ZA 1VE4A 4AQ4A 3IOTA 1ZTYA 3BKIB 1N84A 1MDP1 4RK2A 1BKAA 4H0WA 1B58A 4I8CA 3ZKLA 4H5GA 4JB7A 4HW8A 3KN3A 4NF8B 1IEJA 5KCJB 3DP8A 1B7UA 5TP9A 3QSLA 3H3GA 2R71A 1N0TA 2LAOA 3OXNA 2OLBA 4OTEA 2GHAA 2HCAA 1JEUA 4HTGA 2Y84A 4QHQA 1SYIA 3FZVA 2OBGA 3HN0A 1AOVA 3TYHA 1H43A 1B4ZA 1P1OA 2UVIA 3SEXA 3PU5A 3SETA 3PUVE 4JWXA 1B5IA 4GRKA 2I6EA 3TCGA 5A5XB 2XHDA 5I2KB 3KJTA 1GGGA 3VFJA 4ZEKA 2F97A 4F3PA 4F19A 4MLQA 1FQDA 4OXVA 3K6XA 4X9TA 1NNPA 3QAXA 4BLAA 1YTVA 3IJOB 1I6QA 2Y7PA 5L9SA 2HZKA 3G7WA 1FQAA 1LBCA 3LUYA 2O6AA 2B65A 3HHFA 3PUYE 1H44A 4RYAA 3MVXA 3HV1A 3ILUB 4LQ2A 1AIVA 4U23A 3L6GA 4O3BA 2O68A 1JVYA 4GVOA 4DXBA 3RN8A 2B4MA 3TODA 3TTRA 3K00A 4G2ZA 2UXAA 3TTLA 3EQ1A 3HCQA 4BDLA 4K3FA 1DSNA 2Q2AA 5CBRA 4H5FA 3VLUA 2XXXA 4LZ8A 2I49A 2QL3A 3MP8A 1Y4TA 2Q8JA 2AIXA 5BUUA 4P0IA 1MDQA 3MVZA 3FV1A 5IKBA 2H5YA 1ZIUA 2H98A 3M3FA 1S7YA 2P1SA 4IY5A 3BBRA 1NL5A 4O3CA 1B3GA 4GOTA 2NUVA 1Y9UA 3N6UA 1FTKA 1O7TA 1TWYA 1FQCA 4OWDA 1LB9A 3N6TA 2Y7IA 2I0BA 5I2NA 3O9PA 1A54A 4DXCA 1B0HA 3V5AA 2X26A 1YCJA 3HPIA 4LZ5A 3TTMA 2DYXA 3O6HA 2OZZA 3E13X 3KSXA 3ONMA 3T9HB 3SEYA 3FJ7A 4DLDA 3FIRA 1MS7A 4DIGA 2Y7RA 3Q25A 1POY1 1NKXA 1NNFA 4M4GA 4FAJA 1DPPA 1WDNA 3TTNA 4Z7EA 4H8IA 1FTJA 2GH9A 1CB6A 4C1UA 1MY0A 3PAMA 4KR5A 3Q27A 3S9MC 2XXWA 3VLVA 4KHZE 3W9VA 4YMBA 1AMFA 3LSFB 4LP2B 2DWIA 1VR5A 5EHSA 2F6GA 2DWHA 3MUQA 1Y3PA 2CZLA 2ABHA 5H8HA 4H1XA 3G3HA 1B46A 4OFJA 3KBRA 1US5A 3U1OA 4LVQA 1I6AA 5I84A 1MQGA 1MPCA 3FV2A 2DXYA 3TELA 3PPOA 4NF4A 1B9JA 4NF5B 3LSXA 5AA2B 3BFTA 2Q88A 1MY4A 3OO9A 3FGSA 4LUBA 2QS4A 3B7DA 4KCDA 4U2RA 1MH4A 5DT6A 4MFIA 4R6HA 1Y1ZA 4WEPA 5ISUA 3K1MA 1SD3A 3U93A 4QFPA 3W15C 4E0WA 1MQIA 4F2OA 3IJXB 3IL1B 2HXWA 3O6IA 3M3LA 2B3BA 3SESA 2BJJX 1PDAA 2ONRA 3I3VA 3SEWA 1T0KA 1PBQA 1PEBA 3TTKA 3OO8A 4N6PA 4ZEFA 3H6TA 4FORA 2QRYA 4NEDA 2RC8A 4GXAA 4EQBA 3B6QA 5AE4A 5L9OA 3TZAA 4PFWA 3EHUA 5FTHA 3SERA 5DEXA 5B70A 4QFNA 1LCTA 2I4CA 3UORA 5CRYA 3VVEA 1O63A 2REJA 1ATGA 2F7BA 2P0SA 4DXUA 3KEIA 3T93B 5H8NB 2DSFA 2XD2A 4YB6A 1RKMA 4IO5A 5KZTA 3S9LC 5I56B 4U4SA 3S4UA 4YAHX 1DPEA 4IGRA 3HHGA 3MZ1A 1PB7A 5KDTB 4KFQA 3I5OA 3MP1A 2GRVA 4H65A 2O51A 3S9EA 1MY2A 2ZYOA 5I57B 2O84X 1B51A 1SW5A 3FJMA 3O29A 2XD3A 4TLLB 4XKQA 2VOZA 3RT6B 3SKPA 1H3DA 4OVJA 5FHOA 4KD5A 1IXHA 3OEMA 1N7XA 1B6HA 1H45A 3CSBA 1MPBA 3Q26A 1JQFA 3N94A 4Q30B 2E1SA 1NMUA 4FEDA 1BLFA 4PFTA 1USYH 1A8EA 5J1DA 4PETA 2ZNSA 4JXIA 4QSDA 4FECA 2ANJA 3QIMA 3IB1A 3MVWA 4F3BA 1B3FA 3PPRA 3IORA 3K1NA 4F18A 3LBSA 1WVJA 5H8SA 4IO4A 4JBZA 1UIVA 2P2AA 3PMWA 3FTOA 3R26A 3C35A 1B52A 2HAUA 1MXVA 4XIGQ 3TFLA 3RNNA 1JW4A 4G68B 3U72A 4N07A 3JV9A 1MPDA 5ITOA 1LAGE 2H9BA 3ZSFA 3O66A 2V25A 3FATA 4EXLA 1B05A 4KYSA 5LOMA 1NNTA 1Q35A 2G29A 3DRJA 1FTOA 4L17A 5JEIA 1IITA 2G93A 2O1MA 3TEPA 4RK9A 1QVSA 1VSOA 5EHMA 4BDRA 1ZU0A 4E0XA 1EZOA 1JNFA 4U22A 5F7VA 3CRBA 1WODA 3RLFE 3TAJA 3IO4A 4HCWA 5AA4B 2QS2A 1OIBA 2F35A 3FXUA 2Q9TA 3UK4A 4HS7A 1EH3A 5TPAA 1B5JA 1LAFE 4G8NA 2OWTA 1EU8A 1UTHB 3LVUA 2VHAA 3VXCA 3UIFA 2NOOA 2F7CA 2Y7KA 3C32A 1MXWA 3KZGA 3V83A 3IK6B 4RA1A 3RYBA 1XS5A 1QW0A 2FYIA 2ONKE 3ECRA 5L9MA 1N7WA 1D4NA 1JW5A 1FQFA 2FNCA 4IB2A 2OK2A 5DYHA 3DLNA 1UQWA 3IAZA 4I1DA 4R2BA 4R6KA 5I59A 1HSJA 3DP6A 4F3SA 3S9NC 2O69A 3G3FA 2RINA 4U4XA 4KI0E 2OCUA 3IB0A 2ZYKA 1MG1A 3QUJA 1ZLQA 2I3VA 4KYEA 4Q5TA 4FE8A 5EYFA 2Q89A 3FJGA 1S50A 1BIYA 3R6UA 4OENA 2HAVA 4ELPA 1M5BA 4QSCA 3EHTA 3IOVA 1GTKA 3WAFA 2I0CA 1I69A 3MZBA 3C31A 4PQJA 3H06B 4KCCA 4YKJA 4X1BA 4N13A 4RY1A 3D4GA 4M1VA 5DVFA 4YKKA 2DVCA 2F5XA 5JK4A 1S9TA 4OFLA 3TQLA 1FW0A 4OMBA 3RY3A 2ALUA 2I58A 4JDFA 5H8QB 3THIA 4RPNA 5I58B 4F31B 2XXVA 3GZGA 1D9VA 3RT8A 3PUZE 4EQ9A 2ZNTA 1PBPA 3FVNA 4EQ7A 3O2AA 3FVOA 1UTBA 4X48A 3G3JA 2UYEA 4DZ1A 4OEVA 2IA4A 2DQVA 3MAMA 2XXQA 3SEUA 1N76A 3TMGA 4F3GA 5K2XA 5IAIA 5H8FB 4GIZA 1LFGA 1LAXA 1TT1A 4Z0IA 4NF6A 3T22A 3DRGA 4DCYA 4ELQA 3KFMA 1GR2A 5HM4B 3GLBA 4THIA 1ZMGA 4G8MA 3MP6A 4ZDMA 2VGQA 2GFEA 2WOLA 3H6VA 1MY1A 3O97A 1LGBC 1LBBA 3QYTA 4NE4A 2QS1A 1IIWA 3TKDA 4MLVA 4OFOA 2OWSA 3PMXA 4ZECA 2ZYMA 4X1DA 1XVYA 2QSXA 3MVYA 3UA8A 4IO3A 4G4PA 1A99A 1MXYA 3PGFA 3N26A 1ZKBA 3I6VA 2W7YA 1B7HA 4DCXA 2RKMA 1H76A 3FXRA 5TP9B 1OVTA 4H8JA 3OSRA 3CFLA 2Z8EA 4NF8A 5KCJA 3O28A 4FJPA 1M5DA 3QUFA 4GXSB 4F1YA 4YKIA 4G77A 3FUZA 3H4ZA 2NVUB 1XOCA 3T9VA 1HSEA 4FEBA 2O1LA 2V93A 3KN8A 4ECFA 1XC1A 1R9LA 1IQ7A 2NXOA 2Z23A 1II5A 3UP9A 1MXUA 4ZZAA 3V89B 3K02A 1Y3NA 2YJPA 3BFUA 4KPTA 5I2KA 1NH8A 1ZBMA 3W9WA 1ELJA 4WKMA 1SBPA 1PB9A 4P11A 4FATA 1QUJA 2IEEA 4QF9A 3K6WA 2XXHA 4OYVA 3RGYA 4BDOA 4F22A 2DE4A 1SI0A 3OELA 4R9GA 4R74A 1Y4CA 2HQ0A 3SDFA 3IB2A 3F11A 3O6GA 5ICTA 1N04A 1MXZA 3PPPA 4EXKA 3PPNA 4PFUA 3OO6A 4LQ5A 3A3CA 4R73A 4ZS9A 4GL8A 2QPQA 4XKPA 3LSLA 1MQHA 1QUKA 1Z7NE 1A55A 1GVCA 2XXTA 2PMSA 2REGA 4GD5A 3CR9A 4QFLA 3FVGA 2XXRA 4U21A 4ELOA 4YKPA 5ITPA 2UVHA 1NH7A 3FASA 3IO6A 1YAEA 2F34A 3C36A 1DTZA 1XHYA 2Q2CA 3RPWA 3D4CA 2PX1A 1P1NA 1JVXA 4POXA 1LLSA 2AL5A 3MBPA 3DRHA 1R6ZA 1US4A 2ZYNA 3RUMA 2R6GE 4PFYA 1ZJLA 3TCHA 3VE1B 4R2FA 3PV0E 3RTWB 2CMOA 1URDA 4NTLA 3A09A 3PUXE 5I2NB 2PT1A 2VD2A 3FD3A 5CI5A 2F36A 3OSQA 3TUSA 3OENA 3MWBA 2O7UA 2UVGA 1MRPA 2R9JA 1Y3QA 4ELRA 2RF1A 4EF1A 2E0SA 3OOAA 2H25A 3U8QA 2F6PA 1SVXB 3GBBA 4RPOA 2F8DA 1UIUA 2V3UA 3K0VA 4ESWA
chains in the Genus database with same CATH superfamily
4ISUA 1TFAA 3K2DA 2ZZXA 4OVPA 4Q0CA 3B8BA 4KXPA 4OESA 3T66A 5ESYA 3PUWE 1MQDA 4F1UA 2O7IA 2XXPA 5H8HB 2XX7A 2CZKA 3PD9A 2PT2A 2I3WA 4N91A 2D3IA 2I4BA 1OLAA 2DWAA 3Q28A 4N6DA 3G3GA 3GXAA 1FPGA 1I6BA 1HSLA 2DE2A 4NMYA 1SI1A 2NWJA 3USDA 4GX6A 1DK4A 5EQ8A 3NOHA 1QKAA 4GFRA 1TXFA 5DVIA 4NF4B 4GF8A 1JW1A 3PMVA 2Z8FA 4PAFA 4QRZA 1M5FA 3G3IA 1OLCA 3Q29A 1XVXA 4NF5A 5AA2A 4IY6A 4YB5A 3KGCA 2F7AA 4F39A 3EHSA 1EZ9A 4U1ZA 1O64A 2XXIA 1RDXA 3GBAA 3VV5A 1ANFA 1FTLA 2PFYA 2QJEA 3ZKKA 1XI6A 2DWJA 4I9DA 1LSTA 3M3KA 3MPKA 1IXIA 1Y20A 4OQOA 5BWJA 4IO7A 4MF3A 4MNCA 3B6TA 4H6DA 2WOKA 5CMKA 1LFHA 3CHGA 2FA7A 3CG3A 5CMMA 4QFOA 2RC9A 2ZXTA 3CFZA 4PFIA 4NN3A 3LV0A 4OEUA 5AA1A 4KYDA 2THIA 1DMBA 1EZPA 1NV3A 3TQWA 1B1XA 1A8FA 5K2YA 3RYDA 4YB7A 4R6YA 3IOUA 5DEXB 3SEVA 3ZS6A 4O8MA 2XWVA 5F1QA 3OD7A 1LCFA 2D5WA 2A5SA 3LSWA 1N3WA 1F9BA 4LZ7A 2B4LA 3O6PA 4ZEBA 4RXLA 3OMBA 3VVDA 3ISPA 2DS9A 2M8CA 4MCOA 4R75A 2ZNUA 1VFEA 3DRKA 4OHNA 2OJTA 4KQPA 1NV5A 1Y1MA 3K6VA 4UACA 4AS5A 4N17A 2QS3A 2UYFA 3E78A 4ONYA 4P9KA 3H03A 1QUIA 5H8NA 4WXJA 4JSOA 4TQUQ 1B4HA 2GHBA 3KSJA 2HFBA 4OZ9A 1D9QA 4XKNA 3BIGA 2V84A 4IO6A 5I56A 1M5CA 1VDWA 1SPIA 1AH5A 3D1RA 3ODBA 5KDTA 1PB8A 4EDPA 1B5HA 2X7PA 1R9QA 2V4CA 4MBPA 4GX3A 3M8UA 3DELB 4O3AA 5FHNA 3K1PA 4JVIA 1J1NA 1DTGA 3IOWA 1G0HA 4QFKA 2AYSA 1RYOA 5I57A 4O7MA 2F78A 4G8HA 3T9UA 4O7IA 1A7LA 1RYXA 1FBDA 5HPQA 5AA2D 1B1HA 1LFIA 3LR1A 5I5PA 2RC7A 3KG2A 4NWCA 4U1OA 1B0LA 1QKBA 1B32A 3KN7A 1FPIA 3MJNA 5L8DA 1KZ8A 3VDFA 3MC2A 3VXBA 1IMEA 4JWOA 1SW4A 2A5TA 3DM0A 4MIJA 2DP8A 4XEQA 1M5EA 4NWDA 1R1NA 2VP1A 4TLMB 1FSAA 2YPNA 1SQYA 4JWYA 1B3EA 1OQHA 2XXYA 4YZZA 1TFDA 4BDMA 2UVJA 4C1TA 4JSDA 2XWKA 4G68C 4EUOA 4ESXA 4G68A 1P1WA 1MH3A 3IFAA 5CC2A 2D21A 3LC8A 4LATA 2AL4A 3FBPA 1DOTA 1BTJA 5ELVA 5JTYA 4RNSA 1LBYA 4LN5A 3IX1A 4R72A 4N8GA 3TPAA 2WKYA 4AB6A 4GLIA 3VLWA 5ET6A 2QMXA 3K4UA 1FPJA 2HZLA 4DDDA 1SYHA 3SZPA 3CSGA 3U65A 2ZMBA 1OMPA 3CI8A 4UA8A 5B7DA 3KC0A 3HSTA 1FPLA 1B3HA 3JYRA 3KC1A 1OQGA 3EPEA 3RTFB 4PP0A 1CE2A 4JVDA 5DVJA 4HCYA 3CFXA 2PCRA 2HEUA 3C9HA 5AA4A 5TPAB 2DOJA 4C0RA 2DE3A 4TOZA 2KLFA 4PGNA 2H99A 1MY3A 3V8XB 2X7QA 2XX8A 1D9YA 4IO2A 3JZJA 1POTA 1JETA 3E4RA 3ILTB 1MM6A 1UTHA 1MM7A 1IXGA 3WAEA 3T9XB 1VFDA 4F2QA 5EQ7A 3KJ7A 5IM2A 4NG7A 3TCFA 3E9XA 3H7MA 4FBPA 4GQOA 2Y7WA 2ONSA 5EQ9A 1IMAA 1B3LA 2PYYA 5A5XA 3DP4A 3R7XA 1FCKA 3N5LA 1A40A 3EF7A 4ZEIA 4OERA 4P56A 5FHMA 2H4IA 5CBSA 5I59B 1USYE 4FIMA 1SW2A 2JJKA 1YPNA 4ZE8A 3P7IA 4I62A 3C4MA 4GWOA 4EF2A 3C34A 3FVKA 1IUDA 1SDXA 1FTMA 5IZZA 2ESNA 1NV2A 1P1QA 2XX9A 3OEKA 2DVZA 4RJZA 3U94A 2L5VA 5DTBA 1LB8A 1N3XA 3VVFA 1P99A 4QSEA 2F3DA 5AA3A 1K9ZA 1LAHE 5ICQA 1B40A 4MH5A 4PC9A 1JEVA 3UN6A 4ZE9A 2VD3A 1KWHA 2XXUA 4PBHA 3U92A 4GBWA 2YLNA 1NFTA 1NNKA 1P1UA 5CMCA 1B2HA 1L5TA 3FXQA 4AB5A 3MZ9A 3DRFA 4XXUA 3CIJA 2XWIA 3DRIA 5LDZA 2I48A 3G3KA 2WOPA 5M2VA 1DBZA 1GV8A 3PPQA 4F29A 2PBWA 3KOSA 1IXCA 1NUYA 4ZEDA 3MQ9A 3QK6A 1EYIA 4GWXA 3IFCA 1SW1A 1QGXA 4WEDA 1OVBA 3PD8A 5F24A 1NV4A 3E3KA 2PVUA 4OETA 4LONB 2V3TA 3MPLA 3S2VA 3EN3A 1KA0A 4PDHA 2DXRA 5T3JA 2OX3A 1FQBA 4POWA 3RQTA 3KOTA 5CM6A 1XT8A 4ZZEA 4Q8RA 5H8QA 3C33A 4H67A 4LA9A 5I58A 5CMBA 1IMCA 1URGA 4HXVA 1UTBB 3MYUA 2QMWA 4YU0A 3RYAA 4IGTA 1FBCA 4F1VA 1BP5A 1FQEA 1YYZA 4XKRA 3UGWA 2CEXA 3HO7A 3QXMA 3LUZA 3TDJA 3B6WA 4BDQA 3AXFA 4BDNA 1URSA 5ET7A 1Z7ME 1PC3A 2KR0A 4GL0A 3K6UA 4NF6B 1IZ1A 2RCAA 3CG1A 1MQJA 3L6HA 3OO7A 5FTIA 2B3FA 2A5TB 4YMAA 4R9FA 3IR1A 1QJMA 2Q74A 4P0GA 4YICA 5H8FA 3H6UA 1MXXA 3K01A 1QULA 3T96B 3MW0A 4PE5B 1FPBA 3H6WA 2Z22A 4XTCQ 4ND9A 2RCBA 2Z8DA 2F3BA 5HBCA 2V3QA 5IZ1A 1FPFA 3CVGA 5TU0A 3A3UA 4JVCA 1FTAA 4DE8A 3KBZA 5JTYB 1D3KA 1Q1KA 1AL3A 1B7ZA 1VE4A 2FHYA 4AQ4A 3IOTA 1ZTYA 3BKIB 1N84A 1MDP1 2XWOA 4RK2A 4X04A 1BKAA 4H0WA 1B58A 4I8CA 3ZKLA 4GWYA 4H5GA 4JB7A 4HW8A 4XF5A 4NF8B 3KN3A 1IEJA 5KCJB 3DP8A 1B7UA 5TP9A 2WEFA 3QSLA 3H3GA 2R71A 1N0TA 2LAOA 3OXNA 4OTEA 2OLBA 1FPKA 2GHAA 2ZZWA 2HCAA 1JEUA 4PGPA 4HTGA 2Y84A 4QHQA 1SYIA 3FZVA 2OBGA 3HN0A 1AOVA 3TYHA 1H43A 1B4ZA 4PFBA 3PU5A 1P1OA 2UVIA 3SEXA 5IZ3A 3SETA 3PUVE 4JWXA 1B5IA 4GRKA 2I6EA 3TCGA 5A5XB 2XHDA 5I2KB 3KJTA 1GGGA 3VFJA 4ZEKA 2F97A 4F3PA 4F19A 1YXIA 1DCUA 4MLQA 1FQDA 4OXVA 3K6XA 4X9TA 1NNPA 3QAXA 4BLAA 1YTVA 3IJOB 1I6QA 2Y7PA 5L9SA 2HZKA 2QFLA 3G7WA 1FQAA 1LBCA 3LUYA 4HE0A 2O6AA 2B65A 3HHFA 3PUYE 1H44A 4RYAA 3MVXA 3HV1A 3ILUB 4LQ2A 1IMDA 1AIVA 4U23A 3L6GA 4O3BA 2O68A 1JVYA 4GVOA 4DXBA 3RN8A 2B4MA 3TODA 3TTRA 3HFUA 3K00A 1FBPA 4G2ZA 2UXAA 3MSTA 1BK4A 3TTLA 1G0IA 3EQ1A 3HCQA 1KA1A 4BDLA 4K3FA 4PAIA 1DSNA 2Q2AA 5CBRA 4H5FA 3VLUA 2XXXA 4LZ8A 2I49A 2QL3A 3RPLA 4MMPA 3MP8A 1LBXA 1Y4TA 2Q8JA 3B50A 2AIXA 4P1EA 5BUUA 4P0IA 4N6KA 1MDQA 3MVZA 3FV1A 4P3LA 5IKBA 2H5YA 1ZIUA 2H98A 3M3FA 1S7YA 2P1SA 4IY5A 3BBRA 1NL5A 4O3CA 4GX4A 1YZ0A 1B3GA 4GOTA 2NUVA 1Y9UA 3N6UA 1CNQA 1FTKA 4PFRA 1O7TA 1TWYA 1FQCA 4OWDA 1NV0A 1LB9A 3N6TA 2Y7IA 2I0BA 5I2NA 3O9PA 1A54A 4DXCA 1B0HA 3V5AA 2X26A 1YCJA 3HPIA 4LZ5A 3TTMA 1NV7A 2DYXA 3T0JA 3O6HA 2OZZA 3E13X 4UABA 3KSXA 3ONMA 3T9HB 3SEYA 3FJ7A 4DLDA 3FIRA 1MS7A 2Y7RA 3Q25A 4DIGA 1POY1 1NKXA 1NV6A 1NNFA 4M4GA 4PAKA 4FAJA 1DPPA 1WDNA 3TTNA 4Z7EA 4H8IA 4PDDA 1FTJA 2GH9A 1CB6A 4C1UA 1MY0A 3PAMA 4KR5A 3Q27A 3S9MC 2XXWA 3VLVA 4KHZE 3W9VA 4YMBA 1AMFA 3LSFB 4LP2B 2DWIA 1VR5A 5EHSA 2F6GA 2DWHA 5EYHA 3MUQA 1Y3PA 2CZLA 2ABHA 5H8HA 4H1XA 3G3HA 1B46A 1NUXA 4OFJA 3KBRA 2WX9A 1US5A 3U1OA 4LVQA 1I6AA 4P1LA 5I84A 1MQGA 1MPCA 3FV2A 2DXYA 3TELA 4MAGA 3PPOA 4NF4A 1B9JA 4NF5B 4PF6A 3LSXA 5AA2B 4PBQA 3BFTA 2Q88A 1MY4A 3OO9A 3FGSA 4LUBA 2QS4A 2WBBA 3E79A 3B7DA 4KCDA 4U2RA 1MH4A 5DT6A 1LEVA 4MFIA 4P47A 4R6HA 1IMBA 1Y1ZA 4WEPA 5ISUA 3K1MA 1SD3A 3U93A 1JP4A 4QFPA 3W15C 4E0WA 1FRPA 4I3EA 1MQIA 4F2OA 4AS4A 4OVSA 1NI9A 3IJXB 3IL1B 2HXWA 4X8RA 3O6IA 3M3LA 2B3BA 3SESA 2BJJX 5J16A 1PDAA 2ONRA 3I3VA 4NX1A 3SEWA 1T0KA 1PBQA 1PEBA 3TTKA 3OO8A 4N6PA 2Y5KA 4ZEFA 1INPA 3H6TA 4FORA 2FBPA 2QRYA 5ET5A 4NEDA 2RC8A 4GXAA 4EQBA 3B6QA 5AE4A 5L9OA 3TZAA 4PFWA 3EHUA 4H46A 5FTHA 3SERA 5DEXA 5B70A 4QFNA 1LCTA 4N15A 2I4CA 3UORA 5CRYA 3VVEA 1O63A 2REJA 1ATGA 2F7BA 2P0SA 4DXUA 3KEIA 3T93B 5H8NB 2DSFA 2XD2A 4YB6A 3RPLB 2BJIA 1RKMA 4IO5A 5KZTA 3S9LC 5I56B 4U4SA 3S4UA 4YAHX 1DPEA 4IGRA 3HHGA 3MZ1A 3GYYA 1PB7A 4I40A 2QVRA 5KDTB 4KFQA 4MEVA 3I5OA 3MP1A 2GRVA 4H65A 2O51A 4DI3D 4G61A 3S9EA 1MY2A 2ZYOA 5I57B 2O84X 2XA5A 2HXRA 1B51A 1SW5A 3FJMA 3O29A 2XD3A 4TLLB 4XKQA 2VOZA 3RT6B 3SKPA 1H3DA 4OVRA 4OVJA 5FHOA 4KD5A 2HPGA 1IXHA 1NV1A 3OEMA 1N7XA 1B6HA 1H45A 3A29A 4PE3A 3CSBA 1MPBA 3Q26A 1JQFA 5EYGA 3N94A 1FJ6A 4Q30B 2E1SA 1NMUA 4FEDA 1BLFA 4PFTA 1USYH 1A8EA 5J1DA 4PETA 2ZNSA 4N81A 4JXIA 4QSDA 4FECA 2ANJA 3QIMA 3IB1A 3MVWA 4F3BA 1B3FA 3PPRA 3IORA 3K1NA 4F18A 3LBSA 1WVJA 5H8SA 4IO4A 4JBZA 1UIVA 2P2AA 3PMWA 3FTOA 3R26A 3C35A 4QXDA 2P3VA 3EKIA 1B52A 2HAUA 1MXVA 4XIGQ 3TFLA 3RNNA 1JW4A 4G68B 3U72A 4N07A 3JV9A 1MPDA 4I3YA 5ITOA 1LAGE 2H9BA 3ZSFA 3O66A 2V25A 3FATA 4NF0A 1B05A 4EXLA 4KYSA 2OWZA 5LOMA 1NNTA 1Q35A 2G29A 1FBGA 3DRJA 1FTOA 4L17A 5JEIA 4P8BA 1IITA 2G93A 2O1MA 3TEPA 4RK9A 1QVSA 1VSOA 2CEYA 5EHMA 1ZU0A 4BDRA 2MKZA 4E0XA 1EZOA 1FJ9A 1JNFA 1AWBA 4U22A 5F7VA 3CRBA 1WODA 1EYKA 1LBWA 4PF8A 3RLFE 3TAJA 3IO4A 4HCWA 3T1BA 5AA4B 2QS2A 1OIBA 2F35A 3FXUA 2Q9TA 3UK4A 4HS7A 1EH3A 5TPAA 1B5JA 1LAFE 4G8NA 2OWTA 1EU8A 2WYKA 2FVZA 1UTHB 4HE2A 3LVUA 2VHAA 3VXCA 3UIFA 2NOOA 2F7CA 2Y7KA 3C32A 1MXWA 3KZGA 3V83A 3IK6B 4RA1A 3RYBA 1XS5A 1QW0A 2FYIA 2ONKE 3ECRA 5L9MA 3PTYA 1N7WA 1D4NA 1JW5A 1FQFA 2FNCA 4IB2A 2OK2A 4H45A 5DYHA 3DLNA 4OVQA 1UQWA 3IAZA 4I1DA 4R2BA 4R6KA 5I59A 1HSJA 3DP6A 4GWWA 4F3SA 2ZZVA 3S9NC 2O69A 3G3FA 2RINA 4U4XA 4KI0E 2OCUA 4MNPA 3IB0A 4GBVA 2KQZA 2ZYKA 1MG1A 3QUJA 4DI4B 1ZLQA 2I3VA 4KYEA 4Q5TA 2P3NA 4FE8A 5I7IA 5EYFA 2Q89A 3FJGA 1S50A 2R8TA 1BIYA 3R6UA 4OENA 2HAVA 4ELPA 1M5BA 4QSCA 3EHTA 3IOVA 4MX6A 4MNIA 1GTKA 3WAFA 2I0CA 1I69A 3MZBA 3C31A 4PQJA 3H06B 4KCCA 4YKJA 4X1BA 4N13A 4PTKA 4RY1A 3D4GA 4M1VA 5DVFA 4YKKA 2DVCA 2F5XA 5JK4A 1S9TA 4OFLA 3TQLA 1FW0A 4OMBA 3RY3A 2ALUA 3QMFA 1EYJA 2I58A 4JDFA 1FPDA 5H8QB 3THIA 4RPNA 5I58B 4F31B 2WBDA 2XXVA 3GZGA 5IGAA 4N8YA 1D9VA 3RT8A 3PUZE 4EQ9A 2ZNTA 1PBPA 3FVNA 5A5LA 4EQ7A 3O2AA 3FVOA 3FXBA 1K9YA 1UTBA 4X48A 3G3JA 2UYEA 4DZ1A 4OEVA 2IA4A 2DQVA 1NUWA 2Q8MA 4NGUA 2QVUA 3MAMA 3BIHA 2XXQA 3SEUA 1N76A 3TMGA 4F3GA 5K2XA 5IAIA 5EQAA 5H8FB 4GIZA 1LFGA 1LAXA 1TT1A 4Z0IA 4NF6A 4QBAA 3T22A 3DRGA 4DCYA 4ELQA 1FBEA 3KFMA 1GR2A 5HM4B 1FBFA 3GLBA 4THIA 4MHFA 1ZMGA 4G8MA 3MP6A 4ZDMA 2VGQA 2GFEA 2WOLA 3H6VA 1MY1A 3O97A 1LGBC 2Y5LA 1LBBA 3QYTA 4NE4A 2QS1A 1IIWA 3TKDA 4NHBA 4MLVA 4OFOA 2OWSA 3PMXA 4ZECA 2ZYMA 4X1DA 1XVYA 2QSXA 3MVYA 3UA8A 4IO3A 4G4PA 1A99A 1MXYA 3PGFA 3N26A 1ZKBA 3I6VA 2W7YA 1B7HA 2CZHA 4DCXA 2RKMA 1H76A 3FXRA 5TP9B 1OVTA 4H8JA 3OSRA 3CFLA 2Z8EA 4NF8A 5KCJA 2VT5A 2FIXA 3O28A 4FJPA 1M5DA 3QUFA 4GXSB 4F1YA 4YKIA 4GWZA 4G77A 3FUZA 3H4ZA 4OANA 4XFEA 2NVUB 1XOCA 2XXKA 3T9VA 1HSEA 4FEBA 2O1LA 5IZ3B 2V93A 3KN8A 4ECFA 4OVTA 1XC1A 1R9LA 2WYPA 1IQ7A 2NXOA 2Z23A 1II5A 3UP9A 1MXUA 4ZZAA 3V89B 4GWSA 3K02A 1Y3NA 2YJPA 4GWUA 3BFUA 1RDZA 2DDKA 4KPTA 5I2KA 1NH8A 1ZBMA 3W9WA 1ELJA 4WKMA 1SBPA 1PB9A 4P11A 2CZIA 4FATA 1QUJA 2IEEA 1LBVA 2FIEA 3K6WA 4QF9A 4NAPA 2XXHA 4OYVA 3RGYA 4BDOA 4F22A 2DE4A 1SI0A 4MJOA 1LBZA 3OELA 5ET8A 5DW8A 4R9GA 2PFZA 4R74A 1Y4CA 2HQ0A 3SDFA 4OA4A 3IB2A 3F11A 3O6GA 5ICTA 1N04A 1MXZA 3PPPA 4EXKA 3PPNA 4PFUA 3OO6A 4LQ5A 3A3CA 4R73A 4ZS9A 4GL8A 2QPQA 4XKPA 1Q9DA 3LSLA 1MQHA 5LTCA 1QUKA 1Z7NE 1A55A 1GVCA 2XXTA 2PMSA 2HHMA 2REGA 4GD5A 3CR9A 5FBPA 4QFLA 3FVGA 2XXRA 4U21A 4ELOA 1NUZA 4YKPA 5ITPA 4NQ8A 5I3SA 2UVHA 1NH7A 3FASA 1IMFA 3IO6A 1YAEA 2VPNA 2F34A 3C36A 1DTZA 4PCDA 1XHYA 2Q2CA 3RPWA 3D4CA 2PX1A 1P1NA 1JVXA 4POXA 1LLSA 2AL5A 3MBPA 3DRHA 1R6ZA 1US4A 2ZYNA 3RUMA 4IR8A 2R6GE 4PFYA 1ZJLA 1FBHA 3TCHA 1FPEA 3VE1B 2GQ1A 4R2FA 3PV0E 4HE1A 3RTWB 2CMOA 1URDA 4NTLA 3A09A 3PUXE 5I2NB 2PT1A 2VD2A 3FD3A 5CI5A 4N4UA 2F36A 3OSQA 3TUSA 3OENA 3ROJA 3MWBA 2O7UA 2UVGA 4O94A 1MRPA 2R9JA 1Y3QA 4ELRA 2RF1A 4EF1A 2E0SA 2VPOA 3OOAA 2H25A 2QVVA 3U8QA 2F6PA 1SVXB 3GBBA 4RPOA 2F8DA 1UIUA 2V3UA 1RDYA 3K0VA 4ESWA
chains in the Genus database with same CATH topology
4ISUA 1TFAA 3K2DA 4Q0CA 4OESA 3T66A 3PUWE 1MQDA 4F1UA 2O7IA 2XXPA 5H8HB 2XX7A 3PD9A 2PT2A 2I3WA 2D3IA 2I4BA 1OLAA 2DWAA 3Q28A 3G3GA 3GXAA 1I6BA 1HSLA 2DE2A 4NMYA 1SI1A 2NWJA 3USDA 1QKAA 4GFRA 1TXFA 5DVIA 4NF4B 4GF8A 1JW1A 3PMVA 2Z8FA 4QRZA 1M5FA 3G3IA 1OLCA 3Q29A 1XVXA 4NF5A 5AA2A 4IY6A 4YB5A 3KGCA 2F7AA 4F39A 3EHSA 1EZ9A 4U1ZA 1O64A 2XXIA 3GBAA 3VV5A 1ANFA 1FTLA 2QJEA 3ZKKA 2DWJA 4I9DA 1LSTA 3M3KA 3MPKA 1IXIA 1Y20A 4OQOA 5BWJA 4IO7A 4MF3A 3B6TA 4H6DA 2WOKA 5CMKA 1LFHA 3CHGA 2FA7A 3CG3A 5CMMA 4QFOA 2RC9A 2ZXTA 3CFZA 4OEUA 5AA1A 4KYDA 2THIA 1DMBA 1EZPA 3TQWA 1B1XA 1A8FA 5K2YA 4YB7A 4R6YA 3IOUA 5DEXB 3SEVA 3ZS6A 5F1QA 3OD7A 1LCFA 2D5WA 2A5SA 3LSWA 1N3WA 1F9BA 4LZ7A 2B4LA 3O6PA 4ZEBA 4RXLA 3OMBA 3VVDA 2DS9A 2M8CA 4R75A 2ZNUA 1VFEA 3DRKA 4OHNA 2OJTA 4KQPA 1Y1MA 3K6VA 4UACA 2QS3A 2UYFA 4ONYA 3H03A 1QUIA 5H8NA 4WXJA 4JSOA 4TQUQ 1B4HA 2GHBA 3KSJA 2HFBA 4OZ9A 4XKNA 2V84A 4IO6A 5I56A 1M5CA 1AH5A 3ODBA 5KDTA 1PB8A 4EDPA 1B5HA 2X7PA 1R9QA 4MBPA 3M8UA 3DELB 4O3AA 5FHNA 3K1PA 1J1NA 1DTGA 3IOWA 4QFKA 2AYSA 1RYOA 5I57A 2F78A 4G8HA 3T9UA 1A7LA 1RYXA 5HPQA 5AA2D 1B1HA 1LFIA 3LR1A 2RC7A 3KG2A 4NWCA 4U1OA 1B0LA 1QKBA 1B32A 3KN7A 3MJNA 5L8DA 3VDFA 3MC2A 3VXBA 4JWOA 1SW4A 2A5TA 3DM0A 2DP8A 1M5EA 4NWDA 1R1NA 2VP1A 4TLMB 2YPNA 1SQYA 4JWYA 1B3EA 1OQHA 2XXYA 4YZZA 1TFDA 4BDMA 2UVJA 4C1TA 4JSDA 4G68C 4EUOA 4ESXA 4G68A 1P1WA 1MH3A 5CC2A 2D21A 3LC8A 4LATA 2AL4A 1DOTA 1BTJA 5ELVA 5JTYA 4RNSA 3IX1A 4R72A 3TPAA 2WKYA 4AB6A 4GLIA 3VLWA 2QMXA 3K4UA 2HZLA 4DDDA 1SYHA 3CSGA 2ZMBA 1OMPA 3CI8A 4UA8A 5B7DA 3HSTA 1B3HA 3JYRA 1OQGA 3EPEA 3RTFB 4PP0A 1CE2A 5DVJA 4HCYA 3CFXA 2HEUA 3C9HA 5AA4A 5TPAB 2DOJA 4C0RA 2DE3A 4TOZA 2KLFA 2H99A 3V8XB 1MY3A 2X7QA 2XX8A 1D9YA 4IO2A 3JZJA 1POTA 1JETA 3E4RA 3ILTB 1MM6A 1UTHA 1MM7A 1IXGA 3WAEA 3T9XB 1VFDA 4F2QA 3KJ7A 3TCFA 3E9XA 3H7MA 4GQOA 2Y7WA 2ONSA 1B3LA 2PYYA 5A5XA 3DP4A 3R7XA 1FCKA 3N5LA 1A40A 3EF7A 4ZEIA 4OERA 5FHMA 2H4IA 5CBSA 5I59B 1USYE 4FIMA 1SW2A 1YPNA 4ZE8A 3P7IA 4I62A 3C4MA 4GWOA 4EF2A 3C34A 3FVKA 1IUDA 1SDXA 1FTMA 2ESNA 1P1QA 2XX9A 3OEKA 2DVZA 4RJZA 3U94A 5DTBA 1LB8A 1N3XA 3VVFA 1P99A 4QSEA 5AA3A 1LAHE 5ICQA 1B40A 4MH5A 1JEVA 3UN6A 4ZE9A 2VD3A 1KWHA 2XXUA 3U92A 2YLNA 1NFTA 1NNKA 1P1UA 5CMCA 1B2HA 1L5TA 3FXQA 4AB5A 3MZ9A 3DRFA 4XXUA 3CIJA 3DRIA 2I48A 3G3KA 2WOPA 5M2VA 1GV8A 3PPQA 4F29A 2PBWA 3KOSA 1IXCA 4ZEDA 3MQ9A 3QK6A 1SW1A 4WEDA 1OVBA 3PD8A 3E3KA 2PVUA 4OETA 4LONB 2V3TA 3MPLA 3S2VA 3EN3A 2DXRA 1FQBA 4POWA 3RQTA 3KOTA 5CM6A 1XT8A 4ZZEA 4Q8RA 5H8QA 3C33A 4H67A 4LA9A 5I58A 5CMBA 1URGA 1UTBB 2QMWA 4YU0A 3RYAA 4IGTA 4F1VA 1BP5A 1FQEA 4XKRA 3UGWA 3HO7A 3QXMA 3TDJA 3B6WA 4BDQA 3AXFA 4BDNA 1URSA 1Z7ME 1PC3A 4GL0A 3K6UA 4NF6B 1IZ1A 2RCAA 3CG1A 1MQJA 3L6HA 3OO7A 5FTIA 2B3FA 2A5TB 4YMAA 4R9FA 3IR1A 1QJMA 4P0GA 4YICA 5H8FA 3H6UA 1MXXA 3K01A 1QULA 3T96B 3MW0A 4PE5B 3H6WA 2Z22A 4XTCQ 4ND9A 2RCBA 2Z8DA 5HBCA 2V3QA 3CVGA 5TU0A 3A3UA 4DE8A 5JTYB 1D3KA 1Q1KA 1AL3A 1B7ZA 1VE4A 4AQ4A 3IOTA 1ZTYA 3BKIB 1N84A 1MDP1 4RK2A 1BKAA 4H0WA 1B58A 4I8CA 3ZKLA 4H5GA 4JB7A 4HW8A 3KN3A 4NF8B 1IEJA 5KCJB 3DP8A 1B7UA 5TP9A 3QSLA 3H3GA 2R71A 1N0TA 2LAOA 3OXNA 2OLBA 4OTEA 2GHAA 2HCAA 1JEUA 4HTGA 2Y84A 4QHQA 1SYIA 3FZVA 2OBGA 3HN0A 1AOVA 3TYHA 1H43A 1B4ZA 1P1OA 2UVIA 3SEXA 3PU5A 3SETA 3PUVE 4JWXA 1B5IA 4GRKA 2I6EA 3TCGA 5A5XB 2XHDA 5I2KB 3KJTA 1GGGA 3VFJA 4ZEKA 2F97A 4F3PA 4F19A 4MLQA 1FQDA 4OXVA 3K6XA 4X9TA 1NNPA 3QAXA 4BLAA 1YTVA 3IJOB 1I6QA 2Y7PA 5L9SA 2HZKA 3G7WA 1FQAA 1LBCA 3LUYA 2O6AA 2B65A 3HHFA 3PUYE 1H44A 4RYAA 3MVXA 3HV1A 3ILUB 4LQ2A 1AIVA 4U23A 3L6GA 4O3BA 2O68A 1JVYA 4GVOA 4DXBA 3RN8A 2B4MA 3TODA 3TTRA 3K00A 4G2ZA 2UXAA 3TTLA 3EQ1A 3HCQA 4BDLA 4K3FA 1DSNA 2Q2AA 5CBRA 4H5FA 3VLUA 2XXXA 4LZ8A 2I49A 2QL3A 3MP8A 1Y4TA 2Q8JA 2AIXA 5BUUA 4P0IA 1MDQA 3MVZA 3FV1A 5IKBA 2H5YA 1ZIUA 2H98A 3M3FA 1S7YA 2P1SA 4IY5A 3BBRA 1NL5A 4O3CA 1B3GA 4GOTA 2NUVA 1Y9UA 3N6UA 1FTKA 1O7TA 1TWYA 1FQCA 4OWDA 1LB9A 3N6TA 2Y7IA 2I0BA 5I2NA 3O9PA 1A54A 4DXCA 1B0HA 3V5AA 2X26A 1YCJA 3HPIA 4LZ5A 3TTMA 2DYXA 3O6HA 2OZZA 3E13X 3KSXA 3ONMA 3T9HB 3SEYA 3FJ7A 4DLDA 3FIRA 1MS7A 4DIGA 2Y7RA 3Q25A 1POY1 1NKXA 1NNFA 4M4GA 4FAJA 1DPPA 1WDNA 3TTNA 4Z7EA 4H8IA 1FTJA 2GH9A 1CB6A 4C1UA 1MY0A 3PAMA 4KR5A 3Q27A 3S9MC 2XXWA 3VLVA 4KHZE 3W9VA 4YMBA 1AMFA 3LSFB 4LP2B 2DWIA 1VR5A 5EHSA 2F6GA 2DWHA 3MUQA 1Y3PA 2CZLA 2ABHA 5H8HA 4H1XA 3G3HA 1B46A 4OFJA 3KBRA 1US5A 3U1OA 4LVQA 1I6AA 5I84A 1MQGA 1MPCA 3FV2A 2DXYA 3TELA 3PPOA 4NF4A 1B9JA 4NF5B 3LSXA 5AA2B 3BFTA 2Q88A 1MY4A 3OO9A 3FGSA 4LUBA 2QS4A 3B7DA 4KCDA 4U2RA 1MH4A 5DT6A 4MFIA 4R6HA 1Y1ZA 4WEPA 5ISUA 3K1MA 1SD3A 3U93A 4QFPA 3W15C 4E0WA 1MQIA 4F2OA 3IJXB 3IL1B 2HXWA 3O6IA 3M3LA 2B3BA 3SESA 2BJJX 1PDAA 2ONRA 3I3VA 3SEWA 1T0KA 1PBQA 1PEBA 3TTKA 3OO8A 4N6PA 4ZEFA 3H6TA 4FORA 2QRYA 4NEDA 2RC8A 4GXAA 4EQBA 3B6QA 5AE4A 5L9OA 3TZAA 4PFWA 3EHUA 5FTHA 3SERA 5DEXA 5B70A 4QFNA 1LCTA 2I4CA 3UORA 5CRYA 3VVEA 1O63A 2REJA 1ATGA 2F7BA 2P0SA 4DXUA 3KEIA 3T93B 5H8NB 2DSFA 2XD2A 4YB6A 1RKMA 4IO5A 5KZTA 3S9LC 5I56B 4U4SA 3S4UA 4YAHX 1DPEA 4IGRA 3HHGA 3MZ1A 1PB7A 5KDTB 4KFQA 3I5OA 3MP1A 2GRVA 4H65A 2O51A 3S9EA 1MY2A 2ZYOA 5I57B 2O84X 1B51A 1SW5A 3FJMA 3O29A 2XD3A 4TLLB 4XKQA 2VOZA 3RT6B 3SKPA 1H3DA 4OVJA 5FHOA 4KD5A 1IXHA 3OEMA 1N7XA 1B6HA 1H45A 3CSBA 1MPBA 3Q26A 1JQFA 3N94A 4Q30B 2E1SA 1NMUA 4FEDA 1BLFA 4PFTA 1USYH 1A8EA 5J1DA 4PETA 2ZNSA 4JXIA 4QSDA 4FECA 2ANJA 3QIMA 3IB1A 3MVWA 4F3BA 1B3FA 3PPRA 3IORA 3K1NA 4F18A 3LBSA 1WVJA 5H8SA 4IO4A 4JBZA 1UIVA 2P2AA 3PMWA 3FTOA 3R26A 3C35A 1B52A 2HAUA 1MXVA 4XIGQ 3TFLA 3RNNA 1JW4A 4G68B 3U72A 4N07A 3JV9A 1MPDA 5ITOA 1LAGE 2H9BA 3ZSFA 3O66A 2V25A 3FATA 4EXLA 1B05A 4KYSA 5LOMA 1NNTA 1Q35A 2G29A 3DRJA 1FTOA 4L17A 5JEIA 1IITA 2G93A 2O1MA 3TEPA 4RK9A 1QVSA 1VSOA 5EHMA 4BDRA 1ZU0A 4E0XA 1EZOA 1JNFA 4U22A 5F7VA 3CRBA 1WODA 3RLFE 3TAJA 3IO4A 4HCWA 5AA4B 2QS2A 1OIBA 2F35A 3FXUA 2Q9TA 3UK4A 4HS7A 1EH3A 5TPAA 1B5JA 1LAFE 4G8NA 2OWTA 1EU8A 1UTHB 3LVUA 2VHAA 3VXCA 3UIFA 2NOOA 2F7CA 2Y7KA 3C32A 1MXWA 3KZGA 3V83A 3IK6B 4RA1A 3RYBA 1XS5A 1QW0A 2FYIA 2ONKE 3ECRA 5L9MA 1N7WA 1D4NA 1JW5A 1FQFA 2FNCA 4IB2A 2OK2A 5DYHA 3DLNA 1UQWA 3IAZA 4I1DA 4R2BA 4R6KA 5I59A 1HSJA 3DP6A 4F3SA 3S9NC 2O69A 3G3FA 2RINA 4U4XA 4KI0E 2OCUA 3IB0A 2ZYKA 1MG1A 3QUJA 1ZLQA 2I3VA 4KYEA 4Q5TA 4FE8A 5EYFA 2Q89A 3FJGA 1S50A 1BIYA 3R6UA 4OENA 2HAVA 4ELPA 1M5BA 4QSCA 3EHTA 3IOVA 1GTKA 3WAFA 2I0CA 1I69A 3MZBA 3C31A 4PQJA 3H06B 4KCCA 4YKJA 4X1BA 4N13A 4RY1A 3D4GA 4M1VA 5DVFA 4YKKA 2DVCA 2F5XA 5JK4A 1S9TA 4OFLA 3TQLA 1FW0A 4OMBA 3RY3A 2ALUA 2I58A 4JDFA 5H8QB 3THIA 4RPNA 5I58B 4F31B 2XXVA 3GZGA 1D9VA 3RT8A 3PUZE 4EQ9A 2ZNTA 1PBPA 3FVNA 4EQ7A 3O2AA 3FVOA 1UTBA 4X48A 3G3JA 2UYEA 4DZ1A 4OEVA 2IA4A 2DQVA 3MAMA 2XXQA 3SEUA 1N76A 3TMGA 4F3GA 5K2XA 5IAIA 5H8FB 4GIZA 1LFGA 1LAXA 1TT1A 4Z0IA 4NF6A 3T22A 3DRGA 4DCYA 4ELQA 3KFMA 1GR2A 5HM4B 3GLBA 4THIA 1ZMGA 4G8MA 3MP6A 4ZDMA 2VGQA 2GFEA 2WOLA 3H6VA 1MY1A 3O97A 1LGBC 1LBBA 3QYTA 4NE4A 2QS1A 1IIWA 3TKDA 4MLVA 4OFOA 2OWSA 3PMXA 4ZECA 2ZYMA 4X1DA 1XVYA 2QSXA 3MVYA 3UA8A 4IO3A 4G4PA 1A99A 1MXYA 3PGFA 3N26A 1ZKBA 3I6VA 2W7YA 1B7HA 4DCXA 2RKMA 1H76A 3FXRA 5TP9B 1OVTA 4H8JA 3OSRA 3CFLA 2Z8EA 4NF8A 5KCJA 3O28A 4FJPA 1M5DA 3QUFA 4GXSB 4F1YA 4YKIA 4G77A 3FUZA 3H4ZA 2NVUB 1XOCA 3T9VA 1HSEA 4FEBA 2O1LA 2V93A 3KN8A 4ECFA 1XC1A 1R9LA 1IQ7A 2NXOA 2Z23A 1II5A 3UP9A 1MXUA 4ZZAA 3V89B 3K02A 1Y3NA 2YJPA 3BFUA 4KPTA 5I2KA 1NH8A 1ZBMA 3W9WA 1ELJA 4WKMA 1SBPA 1PB9A 4P11A 4FATA 1QUJA 2IEEA 4QF9A 3K6WA 2XXHA 4OYVA 3RGYA 4BDOA 4F22A 2DE4A 1SI0A 3OELA 4R9GA 4R74A 1Y4CA 2HQ0A 3SDFA 3IB2A 3F11A 3O6GA 5ICTA 1N04A 1MXZA 3PPPA 4EXKA 3PPNA 4PFUA 3OO6A 4LQ5A 3A3CA 4R73A 4ZS9A 4GL8A 2QPQA 4XKPA 3LSLA 1MQHA 1QUKA 1Z7NE 1A55A 1GVCA 2XXTA 2PMSA 2REGA 4GD5A 3CR9A 4QFLA 3FVGA 2XXRA 4U21A 4ELOA 4YKPA 5ITPA 2UVHA 1NH7A 3FASA 3IO6A 1YAEA 2F34A 3C36A 1DTZA 1XHYA 2Q2CA 3RPWA 3D4CA 2PX1A 1P1NA 1JVXA 4POXA 1LLSA 2AL5A 3MBPA 3DRHA 1R6ZA 1US4A 2ZYNA 3RUMA 2R6GE 4PFYA 1ZJLA 3TCHA 3VE1B 4R2FA 3PV0E 3RTWB 2CMOA 1URDA 4NTLA 3A09A 3PUXE 5I2NB 2PT1A 2VD2A 3FD3A 5CI5A 2F36A 3OSQA 3TUSA 3OENA 3MWBA 2O7UA 2UVGA 1MRPA 2R9JA 1Y3QA 4ELRA 2RF1A 4EF1A 2E0SA 3OOAA 2H25A 3U8QA 2F6PA 1SVXB 3GBBA 4RPOA 2F8DA 1UIUA 2V3UA 3K0VA 4ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISU A;  1TFA A;  3K2D A;  4Q0C A;  4OES A;  3T66 A;  3PUW E;  1MQD A;  4F1U A;  2O7I A;  2XXP A;  5H8H B;  2XX7 A;  3PD9 A;  2PT2 A;  2I3W A;  2D3I A;  2I4B A;  1OLA A;  2DWA A;  3Q28 A;  3G3G A;  3GXA A;  1I6B A;  1HSL A;  2DE2 A;  4NMY A;  1SI1 A;  2NWJ A;  3USD A;  1QKA A;  4GFR A;  1TXF A;  5DVI A;  4NF4 B;  4GF8 A;  1JW1 A;  3PMV A;  2Z8F A;  4QRZ A;  1M5F A;  3G3I A;  1OLC A;  3Q29 A;  1XVX A;  4NF5 A;  5AA2 A;  4IY6 A;  4YB5 A;  3KGC A;  2F7A A;  4F39 A;  3EHS A;  1EZ9 A;  4U1Z A;  1O64 A;  2XXI A;  3GBA A;  3VV5 A;  1ANF A;  1FTL A;  2QJE A;  3ZKK A;  2DWJ A;  4I9D A;  1LST A;  3M3K A;  3MPK A;  1IXI A;  1Y20 A;  4OQO A;  5BWJ A;  4IO7 A;  4MF3 A;  3B6T A;  4H6D A;  2WOK A;  5CMK A;  1LFH A;  3CHG A;  2FA7 A;  3CG3 A;  5CMM A;  4QFO A;  2RC9 A;  2ZXT A;  3CFZ A;  4OEU A;  5AA1 A;  4KYD A;  2THI A;  1DMB A;  1EZP A;  3TQW A;  1B1X A;  1A8F A;  5K2Y A;  4YB7 A;  4R6Y A;  3IOU A;  5DEX B;  3SEV A;  3ZS6 A;  5F1Q A;  3OD7 A;  1LCF A;  2D5W A;  2A5S A;  3LSW A;  1N3W A;  1F9B A;  4LZ7 A;  2B4L A;  3O6P A;  4ZEB A;  4RXL A;  3OMB A;  3VVD A;  2DS9 A;  2M8C A;  4R75 A;  2ZNU A;  1VFE A;  3DRK A;  4OHN A;  2OJT A;  4KQP A;  1Y1M A;  3K6V A;  4UAC A;  2QS3 A;  2UYF A;  4ONY A;  3H03 A;  1QUI A;  5H8N A;  4WXJ A;  4JSO A;  4TQU Q;  1B4H A;  2GHB A;  3KSJ A;  2HFB A;  4OZ9 A;  4XKN A;  2V84 A;  4IO6 A;  5I56 A;  1M5C A;  1AH5 A;  3ODB A;  5KDT A;  1PB8 A;  4EDP A;  1B5H A;  2X7P A;  1R9Q A;  4MBP A;  3M8U A;  3DEL B;  4O3A A;  5FHN A;  3K1P A;  1J1N A;  1DTG A;  3IOW A;  4QFK A;  2AYS A;  1RYO A;  5I57 A;  2F78 A;  4G8H A;  3T9U A;  1A7L A;  1RYX A;  5HPQ A;  5AA2 D;  1B1H A;  1LFI A;  3LR1 A;  2RC7 A;  3KG2 A;  4NWC A;  4U1O A;  1B0L A;  1QKB A;  1B32 A;  3KN7 A;  3MJN A;  5L8D A;  3VDF A;  3MC2 A;  3VXB A;  4JWO A;  1SW4 A;  2A5T A;  3DM0 A;  2DP8 A;  1M5E A;  4NWD A;  1R1N A;  2VP1 A;  4TLM B;  2YPN A;  1SQY A;  4JWY A;  1B3E A;  1OQH A;  2XXY A;  4YZZ A;  1TFD A;  4BDM A;  2UVJ A;  4C1T A;  4JSD A;  4G68 C;  4EUO A;  4ESX A;  4G68 A;  1P1W A;  1MH3 A;  5CC2 A;  2D21 A;  3LC8 A;  4LAT A;  2AL4 A;  1DOT A;  1BTJ A;  5ELV A;  5JTY A;  4RNS A;  3IX1 A;  4R72 A;  3TPA A;  2WKY A;  4AB6 A;  4GLI A;  3VLW A;  2QMX A;  3K4U A;  2HZL A;  4DDD A;  1SYH A;  3CSG A;  2ZMB A;  1OMP A;  3CI8 A;  4UA8 A;  5B7D A;  3HST A;  1B3H A;  3JYR A;  1OQG A;  3EPE A;  3RTF B;  4PP0 A;  1CE2 A;  5DVJ A;  4HCY A;  3CFX A;  2HEU A;  3C9H A;  5AA4 A;  5TPA B;  2DOJ A;  4C0R A;  2DE3 A;  4TOZ A;  2KLF A;  2H99 A;  3V8X B;  1MY3 A;  2X7Q A;  2XX8 A;  1D9Y A;  4IO2 A;  3JZJ A;  1POT A;  1JET A;  3E4R A;  3ILT B;  1MM6 A;  1UTH A;  1MM7 A;  1IXG A;  3WAE A;  3T9X B;  1VFD A;  4F2Q A;  3KJ7 A;  3TCF A;  3E9X A;  3H7M A;  4GQO A;  2Y7W A;  2ONS A;  1B3L A;  2PYY A;  5A5X A;  3DP4 A;  3R7X A;  1FCK A;  3N5L A;  1A40 A;  3EF7 A;  4ZEI A;  4OER A;  5FHM A;  2H4I A;  5CBS A;  5I59 B;  1USY E;  4FIM A;  1SW2 A;  1YPN A;  4ZE8 A;  3P7I A;  4I62 A;  3C4M A;  4GWO A;  4EF2 A;  3C34 A;  3FVK A;  1IUD A;  1SDX A;  1FTM A;  2ESN A;  1P1Q A;  2XX9 A;  3OEK A;  2DVZ A;  4RJZ A;  3U94 A;  5DTB A;  1LB8 A;  1N3X A;  3VVF A;  1P99 A;  4QSE A;  5AA3 A;  1LAH E;  5ICQ A;  1B40 A;  4MH5 A;  1JEV A;  3UN6 A;  4ZE9 A;  2VD3 A;  1KWH A;  2XXU A;  3U92 A;  2YLN A;  1NFT A;  1NNK A;  1P1U A;  5CMC A;  1B2H A;  1L5T A;  3FXQ A;  4AB5 A;  3MZ9 A;  3DRF A;  4XXU A;  3CIJ A;  3DRI A;  2I48 A;  3G3K A;  2WOP A;  5M2V A;  1GV8 A;  3PPQ A;  4F29 A;  2PBW A;  3KOS A;  1IXC A;  4ZED A;  3MQ9 A;  3QK6 A;  1SW1 A;  4WED A;  1OVB A;  3PD8 A;  3E3K A;  2PVU A;  4OET A;  4LON B;  2V3T A;  3MPL A;  3S2V A;  3EN3 A;  2DXR A;  1FQB A;  4POW A;  3RQT A;  3KOT A;  5CM6 A;  1XT8 A;  4ZZE A;  4Q8R A;  5H8Q A;  3C33 A;  4H67 A;  4LA9 A;  5I58 A;  5CMB A;  1URG A;  1UTB B;  2QMW A;  4YU0 A;  3RYA A;  4IGT A;  4F1V A;  1BP5 A;  1FQE A;  4XKR A;  3UGW A;  3HO7 A;  3QXM A;  3TDJ A;  3B6W A;  4BDQ A;  3AXF A;  4BDN A;  1URS A;  1Z7M E;  1PC3 A;  4GL0 A;  3K6U A;  4NF6 B;  1IZ1 A;  2RCA A;  3CG1 A;  1MQJ A;  3L6H A;  3OO7 A;  5FTI A;  2B3F A;  2A5T B;  4YMA A;  4R9F A;  3IR1 A;  1QJM A;  4P0G A;  4YIC A;  5H8F A;  3H6U A;  1MXX A;  3K01 A;  1QUL A;  3T96 B;  3MW0 A;  4PE5 B;  3H6W A;  2Z22 A;  4XTC Q;  4ND9 A;  2RCB A;  2Z8D A;  5HBC A;  2V3Q A;  3CVG A;  5TU0 A;  3A3U A;  4DE8 A;  5JTY B;  1D3K A;  1Q1K A;  1AL3 A;  1B7Z A;  1VE4 A;  4AQ4 A;  3IOT A;  1ZTY A;  3BKI B;  1N84 A;  1MDP 1;  4RK2 A;  1BKA A;  4H0W A;  1B58 A;  4I8C A;  3ZKL A;  4H5G A;  4JB7 A;  4HW8 A;  3KN3 A;  4NF8 B;  1IEJ A;  5KCJ B;  3DP8 A;  1B7U A;  5TP9 A;  3QSL A;  3H3G A;  2R71 A;  1N0T A;  2LAO A;  3OXN A;  2OLB A;  4OTE A;  2GHA A;  2HCA A;  1JEU A;  4HTG A;  2Y84 A;  4QHQ A;  1SYI A;  3FZV A;  2OBG A;  3HN0 A;  1AOV A;  3TYH A;  1H43 A;  1B4Z A;  1P1O A;  2UVI A;  3SEX A;  3PU5 A;  3SET A;  3PUV E;  4JWX A;  1B5I A;  4GRK A;  2I6E A;  3TCG A;  5A5X B;  2XHD A;  5I2K B;  3KJT A;  1GGG A;  3VFJ A;  4ZEK A;  2F97 A;  4F3P A;  4F19 A;  4MLQ A;  1FQD A;  4OXV A;  3K6X A;  4X9T A;  1NNP A;  3QAX A;  4BLA A;  1YTV A;  3IJO B;  1I6Q A;  2Y7P A;  5L9S A;  2HZK A;  3G7W A;  1FQA A;  1LBC A;  3LUY A;  2O6A A;  2B65 A;  3HHF A;  3PUY E;  1H44 A;  4RYA A;  3MVX A;  3HV1 A;  3ILU B;  4LQ2 A;  1AIV A;  4U23 A;  3L6G A;  4O3B A;  2O68 A;  1JVY A;  4GVO A;  4DXB A;  3RN8 A;  2B4M A;  3TOD A;  3TTR A;  3K00 A;  4G2Z A;  2UXA A;  3TTL A;  3EQ1 A;  3HCQ A;  4BDL A;  4K3F A;  1DSN A;  2Q2A A;  5CBR A;  4H5F A;  3VLU A;  2XXX A;  4LZ8 A;  2I49 A;  2QL3 A;  3MP8 A;  1Y4T A;  2Q8J A;  2AIX A;  5BUU A;  4P0I A;  1MDQ A;  3MVZ A;  3FV1 A;  5IKB A;  2H5Y A;  1ZIU A;  2H98 A;  3M3F A;  1S7Y A;  2P1S A;  4IY5 A;  3BBR A;  1NL5 A;  4O3C A;  1B3G A;  4GOT A;  2NUV A;  1Y9U A;  3N6U A;  1FTK A;  1O7T A;  1TWY A;  1FQC A;  4OWD A;  1LB9 A;  3N6T A;  2Y7I A;  2I0B A;  5I2N A;  3O9P A;  1A54 A;  4DXC A;  1B0H A;  3V5A A;  2X26 A;  1YCJ A;  3HPI A;  4LZ5 A;  3TTM A;  2DYX A;  3O6H A;  2OZZ A;  3E13 X;  3KSX A;  3ONM A;  3T9H B;  3SEY A;  3FJ7 A;  4DLD A;  3FIR A;  1MS7 A;  4DIG A;  2Y7R A;  3Q25 A;  1POY 1;  1NKX A;  1NNF A;  4M4G A;  4FAJ A;  1DPP A;  1WDN A;  3TTN A;  4Z7E A;  4H8I A;  1FTJ A;  2GH9 A;  1CB6 A;  4C1U A;  1MY0 A;  3PAM A;  4KR5 A;  3Q27 A;  3S9M C;  2XXW A;  3VLV A;  4KHZ E;  3W9V A;  4YMB A;  1AMF A;  3LSF B;  4LP2 B;  2DWI A;  1VR5 A;  5EHS A;  2F6G A;  2DWH A;  3MUQ A;  1Y3P A;  2CZL A;  2ABH A;  5H8H A;  4H1X A;  3G3H A;  1B46 A;  4OFJ A;  3KBR A;  1US5 A;  3U1O A;  4LVQ A;  1I6A A;  5I84 A;  1MQG A;  1MPC A;  3FV2 A;  2DXY A;  3TEL A;  3PPO A;  4NF4 A;  1B9J A;  4NF5 B;  3LSX A;  5AA2 B;  3BFT A;  2Q88 A;  1MY4 A;  3OO9 A;  3FGS A;  4LUB A;  2QS4 A;  3B7D A;  4KCD A;  4U2R A;  1MH4 A;  5DT6 A;  4MFI A;  4R6H A;  1Y1Z A;  4WEP A;  5ISU A;  3K1M A;  1SD3 A;  3U93 A;  4QFP A;  3W15 C;  4E0W A;  1MQI A;  4F2O A;  3IJX B;  3IL1 B;  2HXW A;  3O6I A;  3M3L A;  2B3B A;  3SES A;  2BJJ X;  1PDA A;  2ONR A;  3I3V A;  3SEW A;  1T0K A;  1PBQ A;  1PEB A;  3TTK A;  3OO8 A;  4N6P A;  4ZEF A;  3H6T A;  4FOR A;  2QRY A;  4NED A;  2RC8 A;  4GXA A;  4EQB A;  3B6Q A;  5AE4 A;  5L9O A;  3TZA A;  4PFW A;  3EHU A;  5FTH A;  3SER A;  5DEX A;  5B70 A;  4QFN A;  1LCT A;  2I4C A;  3UOR A;  5CRY A;  3VVE A;  1O63 A;  2REJ A;  1ATG A;  2F7B A;  2P0S A;  4DXU A;  3KEI A;  3T93 B;  5H8N B;  2DSF A;  2XD2 A;  4YB6 A;  1RKM A;  4IO5 A;  5KZT A;  3S9L C;  5I56 B;  4U4S A;  3S4U A;  4YAH X;  1DPE A;  4IGR A;  3HHG A;  3MZ1 A;  1PB7 A;  5KDT B;  4KFQ A;  3I5O A;  3MP1 A;  2GRV A;  4H65 A;  2O51 A;  3S9E A;  1MY2 A;  2ZYO A;  5I57 B;  2O84 X;  1B51 A;  1SW5 A;  3FJM A;  3O29 A;  2XD3 A;  4TLL B;  4XKQ A;  2VOZ A;  3RT6 B;  3SKP A;  1H3D A;  4OVJ A;  5FHO A;  4KD5 A;  1IXH A;  3OEM A;  1N7X A;  1B6H A;  1H45 A;  3CSB A;  1MPB A;  3Q26 A;  1JQF A;  3N94 A;  4Q30 B;  2E1S A;  1NMU A;  4FED A;  1BLF A;  4PFT A;  1USY H;  1A8E A;  5J1D A;  4PET A;  2ZNS A;  4JXI A;  4QSD A;  4FEC A;  2ANJ A;  3QIM A;  3IB1 A;  3MVW A;  4F3B A;  1B3F A;  3PPR A;  3IOR A;  3K1N A;  4F18 A;  3LBS A;  1WVJ A;  5H8S A;  4IO4 A;  4JBZ A;  1UIV A;  2P2A A;  3PMW A;  3FTO A;  3R26 A;  3C35 A;  1B52 A;  2HAU A;  1MXV A;  4XIG Q;  3TFL A;  3RNN A;  1JW4 A;  4G68 B;  3U72 A;  4N07 A;  3JV9 A;  1MPD A;  5ITO A;  1LAG E;  2H9B A;  3ZSF A;  3O66 A;  2V25 A;  3FAT A;  4EXL A;  1B05 A;  4KYS A;  5LOM A;  1NNT A;  1Q35 A;  2G29 A;  3DRJ A;  1FTO A;  4L17 A;  5JEI A;  1IIT A;  2G93 A;  2O1M A;  3TEP A;  4RK9 A;  1QVS A;  1VSO A;  5EHM A;  4BDR A;  1ZU0 A;  4E0X A;  1EZO A;  1JNF A;  4U22 A;  5F7V A;  3CRB A;  1WOD A;  3RLF E;  3TAJ A;  3IO4 A;  4HCW A;  5AA4 B;  2QS2 A;  1OIB A;  2F35 A;  3FXU A;  2Q9T A;  3UK4 A;  4HS7 A;  1EH3 A;  5TPA A;  1B5J A;  1LAF E;  4G8N A;  2OWT A;  1EU8 A;  1UTH B;  3LVU A;  2VHA A;  3VXC A;  3UIF A;  2NOO A;  2F7C A;  2Y7K A;  3C32 A;  1MXW A;  3KZG A;  3V83 A;  3IK6 B;  4RA1 A;  3RYB A;  1XS5 A;  1QW0 A;  2FYI A;  2ONK E;  3ECR A;  5L9M A;  1N7W A;  1D4N A;  1JW5 A;  1FQF A;  2FNC A;  4IB2 A;  2OK2 A;  5DYH A;  3DLN A;  1UQW A;  3IAZ A;  4I1D A;  4R2B A;  4R6K A;  5I59 A;  1HSJ A;  3DP6 A;  4F3S A;  3S9N C;  2O69 A;  3G3F A;  2RIN A;  4U4X A;  4KI0 E;  2OCU A;  3IB0 A;  2ZYK A;  1MG1 A;  3QUJ A;  1ZLQ A;  2I3V A;  4KYE A;  4Q5T A;  4FE8 A;  5EYF A;  2Q89 A;  3FJG A;  1S50 A;  1BIY A;  3R6U A;  4OEN A;  2HAV A;  4ELP A;  1M5B A;  4QSC A;  3EHT A;  3IOV A;  1GTK A;  3WAF A;  2I0C A;  1I69 A;  3MZB A;  3C31 A;  4PQJ A;  3H06 B;  4KCC A;  4YKJ A;  4X1B A;  4N13 A;  4RY1 A;  3D4G A;  4M1V A;  5DVF A;  4YKK A;  2DVC A;  2F5X A;  5JK4 A;  1S9T A;  4OFL A;  3TQL A;  1FW0 A;  4OMB A;  3RY3 A;  2ALU A;  2I58 A;  4JDF A;  5H8Q B;  3THI A;  4RPN A;  5I58 B;  4F31 B;  2XXV A;  3GZG A;  1D9V A;  3RT8 A;  3PUZ E;  4EQ9 A;  2ZNT A;  1PBP A;  3FVN A;  4EQ7 A;  3O2A A;  3FVO A;  1UTB A;  4X48 A;  3G3J A;  2UYE A;  4DZ1 A;  4OEV A;  2IA4 A;  2DQV A;  3MAM A;  2XXQ A;  3SEU A;  1N76 A;  3TMG A;  4F3G A;  5K2X A;  5IAI A;  5H8F B;  4GIZ A;  1LFG A;  1LAX A;  1TT1 A;  4Z0I A;  4NF6 A;  3T22 A;  3DRG A;  4DCY A;  4ELQ A;  3KFM A;  1GR2 A;  5HM4 B;  3GLB A;  4THI A;  1ZMG A;  4G8M A;  3MP6 A;  4ZDM A;  2VGQ A;  2GFE A;  2WOL A;  3H6V A;  1MY1 A;  3O97 A;  1LGB C;  1LBB A;  3QYT A;  4NE4 A;  2QS1 A;  1IIW A;  3TKD A;  4MLV A;  4OFO A;  2OWS A;  3PMX A;  4ZEC A;  2ZYM A;  4X1D A;  1XVY A;  2QSX A;  3MVY A;  3UA8 A;  4IO3 A;  4G4P A;  1A99 A;  1MXY A;  3PGF A;  3N26 A;  1ZKB A;  3I6V A;  2W7Y A;  1B7H A;  4DCX A;  2RKM A;  1H76 A;  3FXR A;  5TP9 B;  1OVT A;  4H8J A;  3OSR A;  3CFL A;  2Z8E A;  4NF8 A;  5KCJ A;  3O28 A;  4FJP A;  1M5D A;  3QUF A;  4GXS B;  4F1Y A;  4YKI A;  4G77 A;  3FUZ A;  3H4Z A;  2NVU B;  1XOC A;  3T9V A;  1HSE A;  4FEB A;  2O1L A;  2V93 A;  3KN8 A;  4ECF A;  1XC1 A;  1R9L A;  1IQ7 A;  2NXO A;  2Z23 A;  1II5 A;  3UP9 A;  1MXU A;  4ZZA A;  3V89 B;  3K02 A;  1Y3N A;  2YJP A;  3BFU A;  4KPT A;  5I2K A;  1NH8 A;  1ZBM A;  3W9W A;  1ELJ A;  4WKM A;  1SBP A;  1PB9 A;  4P11 A;  4FAT A;  1QUJ A;  2IEE A;  4QF9 A;  3K6W A;  2XXH A;  4OYV A;  3RGY A;  4BDO A;  4F22 A;  2DE4 A;  1SI0 A;  3OEL A;  4R9G A;  4R74 A;  1Y4C A;  2HQ0 A;  3SDF A;  3IB2 A;  3F11 A;  3O6G A;  5ICT A;  1N04 A;  1MXZ A;  3PPP A;  4EXK A;  3PPN A;  4PFU A;  3OO6 A;  4LQ5 A;  3A3C A;  4R73 A;  4ZS9 A;  4GL8 A;  2QPQ A;  4XKP A;  3LSL A;  1MQH A;  1QUK A;  1Z7N E;  1A55 A;  1GVC A;  2XXT A;  2PMS A;  2REG A;  4GD5 A;  3CR9 A;  4QFL A;  3FVG A;  2XXR A;  4U21 A;  4ELO A;  4YKP A;  5ITP A;  2UVH A;  1NH7 A;  3FAS A;  3IO6 A;  1YAE A;  2F34 A;  3C36 A;  1DTZ A;  1XHY A;  2Q2C A;  3RPW A;  3D4C A;  2PX1 A;  1P1N A;  1JVX A;  4POX A;  1LLS A;  2AL5 A;  3MBP A;  3DRH A;  1R6Z A;  1US4 A;  2ZYN A;  3RUM A;  2R6G E;  4PFY A;  1ZJL A;  3TCH A;  3VE1 B;  4R2F A;  3PV0 E;  3RTW B;  2CMO A;  1URD A;  4NTL A;  3A09 A;  3PUX E;  5I2N B;  2PT1 A;  2VD2 A;  3FD3 A;  5CI5 A;  2F36 A;  3OSQ A;  3TUS A;  3OEN A;  3MWB A;  2O7U A;  2UVG A;  1MRP A;  2R9J A;  1Y3Q A;  4ELR A;  2RF1 A;  4EF1 A;  2E0S A;  3OOA A;  2H25 A;  3U8Q A;  2F6P A;  1SVX B;  3GBB A;  4RPO A;  2F8D A;  1UIU A;  2V3U A;  3K0V A;  4ESW A; 
#chains in the Genus database with same CATH topology
 4ISU A;  1TFA A;  3K2D A;  2ZZX A;  4OVP A;  4Q0C A;  3B8B A;  4KXP A;  4OES A;  3T66 A;  5ESY A;  3PUW E;  1MQD A;  4F1U A;  2O7I A;  2XXP A;  5H8H B;  2XX7 A;  2CZK A;  3PD9 A;  2PT2 A;  2I3W A;  4N91 A;  2D3I A;  2I4B A;  1OLA A;  2DWA A;  3Q28 A;  4N6D A;  3G3G A;  3GXA A;  1FPG A;  1I6B A;  1HSL A;  2DE2 A;  4NMY A;  1SI1 A;  2NWJ A;  3USD A;  4GX6 A;  1DK4 A;  5EQ8 A;  3NOH A;  1QKA A;  4GFR A;  1TXF A;  5DVI A;  4NF4 B;  4GF8 A;  1JW1 A;  3PMV A;  2Z8F A;  4PAF A;  4QRZ A;  1M5F A;  3G3I A;  1OLC A;  3Q29 A;  1XVX A;  4NF5 A;  5AA2 A;  4IY6 A;  4YB5 A;  3KGC A;  2F7A A;  4F39 A;  3EHS A;  1EZ9 A;  4U1Z A;  1O64 A;  2XXI A;  1RDX A;  3GBA A;  3VV5 A;  1ANF A;  1FTL A;  2PFY A;  2QJE A;  3ZKK A;  1XI6 A;  2DWJ A;  4I9D A;  1LST A;  3M3K A;  3MPK A;  1IXI A;  1Y20 A;  4OQO A;  5BWJ A;  4IO7 A;  4MF3 A;  4MNC A;  3B6T A;  4H6D A;  2WOK A;  5CMK A;  1LFH A;  3CHG A;  2FA7 A;  3CG3 A;  5CMM A;  4QFO A;  2RC9 A;  2ZXT A;  3CFZ A;  4PFI A;  4NN3 A;  3LV0 A;  4OEU A;  5AA1 A;  4KYD A;  2THI A;  1DMB A;  1EZP A;  1NV3 A;  3TQW A;  1B1X A;  1A8F A;  5K2Y A;  3RYD A;  4YB7 A;  4R6Y A;  3IOU A;  5DEX B;  3SEV A;  3ZS6 A;  4O8M A;  2XWV A;  5F1Q A;  3OD7 A;  1LCF A;  2D5W A;  2A5S A;  3LSW A;  1N3W A;  1F9B A;  4LZ7 A;  2B4L A;  3O6P A;  4ZEB A;  4RXL A;  3OMB A;  3VVD A;  3ISP A;  2DS9 A;  2M8C A;  4MCO A;  4R75 A;  2ZNU A;  1VFE A;  3DRK A;  4OHN A;  2OJT A;  4KQP A;  1NV5 A;  1Y1M A;  3K6V A;  4UAC A;  4AS5 A;  4N17 A;  2QS3 A;  2UYF A;  3E78 A;  4ONY A;  4P9K A;  3H03 A;  1QUI A;  5H8N A;  4WXJ A;  4JSO A;  4TQU Q;  1B4H A;  2GHB A;  3KSJ A;  2HFB A;  4OZ9 A;  1D9Q A;  4XKN A;  3BIG A;  2V84 A;  4IO6 A;  5I56 A;  1M5C A;  1VDW A;  1SPI A;  1AH5 A;  3D1R A;  3ODB A;  5KDT A;  1PB8 A;  4EDP A;  1B5H A;  2X7P A;  1R9Q A;  2V4C A;  4MBP A;  4GX3 A;  3M8U A;  3DEL B;  4O3A A;  5FHN A;  3K1P A;  4JVI A;  1J1N A;  1DTG A;  3IOW A;  1G0H A;  4QFK A;  2AYS A;  1RYO A;  5I57 A;  4O7M A;  2F78 A;  4G8H A;  3T9U A;  4O7I A;  1A7L A;  1RYX A;  1FBD A;  5HPQ A;  5AA2 D;  1B1H A;  1LFI A;  3LR1 A;  5I5P A;  2RC7 A;  3KG2 A;  4NWC A;  4U1O A;  1B0L A;  1QKB A;  1B32 A;  3KN7 A;  1FPI A;  3MJN A;  5L8D A;  1KZ8 A;  3VDF A;  3MC2 A;  3VXB A;  1IME A;  4JWO A;  1SW4 A;  2A5T A;  3DM0 A;  4MIJ A;  2DP8 A;  4XEQ A;  1M5E A;  4NWD A;  1R1N A;  2VP1 A;  4TLM B;  1FSA A;  2YPN A;  1SQY A;  4JWY A;  1B3E A;  1OQH A;  2XXY A;  4YZZ A;  1TFD A;  4BDM A;  2UVJ A;  4C1T A;  4JSD A;  2XWK A;  4G68 C;  4EUO A;  4ESX A;  4G68 A;  1P1W A;  1MH3 A;  3IFA A;  5CC2 A;  2D21 A;  3LC8 A;  4LAT A;  2AL4 A;  3FBP A;  1DOT A;  1BTJ A;  5ELV A;  5JTY A;  4RNS A;  1LBY A;  4LN5 A;  3IX1 A;  4R72 A;  4N8G A;  3TPA A;  2WKY A;  4AB6 A;  4GLI A;  3VLW A;  5ET6 A;  2QMX A;  3K4U A;  1FPJ A;  2HZL A;  4DDD A;  1SYH A;  3SZP A;  3CSG A;  3U65 A;  2ZMB A;  1OMP A;  3CI8 A;  4UA8 A;  5B7D A;  3KC0 A;  3HST A;  1FPL A;  1B3H A;  3JYR A;  3KC1 A;  1OQG A;  3EPE A;  3RTF B;  4PP0 A;  1CE2 A;  4JVD A;  5DVJ A;  4HCY A;  3CFX A;  2PCR A;  2HEU A;  3C9H A;  5AA4 A;  5TPA B;  2DOJ A;  4C0R A;  2DE3 A;  4TOZ A;  2KLF A;  4PGN A;  2H99 A;  1MY3 A;  3V8X B;  2X7Q A;  2XX8 A;  1D9Y A;  4IO2 A;  3JZJ A;  1POT A;  1JET A;  3E4R A;  3ILT B;  1MM6 A;  1UTH A;  1MM7 A;  1IXG A;  3WAE A;  3T9X B;  1VFD A;  4F2Q A;  5EQ7 A;  3KJ7 A;  5IM2 A;  4NG7 A;  3TCF A;  3E9X A;  3H7M A;  4FBP A;  4GQO A;  2Y7W A;  2ONS A;  5EQ9 A;  1IMA A;  1B3L A;  2PYY A;  5A5X A;  3DP4 A;  3R7X A;  1FCK A;  3N5L A;  1A40 A;  3EF7 A;  4ZEI A;  4OER A;  4P56 A;  5FHM A;  2H4I A;  5CBS A;  5I59 B;  1USY E;  4FIM A;  1SW2 A;  2JJK A;  1YPN A;  4ZE8 A;  3P7I A;  4I62 A;  3C4M A;  4GWO A;  4EF2 A;  3C34 A;  3FVK A;  1IUD A;  1SDX A;  1FTM A;  5IZZ A;  2ESN A;  1NV2 A;  1P1Q A;  2XX9 A;  3OEK A;  2DVZ A;  4RJZ A;  3U94 A;  2L5V A;  5DTB A;  1LB8 A;  1N3X A;  3VVF A;  1P99 A;  4QSE A;  2F3D A;  5AA3 A;  1K9Z A;  1LAH E;  5ICQ A;  1B40 A;  4MH5 A;  4PC9 A;  1JEV A;  3UN6 A;  4ZE9 A;  2VD3 A;  1KWH A;  2XXU A;  4PBH A;  3U92 A;  4GBW A;  2YLN A;  1NFT A;  1NNK A;  1P1U A;  5CMC A;  1B2H A;  1L5T A;  3FXQ A;  4AB5 A;  3MZ9 A;  3DRF A;  4XXU A;  3CIJ A;  2XWI A;  3DRI A;  5LDZ A;  2I48 A;  3G3K A;  2WOP A;  5M2V A;  1DBZ A;  1GV8 A;  3PPQ A;  4F29 A;  2PBW A;  3KOS A;  1IXC A;  1NUY A;  4ZED A;  3MQ9 A;  3QK6 A;  1EYI A;  4GWX A;  3IFC A;  1SW1 A;  1QGX A;  4WED A;  1OVB A;  3PD8 A;  5F24 A;  1NV4 A;  3E3K A;  2PVU A;  4OET A;  4LON B;  2V3T A;  3MPL A;  3S2V A;  3EN3 A;  1KA0 A;  4PDH A;  2DXR A;  5T3J A;  2OX3 A;  1FQB A;  4POW A;  3RQT A;  3KOT A;  5CM6 A;  1XT8 A;  4ZZE A;  4Q8R A;  5H8Q A;  3C33 A;  4H67 A;  4LA9 A;  5I58 A;  5CMB A;  1IMC A;  1URG A;  4HXV A;  1UTB B;  3MYU A;  2QMW A;  4YU0 A;  3RYA A;  4IGT A;  1FBC A;  4F1V A;  1BP5 A;  1FQE A;  1YYZ A;  4XKR A;  3UGW A;  2CEX A;  3HO7 A;  3QXM A;  3LUZ A;  3TDJ A;  3B6W A;  4BDQ A;  3AXF A;  4BDN A;  1URS A;  5ET7 A;  1Z7M E;  1PC3 A;  2KR0 A;  4GL0 A;  3K6U A;  4NF6 B;  1IZ1 A;  2RCA A;  3CG1 A;  1MQJ A;  3L6H A;  3OO7 A;  5FTI A;  2B3F A;  2A5T B;  4YMA A;  4R9F A;  3IR1 A;  1QJM A;  2Q74 A;  4P0G A;  4YIC A;  5H8F A;  3H6U A;  1MXX A;  3K01 A;  1QUL A;  3T96 B;  3MW0 A;  4PE5 B;  1FPB A;  3H6W A;  2Z22 A;  4XTC Q;  4ND9 A;  2RCB A;  2Z8D A;  2F3B A;  5HBC A;  2V3Q A;  5IZ1 A;  1FPF A;  3CVG A;  5TU0 A;  3A3U A;  4JVC A;  1FTA A;  4DE8 A;  3KBZ A;  5JTY B;  1D3K A;  1Q1K A;  1AL3 A;  1B7Z A;  1VE4 A;  2FHY A;  4AQ4 A;  3IOT A;  1ZTY A;  3BKI B;  1N84 A;  1MDP 1;  2XWO A;  4RK2 A;  4X04 A;  1BKA A;  4H0W A;  1B58 A;  4I8C A;  3ZKL A;  4GWY A;  4H5G A;  4JB7 A;  4HW8 A;  4XF5 A;  4NF8 B;  3KN3 A;  1IEJ A;  5KCJ B;  3DP8 A;  1B7U A;  5TP9 A;  2WEF A;  3QSL A;  3H3G A;  2R71 A;  1N0T A;  2LAO A;  3OXN A;  4OTE A;  2OLB A;  1FPK A;  2GHA A;  2ZZW A;  2HCA A;  1JEU A;  4PGP A;  4HTG A;  2Y84 A;  4QHQ A;  1SYI A;  3FZV A;  2OBG A;  3HN0 A;  1AOV A;  3TYH A;  1H43 A;  1B4Z A;  4PFB A;  3PU5 A;  1P1O A;  2UVI A;  3SEX A;  5IZ3 A;  3SET A;  3PUV E;  4JWX A;  1B5I A;  4GRK A;  2I6E A;  3TCG A;  5A5X B;  2XHD A;  5I2K B;  3KJT A;  1GGG A;  3VFJ A;  4ZEK A;  2F97 A;  4F3P A;  4F19 A;  1YXI A;  1DCU A;  4MLQ A;  1FQD A;  4OXV A;  3K6X A;  4X9T A;  1NNP A;  3QAX A;  4BLA A;  1YTV A;  3IJO B;  1I6Q A;  2Y7P A;  5L9S A;  2HZK A;  2QFL A;  3G7W A;  1FQA A;  1LBC A;  3LUY A;  4HE0 A;  2O6A A;  2B65 A;  3HHF A;  3PUY E;  1H44 A;  4RYA A;  3MVX A;  3HV1 A;  3ILU B;  4LQ2 A;  1IMD A;  1AIV A;  4U23 A;  3L6G A;  4O3B A;  2O68 A;  1JVY A;  4GVO A;  4DXB A;  3RN8 A;  2B4M A;  3TOD A;  3TTR A;  3HFU A;  3K00 A;  1FBP A;  4G2Z A;  2UXA A;  3MST A;  1BK4 A;  3TTL A;  1G0I A;  3EQ1 A;  3HCQ A;  1KA1 A;  4BDL A;  4K3F A;  4PAI A;  1DSN A;  2Q2A A;  5CBR A;  4H5F A;  3VLU A;  2XXX A;  4LZ8 A;  2I49 A;  2QL3 A;  3RPL A;  4MMP A;  3MP8 A;  1LBX A;  1Y4T A;  2Q8J A;  3B50 A;  2AIX A;  4P1E A;  5BUU A;  4P0I A;  4N6K A;  1MDQ A;  3MVZ A;  3FV1 A;  4P3L A;  5IKB A;  2H5Y A;  1ZIU A;  2H98 A;  3M3F A;  1S7Y A;  2P1S A;  4IY5 A;  3BBR A;  1NL5 A;  4O3C A;  4GX4 A;  1YZ0 A;  1B3G A;  4GOT A;  2NUV A;  1Y9U A;  3N6U A;  1CNQ A;  1FTK A;  4PFR A;  1O7T A;  1TWY A;  1FQC A;  4OWD A;  1NV0 A;  1LB9 A;  3N6T A;  2Y7I A;  2I0B A;  5I2N A;  3O9P A;  1A54 A;  4DXC A;  1B0H A;  3V5A A;  2X26 A;  1YCJ A;  3HPI A;  4LZ5 A;  3TTM A;  1NV7 A;  2DYX A;  3T0J A;  3O6H A;  2OZZ A;  3E13 X;  4UAB A;  3KSX A;  3ONM A;  3T9H B;  3SEY A;  3FJ7 A;  4DLD A;  3FIR A;  1MS7 A;  2Y7R A;  3Q25 A;  4DIG A;  1POY 1;  1NKX A;  1NV6 A;  1NNF A;  4M4G A;  4PAK A;  4FAJ A;  1DPP A;  1WDN A;  3TTN A;  4Z7E A;  4H8I A;  4PDD A;  1FTJ A;  2GH9 A;  1CB6 A;  4C1U A;  1MY0 A;  3PAM A;  4KR5 A;  3Q27 A;  3S9M C;  2XXW A;  3VLV A;  4KHZ E;  3W9V A;  4YMB A;  1AMF A;  3LSF B;  4LP2 B;  2DWI A;  1VR5 A;  5EHS A;  2F6G A;  2DWH A;  5EYH A;  3MUQ A;  1Y3P A;  2CZL A;  2ABH A;  5H8H A;  4H1X A;  3G3H A;  1B46 A;  1NUX A;  4OFJ A;  3KBR A;  2WX9 A;  1US5 A;  3U1O A;  4LVQ A;  1I6A A;  4P1L A;  5I84 A;  1MQG A;  1MPC A;  3FV2 A;  2DXY A;  3TEL A;  4MAG A;  3PPO A;  4NF4 A;  1B9J A;  4NF5 B;  4PF6 A;  3LSX A;  5AA2 B;  4PBQ A;  3BFT A;  2Q88 A;  1MY4 A;  3OO9 A;  3FGS A;  4LUB A;  2QS4 A;  2WBB A;  3E79 A;  3B7D A;  4KCD A;  4U2R A;  1MH4 A;  5DT6 A;  1LEV A;  4MFI A;  4P47 A;  4R6H A;  1IMB A;  1Y1Z A;  4WEP A;  5ISU A;  3K1M A;  1SD3 A;  3U93 A;  1JP4 A;  4QFP A;  3W15 C;  4E0W A;  1FRP A;  4I3E A;  1MQI A;  4F2O A;  4AS4 A;  4OVS A;  1NI9 A;  3IJX B;  3IL1 B;  2HXW A;  4X8R A;  3O6I A;  3M3L A;  2B3B A;  3SES A;  2BJJ X;  5J16 A;  1PDA A;  2ONR A;  3I3V A;  4NX1 A;  3SEW A;  1T0K A;  1PBQ A;  1PEB A;  3TTK A;  3OO8 A;  4N6P A;  2Y5K A;  4ZEF A;  1INP A;  3H6T A;  4FOR A;  2FBP A;  2QRY A;  5ET5 A;  4NED A;  2RC8 A;  4GXA A;  4EQB A;  3B6Q A;  5AE4 A;  5L9O A;  3TZA A;  4PFW A;  3EHU A;  4H46 A;  5FTH A;  3SER A;  5DEX A;  5B70 A;  4QFN A;  1LCT A;  4N15 A;  2I4C A;  3UOR A;  5CRY A;  3VVE A;  1O63 A;  2REJ A;  1ATG A;  2F7B A;  2P0S A;  4DXU A;  3KEI A;  3T93 B;  5H8N B;  2DSF A;  2XD2 A;  4YB6 A;  3RPL B;  2BJI A;  1RKM A;  4IO5 A;  5KZT A;  3S9L C;  5I56 B;  4U4S A;  3S4U A;  4YAH X;  1DPE A;  4IGR A;  3HHG A;  3MZ1 A;  3GYY A;  1PB7 A;  4I40 A;  2QVR A;  5KDT B;  4KFQ A;  4MEV A;  3I5O A;  3MP1 A;  2GRV A;  4H65 A;  2O51 A;  4DI3 D;  4G61 A;  3S9E A;  1MY2 A;  2ZYO A;  5I57 B;  2O84 X;  2XA5 A;  2HXR A;  1B51 A;  1SW5 A;  3FJM A;  3O29 A;  2XD3 A;  4TLL B;  4XKQ A;  2VOZ A;  3RT6 B;  3SKP A;  1H3D A;  4OVR A;  4OVJ A;  5FHO A;  4KD5 A;  2HPG A;  1IXH A;  1NV1 A;  3OEM A;  1N7X A;  1B6H A;  1H45 A;  3A29 A;  4PE3 A;  3CSB A;  1MPB A;  3Q26 A;  1JQF A;  5EYG A;  3N94 A;  1FJ6 A;  4Q30 B;  2E1S A;  1NMU A;  4FED A;  1BLF A;  4PFT A;  1USY H;  1A8E A;  5J1D A;  4PET A;  2ZNS A;  4N81 A;  4JXI A;  4QSD A;  4FEC A;  2ANJ A;  3QIM A;  3IB1 A;  3MVW A;  4F3B A;  1B3F A;  3PPR A;  3IOR A;  3K1N A;  4F18 A;  3LBS A;  1WVJ A;  5H8S A;  4IO4 A;  4JBZ A;  1UIV A;  2P2A A;  3PMW A;  3FTO A;  3R26 A;  3C35 A;  4QXD A;  2P3V A;  3EKI A;  1B52 A;  2HAU A;  1MXV A;  4XIG Q;  3TFL A;  3RNN A;  1JW4 A;  4G68 B;  3U72 A;  4N07 A;  3JV9 A;  1MPD A;  4I3Y A;  5ITO A;  1LAG E;  2H9B A;  3ZSF A;  3O66 A;  2V25 A;  3FAT A;  4NF0 A;  1B05 A;  4EXL A;  4KYS A;  2OWZ A;  5LOM A;  1NNT A;  1Q35 A;  2G29 A;  1FBG A;  3DRJ A;  1FTO A;  4L17 A;  5JEI A;  4P8B A;  1IIT A;  2G93 A;  2O1M A;  3TEP A;  4RK9 A;  1QVS A;  1VSO A;  2CEY A;  5EHM A;  1ZU0 A;  4BDR A;  2MKZ A;  4E0X A;  1EZO A;  1FJ9 A;  1JNF A;  1AWB A;  4U22 A;  5F7V A;  3CRB A;  1WOD A;  1EYK A;  1LBW A;  4PF8 A;  3RLF E;  3TAJ A;  3IO4 A;  4HCW A;  3T1B A;  5AA4 B;  2QS2 A;  1OIB A;  2F35 A;  3FXU A;  2Q9T A;  3UK4 A;  4HS7 A;  1EH3 A;  5TPA A;  1B5J A;  1LAF E;  4G8N A;  2OWT A;  1EU8 A;  2WYK A;  2FVZ A;  1UTH B;  4HE2 A;  3LVU A;  2VHA A;  3VXC A;  3UIF A;  2NOO A;  2F7C A;  2Y7K A;  3C32 A;  1MXW A;  3KZG A;  3V83 A;  3IK6 B;  4RA1 A;  3RYB A;  1XS5 A;  1QW0 A;  2FYI A;  2ONK E;  3ECR A;  5L9M A;  3PTY A;  1N7W A;  1D4N A;  1JW5 A;  1FQF A;  2FNC A;  4IB2 A;  2OK2 A;  4H45 A;  5DYH A;  3DLN A;  4OVQ A;  1UQW A;  3IAZ A;  4I1D A;  4R2B A;  4R6K A;  5I59 A;  1HSJ A;  3DP6 A;  4GWW A;  4F3S A;  2ZZV A;  3S9N C;  2O69 A;  3G3F A;  2RIN A;  4U4X A;  4KI0 E;  2OCU A;  4MNP A;  3IB0 A;  4GBV A;  2KQZ A;  2ZYK A;  1MG1 A;  3QUJ A;  4DI4 B;  1ZLQ A;  2I3V A;  4KYE A;  4Q5T A;  2P3N A;  4FE8 A;  5I7I A;  5EYF A;  2Q89 A;  3FJG A;  1S50 A;  2R8T A;  1BIY A;  3R6U A;  4OEN A;  2HAV A;  4ELP A;  1M5B A;  4QSC A;  3EHT A;  3IOV A;  4MX6 A;  4MNI A;  1GTK A;  3WAF A;  2I0C A;  1I69 A;  3MZB A;  3C31 A;  4PQJ A;  3H06 B;  4KCC A;  4YKJ A;  4X1B A;  4N13 A;  4PTK A;  4RY1 A;  3D4G A;  4M1V A;  5DVF A;  4YKK A;  2DVC A;  2F5X A;  5JK4 A;  1S9T A;  4OFL A;  3TQL A;  1FW0 A;  4OMB A;  3RY3 A;  2ALU A;  3QMF A;  1EYJ A;  2I58 A;  4JDF A;  1FPD A;  5H8Q B;  3THI A;  4RPN A;  5I58 B;  4F31 B;  2WBD A;  2XXV A;  3GZG A;  5IGA A;  4N8Y A;  1D9V A;  3RT8 A;  3PUZ E;  4EQ9 A;  2ZNT A;  1PBP A;  3FVN A;  5A5L A;  4EQ7 A;  3O2A A;  3FVO A;  3FXB A;  1K9Y A;  1UTB A;  4X48 A;  3G3J A;  2UYE A;  4DZ1 A;  4OEV A;  2IA4 A;  2DQV A;  1NUW A;  2Q8M A;  4NGU A;  2QVU A;  3MAM A;  3BIH A;  2XXQ A;  3SEU A;  1N76 A;  3TMG A;  4F3G A;  5K2X A;  5IAI A;  5EQA A;  5H8F B;  4GIZ A;  1LFG A;  1LAX A;  1TT1 A;  4Z0I A;  4NF6 A;  4QBA A;  3T22 A;  3DRG A;  4DCY A;  4ELQ A;  1FBE A;  3KFM A;  1GR2 A;  5HM4 B;  1FBF A;  3GLB A;  4THI A;  4MHF A;  1ZMG A;  4G8M A;  3MP6 A;  4ZDM A;  2VGQ A;  2GFE A;  2WOL A;  3H6V A;  1MY1 A;  3O97 A;  1LGB C;  2Y5L A;  1LBB A;  3QYT A;  4NE4 A;  2QS1 A;  1IIW A;  3TKD A;  4NHB A;  4MLV A;  4OFO A;  2OWS A;  3PMX A;  4ZEC A;  2ZYM A;  4X1D A;  1XVY A;  2QSX A;  3MVY A;  3UA8 A;  4IO3 A;  4G4P A;  1A99 A;  1MXY A;  3PGF A;  3N26 A;  1ZKB A;  3I6V A;  2W7Y A;  1B7H A;  2CZH A;  4DCX A;  2RKM A;  1H76 A;  3FXR A;  5TP9 B;  1OVT A;  4H8J A;  3OSR A;  3CFL A;  2Z8E A;  4NF8 A;  5KCJ A;  2VT5 A;  2FIX A;  3O28 A;  4FJP A;  1M5D A;  3QUF A;  4GXS B;  4F1Y A;  4YKI A;  4GWZ A;  4G77 A;  3FUZ A;  3H4Z A;  4OAN A;  4XFE A;  2NVU B;  1XOC A;  2XXK A;  3T9V A;  1HSE A;  4FEB A;  2O1L A;  5IZ3 B;  2V93 A;  3KN8 A;  4ECF A;  4OVT A;  1XC1 A;  1R9L A;  2WYP A;  1IQ7 A;  2NXO A;  2Z23 A;  1II5 A;  3UP9 A;  1MXU A;  4ZZA A;  3V89 B;  4GWS A;  3K02 A;  1Y3N A;  2YJP A;  4GWU A;  3BFU A;  1RDZ A;  2DDK A;  4KPT A;  5I2K A;  1NH8 A;  1ZBM A;  3W9W A;  1ELJ A;  4WKM A;  1SBP A;  1PB9 A;  4P11 A;  2CZI A;  4FAT A;  1QUJ A;  2IEE A;  1LBV A;  2FIE A;  3K6W A;  4QF9 A;  4NAP A;  2XXH A;  4OYV A;  3RGY A;  4BDO A;  4F22 A;  2DE4 A;  1SI0 A;  4MJO A;  1LBZ A;  3OEL A;  5ET8 A;  5DW8 A;  4R9G A;  2PFZ A;  4R74 A;  1Y4C A;  2HQ0 A;  3SDF A;  4OA4 A;  3IB2 A;  3F11 A;  3O6G A;  5ICT A;  1N04 A;  1MXZ A;  3PPP A;  4EXK A;  3PPN A;  4PFU A;  3OO6 A;  4LQ5 A;  3A3C A;  4R73 A;  4ZS9 A;  4GL8 A;  2QPQ A;  4XKP A;  1Q9D A;  3LSL A;  1MQH A;  5LTC A;  1QUK A;  1Z7N E;  1A55 A;  1GVC A;  2XXT A;  2PMS A;  2HHM A;  2REG A;  4GD5 A;  3CR9 A;  5FBP A;  4QFL A;  3FVG A;  2XXR A;  4U21 A;  4ELO A;  1NUZ A;  4YKP A;  5ITP A;  4NQ8 A;  5I3S A;  2UVH A;  1NH7 A;  3FAS A;  1IMF A;  3IO6 A;  1YAE A;  2VPN A;  2F34 A;  3C36 A;  1DTZ A;  4PCD A;  1XHY A;  2Q2C A;  3RPW A;  3D4C A;  2PX1 A;  1P1N A;  1JVX A;  4POX A;  1LLS A;  2AL5 A;  3MBP A;  3DRH A;  1R6Z A;  1US4 A;  2ZYN A;  3RUM A;  4IR8 A;  2R6G E;  4PFY A;  1ZJL A;  1FBH A;  3TCH A;  1FPE A;  3VE1 B;  2GQ1 A;  4R2F A;  3PV0 E;  4HE1 A;  3RTW B;  2CMO A;  1URD A;  4NTL A;  3A09 A;  3PUX E;  5I2N B;  2PT1 A;  2VD2 A;  3FD3 A;  5CI5 A;  4N4U A;  2F36 A;  3OSQ A;  3TUS A;  3OEN A;  3ROJ A;  3MWB A;  2O7U A;  2UVG A;  4O94 A;  1MRP A;  2R9J A;  1Y3Q A;  4ELR A;  2RF1 A;  4EF1 A;  2E0S A;  2VPO A;  3OOA A;  2H25 A;  2QVV A;  3U8Q A;  2F6P A;  1SVX B;  3GBB A;  4RPO A;  2F8D A;  1UIU A;  2V3U A;  1RDY A;  3K0V A;  4ESW A; 
#chains in the Genus database with same CATH homology
 4ISU A;  1TFA A;  3K2D A;  4Q0C A;  4OES A;  3T66 A;  3PUW E;  1MQD A;  4F1U A;  2O7I A;  2XXP A;  5H8H B;  2XX7 A;  3PD9 A;  2PT2 A;  2I3W A;  2D3I A;  2I4B A;  1OLA A;  2DWA A;  3Q28 A;  3G3G A;  3GXA A;  1I6B A;  1HSL A;  2DE2 A;  4NMY A;  1SI1 A;  2NWJ A;  3USD A;  1QKA A;  4GFR A;  1TXF A;  5DVI A;  4NF4 B;  4GF8 A;  1JW1 A;  3PMV A;  2Z8F A;  4QRZ A;  1M5F A;  3G3I A;  1OLC A;  3Q29 A;  1XVX A;  4NF5 A;  5AA2 A;  4IY6 A;  4YB5 A;  3KGC A;  2F7A A;  4F39 A;  3EHS A;  1EZ9 A;  4U1Z A;  1O64 A;  2XXI A;  3GBA A;  3VV5 A;  1ANF A;  1FTL A;  2QJE A;  3ZKK A;  2DWJ A;  4I9D A;  1LST A;  3M3K A;  3MPK A;  1IXI A;  1Y20 A;  4OQO A;  5BWJ A;  4IO7 A;  4MF3 A;  3B6T A;  4H6D A;  2WOK A;  5CMK A;  1LFH A;  3CHG A;  2FA7 A;  3CG3 A;  5CMM A;  4QFO A;  2RC9 A;  2ZXT A;  3CFZ A;  4OEU A;  5AA1 A;  4KYD A;  2THI A;  1DMB A;  1EZP A;  3TQW A;  1B1X A;  1A8F A;  5K2Y A;  4YB7 A;  4R6Y A;  3IOU A;  5DEX B;  3SEV A;  3ZS6 A;  5F1Q A;  3OD7 A;  1LCF A;  2D5W A;  2A5S A;  3LSW A;  1N3W A;  1F9B A;  4LZ7 A;  2B4L A;  3O6P A;  4ZEB A;  4RXL A;  3OMB A;  3VVD A;  2DS9 A;  2M8C A;  4R75 A;  2ZNU A;  1VFE A;  3DRK A;  4OHN A;  2OJT A;  4KQP A;  1Y1M A;  3K6V A;  4UAC A;  2QS3 A;  2UYF A;  4ONY A;  3H03 A;  1QUI A;  5H8N A;  4WXJ A;  4JSO A;  4TQU Q;  1B4H A;  2GHB A;  3KSJ A;  2HFB A;  4OZ9 A;  4XKN A;  2V84 A;  4IO6 A;  5I56 A;  1M5C A;  1AH5 A;  3ODB A;  5KDT A;  1PB8 A;  4EDP A;  1B5H A;  2X7P A;  1R9Q A;  4MBP A;  3M8U A;  3DEL B;  4O3A A;  5FHN A;  3K1P A;  1J1N A;  1DTG A;  3IOW A;  4QFK A;  2AYS A;  1RYO A;  5I57 A;  2F78 A;  4G8H A;  3T9U A;  1A7L A;  1RYX A;  5HPQ A;  5AA2 D;  1B1H A;  1LFI A;  3LR1 A;  2RC7 A;  3KG2 A;  4NWC A;  4U1O A;  1B0L A;  1QKB A;  1B32 A;  3KN7 A;  3MJN A;  5L8D A;  3VDF A;  3MC2 A;  3VXB A;  4JWO A;  1SW4 A;  2A5T A;  3DM0 A;  2DP8 A;  1M5E A;  4NWD A;  1R1N A;  2VP1 A;  4TLM B;  2YPN A;  1SQY A;  4JWY A;  1B3E A;  1OQH A;  2XXY A;  4YZZ A;  1TFD A;  4BDM A;  2UVJ A;  4C1T A;  4JSD A;  4G68 C;  4EUO A;  4ESX A;  4G68 A;  1P1W A;  1MH3 A;  5CC2 A;  2D21 A;  3LC8 A;  4LAT A;  2AL4 A;  1DOT A;  1BTJ A;  5ELV A;  5JTY A;  4RNS A;  3IX1 A;  4R72 A;  3TPA A;  2WKY A;  4AB6 A;  4GLI A;  3VLW A;  2QMX A;  3K4U A;  2HZL A;  4DDD A;  1SYH A;  3CSG A;  2ZMB A;  1OMP A;  3CI8 A;  4UA8 A;  5B7D A;  3HST A;  1B3H A;  3JYR A;  1OQG A;  3EPE A;  3RTF B;  4PP0 A;  1CE2 A;  5DVJ A;  4HCY A;  3CFX A;  2HEU A;  3C9H A;  5AA4 A;  5TPA B;  2DOJ A;  4C0R A;  2DE3 A;  4TOZ A;  2KLF A;  2H99 A;  3V8X B;  1MY3 A;  2X7Q A;  2XX8 A;  1D9Y A;  4IO2 A;  3JZJ A;  1POT A;  1JET A;  3E4R A;  3ILT B;  1MM6 A;  1UTH A;  1MM7 A;  1IXG A;  3WAE A;  3T9X B;  1VFD A;  4F2Q A;  3KJ7 A;  3TCF A;  3E9X A;  3H7M A;  4GQO A;  2Y7W A;  2ONS A;  1B3L A;  2PYY A;  5A5X A;  3DP4 A;  3R7X A;  1FCK A;  3N5L A;  1A40 A;  3EF7 A;  4ZEI A;  4OER A;  5FHM A;  2H4I A;  5CBS A;  5I59 B;  1USY E;  4FIM A;  1SW2 A;  1YPN A;  4ZE8 A;  3P7I A;  4I62 A;  3C4M A;  4GWO A;  4EF2 A;  3C34 A;  3FVK A;  1IUD A;  1SDX A;  1FTM A;  2ESN A;  1P1Q A;  2XX9 A;  3OEK A;  2DVZ A;  4RJZ A;  3U94 A;  5DTB A;  1LB8 A;  1N3X A;  3VVF A;  1P99 A;  4QSE A;  5AA3 A;  1LAH E;  5ICQ A;  1B40 A;  4MH5 A;  1JEV A;  3UN6 A;  4ZE9 A;  2VD3 A;  1KWH A;  2XXU A;  3U92 A;  2YLN A;  1NFT A;  1NNK A;  1P1U A;  5CMC A;  1B2H A;  1L5T A;  3FXQ A;  4AB5 A;  3MZ9 A;  3DRF A;  4XXU A;  3CIJ A;  3DRI A;  2I48 A;  3G3K A;  2WOP A;  5M2V A;  1GV8 A;  3PPQ A;  4F29 A;  2PBW A;  3KOS A;  1IXC A;  4ZED A;  3MQ9 A;  3QK6 A;  1SW1 A;  4WED A;  1OVB A;  3PD8 A;  3E3K A;  2PVU A;  4OET A;  4LON B;  2V3T A;  3MPL A;  3S2V A;  3EN3 A;  2DXR A;  1FQB A;  4POW A;  3RQT A;  3KOT A;  5CM6 A;  1XT8 A;  4ZZE A;  4Q8R A;  5H8Q A;  3C33 A;  4H67 A;  4LA9 A;  5I58 A;  5CMB A;  1URG A;  1UTB B;  2QMW A;  4YU0 A;  3RYA A;  4IGT A;  4F1V A;  1BP5 A;  1FQE A;  4XKR A;  3UGW A;  3HO7 A;  3QXM A;  3TDJ A;  3B6W A;  4BDQ A;  3AXF A;  4BDN A;  1URS A;  1Z7M E;  1PC3 A;  4GL0 A;  3K6U A;  4NF6 B;  1IZ1 A;  2RCA A;  3CG1 A;  1MQJ A;  3L6H A;  3OO7 A;  5FTI A;  2B3F A;  2A5T B;  4YMA A;  4R9F A;  3IR1 A;  1QJM A;  4P0G A;  4YIC A;  5H8F A;  3H6U A;  1MXX A;  3K01 A;  1QUL A;  3T96 B;  3MW0 A;  4PE5 B;  3H6W A;  2Z22 A;  4XTC Q;  4ND9 A;  2RCB A;  2Z8D A;  5HBC A;  2V3Q A;  3CVG A;  5TU0 A;  3A3U A;  4DE8 A;  5JTY B;  1D3K A;  1Q1K A;  1AL3 A;  1B7Z A;  1VE4 A;  4AQ4 A;  3IOT A;  1ZTY A;  3BKI B;  1N84 A;  1MDP 1;  4RK2 A;  1BKA A;  4H0W A;  1B58 A;  4I8C A;  3ZKL A;  4H5G A;  4JB7 A;  4HW8 A;  3KN3 A;  4NF8 B;  1IEJ A;  5KCJ B;  3DP8 A;  1B7U A;  5TP9 A;  3QSL A;  3H3G A;  2R71 A;  1N0T A;  2LAO A;  3OXN A;  2OLB A;  4OTE A;  2GHA A;  2HCA A;  1JEU A;  4HTG A;  2Y84 A;  4QHQ A;  1SYI A;  3FZV A;  2OBG A;  3HN0 A;  1AOV A;  3TYH A;  1H43 A;  1B4Z A;  1P1O A;  2UVI A;  3SEX A;  3PU5 A;  3SET A;  3PUV E;  4JWX A;  1B5I A;  4GRK A;  2I6E A;  3TCG A;  5A5X B;  2XHD A;  5I2K B;  3KJT A;  1GGG A;  3VFJ A;  4ZEK A;  2F97 A;  4F3P A;  4F19 A;  4MLQ A;  1FQD A;  4OXV A;  3K6X A;  4X9T A;  1NNP A;  3QAX A;  4BLA A;  1YTV A;  3IJO B;  1I6Q A;  2Y7P A;  5L9S A;  2HZK A;  3G7W A;  1FQA A;  1LBC A;  3LUY A;  2O6A A;  2B65 A;  3HHF A;  3PUY E;  1H44 A;  4RYA A;  3MVX A;  3HV1 A;  3ILU B;  4LQ2 A;  1AIV A;  4U23 A;  3L6G A;  4O3B A;  2O68 A;  1JVY A;  4GVO A;  4DXB A;  3RN8 A;  2B4M A;  3TOD A;  3TTR A;  3K00 A;  4G2Z A;  2UXA A;  3TTL A;  3EQ1 A;  3HCQ A;  4BDL A;  4K3F A;  1DSN A;  2Q2A A;  5CBR A;  4H5F A;  3VLU A;  2XXX A;  4LZ8 A;  2I49 A;  2QL3 A;  3MP8 A;  1Y4T A;  2Q8J A;  2AIX A;  5BUU A;  4P0I A;  1MDQ A;  3MVZ A;  3FV1 A;  5IKB A;  2H5Y A;  1ZIU A;  2H98 A;  3M3F A;  1S7Y A;  2P1S A;  4IY5 A;  3BBR A;  1NL5 A;  4O3C A;  1B3G A;  4GOT A;  2NUV A;  1Y9U A;  3N6U A;  1FTK A;  1O7T A;  1TWY A;  1FQC A;  4OWD A;  1LB9 A;  3N6T A;  2Y7I A;  2I0B A;  5I2N A;  3O9P A;  1A54 A;  4DXC A;  1B0H A;  3V5A A;  2X26 A;  1YCJ A;  3HPI A;  4LZ5 A;  3TTM A;  2DYX A;  3O6H A;  2OZZ A;  3E13 X;  3KSX A;  3ONM A;  3T9H B;  3SEY A;  3FJ7 A;  4DLD A;  3FIR A;  1MS7 A;  4DIG A;  2Y7R A;  3Q25 A;  1POY 1;  1NKX A;  1NNF A;  4M4G A;  4FAJ A;  1DPP A;  1WDN A;  3TTN A;  4Z7E A;  4H8I A;  1FTJ A;  2GH9 A;  1CB6 A;  4C1U A;  1MY0 A;  3PAM A;  4KR5 A;  3Q27 A;  3S9M C;  2XXW A;  3VLV A;  4KHZ E;  3W9V A;  4YMB A;  1AMF A;  3LSF B;  4LP2 B;  2DWI A;  1VR5 A;  5EHS A;  2F6G A;  2DWH A;  3MUQ A;  1Y3P A;  2CZL A;  2ABH A;  5H8H A;  4H1X A;  3G3H A;  1B46 A;  4OFJ A;  3KBR A;  1US5 A;  3U1O A;  4LVQ A;  1I6A A;  5I84 A;  1MQG A;  1MPC A;  3FV2 A;  2DXY A;  3TEL A;  3PPO A;  4NF4 A;  1B9J A;  4NF5 B;  3LSX A;  5AA2 B;  3BFT A;  2Q88 A;  1MY4 A;  3OO9 A;  3FGS A;  4LUB A;  2QS4 A;  3B7D A;  4KCD A;  4U2R A;  1MH4 A;  5DT6 A;  4MFI A;  4R6H A;  1Y1Z A;  4WEP A;  5ISU A;  3K1M A;  1SD3 A;  3U93 A;  4QFP A;  3W15 C;  4E0W A;  1MQI A;  4F2O A;  3IJX B;  3IL1 B;  2HXW A;  3O6I A;  3M3L A;  2B3B A;  3SES A;  2BJJ X;  1PDA A;  2ONR A;  3I3V A;  3SEW A;  1T0K A;  1PBQ A;  1PEB A;  3TTK A;  3OO8 A;  4N6P A;  4ZEF A;  3H6T A;  4FOR A;  2QRY A;  4NED A;  2RC8 A;  4GXA A;  4EQB A;  3B6Q A;  5AE4 A;  5L9O A;  3TZA A;  4PFW A;  3EHU A;  5FTH A;  3SER A;  5DEX A;  5B70 A;  4QFN A;  1LCT A;  2I4C A;  3UOR A;  5CRY A;  3VVE A;  1O63 A;  2REJ A;  1ATG A;  2F7B A;  2P0S A;  4DXU A;  3KEI A;  3T93 B;  5H8N B;  2DSF A;  2XD2 A;  4YB6 A;  1RKM A;  4IO5 A;  5KZT A;  3S9L C;  5I56 B;  4U4S A;  3S4U A;  4YAH X;  1DPE A;  4IGR A;  3HHG A;  3MZ1 A;  1PB7 A;  5KDT B;  4KFQ A;  3I5O A;  3MP1 A;  2GRV A;  4H65 A;  2O51 A;  3S9E A;  1MY2 A;  2ZYO A;  5I57 B;  2O84 X;  1B51 A;  1SW5 A;  3FJM A;  3O29 A;  2XD3 A;  4TLL B;  4XKQ A;  2VOZ A;  3RT6 B;  3SKP A;  1H3D A;  4OVJ A;  5FHO A;  4KD5 A;  1IXH A;  3OEM A;  1N7X A;  1B6H A;  1H45 A;  3CSB A;  1MPB A;  3Q26 A;  1JQF A;  3N94 A;  4Q30 B;  2E1S A;  1NMU A;  4FED A;  1BLF A;  4PFT A;  1USY H;  1A8E A;  5J1D A;  4PET A;  2ZNS A;  4JXI A;  4QSD A;  4FEC A;  2ANJ A;  3QIM A;  3IB1 A;  3MVW A;  4F3B A;  1B3F A;  3PPR A;  3IOR A;  3K1N A;  4F18 A;  3LBS A;  1WVJ A;  5H8S A;  4IO4 A;  4JBZ A;  1UIV A;  2P2A A;  3PMW A;  3FTO A;  3R26 A;  3C35 A;  1B52 A;  2HAU A;  1MXV A;  4XIG Q;  3TFL A;  3RNN A;  1JW4 A;  4G68 B;  3U72 A;  4N07 A;  3JV9 A;  1MPD A;  5ITO A;  1LAG E;  2H9B A;  3ZSF A;  3O66 A;  2V25 A;  3FAT A;  4EXL A;  1B05 A;  4KYS A;  5LOM A;  1NNT A;  1Q35 A;  2G29 A;  3DRJ A;  1FTO A;  4L17 A;  5JEI A;  1IIT A;  2G93 A;  2O1M A;  3TEP A;  4RK9 A;  1QVS A;  1VSO A;  5EHM A;  4BDR A;  1ZU0 A;  4E0X A;  1EZO A;  1JNF A;  4U22 A;  5F7V A;  3CRB A;  1WOD A;  3RLF E;  3TAJ A;  3IO4 A;  4HCW A;  5AA4 B;  2QS2 A;  1OIB A;  2F35 A;  3FXU A;  2Q9T A;  3UK4 A;  4HS7 A;  1EH3 A;  5TPA A;  1B5J A;  1LAF E;  4G8N A;  2OWT A;  1EU8 A;  1UTH B;  3LVU A;  2VHA A;  3VXC A;  3UIF A;  2NOO A;  2F7C A;  2Y7K A;  3C32 A;  1MXW A;  3KZG A;  3V83 A;  3IK6 B;  4RA1 A;  3RYB A;  1XS5 A;  1QW0 A;  2FYI A;  2ONK E;  3ECR A;  5L9M A;  1N7W A;  1D4N A;  1JW5 A;  1FQF A;  2FNC A;  4IB2 A;  2OK2 A;  5DYH A;  3DLN A;  1UQW A;  3IAZ A;  4I1D A;  4R2B A;  4R6K A;  5I59 A;  1HSJ A;  3DP6 A;  4F3S A;  3S9N C;  2O69 A;  3G3F A;  2RIN A;  4U4X A;  4KI0 E;  2OCU A;  3IB0 A;  2ZYK A;  1MG1 A;  3QUJ A;  1ZLQ A;  2I3V A;  4KYE A;  4Q5T A;  4FE8 A;  5EYF A;  2Q89 A;  3FJG A;  1S50 A;  1BIY A;  3R6U A;  4OEN A;  2HAV A;  4ELP A;  1M5B A;  4QSC A;  3EHT A;  3IOV A;  1GTK A;  3WAF A;  2I0C A;  1I69 A;  3MZB A;  3C31 A;  4PQJ A;  3H06 B;  4KCC A;  4YKJ A;  4X1B A;  4N13 A;  4RY1 A;  3D4G A;  4M1V A;  5DVF A;  4YKK A;  2DVC A;  2F5X A;  5JK4 A;  1S9T A;  4OFL A;  3TQL A;  1FW0 A;  4OMB A;  3RY3 A;  2ALU A;  2I58 A;  4JDF A;  5H8Q B;  3THI A;  4RPN A;  5I58 B;  4F31 B;  2XXV A;  3GZG A;  1D9V A;  3RT8 A;  3PUZ E;  4EQ9 A;  2ZNT A;  1PBP A;  3FVN A;  4EQ7 A;  3O2A A;  3FVO A;  1UTB A;  4X48 A;  3G3J A;  2UYE A;  4DZ1 A;  4OEV A;  2IA4 A;  2DQV A;  3MAM A;  2XXQ A;  3SEU A;  1N76 A;  3TMG A;  4F3G A;  5K2X A;  5IAI A;  5H8F B;  4GIZ A;  1LFG A;  1LAX A;  1TT1 A;  4Z0I A;  4NF6 A;  3T22 A;  3DRG A;  4DCY A;  4ELQ A;  3KFM A;  1GR2 A;  5HM4 B;  3GLB A;  4THI A;  1ZMG A;  4G8M A;  3MP6 A;  4ZDM A;  2VGQ A;  2GFE A;  2WOL A;  3H6V A;  1MY1 A;  3O97 A;  1LGB C;  1LBB A;  3QYT A;  4NE4 A;  2QS1 A;  1IIW A;  3TKD A;  4MLV A;  4OFO A;  2OWS A;  3PMX A;  4ZEC A;  2ZYM A;  4X1D A;  1XVY A;  2QSX A;  3MVY A;  3UA8 A;  4IO3 A;  4G4P A;  1A99 A;  1MXY A;  3PGF A;  3N26 A;  1ZKB A;  3I6V A;  2W7Y A;  1B7H A;  4DCX A;  2RKM A;  1H76 A;  3FXR A;  5TP9 B;  1OVT A;  4H8J A;  3OSR A;  3CFL A;  2Z8E A;  4NF8 A;  5KCJ A;  3O28 A;  4FJP A;  1M5D A;  3QUF A;  4GXS B;  4F1Y A;  4YKI A;  4G77 A;  3FUZ A;  3H4Z A;  2NVU B;  1XOC A;  3T9V A;  1HSE A;  4FEB A;  2O1L A;  2V93 A;  3KN8 A;  4ECF A;  1XC1 A;  1R9L A;  1IQ7 A;  2NXO A;  2Z23 A;  1II5 A;  3UP9 A;  1MXU A;  4ZZA A;  3V89 B;  3K02 A;  1Y3N A;  2YJP A;  3BFU A;  4KPT A;  5I2K A;  1NH8 A;  1ZBM A;  3W9W A;  1ELJ A;  4WKM A;  1SBP A;  1PB9 A;  4P11 A;  4FAT A;  1QUJ A;  2IEE A;  4QF9 A;  3K6W A;  2XXH A;  4OYV A;  3RGY A;  4BDO A;  4F22 A;  2DE4 A;  1SI0 A;  3OEL A;  4R9G A;  4R74 A;  1Y4C A;  2HQ0 A;  3SDF A;  3IB2 A;  3F11 A;  3O6G A;  5ICT A;  1N04 A;  1MXZ A;  3PPP A;  4EXK A;  3PPN A;  4PFU A;  3OO6 A;  4LQ5 A;  3A3C A;  4R73 A;  4ZS9 A;  4GL8 A;  2QPQ A;  4XKP A;  3LSL A;  1MQH A;  1QUK A;  1Z7N E;  1A55 A;  1GVC A;  2XXT A;  2PMS A;  2REG A;  4GD5 A;  3CR9 A;  4QFL A;  3FVG A;  2XXR A;  4U21 A;  4ELO A;  4YKP A;  5ITP A;  2UVH A;  1NH7 A;  3FAS A;  3IO6 A;  1YAE A;  2F34 A;  3C36 A;  1DTZ A;  1XHY A;  2Q2C A;  3RPW A;  3D4C A;  2PX1 A;  1P1N A;  1JVX A;  4POX A;  1LLS A;  2AL5 A;  3MBP A;  3DRH A;  1R6Z A;  1US4 A;  2ZYN A;  3RUM A;  2R6G E;  4PFY A;  1ZJL A;  3TCH A;  3VE1 B;  4R2F A;  3PV0 E;  3RTW B;  2CMO A;  1URD A;  4NTL A;  3A09 A;  3PUX E;  5I2N B;  2PT1 A;  2VD2 A;  3FD3 A;  5CI5 A;  2F36 A;  3OSQ A;  3TUS A;  3OEN A;  3MWB A;  2O7U A;  2UVG A;  1MRP A;  2R9J A;  1Y3Q A;  4ELR A;  2RF1 A;  4EF1 A;  2E0S A;  3OOA A;  2H25 A;  3U8Q A;  2F6P A;  1SVX B;  3GBB A;  4RPO A;  2F8D A;  1UIU A;  2V3U A;  3K0V A;  4ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...