2Z23A

Crystal structure of y.pestis oligo peptide binding protein oppa with tri-lysine ligand
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
517
structure length
517
Chain Sequence
ANVPTGVQLAEKQVLVRNNGSEPQSLDPHKIEGVPESNISRDLLEGLVINDPNGNIVPGAAESWDNKDFKVWTFNIRKDAKWSNGDPVTAQDFVYSWQRLADPKTVSPYASYLQYAHLTNIDDIITGKAAPDTLGVKALDDHTLEVTLSEPVPYLDKLLAHPLMSPVNKTVVEKFGEKWTQPQNFVGNGAYKLKDWIVNERIVLERSPTYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPDQVHVDPYLCTYYYEINNQKAPFTDARVREALKLGMDRDIIVNKVKNQGDLPAYGFTPPYTSGAELTPPEWFSWTQEKRNEVAKKLLAEAGYTKDNPLKFSLLYNTSDLHKKLAIAAASIWKKNLGVDVKLENQEWKTFLDTRHQGTYDVARAAWCADYNEPSSFLNMMLSNSSNNTTHYKSSVFDKLIEDTLKVKSEKERADLYQQAEIQLDKDSAIVPVFYYVSARLVKPYVGGYTGKDPLDNMHVKDLYIIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of OppA and PstS from Yersinia pestis indicate variability of interactions with transmembrane domains.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Peptide binding protein
molecule keywords Periplasmic oligopeptide-binding protein
total genus 173
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2z23A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z23A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 2z23A02
4KR5A 1MS7A 3K1NA 5L9MA 4JSOA 4EQ7A 3N6TA 2UVJA 1B6HA 3JV9A 3IAZA 3QYTA 4LVQA 3V89B 3MZ9A 3S9EA 4DCYA 4XKNA 2GHBA 3TTRA 4XKQA 3O6IA 3FJGA 3ILUB 1Y4CA 4X9TA 2HXWA 3VLWA 2B65A 4R6YA 4YKKA 1B46A 1Y1ZA 4EUOA 2OZZA 3E3KA 4GVOA 2NUVA 1XVYA 3CRBA 3HO7A 1B3EA 3LSFB 3JZJA 2PT2A 3OD7A 4FEDA 4MLQA 1OQGA 4YKPA 5CMBA 1AL3A 3FXQA 5I56B 1MRPA 4FORA 4LZ8A 3V5AA 1B3FA 3TCGA 3OMBA 5H8FB 3CHGA 1LAHE 3EQ1A 4KD5A 1GVCA 3K4UA 5TPAB 4JBZA 1XOCA 1O64A 1SVXB 4RK9A 5FHMA 3IL1B 2OBGA 4HTGA 4IO6A 2R71A 4F39A 4NTLA 4ZEIA 1FQBA 2P1SA 5CM6A 2ZNUA 3T22A 5F7VA 3KJ7A 3S9NC 3QSLA 3WAFA 2F35A 3OXNA 2RCAA 4BLAA 4GWOA 2F6PA 4AQ4A 3MBPA 2DOJA 1UIVA 4XKRA 2XXWA 2XXPA 3ONMA 3HSTA 3SEYA 2I4BA 2Z8DA 2VD3A 3HHGA 4KHZE 1MXWA 2R6GE 1SW4A 2AL5A 1NNFA 3H3GA 2FYIA 4DXUA 4F19A 5CC2A 1UTHA 5JK4A 2X26A 1LFIA 4OETA 2X7QA 3MP8A 1MXZA 3HPIA 3OO7A 1POY1 4F3BA 3BFTA 2ZXTA 4FEBA 3TQLA 3TTKA 1ANFA 1D9YA 1MXVA 4GLIA 2XHDA 2DP8A 1Y3PA 1YPNA 5I57A 5TU0A 1R9LA 2FA7A 1RKMA 1D3KA 1FQEA 2DWJA 5IAIA 3FIRA 2FNCA 3TDJA 1PDAA 3K0VA 2P0SA 5DT6A 4F3SA 4BDOA 4KCCA 3H03A 2DWIA 3B6QA 1NMUA 2I49A 3CR9A 3EPEA 4P0GA 5I57B 2KLFA 2XXYA 1QJMA 2O1LA 3T96B 1A7LA 1SI0A 4OFLA 3DP8A 2DQVA 3M3LA 1B3HA 4E0XA 2E1SA 2XXXA 3CFXA 3MPKA 4NF6B 2F7BA 4OZ9A 4X1DA 3RUMA 2XXUA 4KFQA 1NFTA 1UTHB 3O9PA 1J1NA 2IEEA 5AA1A 1OVBA 1B4ZA 3USDA 4K3FA 3RY3A 4WKMA 5L8DA 4PFTA 4ZS9A 3UA8A 4AB6A 1Y4TA 3K00A 4O3CA 4KYEA 1MPCA 1MDQA 4LA9A 5I84A 3FJMA 3PUZE 3R6UA 3T9UA 4R9FA 5ELVA 4WEPA 2QS3A 1SDXA 3FXUA 4O3AA 3LSLA 2A5TA 2ZYOA 1LBBA 1MY0A 3MW0A 3UP9A 1N0TA 3KG2A 3Q29A 3TELA 1YCJA 1BTJA 1R6ZA 3Q27A 4NF6A 5TPAA 1MY1A 1SW1A 3MZBA 3RQTA 1GTKA 4TQUQ 5H8FA 4UA8A 4DDDA 1D4NA 3PMXA 3ZKKA 3TCFA 3LBSA 1VSOA 1B7UA 1H76A 2Y7KA 4OEUA 3DLNA 4JXIA 4QSCA 3KN8A 1SW2A 3W9VA 4EDPA 1HSJA 3S9LC 3TKDA 5ICQA 4JWYA 3ILTB 5FTIA 1YTVA 2RINA 1LBCA 2I0CA 5AA3A 1MQJA 3MP6A 4QSEA 5AA4B 2HZKA 4DXBA 2ABHA 3OOAA 4THIA 1SD3A 2HFBA 1O7TA 2NWJA 4C0RA 1DPEA 2GH9A 3QUFA 4H67A 2Q9TA 3VXCA 4LP2B 2CMOA 4U21A 4NF5A 4DCXA 3R7XA 5AE4A 4F2QA 1Y3NA 3E9XA 3PMVA 3GBAA 3D4GA 5AA2A 3ZS6A 3T9VA 4EXLA 3TUSA 1R9QA 4BDRA 4DZ1A 2Q88A 1JEVA 1I6BA 3SEUA 3RT6B 1MQDA 1BP5A 3CG1A 4U2RA 3RYBA 5DYHA 5K2XA 1B5JA 3TTNA 3MVXA 5M2VA 2Z22A 1OMPA 3TAJA 5A5XA 2I3VA 4NF4A 5H8HA 4QFLA 1TFDA 1OIBA 1S50A 4I9DA 1P1OA 3DP4A 3PUYE 4R2FA 2F6GA 5I2NA 2XD2A 1A8EA 1SBPA 3OEMA 3LSXA 4Z7EA 2VGQA 4BDNA 4RA1A 1QUKA 1LFGA 4FJPA 3SETA 2XX7A 3FV1A 3U92A 4G4PA 1B7HA 3TODA 4Q5TA 1M5EA 2QL3A 1S9TA 1FQAA 2DS9A 2G29A 3C36A 2OWTA 4PQJA 3FJ7A 4LUBA 4RK2A 3S4UA 3HV1A 3RNNA 1QW0A 4ESXA 5J1DA 1PEBA 4H1XA 1LCTA 2WKYA 1PB7A 2VHAA 2UVGA 3IO6A 2V25A 1MY4A 4IO7A 4YB5A 1NKXA 3K02A 3O6HA 3U93A 1UQWA 3HCQA 4EQ9A 1N76A 2ZMBA 2H99A 2VP1A 3FD3A 4H65A 4KQPA 1JVYA 1P1UA 4O3BA 3UGWA 4F3PA 4I1DA 3VLUA 3MJNA 4IB2A 3FZVA 3OENA 1P1NA 2F7CA 3FXRA 3N5LA 3N6UA 1MQGA 3Q25A 4GOTA 5H8QB 3VVDA 1VR5A 5B70A 3OEKA 3TQWA 2QMWA 1R1NA 4R9GA 1MM6A 1OLCA 1XS5A 2O7IA 4GF8A 5ISUA 2XXTA 3B6WA 3C9HA 3CVGA 3IORA 2DYXA 1LAGE 1SQYA 3E13X 4ZE8A 1MQIA 4GL0A 4U4SA 2NVUB 3P7IA 4OVJA 5I2KB 3U8QA 2H5YA 2O7UA 2I6EA 2UYFA 5CMCA 3UIFA 5CMKA 1A54A 1FQCA 3H6TA 5EYFA 4PFYA 1IZ1A 4JDFA 2R9JA 2AIXA 3SEWA 3K6WA 3U1OA 3U72A 1Z7NE 3VDFA 1MM7A 4F1VA 4G68C 1ZKBA 1OLAA 2DE4A 3GXAA 3H4ZA 5CRYA 4NF8A 1Y1MA 4QSDA 2DWHA 3OO6A 5CMMA 3FATA 3RN8A 1IUDA 4IO3A 3W15C 4R72A 1LB9A 1ZMGA 4GFRA 1XT8A 4JWOA 1RYXA 4XXUA 5FHOA 3W9WA 1MXYA 3ODBA 1H3DA 4DXCA 2H98A 2O84X 3OSRA 3TCHA 3I5OA 4P0IA 5EHSA 1QUJA 1B3LA 2PYYA 2LAOA 3H6UA 2OWSA 2V93A 1CB6A 2Q2CA 4E0WA 3E4RA 1RYOA 4G68A 1JETA 1MPBA 4RNSA 1D9VA 4QFPA 1NNKA 3LVUA 1S7YA 1UTBB 2P2AA 3KOSA 3C34A 3IK6B 4RPNA 4H6DA 4OXVA 1B58A 2WOLA 1H43A 2HQ0A 3DRIA 3CFLA 4ISUA 1B9JA 5IKBA 4ZZAA 4F22A 1LSTA 2QRYA 1XHYA 3OELA 1B0HA 5JTYA 4ELOA 2AYSA 1VFDA 2REGA 3IOUA 1B05A 4IGTA 3O6GA 2QS1A 3O2AA 3OO8A 1H45A 1B5IA 4YKJA 1IXGA 4F18A 5DVIA 3THIA 5ICTA 1N84A 4ZZEA 3G3FA 3TPAA 5I59A 1B3GA 1GGGA 1TFAA 4H8IA 5KDTA 3CSBA 1GR2A 1Y3QA 2UYEA 2Z8FA 4KPTA 5H8NB 5DTBA 3CI8A 3TTLA 3FVOA 5I58A 1PBQA 4G8MA 3SEXA 3RTFB 4ONYA 1IXHA 2UVHA 3EHTA 2H25A 1ZTYA 3K6UA 4YMBA 4LATA 3PPQA 4BDMA 4PE5B 2B4LA 2RKMA 3DRHA 5BUUA 1USYE 1YAEA 4ELPA 5KCJA 3KN3A 4R6KA 3DRKA 3PD9A 4KCDA 4QFNA 4N6PA 4WXJA 3VV5A 2B4MA 2F97A 4QF9A 2YLNA 4U23A 2O1MA 4DIGA 1LFHA 2VD2A 1JQFA 4ZDMA 4RPOA 3HN0A 4HS7A 5DVFA 1FW0A 2HAVA 2Z23A 3K6VA 2RC9A 4KI0E 4UACA 1TT1A 2HEUA 3MVZA 4R74A 4EQBA 3V83A 1M5CA 1MQHA 4JSDA 3IOTA 2F34A 4POWA 4QFOA 3C31A 4ZE9A 4OMBA 2ZNSA 4TLMB 3PPRA 3VXBA 3FVKA 3M3KA 4OFJA 1I69A 4FE8A 3KSJA 3TTMA 1A8FA 4RY1A 3VE1B 3PAMA 1N7WA 3MP1A 4OWDA 4X1BA 5I59B 2D3IA 4AB5A 4ZEBA 4WEDA 3DM0A 4JWXA 1B40A 4KYSA 3IB1A 5DEXA 2O51A 3ZKLA 4I62A 1LAFE 4Q0CA 1B1XA 3EHSA 3GLBA 1B0LA 1SW5A 5HBCA 4ZEDA 1DTZA 2Y7PA 1JW4A 1SYIA 3B6TA 2QS2A 3IB0A 3MAMA 3T66A 2RC7A 4GD5A 4EF1A 3FUZA 3MC2A 3KBRA 4F1UA 3KFMA 4YB6A 4XTCQ 4LZ7A 3S2VA 4FECA 4C1TA 3LUYA 3AXFA 1CE2A 1EH3A 4QFKA 1A55A 1MPDA 3BBRA 3JYRA 2REJA 1A40A 2X7PA 3K1PA 4G68B 4HCYA 1IIWA 3OO9A 1GV8A 4BDLA 4ESWA 3EHUA 3L6GA 1MH3A 2OCUA 1P1QA 2E0SA 2XXVA 3VVEA 4F1YA 4F2OA 3I6VA 3IX1A 1O63A 3C32A 4ND9A 4POXA 4R6HA 3T9XB 2WOKA 3RTWB 4RJZA 2ZYMA 2O69A 1ZU0A 1HSEA 5TP9B 5TP9A 1QULA 1T0KA 4NWDA 2QPQA 1IQ7A 4YB7A 1I6AA 3K2DA 5AA2D 2DVZA 1XC1A 3C33A 3KGCA 4MLVA 1LGBC 3H7MA 4NF8B 1AIVA 4EF2A 2I0BA 2ONKE 1ZJLA 4M4GA 5FTHA 2RCBA 1JVXA 2XX8A 4X48A 5F1QA 4R2BA 3WAEA 1NNPA 1B1HA 2O68A 4MBPA 4QRZA 3FASA 3VVFA 3RLFE 1VE4A 5B7DA 1EU8A 2V3QA 3UK4A 2DWAA 1NH8A 1M5DA 3QIMA 3CFZA 4R73A 1AH5A 1DOTA 2DVCA 4M1VA 2YPNA 3UN6A 2F78A 2I48A 2ALUA 2Y7WA 1NH7A 3L6HA 1N7XA 2HAUA 4KYDA 4DE8A 1B52A 4RYAA 2PVUA 3PPOA 1B32A 3SEVA 1UTBA 3MQ9A 1IXCA 3IO4A 1N3XA 5HM4B 3B7DA 5H8QA 2M8CA 3MWBA 4GQOA 4TOZA 3A09A 2NOOA 4LZ5A 4YMAA 4LQ2A 1A99A 4H0WA 1NL5A 3LC8A 4NEDA 1UIUA 4Q8RA 4OESA 1DTGA 3UORA 3TYHA 1OQHA 2PBWA 2Q2AA 3A3CA 3N94A 3DRJA 4NMYA 2Y7RA 1L5TA 3TZAA 2Y84A 5LOMA 1AMFA 3FTOA 1DPPA 2XX9A 3ECRA 4G8NA 1US4A 1B4HA 1BLFA 1USYH 2XXIA 2H4IA 2XD3A 3MZ1A 2F36A 3VLVA 3QK6A 1Q1KA 1Y20A 3F11A 1B7ZA 2F5XA 3QUJA 1MXUA 2OLBA 1II5A 4YAHX 2BJJX 4JB7A 3K1MA 1FTKA 2ESNA 1B2HA 2GRVA 2HZLA 4I8CA 1MY3A 1I6QA 2AL4A 4OHNA 4OTEA 3RYAA 3DP6A 2I3WA 3K01A 4G8HA 5H8HB 3C4MA 1PC3A 4F3GA 4N07A 5A5XB 3G3IA 5KCJB 3TFLA 1QUIA 3S9MC 1EZPA 1URDA 1WODA 3GBBA 4YU0A 1Q35A 3EN3A 1FTJA 2Z8EA 2ANJA 4N13A 1B51A 2F8DA 5I2KA 3KZGA 3O6PA 3KN7A 1FTLA 3LR1A 4LONB 2RC8A 5DVJA 4ZEKA 4PFUA 4L17A 3IR1A 4HW8A 4G77A 2I58A 3OSQA 2PT1A 2O6AA 4PETA 4C1UA 3Q28A 4IGRA 1JW5A 1Y9UA 4U1ZA 5DEXB 2Q8JA 3T93B 4OFOA 1POTA 3H6WA 1IXIA 4GL8A 1DMBA 4H5GA 4LQ5A 3MVWA 1EZOA 4DLDA 3G3JA 2DE3A 2UXAA 2ZYNA 3G7WA 1SI1A 5AA4A 4GIZA 3RGYA 3PD8A 4F29A 1ZLQA 3ZSFA 5CBSA 1F9BA 3VFJA 1M5FA 5FHNA 2THIA 3M3FA 3G3KA 1QVSA 2OK2A 5ITPA 3RPWA 4FIMA 3KOTA 1EZ9A 1BIYA 1P99A 3IJOB 3PV0E 2V3TA 2D5WA 3BFUA 4NE4A 3IB2A 4OERA 4ZECA 3I3VA 1ZIUA 4NWCA 3TEPA 1KWHA 3G3GA 1P1WA 3QAXA 3O66A 1DSNA 3MPLA 2QMXA 3PU5A 4IY5A 4FATA 4ELQA 5I2NB 1LB8A 5ITOA 2DXRA 4H8JA 3U94A 4FAJA 1LCFA 1ATGA 3CG3A 2A5TB 4U22A 3RT8A 4NF4B 4OEVA 1JEUA 5CI5A 5BWJA 2IA4A 1URSA 1LLSA 2OJTA 4ZEFA 4XIGQ 4PFWA 1TWYA 1BKAA 1QKBA 1FTMA 1JW1A 2B3BA 2G93A 2PX1A 4U4XA 3IJXB 3DRGA 4YICA 1IEJA 5I58B 2RF1A 1QKAA 1HSLA 1US5A 5AA2B 3FVNA 3A3UA 3D4CA 4RXLA 2HCAA 5H8NA 5L9SA 1IITA 3FGSA 2QJEA 4H5FA 4OQOA 4YKIA 5KDTB 4NF5B 3M8UA 2VOZA 2ONRA 2I4CA 3TMGA 5KZTA 3V8XB 2XXQA 2DXYA 3C35A 4Q30B 3HHFA 3MUQA 3IOVA 2D21A 1URGA 4R75A 4IO4A 4Z0IA 4F31B 1AOVA 1LAXA 3PGFA 5JTYB 5JEIA 3QXMA 1N04A 4ECFA 4EXKA 1OVTA 3PPNA 4MFIA 1WDNA 3FV2A 1XVXA 1NNTA 5K2YA 3SESA 5EHMA 4GXSB 4P11A 2UVIA 1Z7ME 1H44A 2PMSA 2Q89A 2GFEA 2H9BA 3KJTA 3Q26A 3T9HB 3O28A 2NXOA 3K6XA 4OENA 4U1OA 1FQDA 3CSGA 3GZGA 2Y7IA 2DE2A 3MVYA 2A5SA 2WOPA 3PUXE 5L9OA 4GXAA 1PBPA 3DRFA 2XXRA 1FQFA 3N26A 1FTOA 3CIJA 3EF7A 4PP0A 2QS4A 1MY2A 5CBRA 3DELB 3H06B 1JNFA 1B5HA 4TLLB 5H8SA 1PB9A 1ELJA 4IY6A 4BDQA 2V3UA 4OYVA 3PMWA 3PUWE 4IO2A 1MH4A 2B3FA 4HCWA 2W7YA 2ZNTA 2CZLA 3R26A 1N3WA 3O97A 5HPQA 2ONSA 1PB8A 1FCKA 2QSXA 3PPPA 2DSFA 3KSXA 3BKIB 4ELRA 1TXFA 4QHQA 3SDFA 4MH5A 1MG1A 5I56A 3G3HA 3PUVE 4GRKA 4YZZA 4XKPA 2GHAA 4G2ZA 3O29A 1ZBMA 3KEIA 1VFEA 3IOWA 1MDP1 1WVJA 2XXHA 3LSWA 1SYHA 1MXXA 2F7AA 2V84A 2YJPA 3SERA 3SKPA 1M5BA 2ZYKA 3FVGA 3H6VA 4MF3A 4IO5A
chains in the Genus database with same CATH superfamily
4JSOA 1D9QA 2UVJA 2Y5LA 3S9EA 3MZ9A 4XKQA 3O6IA 4X9TA 4EUOA 3CRBA 3HO7A 3LSFB 3JZJA 4YKPA 3OD7A 4FORA 4NX1A 1XOCA 1SVXB 5FHMA 4DI3D 4NTLA 4ZEIA 3T22A 5F7VA 3S9NC 3WAFA 3OXNA 4BLAA 3MBPA 3SEYA 3UK4A 1RDYA 2AL5A 5JK4A 4DXUA 3MP8A 4F3BA 1FPLA 1POY1 2DP8A 1NV4A 3K0VA 1NMUA 1QJMA 2O1LA 1FPDA 2DQVA 4PGNA 3CFXA 2XA5A 4NF6B 2F7BA 4OZ9A 3O9PA 1J1NA 2IEEA 1EYKA 3USDA 4K3FA 4AB6A 4ZS9A 3K00A 1MPCA 1MDQA 4R9FA 5ELVA 4NQ8A 2ZYOA 3MW0A 3UP9A 1N0TA 3Q29A 1YCJA 1CNQA 4NAPA 2FVZA 5H8FA 1VSOA 3W9VA 1SW2A 3S9LC 2XWOA 3TKDA 2XWKA 1YTVA 1LBCA 1MQJA 5AA4B 2ABHA 2NWJA 4C0RA 1DPEA 4H67A 3VXCA 4LP2B 2CMOA 4DCXA 3PTYA 4MNCA 3T9VA 2Q88A 3SEUA 5DYHA 3CG1A 4U2RA 3TTNA 1B5JA 3MVXA 5H8HA 4QFLA 1S50A 1P1OA 4R2FA 2F6GA 5I2NA 5EQ8A 2VGQA 4BDNA 4FJPA 4XEQA 3FV1A 2HHMA 5IZ3A 3C36A 1S9TA 2G29A 1FPFA 1NKXA 3FD3A 4KQPA 1P1NA 3OEKA 1MM6A 5ISUA 2NVUB 4U4SA 5I2KB 2H5YA 2I6EA 1FQCA 2QVUA 3H6TA 4PFYA 3SEWA 3U72A 1MM7A 2XWIA 3W15C 4R72A 4JVDA 4DXCA 2H98A 3OSRA 3TCHA 3I5OA 2PYYA 2LAOA 2ZZXA 2OWSA 4O8MA 4GWYA 1NNKA 3C34A 4OXVA 1B58A 4GWZA 5IKBA 1B9JA 1LSTA 1B0HA 2REGA 4IGTA 1FSAA 1H45A 1B5IA 4X04A 5I59A 1B3GA 3CSBA 1GR2A 2UYEA 2Z8FA 4KPTA 5H8NB 4ONYA 2UVHA 3EHTA 2H25A 4LATA 2B4LA 1USYE 5KCJA 3KN3A 4R6KA 4N6PA 4KCDA 2B4MA 1NUYA 4U23A 4DIGA 1FPBA 5I7IA 2Z23A 2RC9A 1NV7A 4EQBA 4R74A 1M5CA 3IOTA 2CZHA 4ZE9A 3PPRA 3VXBA 3M3KA 4FE8A 1I69A 3TTMA 1A8FA 4RY1A 3VE1B 3PAMA 3MP1A 4X1BA 5I59B 1INPA 2D3IA 3DM0A 5DEXA 5HBCA 1B0LA 4ZEDA 1DTZA 3B6TA 4GD5A 4EF1A 3KFMA 4PFIA 4YB6A 2CEYA 3S2VA 4FECA 4C1TA 3BBRA 4BDLA 1GV8A 4N81A 2OCUA 3IX1A 1O63A 4ND9A 4POXA 3T9XB 2WOKA 3RTWB 1ZU0A 5TP9B 2L5VA 1IQ7A 1I6AA 5AA2D 3C33A 1XC1A 1IMCA 1LGBC 2I0BA 2ONKE 1ZJLA 2VPOA 4X48A 4R2BA 1NNPA 1B1HA 4MBPA 4QRZA 2DVCA 3UN6A 4DE8A 4N6DA 1B32A 3B7DA 3MWBA 2NOOA 4LZ5A 4OANA 4XFEA 1A99A 4H0WA 1UIUA 4Q8RA 3TYHA 1OQHA 2Q2AA 1AMFA 1DPPA 1USYH 2WYPA 1Q1KA 1B7ZA 2F5XA 4YAHX 2OLBA 2HZLA 1I6QA 3RYAA 5H8HB 5A5XB 5KCJB 4YU0A 1Q35A 2ANJA 4N13A 1B51A 2JJKA 3O6PA 4NN3A 2I58A 2O6AA 5DEXB 4OFOA 1POTA 3MVWA 3G3JA 4MEVA 1ZLQA 5CBSA 2OWZA 3VFJA 3M3FA 2MKZA 1FBHA 3KOTA 1P99A 1BIYA 3PV0E 4NE4A 2V3TA 2D5WA 1ZIUA 3SEXA 1P1WA 3QAXA 3PU5A 4IY5A 4FATA 1LB8A 5ITOA 3CG3A 2WYKA 3RT8A 4G61A 5CI5A 4OVPA 1IMDA 1FTMA 2B3BA 3IJXB 1IEJA 2RF1A 5AA2B 3D4CA 4YKIA 5KDTB 3TMGA 3V8XB 2D21A 1FTAA 1NV5A 3PGFA 3KC0A 1OVTA 3PPNA 5IZZA 4NF0A 1Z7ME 3T9HB 3KJTA 2GFEA 3Q26A 1FQDA 3CSGA 1PBPA 4PFRA 2Q74A 5CBRA 5EQAA 1B5HA 2V3UA 3HFUA 2CZLA 2ONSA 1PB8A 3BKIB 1TXFA 4QHQA 2HPGA 3PUVE 4P9KA 1FPKA 1K9YA 1ZBMA 3IOWA 3E78A 1MDP1 1WVJA 1SYHA 2V84A 4KR5A 1MS7A 4OVRA 4LVQA 2GHBA 3TTRA 4N8GA 1XVYA 4FEDA 5I56B 1MRPA 3V5AA 1B3FA 3CHGA 1LAHE 3EQ1A 4KD5A 3GYYA 3K4UA 2OBGA 4F39A 1QGXA 2ZNUA 1LBWA 3QSLA 2BJIA 1FPGA 2F35A 5ET6A 2RCAA 1VDWA 4XKRA 2XXWA 2XXPA 3ONMA 2I4BA 2Z8DA 2VD3A 1DBZA 1SW4A 2FYIA 1UTHA 4PTKA 2X26A 4OETA 1MXZA 3HPIA 4I40A 2ZXTA 1ANFA 4GLIA 2XHDA 5I57A 4GWXA 1D3KA 3FIRA 2FNCA 5DT6A 4F3SA 4BDOA 3V83A 2DWIA 3B6QA 2I49A 5I57B 2KLFA 1A7LA 4OFLA 3M3LA 3MPKA 2Y5KA 3RUMA 2XXUA 1UTHB 1B4ZA 3RY3A 4PFTA 4N17A 1Y4TA 5I84A 4WEPA 2F3DA 2A5TA 1MY0A 2R8TA 3KG2A 3Q27A 1R6ZA 4NF6A 3RQTA 4TQUQ 4DDDA 3ZKKA 1B7UA 3DLNA 4QSCA 4XF5A 5FTIA 3ILTB 3OOAA 1DK4A 1KA1A 4NF5A 5AE4A 1FJ6A 3R7XA 3PMVA 3D4GA 2FBPA 1BP5A 5M2VA 2I3VA 4NF4A 4GX3A 3OEMA 1A8EA 3SETA 1LFGA 2XX7A 3U92A 4G4PA 4GBVA 4NG7A 1B7HA 1M5EA 3T0JA 1FQAA 4PQJA 4RK2A 3FJ7A 3S4UA 1QW0A 4IO7A 3U93A 1UQWA 2VP1A 1P1UA 4O3BA 3UGWA 4I1DA 3FZVA 3OENA 1VR5A 2O7IA 4GL0A 1SQYA 4ZE8A 3P7IA 4OVJA 3U8QA 3UIFA 2UYFA 1IZ1A 5IM2A 1OLAA 2DE4A 3H4ZA 4NF8A 4QSDA 5LTCA 3OO6A 3FATA 3RN8A 1ZMGA 4XXUA 2O84X 2V93A 4E0WA 3E4RA 4G68A 1MPBA 2KQZA 2PFYA 4QFPA 1S7YA 1UTBB 3IK6B 3QMFA 2WOLA 4F22A 1XHYA 5EQ9A 1VFDA 4OVTA 3O6GA 4F18A 1RDXA 5DVIA 3THIA 1N84A 4ZZEA 2V4CA 1GGGA 4HXVA 3TTLA 4YMBA 5BUUA 3DRHA 4ELPA 1IMAA 4QFNA 1LBXA 2YLNA 2O1MA 2VD2A 4RPOA 1FW0A 3K6VA 3C31A 2ZNSA 5ET5A 3FXBA 4ZEBA 4WEDA 1B40A 4KYSA 1LAFE 4Q0CA 3RYDA 1SW5A 1SYIA 2QS2A 2RC7A 3MC2A 5EYGA 4F1UA 3LUYA 1CE2A 1MPDA 1A55A 3JYRA 4HCYA 1IIWA 3OO9A 4P47A 3VVEA 1MH3A 2XXVA 4F1YA 4F2OA 4PDHA 3EKIA 2ZYMA 1T0KA 1HSEA 5TP9A 4NWDA 4YB7A 3K2DA 4MLVA 3IFCA 3H7MA 4LN5A 1JVXA 2XX8A 4O7IA 3FASA 3VVFA 3RLFE 5B7DA 4R73A 2YPNA 3LV0A 2F78A 2I48A 2ALUA 4MHFA 1N7XA 4RYAA 5IGAA 1UTBA 5H8QA 5HM4B 4GBWA 4TOZA 3U65A 4YMAA 4LQ2A 1NI9A 3LC8A 4OESA 4QBAA 3DRJA 3TZAA 1L5TA 4N6KA 3QK6A 3F11A 2BJJX 3K1MA 2ESNA 1MY3A 4OTEA 2I3WA 4AS4A 1URDA 4L17A 3KC1A 4HW8A 2HXRA 4PETA 4IGRA 2KR0A 1IXIA 4GL8A 4H5GA 4DLDA 2DE3A 1FBFA 3G7WA 4OA4A 4GIZA 3RGYA 1F9BA 2THIA 3G3KA 3IB2A 4OERA 1KWHA 3O66A 1DSNA 3MPLA 2QMXA 2DDKA 1KZ8A 2DXRA 3U94A 4FAJA 1JEUA 2IA4A 4PFWA 1JW1A 2G93A 4JVIA 1FRPA 3DRGA 4YICA 5I58B 5LDZA 1HSLA 1US5A 3RPLB 3B8BA 1IITA 4H5FA 2QJEA 1NV1A 2ONRA 2XXQA 2DXYA 3HHFA 4R75A 1AOVA 5JTYB 5JEIA 3QXMA 1WDNA 3SESA 4GXSB 1H44A 2CEXA 2PMSA 2Q89A 2H9BA 3O28A 3K6XA 4OENA 2Y7IA 5L9OA 4GXAA 4MAGA 4KXPA 3EF7A 2PFZA 2QS4A 1MY2A 3H06B 5IZ3B 4TLLB 3MSTA 1PB9A 3PMWA 2W7YA 2QSXA 2DSFA 3KSXA 3SDFA 3G3HA 5F24A 2YJPA 1M5BA 3H6VA 3OMBA 3K1NA 1B6HA 3V89B 4DCYA 4MMPA 4XKNA 3ILUB 1B46A 5EQ7A 4MLQA 2PT2A 1AL3A 3FXQA 1NV6A 4LZ8A 3TCGA 5H8FB 1GVCA 5TPAB 1O64A 3IL1B 4NGUA 4HTGA 1LBYA 1FQBA 2P1SA 2OX3A 3KJ7A 4AQ4A 2DOJA 3HHGA 1MXWA 4F19A 1NNFA 1FPIA 5CC2A 3BFTA 4FEBA 3TTKA 1FPJA 1D9YA 1MXVA 1Y3PA 1R9LA 2FA7A 1K9ZA 1PDAA 2Q8MA 4KCCA 3H03A 4P0GA 2XXYA 3T96B 1SI0A 4E0XA 1B3HA 4X1DA 4PDDA 1NFTA 5AA1A 3UA8A 4WKMA 4O3CA 4O7MA 2QS3A 3FXUA 4MJOA 4AS5A 4O3AA 3LSLA 2P3NA 3SZPA 1MY1A 3MZBA 3A29A 1D4NA 3LBSA 4HE2A 4DI4B 2Y7KA 4JXIA 3KN8A 4EDPA 1HSJA 2ZZVA 2RINA 2I0CA 5AA3A 2HFBA 1O7TA 3QUFA 2Q9TA 3E9XA 3RPLA 5EYHA 1R9QA 4DZ1A 1I6BA 3RT6B 5K2XA 2Z22A 1FBGA 1OIBA 3PUYE 4I9DA 3DP4A 4Z7EA 3LSXA 4RA1A 1QUKA 4Q5TA 2QL3A 1NV2A 2OWTA 4ESXA 3HV1A 1PEBA 1LCTA 4MIJA 2VHAA 2UVGA 3IO6A 4JVCA 3O6HA 4EQ9A 3HCQA 2ZMBA 4F3PA 4IB2A 3VVDA 4GOTA 5H8QB 1KA0A 1XS5A 4GF8A 1NUWA 3CVGA 3B6WA 3TODA 1LAGE 4MCOA 2O7UA 2CZIA 5EYFA 4JDFA 2R9JA 3U1OA 4F1VA 4G68C 4UABA 3GXAA 1Y1MA 5CMMA 2DWHA 1LB9A 4JWOA 3W9WA 1MXYA 5A5LA 3ODBA 4PFBA 1H3DA 4P0IA 5EHSA 1QUJA 3H6UA 1RYOA 2P2AA 4YKJA 4RPNA 3DRIA 4ISUA 4ZZAA 4GX6A 5JTYA 3IOUA 1B05A 1IXGA 3G3FA 3TPAA 1Y3QA 2PCRA 5DTBA 3FVOA 3B50A 1ZTYA 4BDMA 4PE5B 1YAEA 3FBPA 4QF9A 1JQFA 2HAVA 4KI0E 2VPNA 1NV0A 1TT1A 2HEUA 1MQHA 5J16A 4JSDA 2F34A 4POWA 4QFOA 4OMBA 4TLMB 4I3EA 3FVKA 3BIGA 1N7WA 4AB5A 3IB1A 2O51A 1B1XA 3GLBA 2Y7PA 3T66A 2QVVA 3KBRA 2WX9A 3E79A 1IMEA 3AXFA 4G68B 3ROJA 2REJA 2X7PA 4X8RA 1P1QA 3I6VA 4R6HA 1QULA 2QPQA 2DVZA 1AIVA 5ESYA 2RCBA 5F1QA 2O68A 1VE4A 1EU8A 2V3QA 2DWAA 1NH8A 4M1VA 1YYZA 2Y7WA 4PC9A 1B52A 2PVUA 3PPOA 2FIEA 3SEVA 3MQ9A 3IO4A 2M8CA 3A09A 1JP4A 1NL5A 4NEDA 3UORA 3A3CA 2WBDA 3N94A 2Y7RA 3FTOA 2XX9A 1US4A 2XXIA 1G0HA 1Y20A 1MXUA 1II5A 4P3LA 1NUZA 2GRVA 4I8CA 1FBCA 4OHNA 3K01A 3C4MA 1PC3A 4N07A 3G3IA 3S9MC 3TFLA 1EZPA 1WODA 3EN3A 5I2KA 2F8DA 5I5PA 3KZGA 3LR1A 4LONB 4ZEKA 3IR1A 4G77A 3OSQA 2PT1A 4C1UA 1Y9UA 5IZ1A 1DMBA 5FHNA 2OK2A 3RPWA 4FIMA 3IJOB 4BDRA 3BFUA 4ZECA 3I3VA 4ELQA 4H8JA 1LCFA 2P3VA 1ATGA 4U22A 1FJ9A 4NF4B 4OEVA 1AWBA 5BWJA 1URSA 4ZEFA 1TWYA 1BKAA 1QKBA 4GWSA 1QKAA 3FVNA 5L9SA 4RXLA 4OQOA 4NF5B 3M8UA 2VOZA 2I4CA 5KZTA 3C35A 4IR8A 1IMFA 3MUQA 1URGA 4Z0IA 4IO4A 4F31B 4P1EA 1N04A 4FBPA 4ECFA 4MFIA 2UVIA 2NXOA 4U1OA 3GZGA 3MVYA 2WOPA 2FIXA 4N4UA 2QVRA 4PP0A 2XXKA 1JNFA 5H8SA 1ELJA 4IO2A 3R26A 3O97A 3PPPA 4ELRA 5FBPA 4MH5A 2ZZWA 5I56A 4GRKA 1LBZA 4G2ZA 3O29A 3KEIA 2XXHA 3LSWA 3SKPA 1MXXA 3SERA 2ZYKA 3FVGA 4MF3A 4IO5A 5L9MA 4EQ7A 3N6TA 3JV9A 3IAZA 3QYTA 3FJGA 1Y4CA 2HXWA 3VLWA 2B65A 4R6YA 4YKKA 1Y1ZA 2OZZA 3E3KA 4GVOA 2NUVA 1B3EA 1OQGA 5CMBA 4H45A 1FBDA 4JBZA 4RK9A 4IO6A 2R71A 5CM6A 4GWOA 2F6PA 1UIVA 3HSTA 2WBBA 4KHZE 1DCUA 2R6GE 4PF8A 3H3GA 4OVQA 1LFIA 2X7QA 3OO7A 3TQLA 3ISPA 1YPNA 5TU0A 1RKMA 1FQEA 2DWJA 5IAIA 3TDJA 2P0SA 3CR9A 3EPEA 4GWWA 3DP8A 2E1SA 2XXXA 4KFQA 1OVBA 4P8BA 5L8DA 1G0IA 4KYEA 3MYUA 4LA9A 3FJMA 3PUZE 3R6UA 3T9UA 4PF6A 1SDXA 4PCDA 4O94A 1LBBA 3TELA 1BTJA 5TPAA 1SW1A 1GTKA 4UA8A 3PMXA 3TCFA 4PE3A 4HE0A 1H76A 4OEUA 5ICQA 4JWYA 3MP6A 4QSEA 2HZKA 4DXBA 1SPIA 4THIA 1SD3A 2GH9A 4U21A 4F2QA 1Y3NA 3GBAA 5AA2A 3ZS6A 4EXLA 3TUSA 1JEVA 1MQDA 3RYBA 1OMPA 3TAJA 5A5XA 1TFDA 2XD2A 1SBPA 4PGPA 2DS9A 1FBPA 4LUBA 5J1DA 3RNNA 1Q9DA 4H1XA 2WKYA 1PB7A 2V25A 1MY4A 4YB5A 3K02A 1N76A 2H99A 4H65A 1JVYA 3VLUA 3MJNA 3Q25A 5ET7A 2F7CA 3FXRA 3N5LA 3N6UA 1MQGA 5ET8A 1EYJA 5B70A 3TQWA 2QMWA 1R1NA 4R9GA 1OLCA 3IORA 2XXTA 3C9HA 2DYXA 3E13X 1MQIA 5CMCA 1A54A 2AIXA 3K6WA 1Z7NE 3VDFA 1ZKBA 5CRYA 4N91A 1IUDA 4IO3A 4GFRA 1XT8A 5FHOA 1RYXA 4PBHA 3IFAA 1XI6A 1B3LA 4PAKA 1CB6A 1EYIA 2Q2CA 1JETA 4RNSA 1D9VA 3KOSA 3LVUA 2XWVA 4H6DA 1H43A 2HQ0A 3CFLA 2QRYA 3OELA 4ELOA 2AYSA 2QS1A 3O2AA 3OO8A 1NUXA 5ICTA 4PAFA 2F3BA 4H8IA 1TFAA 1YZ0A 2CZKA 5KDTA 3CI8A 1LEVA 5I58A 1IMBA 1PBQA 4G8MA 3RTFB 1IXHA 3K6UA 5I3SA 3PPQA 4GWUA 2RKMA 3DRKA 3PD9A 4WXJA 3VV5A 2F97A 4MX6A 1LFHA 4ZDMA 3HN0A 4HS7A 5DVFA 4UACA 3MVZA 5DW8A 4OFJA 3KSJA 4OWDA 3NOHA 4JWXA 4OVSA 3ZKLA 4I62A 3EHSA 1JW4A 3MAMA 3IB0A 3FUZA 4XTCQ 1FPEA 4LZ7A 1EH3A 4QFKA 3K1PA 1A40A 3LUZA 4ESWA 2GQ1A 3EHUA 3L6GA 2E0SA 3T1BA 3C32A 4H46A 4RJZA 2O69A 2VT5A 3KGCA 4NF8B 4EF2A 4M4GA 5FTHA 2QFLA 3WAEA 1LBVA 1M5DA 3QIMA 3CFZA 1AH5A 1DOTA 1NH7A 3L6HA 2HAUA 4KYDA 1IXCA 1N3XA 4GQOA 5T3JA 2WEFA 1DTGA 2PBWA 4NMYA 4PBQA 5LOMA 2Y84A 3ECRA 4G8NA 1B4HA 1BLFA 3MZ1A 2H4IA 2XD3A 3VLVA 2F36A 1RDZA 4HE1A 3QUJA 4JB7A 1FTKA 1B2HA 4EXKA 2AL4A 3DP6A 4NHBA 4G8HA 4F3GA 1QUIA 3GBBA 1FTJA 2Z8EA 4P1LA 3KN7A 1FTLA 2RC8A 5DVJA 4PFUA 3Q28A 1JW5A 4U1ZA 3T93B 2Q8JA 3H6WA 1YXIA 4LQ5A 1EZOA 2UXAA 2ZYNA 5AA4A 1SI1A 3PD8A 4F29A 3ZSFA 1M5FA 3D1RA 1QVSA 5ITPA 1EZ9A 4QXDA 4NWCA 3TEPA 3G3GA 4N15A 5I2NB 4N8YA 2A5TB 1BK4A 4MNPA 1LLSA 2OJTA 4XIGQ 2PX1A 4U4XA 4MNIA 3A3UA 2HCAA 5H8NA 3FGSA 4Q30B 3IOVA 1LAXA 2FHYA 3FV2A 5K2YA 1XVXA 1NNTA 1NV3A 5EHMA 4P11A 4P56A 1FBEA 2DE2A 3PUXE 2A5SA 3DRFA 4PAIA 2XXRA 1FQFA 3KBZA 3N26A 1FTOA 3CIJA 3BIHA 4GX4A 3DELB 4IY6A 4BDQA 4OYVA 3PUWE 1MH4A 2B3FA 4HCWA 2ZNTA 1N3WA 5HPQA 1FCKA 4I3YA 1MG1A 4YZZA 4XKPA 2GHAA 1VFEA 2F7AA 5CMKA
chains in the Genus database with same CATH topology
4KR5A 1MS7A 3K1NA 5L9MA 4JSOA 4EQ7A 3N6TA 2UVJA 1B6HA 3JV9A 3IAZA 3QYTA 4LVQA 3V89B 3MZ9A 3S9EA 4DCYA 4XKNA 2GHBA 3TTRA 4XKQA 3O6IA 3FJGA 3ILUB 1Y4CA 4X9TA 2HXWA 3VLWA 2B65A 4R6YA 4YKKA 1B46A 1Y1ZA 4EUOA 2OZZA 3E3KA 4GVOA 2NUVA 1XVYA 3CRBA 3HO7A 1B3EA 3LSFB 3JZJA 2PT2A 3OD7A 4FEDA 4MLQA 1OQGA 4YKPA 5CMBA 1AL3A 3FXQA 5I56B 1MRPA 4FORA 4LZ8A 3V5AA 1B3FA 3TCGA 3OMBA 5H8FB 3CHGA 1LAHE 3EQ1A 4KD5A 1GVCA 3K4UA 5TPAB 4JBZA 1XOCA 1O64A 1SVXB 4RK9A 5FHMA 3IL1B 2OBGA 4HTGA 4IO6A 2R71A 4F39A 4NTLA 4ZEIA 1FQBA 2P1SA 5CM6A 2ZNUA 3T22A 5F7VA 3KJ7A 3S9NC 3QSLA 3WAFA 2F35A 3OXNA 2RCAA 4BLAA 4GWOA 2F6PA 4AQ4A 3MBPA 2DOJA 1UIVA 4XKRA 2XXWA 2XXPA 3ONMA 3HSTA 3SEYA 2I4BA 2Z8DA 2VD3A 3HHGA 4KHZE 1MXWA 2R6GE 1SW4A 2AL5A 1NNFA 3H3GA 2FYIA 4DXUA 4F19A 5CC2A 1UTHA 5JK4A 2X26A 1LFIA 4OETA 2X7QA 3MP8A 1MXZA 3HPIA 3OO7A 1POY1 4F3BA 3BFTA 2ZXTA 4FEBA 3TQLA 3TTKA 1ANFA 1D9YA 1MXVA 4GLIA 2XHDA 2DP8A 1Y3PA 1YPNA 5I57A 5TU0A 1R9LA 2FA7A 1RKMA 1D3KA 1FQEA 2DWJA 5IAIA 3FIRA 2FNCA 3TDJA 1PDAA 3K0VA 2P0SA 5DT6A 4F3SA 4BDOA 4KCCA 3H03A 2DWIA 3B6QA 1NMUA 2I49A 3CR9A 3EPEA 4P0GA 5I57B 2KLFA 2XXYA 1QJMA 2O1LA 3T96B 1A7LA 1SI0A 4OFLA 3DP8A 2DQVA 3M3LA 1B3HA 4E0XA 2E1SA 2XXXA 3CFXA 3MPKA 4NF6B 2F7BA 4OZ9A 4X1DA 3RUMA 2XXUA 4KFQA 1NFTA 1UTHB 3O9PA 1J1NA 2IEEA 5AA1A 1OVBA 1B4ZA 3USDA 4K3FA 3RY3A 4WKMA 5L8DA 4PFTA 4ZS9A 3UA8A 4AB6A 1Y4TA 3K00A 4O3CA 4KYEA 1MPCA 1MDQA 4LA9A 5I84A 3FJMA 3PUZE 3R6UA 3T9UA 4R9FA 5ELVA 4WEPA 2QS3A 1SDXA 3FXUA 4O3AA 3LSLA 2A5TA 2ZYOA 1LBBA 1MY0A 3MW0A 3UP9A 1N0TA 3KG2A 3Q29A 3TELA 1YCJA 1BTJA 1R6ZA 3Q27A 4NF6A 5TPAA 1MY1A 1SW1A 3MZBA 3RQTA 1GTKA 4TQUQ 5H8FA 4UA8A 4DDDA 1D4NA 3PMXA 3ZKKA 3TCFA 3LBSA 1VSOA 1B7UA 1H76A 2Y7KA 4OEUA 3DLNA 4JXIA 4QSCA 3KN8A 1SW2A 3W9VA 4EDPA 1HSJA 3S9LC 3TKDA 5ICQA 4JWYA 3ILTB 5FTIA 1YTVA 2RINA 1LBCA 2I0CA 5AA3A 1MQJA 3MP6A 4QSEA 5AA4B 2HZKA 4DXBA 2ABHA 3OOAA 4THIA 1SD3A 2HFBA 1O7TA 2NWJA 4C0RA 1DPEA 2GH9A 3QUFA 4H67A 2Q9TA 3VXCA 4LP2B 2CMOA 4U21A 4NF5A 4DCXA 3R7XA 5AE4A 4F2QA 1Y3NA 3E9XA 3PMVA 3GBAA 3D4GA 5AA2A 3ZS6A 3T9VA 4EXLA 3TUSA 1R9QA 4BDRA 4DZ1A 2Q88A 1JEVA 1I6BA 3SEUA 3RT6B 1MQDA 1BP5A 3CG1A 4U2RA 3RYBA 5DYHA 5K2XA 1B5JA 3TTNA 3MVXA 5M2VA 2Z22A 1OMPA 3TAJA 5A5XA 2I3VA 4NF4A 5H8HA 4QFLA 1TFDA 1OIBA 1S50A 4I9DA 1P1OA 3DP4A 3PUYE 4R2FA 2F6GA 5I2NA 2XD2A 1A8EA 1SBPA 3OEMA 3LSXA 4Z7EA 2VGQA 4BDNA 4RA1A 1QUKA 1LFGA 4FJPA 3SETA 2XX7A 3FV1A 3U92A 4G4PA 1B7HA 3TODA 4Q5TA 1M5EA 2QL3A 1S9TA 1FQAA 2DS9A 2G29A 3C36A 2OWTA 4PQJA 3FJ7A 4LUBA 4RK2A 3S4UA 3HV1A 3RNNA 1QW0A 4ESXA 5J1DA 1PEBA 4H1XA 1LCTA 2WKYA 1PB7A 2VHAA 2UVGA 3IO6A 2V25A 1MY4A 4IO7A 4YB5A 1NKXA 3K02A 3O6HA 3U93A 1UQWA 3HCQA 4EQ9A 1N76A 2ZMBA 2H99A 2VP1A 3FD3A 4H65A 4KQPA 1JVYA 1P1UA 4O3BA 3UGWA 4F3PA 4I1DA 3VLUA 3MJNA 4IB2A 3FZVA 3OENA 1P1NA 2F7CA 3FXRA 3N5LA 3N6UA 1MQGA 3Q25A 4GOTA 5H8QB 3VVDA 1VR5A 5B70A 3OEKA 3TQWA 2QMWA 1R1NA 4R9GA 1MM6A 1OLCA 1XS5A 2O7IA 4GF8A 5ISUA 2XXTA 3B6WA 3C9HA 3CVGA 3IORA 2DYXA 1LAGE 1SQYA 3E13X 4ZE8A 1MQIA 4GL0A 4U4SA 2NVUB 3P7IA 4OVJA 5I2KB 3U8QA 2H5YA 2O7UA 2I6EA 2UYFA 5CMCA 3UIFA 5CMKA 1A54A 1FQCA 3H6TA 5EYFA 4PFYA 1IZ1A 4JDFA 2R9JA 2AIXA 3SEWA 3K6WA 3U1OA 3U72A 1Z7NE 3VDFA 1MM7A 4F1VA 4G68C 1ZKBA 1OLAA 2DE4A 3GXAA 3H4ZA 5CRYA 4NF8A 1Y1MA 4QSDA 2DWHA 3OO6A 5CMMA 3FATA 3RN8A 1IUDA 4IO3A 3W15C 4R72A 1LB9A 1ZMGA 4GFRA 1XT8A 4JWOA 1RYXA 4XXUA 5FHOA 3W9WA 1MXYA 3ODBA 1H3DA 4DXCA 2H98A 2O84X 3OSRA 3TCHA 3I5OA 4P0IA 5EHSA 1QUJA 1B3LA 2PYYA 2LAOA 3H6UA 2OWSA 2V93A 1CB6A 2Q2CA 4E0WA 3E4RA 1RYOA 4G68A 1JETA 1MPBA 4RNSA 1D9VA 4QFPA 1NNKA 3LVUA 1S7YA 1UTBB 2P2AA 3KOSA 3C34A 3IK6B 4RPNA 4H6DA 4OXVA 1B58A 2WOLA 1H43A 2HQ0A 3DRIA 3CFLA 4ISUA 1B9JA 5IKBA 4ZZAA 4F22A 1LSTA 2QRYA 1XHYA 3OELA 1B0HA 5JTYA 4ELOA 2AYSA 1VFDA 2REGA 3IOUA 1B05A 4IGTA 3O6GA 2QS1A 3O2AA 3OO8A 1H45A 1B5IA 4YKJA 1IXGA 4F18A 5DVIA 3THIA 5ICTA 1N84A 4ZZEA 3G3FA 3TPAA 5I59A 1B3GA 1GGGA 1TFAA 4H8IA 5KDTA 3CSBA 1GR2A 1Y3QA 2UYEA 2Z8FA 4KPTA 5H8NB 5DTBA 3CI8A 3TTLA 3FVOA 5I58A 1PBQA 4G8MA 3SEXA 3RTFB 4ONYA 1IXHA 2UVHA 3EHTA 2H25A 1ZTYA 3K6UA 4YMBA 4LATA 3PPQA 4BDMA 4PE5B 2B4LA 2RKMA 3DRHA 5BUUA 1USYE 1YAEA 4ELPA 5KCJA 3KN3A 4R6KA 3DRKA 3PD9A 4KCDA 4QFNA 4N6PA 4WXJA 3VV5A 2B4MA 2F97A 4QF9A 2YLNA 4U23A 2O1MA 4DIGA 1LFHA 2VD2A 1JQFA 4ZDMA 4RPOA 3HN0A 4HS7A 5DVFA 1FW0A 2HAVA 2Z23A 3K6VA 2RC9A 4KI0E 4UACA 1TT1A 2HEUA 3MVZA 4R74A 4EQBA 3V83A 1M5CA 1MQHA 4JSDA 3IOTA 2F34A 4POWA 4QFOA 3C31A 4ZE9A 4OMBA 2ZNSA 4TLMB 3PPRA 3VXBA 3FVKA 3M3KA 4OFJA 1I69A 4FE8A 3KSJA 3TTMA 1A8FA 4RY1A 3VE1B 3PAMA 1N7WA 3MP1A 4OWDA 4X1BA 5I59B 2D3IA 4AB5A 4ZEBA 4WEDA 3DM0A 4JWXA 1B40A 4KYSA 3IB1A 5DEXA 2O51A 3ZKLA 4I62A 1LAFE 4Q0CA 1B1XA 3EHSA 3GLBA 1B0LA 1SW5A 5HBCA 4ZEDA 1DTZA 2Y7PA 1JW4A 1SYIA 3B6TA 2QS2A 3IB0A 3MAMA 3T66A 2RC7A 4GD5A 4EF1A 3FUZA 3MC2A 3KBRA 4F1UA 3KFMA 4YB6A 4XTCQ 4LZ7A 3S2VA 4FECA 4C1TA 3LUYA 3AXFA 1CE2A 1EH3A 4QFKA 1A55A 1MPDA 3BBRA 3JYRA 2REJA 1A40A 2X7PA 3K1PA 4G68B 4HCYA 1IIWA 3OO9A 1GV8A 4BDLA 4ESWA 3EHUA 3L6GA 1MH3A 2OCUA 1P1QA 2E0SA 2XXVA 3VVEA 4F1YA 4F2OA 3I6VA 3IX1A 1O63A 3C32A 4ND9A 4POXA 4R6HA 3T9XB 2WOKA 3RTWB 4RJZA 2ZYMA 2O69A 1ZU0A 1HSEA 5TP9B 5TP9A 1QULA 1T0KA 4NWDA 2QPQA 1IQ7A 4YB7A 1I6AA 3K2DA 5AA2D 2DVZA 1XC1A 3C33A 3KGCA 4MLVA 1LGBC 3H7MA 4NF8B 1AIVA 4EF2A 2I0BA 2ONKE 1ZJLA 4M4GA 5FTHA 2RCBA 1JVXA 2XX8A 4X48A 5F1QA 4R2BA 3WAEA 1NNPA 1B1HA 2O68A 4MBPA 4QRZA 3FASA 3VVFA 3RLFE 1VE4A 5B7DA 1EU8A 2V3QA 3UK4A 2DWAA 1NH8A 1M5DA 3QIMA 3CFZA 4R73A 1AH5A 1DOTA 2DVCA 4M1VA 2YPNA 3UN6A 2F78A 2I48A 2ALUA 2Y7WA 1NH7A 3L6HA 1N7XA 2HAUA 4KYDA 4DE8A 1B52A 4RYAA 2PVUA 3PPOA 1B32A 3SEVA 1UTBA 3MQ9A 1IXCA 3IO4A 1N3XA 5HM4B 3B7DA 5H8QA 2M8CA 3MWBA 4GQOA 4TOZA 3A09A 2NOOA 4LZ5A 4YMAA 4LQ2A 1A99A 4H0WA 1NL5A 3LC8A 4NEDA 1UIUA 4Q8RA 4OESA 1DTGA 3UORA 3TYHA 1OQHA 2PBWA 2Q2AA 3A3CA 3N94A 3DRJA 4NMYA 2Y7RA 1L5TA 3TZAA 2Y84A 5LOMA 1AMFA 3FTOA 1DPPA 2XX9A 3ECRA 4G8NA 1US4A 1B4HA 1BLFA 1USYH 2XXIA 2H4IA 2XD3A 3MZ1A 2F36A 3VLVA 3QK6A 1Q1KA 1Y20A 3F11A 1B7ZA 2F5XA 3QUJA 1MXUA 2OLBA 1II5A 4YAHX 2BJJX 4JB7A 3K1MA 1FTKA 2ESNA 1B2HA 2GRVA 2HZLA 4I8CA 1MY3A 1I6QA 2AL4A 4OHNA 4OTEA 3RYAA 3DP6A 2I3WA 3K01A 4G8HA 5H8HB 3C4MA 1PC3A 4F3GA 4N07A 5A5XB 3G3IA 5KCJB 3TFLA 1QUIA 3S9MC 1EZPA 1URDA 1WODA 3GBBA 4YU0A 1Q35A 3EN3A 1FTJA 2Z8EA 2ANJA 4N13A 1B51A 2F8DA 5I2KA 3KZGA 3O6PA 3KN7A 1FTLA 3LR1A 4LONB 2RC8A 5DVJA 4ZEKA 4PFUA 4L17A 3IR1A 4HW8A 4G77A 2I58A 3OSQA 2PT1A 2O6AA 4PETA 4C1UA 3Q28A 4IGRA 1JW5A 1Y9UA 4U1ZA 5DEXB 2Q8JA 3T93B 4OFOA 1POTA 3H6WA 1IXIA 4GL8A 1DMBA 4H5GA 4LQ5A 3MVWA 1EZOA 4DLDA 3G3JA 2DE3A 2UXAA 2ZYNA 3G7WA 1SI1A 5AA4A 4GIZA 3RGYA 3PD8A 4F29A 1ZLQA 3ZSFA 5CBSA 1F9BA 3VFJA 1M5FA 5FHNA 2THIA 3M3FA 3G3KA 1QVSA 2OK2A 5ITPA 3RPWA 4FIMA 3KOTA 1EZ9A 1BIYA 1P99A 3IJOB 3PV0E 2V3TA 2D5WA 3BFUA 4NE4A 3IB2A 4OERA 4ZECA 3I3VA 1ZIUA 4NWCA 3TEPA 1KWHA 3G3GA 1P1WA 3QAXA 3O66A 1DSNA 3MPLA 2QMXA 3PU5A 4IY5A 4FATA 4ELQA 5I2NB 1LB8A 5ITOA 2DXRA 4H8JA 3U94A 4FAJA 1LCFA 1ATGA 3CG3A 2A5TB 4U22A 3RT8A 4NF4B 4OEVA 1JEUA 5CI5A 5BWJA 2IA4A 1URSA 1LLSA 2OJTA 4ZEFA 4XIGQ 4PFWA 1TWYA 1BKAA 1QKBA 1FTMA 1JW1A 2B3BA 2G93A 2PX1A 4U4XA 3IJXB 3DRGA 4YICA 1IEJA 5I58B 2RF1A 1QKAA 1HSLA 1US5A 5AA2B 3FVNA 3A3UA 3D4CA 4RXLA 2HCAA 5H8NA 5L9SA 1IITA 3FGSA 2QJEA 4H5FA 4OQOA 4YKIA 5KDTB 4NF5B 3M8UA 2VOZA 2ONRA 2I4CA 3TMGA 5KZTA 3V8XB 2XXQA 2DXYA 3C35A 4Q30B 3HHFA 3MUQA 3IOVA 2D21A 1URGA 4R75A 4IO4A 4Z0IA 4F31B 1AOVA 1LAXA 3PGFA 5JTYB 5JEIA 3QXMA 1N04A 4ECFA 4EXKA 1OVTA 3PPNA 4MFIA 1WDNA 3FV2A 1XVXA 1NNTA 5K2YA 3SESA 5EHMA 4GXSB 4P11A 2UVIA 1Z7ME 1H44A 2PMSA 2Q89A 2GFEA 2H9BA 3KJTA 3Q26A 3T9HB 3O28A 2NXOA 3K6XA 4OENA 4U1OA 1FQDA 3CSGA 3GZGA 2Y7IA 2DE2A 3MVYA 2A5SA 2WOPA 3PUXE 5L9OA 4GXAA 1PBPA 3DRFA 2XXRA 1FQFA 3N26A 1FTOA 3CIJA 3EF7A 4PP0A 2QS4A 1MY2A 5CBRA 3DELB 3H06B 1JNFA 1B5HA 4TLLB 5H8SA 1PB9A 1ELJA 4IY6A 4BDQA 2V3UA 4OYVA 3PMWA 3PUWE 4IO2A 1MH4A 2B3FA 4HCWA 2W7YA 2ZNTA 2CZLA 3R26A 1N3WA 3O97A 5HPQA 2ONSA 1PB8A 1FCKA 2QSXA 3PPPA 2DSFA 3KSXA 3BKIB 4ELRA 1TXFA 4QHQA 3SDFA 4MH5A 1MG1A 5I56A 3G3HA 3PUVE 4GRKA 4YZZA 4XKPA 2GHAA 4G2ZA 3O29A 1ZBMA 3KEIA 1VFEA 3IOWA 1MDP1 1WVJA 2XXHA 3LSWA 1SYHA 1MXXA 2F7AA 2V84A 2YJPA 3SERA 3SKPA 1M5BA 2ZYKA 3FVGA 3H6VA 4MF3A 4IO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KR5 A;  1MS7 A;  3K1N A;  5L9M A;  4JSO A;  4EQ7 A;  3N6T A;  2UVJ A;  1B6H A;  3JV9 A;  3IAZ A;  3QYT A;  4LVQ A;  3V89 B;  3MZ9 A;  3S9E A;  4DCY A;  4XKN A;  2GHB A;  3TTR A;  4XKQ A;  3O6I A;  3FJG A;  3ILU B;  1Y4C A;  4X9T A;  2HXW A;  3VLW A;  2B65 A;  4R6Y A;  4YKK A;  1B46 A;  1Y1Z A;  4EUO A;  2OZZ A;  3E3K A;  4GVO A;  2NUV A;  1XVY A;  3CRB A;  3HO7 A;  1B3E A;  3LSF B;  3JZJ A;  2PT2 A;  3OD7 A;  4FED A;  4MLQ A;  1OQG A;  4YKP A;  5CMB A;  1AL3 A;  3FXQ A;  5I56 B;  1MRP A;  4FOR A;  4LZ8 A;  3V5A A;  1B3F A;  3TCG A;  3OMB A;  5H8F B;  3CHG A;  1LAH E;  3EQ1 A;  4KD5 A;  1GVC A;  3K4U A;  5TPA B;  4JBZ A;  1XOC A;  1O64 A;  1SVX B;  4RK9 A;  5FHM A;  3IL1 B;  2OBG A;  4HTG A;  4IO6 A;  2R71 A;  4F39 A;  4NTL A;  4ZEI A;  1FQB A;  2P1S A;  5CM6 A;  2ZNU A;  3T22 A;  5F7V A;  3KJ7 A;  3S9N C;  3QSL A;  3WAF A;  2F35 A;  3OXN A;  2RCA A;  4BLA A;  4GWO A;  2F6P A;  4AQ4 A;  3MBP A;  2DOJ A;  1UIV A;  4XKR A;  2XXW A;  2XXP A;  3ONM A;  3HST A;  3SEY A;  2I4B A;  2Z8D A;  2VD3 A;  3HHG A;  4KHZ E;  1MXW A;  2R6G E;  1SW4 A;  2AL5 A;  1NNF A;  3H3G A;  2FYI A;  4DXU A;  4F19 A;  5CC2 A;  1UTH A;  5JK4 A;  2X26 A;  1LFI A;  4OET A;  2X7Q A;  3MP8 A;  1MXZ A;  3HPI A;  3OO7 A;  1POY 1;  4F3B A;  3BFT A;  2ZXT A;  4FEB A;  3TQL A;  3TTK A;  1ANF A;  1D9Y A;  1MXV A;  4GLI A;  2XHD A;  2DP8 A;  1Y3P A;  1YPN A;  5I57 A;  5TU0 A;  1R9L A;  2FA7 A;  1RKM A;  1D3K A;  1FQE A;  2DWJ A;  5IAI A;  3FIR A;  2FNC A;  3TDJ A;  1PDA A;  3K0V A;  2P0S A;  5DT6 A;  4F3S A;  4BDO A;  4KCC A;  3H03 A;  2DWI A;  3B6Q A;  1NMU A;  2I49 A;  3CR9 A;  3EPE A;  4P0G A;  5I57 B;  2KLF A;  2XXY A;  1QJM A;  2O1L A;  3T96 B;  1A7L A;  1SI0 A;  4OFL A;  3DP8 A;  2DQV A;  3M3L A;  1B3H A;  4E0X A;  2E1S A;  2XXX A;  3CFX A;  3MPK A;  4NF6 B;  2F7B A;  4OZ9 A;  4X1D A;  3RUM A;  2XXU A;  4KFQ A;  1NFT A;  1UTH B;  3O9P A;  1J1N A;  2IEE A;  5AA1 A;  1OVB A;  1B4Z A;  3USD A;  4K3F A;  3RY3 A;  4WKM A;  5L8D A;  4PFT A;  4ZS9 A;  3UA8 A;  4AB6 A;  1Y4T A;  3K00 A;  4O3C A;  4KYE A;  1MPC A;  1MDQ A;  4LA9 A;  5I84 A;  3FJM A;  3PUZ E;  3R6U A;  3T9U A;  4R9F A;  5ELV A;  4WEP A;  2QS3 A;  1SDX A;  3FXU A;  4O3A A;  3LSL A;  2A5T A;  2ZYO A;  1LBB A;  1MY0 A;  3MW0 A;  3UP9 A;  1N0T A;  3KG2 A;  3Q29 A;  3TEL A;  1YCJ A;  1BTJ A;  1R6Z A;  3Q27 A;  4NF6 A;  5TPA A;  1MY1 A;  1SW1 A;  3MZB A;  3RQT A;  1GTK A;  4TQU Q;  5H8F A;  4UA8 A;  4DDD A;  1D4N A;  3PMX A;  3ZKK A;  3TCF A;  3LBS A;  1VSO A;  1B7U A;  1H76 A;  2Y7K A;  4OEU A;  3DLN A;  4JXI A;  4QSC A;  3KN8 A;  1SW2 A;  3W9V A;  4EDP A;  1HSJ A;  3S9L C;  3TKD A;  5ICQ A;  4JWY A;  3ILT B;  5FTI A;  1YTV A;  2RIN A;  1LBC A;  2I0C A;  5AA3 A;  1MQJ A;  3MP6 A;  4QSE A;  5AA4 B;  2HZK A;  4DXB A;  2ABH A;  3OOA A;  4THI A;  1SD3 A;  2HFB A;  1O7T A;  2NWJ A;  4C0R A;  1DPE A;  2GH9 A;  3QUF A;  4H67 A;  2Q9T A;  3VXC A;  4LP2 B;  2CMO A;  4U21 A;  4NF5 A;  4DCX A;  3R7X A;  5AE4 A;  4F2Q A;  1Y3N A;  3E9X A;  3PMV A;  3GBA A;  3D4G A;  5AA2 A;  3ZS6 A;  3T9V A;  4EXL A;  3TUS A;  1R9Q A;  4BDR A;  4DZ1 A;  2Q88 A;  1JEV A;  1I6B A;  3SEU A;  3RT6 B;  1MQD A;  1BP5 A;  3CG1 A;  4U2R A;  3RYB A;  5DYH A;  5K2X A;  1B5J A;  3TTN A;  3MVX A;  5M2V A;  2Z22 A;  1OMP A;  3TAJ A;  5A5X A;  2I3V A;  4NF4 A;  5H8H A;  4QFL A;  1TFD A;  1OIB A;  1S50 A;  4I9D A;  1P1O A;  3DP4 A;  3PUY E;  4R2F A;  2F6G A;  5I2N A;  2XD2 A;  1A8E A;  1SBP A;  3OEM A;  3LSX A;  4Z7E A;  2VGQ A;  4BDN A;  4RA1 A;  1QUK A;  1LFG A;  4FJP A;  3SET A;  2XX7 A;  3FV1 A;  3U92 A;  4G4P A;  1B7H A;  3TOD A;  4Q5T A;  1M5E A;  2QL3 A;  1S9T A;  1FQA A;  2DS9 A;  2G29 A;  3C36 A;  2OWT A;  4PQJ A;  3FJ7 A;  4LUB A;  4RK2 A;  3S4U A;  3HV1 A;  3RNN A;  1QW0 A;  4ESX A;  5J1D A;  1PEB A;  4H1X A;  1LCT A;  2WKY A;  1PB7 A;  2VHA A;  2UVG A;  3IO6 A;  2V25 A;  1MY4 A;  4IO7 A;  4YB5 A;  1NKX A;  3K02 A;  3O6H A;  3U93 A;  1UQW A;  3HCQ A;  4EQ9 A;  1N76 A;  2ZMB A;  2H99 A;  2VP1 A;  3FD3 A;  4H65 A;  4KQP A;  1JVY A;  1P1U A;  4O3B A;  3UGW A;  4F3P A;  4I1D A;  3VLU A;  3MJN A;  4IB2 A;  3FZV A;  3OEN A;  1P1N A;  2F7C A;  3FXR A;  3N5L A;  3N6U A;  1MQG A;  3Q25 A;  4GOT A;  5H8Q B;  3VVD A;  1VR5 A;  5B70 A;  3OEK A;  3TQW A;  2QMW A;  1R1N A;  4R9G A;  1MM6 A;  1OLC A;  1XS5 A;  2O7I A;  4GF8 A;  5ISU A;  2XXT A;  3B6W A;  3C9H A;  3CVG A;  3IOR A;  2DYX A;  1LAG E;  1SQY A;  3E13 X;  4ZE8 A;  1MQI A;  4GL0 A;  4U4S A;  2NVU B;  3P7I A;  4OVJ A;  5I2K B;  3U8Q A;  2H5Y A;  2O7U A;  2I6E A;  2UYF A;  5CMC A;  3UIF A;  5CMK A;  1A54 A;  1FQC A;  3H6T A;  5EYF A;  4PFY A;  1IZ1 A;  4JDF A;  2R9J A;  2AIX A;  3SEW A;  3K6W A;  3U1O A;  3U72 A;  1Z7N E;  3VDF A;  1MM7 A;  4F1V A;  4G68 C;  1ZKB A;  1OLA A;  2DE4 A;  3GXA A;  3H4Z A;  5CRY A;  4NF8 A;  1Y1M A;  4QSD A;  2DWH A;  3OO6 A;  5CMM A;  3FAT A;  3RN8 A;  1IUD A;  4IO3 A;  3W15 C;  4R72 A;  1LB9 A;  1ZMG A;  4GFR A;  1XT8 A;  4JWO A;  1RYX A;  4XXU A;  5FHO A;  3W9W A;  1MXY A;  3ODB A;  1H3D A;  4DXC A;  2H98 A;  2O84 X;  3OSR A;  3TCH A;  3I5O A;  4P0I A;  5EHS A;  1QUJ A;  1B3L A;  2PYY A;  2LAO A;  3H6U A;  2OWS A;  2V93 A;  1CB6 A;  2Q2C A;  4E0W A;  3E4R A;  1RYO A;  4G68 A;  1JET A;  1MPB A;  4RNS A;  1D9V A;  4QFP A;  1NNK A;  3LVU A;  1S7Y A;  1UTB B;  2P2A A;  3KOS A;  3C34 A;  3IK6 B;  4RPN A;  4H6D A;  4OXV A;  1B58 A;  2WOL A;  1H43 A;  2HQ0 A;  3DRI A;  3CFL A;  4ISU A;  1B9J A;  5IKB A;  4ZZA A;  4F22 A;  1LST A;  2QRY A;  1XHY A;  3OEL A;  1B0H A;  5JTY A;  4ELO A;  2AYS A;  1VFD A;  2REG A;  3IOU A;  1B05 A;  4IGT A;  3O6G A;  2QS1 A;  3O2A A;  3OO8 A;  1H45 A;  1B5I A;  4YKJ A;  1IXG A;  4F18 A;  5DVI A;  3THI A;  5ICT A;  1N84 A;  4ZZE A;  3G3F A;  3TPA A;  5I59 A;  1B3G A;  1GGG A;  1TFA A;  4H8I A;  5KDT A;  3CSB A;  1GR2 A;  1Y3Q A;  2UYE A;  2Z8F A;  4KPT A;  5H8N B;  5DTB A;  3CI8 A;  3TTL A;  3FVO A;  5I58 A;  1PBQ A;  4G8M A;  3SEX A;  3RTF B;  4ONY A;  1IXH A;  2UVH A;  3EHT A;  2H25 A;  1ZTY A;  3K6U A;  4YMB A;  4LAT A;  3PPQ A;  4BDM A;  4PE5 B;  2B4L A;  2RKM A;  3DRH A;  5BUU A;  1USY E;  1YAE A;  4ELP A;  5KCJ A;  3KN3 A;  4R6K A;  3DRK A;  3PD9 A;  4KCD A;  4QFN A;  4N6P A;  4WXJ A;  3VV5 A;  2B4M A;  2F97 A;  4QF9 A;  2YLN A;  4U23 A;  2O1M A;  4DIG A;  1LFH A;  2VD2 A;  1JQF A;  4ZDM A;  4RPO A;  3HN0 A;  4HS7 A;  5DVF A;  1FW0 A;  2HAV A;  2Z23 A;  3K6V A;  2RC9 A;  4KI0 E;  4UAC A;  1TT1 A;  2HEU A;  3MVZ A;  4R74 A;  4EQB A;  3V83 A;  1M5C A;  1MQH A;  4JSD A;  3IOT A;  2F34 A;  4POW A;  4QFO A;  3C31 A;  4ZE9 A;  4OMB A;  2ZNS A;  4TLM B;  3PPR A;  3VXB A;  3FVK A;  3M3K A;  4OFJ A;  1I69 A;  4FE8 A;  3KSJ A;  3TTM A;  1A8F A;  4RY1 A;  3VE1 B;  3PAM A;  1N7W A;  3MP1 A;  4OWD A;  4X1B A;  5I59 B;  2D3I A;  4AB5 A;  4ZEB A;  4WED A;  3DM0 A;  4JWX A;  1B40 A;  4KYS A;  3IB1 A;  5DEX A;  2O51 A;  3ZKL A;  4I62 A;  1LAF E;  4Q0C A;  1B1X A;  3EHS A;  3GLB A;  1B0L A;  1SW5 A;  5HBC A;  4ZED A;  1DTZ A;  2Y7P A;  1JW4 A;  1SYI A;  3B6T A;  2QS2 A;  3IB0 A;  3MAM A;  3T66 A;  2RC7 A;  4GD5 A;  4EF1 A;  3FUZ A;  3MC2 A;  3KBR A;  4F1U A;  3KFM A;  4YB6 A;  4XTC Q;  4LZ7 A;  3S2V A;  4FEC A;  4C1T A;  3LUY A;  3AXF A;  1CE2 A;  1EH3 A;  4QFK A;  1A55 A;  1MPD A;  3BBR A;  3JYR A;  2REJ A;  1A40 A;  2X7P A;  3K1P A;  4G68 B;  4HCY A;  1IIW A;  3OO9 A;  1GV8 A;  4BDL A;  4ESW A;  3EHU A;  3L6G A;  1MH3 A;  2OCU A;  1P1Q A;  2E0S A;  2XXV A;  3VVE A;  4F1Y A;  4F2O A;  3I6V A;  3IX1 A;  1O63 A;  3C32 A;  4ND9 A;  4POX A;  4R6H A;  3T9X B;  2WOK A;  3RTW B;  4RJZ A;  2ZYM A;  2O69 A;  1ZU0 A;  1HSE A;  5TP9 B;  5TP9 A;  1QUL A;  1T0K A;  4NWD A;  2QPQ A;  1IQ7 A;  4YB7 A;  1I6A A;  3K2D A;  5AA2 D;  2DVZ A;  1XC1 A;  3C33 A;  3KGC A;  4MLV A;  1LGB C;  3H7M A;  4NF8 B;  1AIV A;  4EF2 A;  2I0B A;  2ONK E;  1ZJL A;  4M4G A;  5FTH A;  2RCB A;  1JVX A;  2XX8 A;  4X48 A;  5F1Q A;  4R2B A;  3WAE A;  1NNP A;  1B1H A;  2O68 A;  4MBP A;  4QRZ A;  3FAS A;  3VVF A;  3RLF E;  1VE4 A;  5B7D A;  1EU8 A;  2V3Q A;  3UK4 A;  2DWA A;  1NH8 A;  1M5D A;  3QIM A;  3CFZ A;  4R73 A;  1AH5 A;  1DOT A;  2DVC A;  4M1V A;  2YPN A;  3UN6 A;  2F78 A;  2I48 A;  2ALU A;  2Y7W A;  1NH7 A;  3L6H A;  1N7X A;  2HAU A;  4KYD A;  4DE8 A;  1B52 A;  4RYA A;  2PVU A;  3PPO A;  1B32 A;  3SEV A;  1UTB A;  3MQ9 A;  1IXC A;  3IO4 A;  1N3X A;  5HM4 B;  3B7D A;  5H8Q A;  2M8C A;  3MWB A;  4GQO A;  4TOZ A;  3A09 A;  2NOO A;  4LZ5 A;  4YMA A;  4LQ2 A;  1A99 A;  4H0W A;  1NL5 A;  3LC8 A;  4NED A;  1UIU A;  4Q8R A;  4OES A;  1DTG A;  3UOR A;  3TYH A;  1OQH A;  2PBW A;  2Q2A A;  3A3C A;  3N94 A;  3DRJ A;  4NMY A;  2Y7R A;  1L5T A;  3TZA A;  2Y84 A;  5LOM A;  1AMF A;  3FTO A;  1DPP A;  2XX9 A;  3ECR A;  4G8N A;  1US4 A;  1B4H A;  1BLF A;  1USY H;  2XXI A;  2H4I A;  2XD3 A;  3MZ1 A;  2F36 A;  3VLV A;  3QK6 A;  1Q1K A;  1Y20 A;  3F11 A;  1B7Z A;  2F5X A;  3QUJ A;  1MXU A;  2OLB A;  1II5 A;  4YAH X;  2BJJ X;  4JB7 A;  3K1M A;  1FTK A;  2ESN A;  1B2H A;  2GRV A;  2HZL A;  4I8C A;  1MY3 A;  1I6Q A;  2AL4 A;  4OHN A;  4OTE A;  3RYA A;  3DP6 A;  2I3W A;  3K01 A;  4G8H A;  5H8H B;  3C4M A;  1PC3 A;  4F3G A;  4N07 A;  5A5X B;  3G3I A;  5KCJ B;  3TFL A;  1QUI A;  3S9M C;  1EZP A;  1URD A;  1WOD A;  3GBB A;  4YU0 A;  1Q35 A;  3EN3 A;  1FTJ A;  2Z8E A;  2ANJ A;  4N13 A;  1B51 A;  2F8D A;  5I2K A;  3KZG A;  3O6P A;  3KN7 A;  1FTL A;  3LR1 A;  4LON B;  2RC8 A;  5DVJ A;  4ZEK A;  4PFU A;  4L17 A;  3IR1 A;  4HW8 A;  4G77 A;  2I58 A;  3OSQ A;  2PT1 A;  2O6A A;  4PET A;  4C1U A;  3Q28 A;  4IGR A;  1JW5 A;  1Y9U A;  4U1Z A;  5DEX B;  2Q8J A;  3T93 B;  4OFO A;  1POT A;  3H6W A;  1IXI A;  4GL8 A;  1DMB A;  4H5G A;  4LQ5 A;  3MVW A;  1EZO A;  4DLD A;  3G3J A;  2DE3 A;  2UXA A;  2ZYN A;  3G7W A;  1SI1 A;  5AA4 A;  4GIZ A;  3RGY A;  3PD8 A;  4F29 A;  1ZLQ A;  3ZSF A;  5CBS A;  1F9B A;  3VFJ A;  1M5F A;  5FHN A;  2THI A;  3M3F A;  3G3K A;  1QVS A;  2OK2 A;  5ITP A;  3RPW A;  4FIM A;  3KOT A;  1EZ9 A;  1BIY A;  1P99 A;  3IJO B;  3PV0 E;  2V3T A;  2D5W A;  3BFU A;  4NE4 A;  3IB2 A;  4OER A;  4ZEC A;  3I3V A;  1ZIU A;  4NWC A;  3TEP A;  1KWH A;  3G3G A;  1P1W A;  3QAX A;  3O66 A;  1DSN A;  3MPL A;  2QMX A;  3PU5 A;  4IY5 A;  4FAT A;  4ELQ A;  5I2N B;  1LB8 A;  5ITO A;  2DXR A;  4H8J A;  3U94 A;  4FAJ A;  1LCF A;  1ATG A;  3CG3 A;  2A5T B;  4U22 A;  3RT8 A;  4NF4 B;  4OEV A;  1JEU A;  5CI5 A;  5BWJ A;  2IA4 A;  1URS A;  1LLS A;  2OJT A;  4ZEF A;  4XIG Q;  4PFW A;  1TWY A;  1BKA A;  1QKB A;  1FTM A;  1JW1 A;  2B3B A;  2G93 A;  2PX1 A;  4U4X A;  3IJX B;  3DRG A;  4YIC A;  1IEJ A;  5I58 B;  2RF1 A;  1QKA A;  1HSL A;  1US5 A;  5AA2 B;  3FVN A;  3A3U A;  3D4C A;  4RXL A;  2HCA A;  5H8N A;  5L9S A;  1IIT A;  3FGS A;  2QJE A;  4H5F A;  4OQO A;  4YKI A;  5KDT B;  4NF5 B;  3M8U A;  2VOZ A;  2ONR A;  2I4C A;  3TMG A;  5KZT A;  3V8X B;  2XXQ A;  2DXY A;  3C35 A;  4Q30 B;  3HHF A;  3MUQ A;  3IOV A;  2D21 A;  1URG A;  4R75 A;  4IO4 A;  4Z0I A;  4F31 B;  1AOV A;  1LAX A;  3PGF A;  5JTY B;  5JEI A;  3QXM A;  1N04 A;  4ECF A;  4EXK A;  1OVT A;  3PPN A;  4MFI A;  1WDN A;  3FV2 A;  1XVX A;  1NNT A;  5K2Y A;  3SES A;  5EHM A;  4GXS B;  4P11 A;  2UVI A;  1Z7M E;  1H44 A;  2PMS A;  2Q89 A;  2GFE A;  2H9B A;  3KJT A;  3Q26 A;  3T9H B;  3O28 A;  2NXO A;  3K6X A;  4OEN A;  4U1O A;  1FQD A;  3CSG A;  3GZG A;  2Y7I A;  2DE2 A;  3MVY A;  2A5S A;  2WOP A;  3PUX E;  5L9O A;  4GXA A;  1PBP A;  3DRF A;  2XXR A;  1FQF A;  3N26 A;  1FTO A;  3CIJ A;  3EF7 A;  4PP0 A;  2QS4 A;  1MY2 A;  5CBR A;  3DEL B;  3H06 B;  1JNF A;  1B5H A;  4TLL B;  5H8S A;  1PB9 A;  1ELJ A;  4IY6 A;  4BDQ A;  2V3U A;  4OYV A;  3PMW A;  3PUW E;  4IO2 A;  1MH4 A;  2B3F A;  4HCW A;  2W7Y A;  2ZNT A;  2CZL A;  3R26 A;  1N3W A;  3O97 A;  5HPQ A;  2ONS A;  1PB8 A;  1FCK A;  2QSX A;  3PPP A;  2DSF A;  3KSX A;  3BKI B;  4ELR A;  1TXF A;  4QHQ A;  3SDF A;  4MH5 A;  1MG1 A;  5I56 A;  3G3H A;  3PUV E;  4GRK A;  4YZZ A;  4XKP A;  2GHA A;  4G2Z A;  3O29 A;  1ZBM A;  3KEI A;  1VFE A;  3IOW A;  1MDP 1;  1WVJ A;  2XXH A;  3LSW A;  1SYH A;  1MXX A;  2F7A A;  2V84 A;  2YJP A;  3SER A;  3SKP A;  1M5B A;  2ZYK A;  3FVG A;  3H6V A;  4MF3 A;  4IO5 A; 
#chains in the Genus database with same CATH topology
 4JSO A;  1D9Q A;  2UVJ A;  2Y5L A;  3S9E A;  3MZ9 A;  4XKQ A;  3O6I A;  4X9T A;  4EUO A;  3CRB A;  3HO7 A;  3LSF B;  3JZJ A;  4YKP A;  3OD7 A;  4FOR A;  4NX1 A;  1XOC A;  1SVX B;  5FHM A;  4DI3 D;  4NTL A;  4ZEI A;  3T22 A;  5F7V A;  3S9N C;  3WAF A;  3OXN A;  4BLA A;  3MBP A;  3SEY A;  3UK4 A;  1RDY A;  2AL5 A;  5JK4 A;  4DXU A;  3MP8 A;  4F3B A;  1FPL A;  1POY 1;  2DP8 A;  1NV4 A;  3K0V A;  1NMU A;  1QJM A;  2O1L A;  1FPD A;  2DQV A;  4PGN A;  3CFX A;  2XA5 A;  4NF6 B;  2F7B A;  4OZ9 A;  3O9P A;  1J1N A;  2IEE A;  1EYK A;  3USD A;  4K3F A;  4AB6 A;  4ZS9 A;  3K00 A;  1MPC A;  1MDQ A;  4R9F A;  5ELV A;  4NQ8 A;  2ZYO A;  3MW0 A;  3UP9 A;  1N0T A;  3Q29 A;  1YCJ A;  1CNQ A;  4NAP A;  2FVZ A;  5H8F A;  1VSO A;  3W9V A;  1SW2 A;  3S9L C;  2XWO A;  3TKD A;  2XWK A;  1YTV A;  1LBC A;  1MQJ A;  5AA4 B;  2ABH A;  2NWJ A;  4C0R A;  1DPE A;  4H67 A;  3VXC A;  4LP2 B;  2CMO A;  4DCX A;  3PTY A;  4MNC A;  3T9V A;  2Q88 A;  3SEU A;  5DYH A;  3CG1 A;  4U2R A;  3TTN A;  1B5J A;  3MVX A;  5H8H A;  4QFL A;  1S50 A;  1P1O A;  4R2F A;  2F6G A;  5I2N A;  5EQ8 A;  2VGQ A;  4BDN A;  4FJP A;  4XEQ A;  3FV1 A;  2HHM A;  5IZ3 A;  3C36 A;  1S9T A;  2G29 A;  1FPF A;  1NKX A;  3FD3 A;  4KQP A;  1P1N A;  3OEK A;  1MM6 A;  5ISU A;  2NVU B;  4U4S A;  5I2K B;  2H5Y A;  2I6E A;  1FQC A;  2QVU A;  3H6T A;  4PFY A;  3SEW A;  3U72 A;  1MM7 A;  2XWI A;  3W15 C;  4R72 A;  4JVD A;  4DXC A;  2H98 A;  3OSR A;  3TCH A;  3I5O A;  2PYY A;  2LAO A;  2ZZX A;  2OWS A;  4O8M A;  4GWY A;  1NNK A;  3C34 A;  4OXV A;  1B58 A;  4GWZ A;  5IKB A;  1B9J A;  1LST A;  1B0H A;  2REG A;  4IGT A;  1FSA A;  1H45 A;  1B5I A;  4X04 A;  5I59 A;  1B3G A;  3CSB A;  1GR2 A;  2UYE A;  2Z8F A;  4KPT A;  5H8N B;  4ONY A;  2UVH A;  3EHT A;  2H25 A;  4LAT A;  2B4L A;  1USY E;  5KCJ A;  3KN3 A;  4R6K A;  4N6P A;  4KCD A;  2B4M A;  1NUY A;  4U23 A;  4DIG A;  1FPB A;  5I7I A;  2Z23 A;  2RC9 A;  1NV7 A;  4EQB A;  4R74 A;  1M5C A;  3IOT A;  2CZH A;  4ZE9 A;  3PPR A;  3VXB A;  3M3K A;  4FE8 A;  1I69 A;  3TTM A;  1A8F A;  4RY1 A;  3VE1 B;  3PAM A;  3MP1 A;  4X1B A;  5I59 B;  1INP A;  2D3I A;  3DM0 A;  5DEX A;  5HBC A;  1B0L A;  4ZED A;  1DTZ A;  3B6T A;  4GD5 A;  4EF1 A;  3KFM A;  4PFI A;  4YB6 A;  2CEY A;  3S2V A;  4FEC A;  4C1T A;  3BBR A;  4BDL A;  1GV8 A;  4N81 A;  2OCU A;  3IX1 A;  1O63 A;  4ND9 A;  4POX A;  3T9X B;  2WOK A;  3RTW B;  1ZU0 A;  5TP9 B;  2L5V A;  1IQ7 A;  1I6A A;  5AA2 D;  3C33 A;  1XC1 A;  1IMC A;  1LGB C;  2I0B A;  2ONK E;  1ZJL A;  2VPO A;  4X48 A;  4R2B A;  1NNP A;  1B1H A;  4MBP A;  4QRZ A;  2DVC A;  3UN6 A;  4DE8 A;  4N6D A;  1B32 A;  3B7D A;  3MWB A;  2NOO A;  4LZ5 A;  4OAN A;  4XFE A;  1A99 A;  4H0W A;  1UIU A;  4Q8R A;  3TYH A;  1OQH A;  2Q2A A;  1AMF A;  1DPP A;  1USY H;  2WYP A;  1Q1K A;  1B7Z A;  2F5X A;  4YAH X;  2OLB A;  2HZL A;  1I6Q A;  3RYA A;  5H8H B;  5A5X B;  5KCJ B;  4YU0 A;  1Q35 A;  2ANJ A;  4N13 A;  1B51 A;  2JJK A;  3O6P A;  4NN3 A;  2I58 A;  2O6A A;  5DEX B;  4OFO A;  1POT A;  3MVW A;  3G3J A;  4MEV A;  1ZLQ A;  5CBS A;  2OWZ A;  3VFJ A;  3M3F A;  2MKZ A;  1FBH A;  3KOT A;  1P99 A;  1BIY A;  3PV0 E;  4NE4 A;  2V3T A;  2D5W A;  1ZIU A;  3SEX A;  1P1W A;  3QAX A;  3PU5 A;  4IY5 A;  4FAT A;  1LB8 A;  5ITO A;  3CG3 A;  2WYK A;  3RT8 A;  4G61 A;  5CI5 A;  4OVP A;  1IMD A;  1FTM A;  2B3B A;  3IJX B;  1IEJ A;  2RF1 A;  5AA2 B;  3D4C A;  4YKI A;  5KDT B;  3TMG A;  3V8X B;  2D21 A;  1FTA A;  1NV5 A;  3PGF A;  3KC0 A;  1OVT A;  3PPN A;  5IZZ A;  4NF0 A;  1Z7M E;  3T9H B;  3KJT A;  2GFE A;  3Q26 A;  1FQD A;  3CSG A;  1PBP A;  4PFR A;  2Q74 A;  5CBR A;  5EQA A;  1B5H A;  2V3U A;  3HFU A;  2CZL A;  2ONS A;  1PB8 A;  3BKI B;  1TXF A;  4QHQ A;  2HPG A;  3PUV E;  4P9K A;  1FPK A;  1K9Y A;  1ZBM A;  3IOW A;  3E78 A;  1MDP 1;  1WVJ A;  1SYH A;  2V84 A;  4KR5 A;  1MS7 A;  4OVR A;  4LVQ A;  2GHB A;  3TTR A;  4N8G A;  1XVY A;  4FED A;  5I56 B;  1MRP A;  3V5A A;  1B3F A;  3CHG A;  1LAH E;  3EQ1 A;  4KD5 A;  3GYY A;  3K4U A;  2OBG A;  4F39 A;  1QGX A;  2ZNU A;  1LBW A;  3QSL A;  2BJI A;  1FPG A;  2F35 A;  5ET6 A;  2RCA A;  1VDW A;  4XKR A;  2XXW A;  2XXP A;  3ONM A;  2I4B A;  2Z8D A;  2VD3 A;  1DBZ A;  1SW4 A;  2FYI A;  1UTH A;  4PTK A;  2X26 A;  4OET A;  1MXZ A;  3HPI A;  4I40 A;  2ZXT A;  1ANF A;  4GLI A;  2XHD A;  5I57 A;  4GWX A;  1D3K A;  3FIR A;  2FNC A;  5DT6 A;  4F3S A;  4BDO A;  3V83 A;  2DWI A;  3B6Q A;  2I49 A;  5I57 B;  2KLF A;  1A7L A;  4OFL A;  3M3L A;  3MPK A;  2Y5K A;  3RUM A;  2XXU A;  1UTH B;  1B4Z A;  3RY3 A;  4PFT A;  4N17 A;  1Y4T A;  5I84 A;  4WEP A;  2F3D A;  2A5T A;  1MY0 A;  2R8T A;  3KG2 A;  3Q27 A;  1R6Z A;  4NF6 A;  3RQT A;  4TQU Q;  4DDD A;  3ZKK A;  1B7U A;  3DLN A;  4QSC A;  4XF5 A;  5FTI A;  3ILT B;  3OOA A;  1DK4 A;  1KA1 A;  4NF5 A;  5AE4 A;  1FJ6 A;  3R7X A;  3PMV A;  3D4G A;  2FBP A;  1BP5 A;  5M2V A;  2I3V A;  4NF4 A;  4GX3 A;  3OEM A;  1A8E A;  3SET A;  1LFG A;  2XX7 A;  3U92 A;  4G4P A;  4GBV A;  4NG7 A;  1B7H A;  1M5E A;  3T0J A;  1FQA A;  4PQJ A;  4RK2 A;  3FJ7 A;  3S4U A;  1QW0 A;  4IO7 A;  3U93 A;  1UQW A;  2VP1 A;  1P1U A;  4O3B A;  3UGW A;  4I1D A;  3FZV A;  3OEN A;  1VR5 A;  2O7I A;  4GL0 A;  1SQY A;  4ZE8 A;  3P7I A;  4OVJ A;  3U8Q A;  3UIF A;  2UYF A;  1IZ1 A;  5IM2 A;  1OLA A;  2DE4 A;  3H4Z A;  4NF8 A;  4QSD A;  5LTC A;  3OO6 A;  3FAT A;  3RN8 A;  1ZMG A;  4XXU A;  2O84 X;  2V93 A;  4E0W A;  3E4R A;  4G68 A;  1MPB A;  2KQZ A;  2PFY A;  4QFP A;  1S7Y A;  1UTB B;  3IK6 B;  3QMF A;  2WOL A;  4F22 A;  1XHY A;  5EQ9 A;  1VFD A;  4OVT A;  3O6G A;  4F18 A;  1RDX A;  5DVI A;  3THI A;  1N84 A;  4ZZE A;  2V4C A;  1GGG A;  4HXV A;  3TTL A;  4YMB A;  5BUU A;  3DRH A;  4ELP A;  1IMA A;  4QFN A;  1LBX A;  2YLN A;  2O1M A;  2VD2 A;  4RPO A;  1FW0 A;  3K6V A;  3C31 A;  2ZNS A;  5ET5 A;  3FXB A;  4ZEB A;  4WED A;  1B40 A;  4KYS A;  1LAF E;  4Q0C A;  3RYD A;  1SW5 A;  1SYI A;  2QS2 A;  2RC7 A;  3MC2 A;  5EYG A;  4F1U A;  3LUY A;  1CE2 A;  1MPD A;  1A55 A;  3JYR A;  4HCY A;  1IIW A;  3OO9 A;  4P47 A;  3VVE A;  1MH3 A;  2XXV A;  4F1Y A;  4F2O A;  4PDH A;  3EKI A;  2ZYM A;  1T0K A;  1HSE A;  5TP9 A;  4NWD A;  4YB7 A;  3K2D A;  4MLV A;  3IFC A;  3H7M A;  4LN5 A;  1JVX A;  2XX8 A;  4O7I A;  3FAS A;  3VVF A;  3RLF E;  5B7D A;  4R73 A;  2YPN A;  3LV0 A;  2F78 A;  2I48 A;  2ALU A;  4MHF A;  1N7X A;  4RYA A;  5IGA A;  1UTB A;  5H8Q A;  5HM4 B;  4GBW A;  4TOZ A;  3U65 A;  4YMA A;  4LQ2 A;  1NI9 A;  3LC8 A;  4OES A;  4QBA A;  3DRJ A;  3TZA A;  1L5T A;  4N6K A;  3QK6 A;  3F11 A;  2BJJ X;  3K1M A;  2ESN A;  1MY3 A;  4OTE A;  2I3W A;  4AS4 A;  1URD A;  4L17 A;  3KC1 A;  4HW8 A;  2HXR A;  4PET A;  4IGR A;  2KR0 A;  1IXI A;  4GL8 A;  4H5G A;  4DLD A;  2DE3 A;  1FBF A;  3G7W A;  4OA4 A;  4GIZ A;  3RGY A;  1F9B A;  2THI A;  3G3K A;  3IB2 A;  4OER A;  1KWH A;  3O66 A;  1DSN A;  3MPL A;  2QMX A;  2DDK A;  1KZ8 A;  2DXR A;  3U94 A;  4FAJ A;  1JEU A;  2IA4 A;  4PFW A;  1JW1 A;  2G93 A;  4JVI A;  1FRP A;  3DRG A;  4YIC A;  5I58 B;  5LDZ A;  1HSL A;  1US5 A;  3RPL B;  3B8B A;  1IIT A;  4H5F A;  2QJE A;  1NV1 A;  2ONR A;  2XXQ A;  2DXY A;  3HHF A;  4R75 A;  1AOV A;  5JTY B;  5JEI A;  3QXM A;  1WDN A;  3SES A;  4GXS B;  1H44 A;  2CEX A;  2PMS A;  2Q89 A;  2H9B A;  3O28 A;  3K6X A;  4OEN A;  2Y7I A;  5L9O A;  4GXA A;  4MAG A;  4KXP A;  3EF7 A;  2PFZ A;  2QS4 A;  1MY2 A;  3H06 B;  5IZ3 B;  4TLL B;  3MST A;  1PB9 A;  3PMW A;  2W7Y A;  2QSX A;  2DSF A;  3KSX A;  3SDF A;  3G3H A;  5F24 A;  2YJP A;  1M5B A;  3H6V A;  3OMB A;  3K1N A;  1B6H A;  3V89 B;  4DCY A;  4MMP A;  4XKN A;  3ILU B;  1B46 A;  5EQ7 A;  4MLQ A;  2PT2 A;  1AL3 A;  3FXQ A;  1NV6 A;  4LZ8 A;  3TCG A;  5H8F B;  1GVC A;  5TPA B;  1O64 A;  3IL1 B;  4NGU A;  4HTG A;  1LBY A;  1FQB A;  2P1S A;  2OX3 A;  3KJ7 A;  4AQ4 A;  2DOJ A;  3HHG A;  1MXW A;  4F19 A;  1NNF A;  1FPI A;  5CC2 A;  3BFT A;  4FEB A;  3TTK A;  1FPJ A;  1D9Y A;  1MXV A;  1Y3P A;  1R9L A;  2FA7 A;  1K9Z A;  1PDA A;  2Q8M A;  4KCC A;  3H03 A;  4P0G A;  2XXY A;  3T96 B;  1SI0 A;  4E0X A;  1B3H A;  4X1D A;  4PDD A;  1NFT A;  5AA1 A;  3UA8 A;  4WKM A;  4O3C A;  4O7M A;  2QS3 A;  3FXU A;  4MJO A;  4AS5 A;  4O3A A;  3LSL A;  2P3N A;  3SZP A;  1MY1 A;  3MZB A;  3A29 A;  1D4N A;  3LBS A;  4HE2 A;  4DI4 B;  2Y7K A;  4JXI A;  3KN8 A;  4EDP A;  1HSJ A;  2ZZV A;  2RIN A;  2I0C A;  5AA3 A;  2HFB A;  1O7T A;  3QUF A;  2Q9T A;  3E9X A;  3RPL A;  5EYH A;  1R9Q A;  4DZ1 A;  1I6B A;  3RT6 B;  5K2X A;  2Z22 A;  1FBG A;  1OIB A;  3PUY E;  4I9D A;  3DP4 A;  4Z7E A;  3LSX A;  4RA1 A;  1QUK A;  4Q5T A;  2QL3 A;  1NV2 A;  2OWT A;  4ESX A;  3HV1 A;  1PEB A;  1LCT A;  4MIJ A;  2VHA A;  2UVG A;  3IO6 A;  4JVC A;  3O6H A;  4EQ9 A;  3HCQ A;  2ZMB A;  4F3P A;  4IB2 A;  3VVD A;  4GOT A;  5H8Q B;  1KA0 A;  1XS5 A;  4GF8 A;  1NUW A;  3CVG A;  3B6W A;  3TOD A;  1LAG E;  4MCO A;  2O7U A;  2CZI A;  5EYF A;  4JDF A;  2R9J A;  3U1O A;  4F1V A;  4G68 C;  4UAB A;  3GXA A;  1Y1M A;  5CMM A;  2DWH A;  1LB9 A;  4JWO A;  3W9W A;  1MXY A;  5A5L A;  3ODB A;  4PFB A;  1H3D A;  4P0I A;  5EHS A;  1QUJ A;  3H6U A;  1RYO A;  2P2A A;  4YKJ A;  4RPN A;  3DRI A;  4ISU A;  4ZZA A;  4GX6 A;  5JTY A;  3IOU A;  1B05 A;  1IXG A;  3G3F A;  3TPA A;  1Y3Q A;  2PCR A;  5DTB A;  3FVO A;  3B50 A;  1ZTY A;  4BDM A;  4PE5 B;  1YAE A;  3FBP A;  4QF9 A;  1JQF A;  2HAV A;  4KI0 E;  2VPN A;  1NV0 A;  1TT1 A;  2HEU A;  1MQH A;  5J16 A;  4JSD A;  2F34 A;  4POW A;  4QFO A;  4OMB A;  4TLM B;  4I3E A;  3FVK A;  3BIG A;  1N7W A;  4AB5 A;  3IB1 A;  2O51 A;  1B1X A;  3GLB A;  2Y7P A;  3T66 A;  2QVV A;  3KBR A;  2WX9 A;  3E79 A;  1IME A;  3AXF A;  4G68 B;  3ROJ A;  2REJ A;  2X7P A;  4X8R A;  1P1Q A;  3I6V A;  4R6H A;  1QUL A;  2QPQ A;  2DVZ A;  1AIV A;  5ESY A;  2RCB A;  5F1Q A;  2O68 A;  1VE4 A;  1EU8 A;  2V3Q A;  2DWA A;  1NH8 A;  4M1V A;  1YYZ A;  2Y7W A;  4PC9 A;  1B52 A;  2PVU A;  3PPO A;  2FIE A;  3SEV A;  3MQ9 A;  3IO4 A;  2M8C A;  3A09 A;  1JP4 A;  1NL5 A;  4NED A;  3UOR A;  3A3C A;  2WBD A;  3N94 A;  2Y7R A;  3FTO A;  2XX9 A;  1US4 A;  2XXI A;  1G0H A;  1Y20 A;  1MXU A;  1II5 A;  4P3L A;  1NUZ A;  2GRV A;  4I8C A;  1FBC A;  4OHN A;  3K01 A;  3C4M A;  1PC3 A;  4N07 A;  3G3I A;  3S9M C;  3TFL A;  1EZP A;  1WOD A;  3EN3 A;  5I2K A;  2F8D A;  5I5P A;  3KZG A;  3LR1 A;  4LON B;  4ZEK A;  3IR1 A;  4G77 A;  3OSQ A;  2PT1 A;  4C1U A;  1Y9U A;  5IZ1 A;  1DMB A;  5FHN A;  2OK2 A;  3RPW A;  4FIM A;  3IJO B;  4BDR A;  3BFU A;  4ZEC A;  3I3V A;  4ELQ A;  4H8J A;  1LCF A;  2P3V A;  1ATG A;  4U22 A;  1FJ9 A;  4NF4 B;  4OEV A;  1AWB A;  5BWJ A;  1URS A;  4ZEF A;  1TWY A;  1BKA A;  1QKB A;  4GWS A;  1QKA A;  3FVN A;  5L9S A;  4RXL A;  4OQO A;  4NF5 B;  3M8U A;  2VOZ A;  2I4C A;  5KZT A;  3C35 A;  4IR8 A;  1IMF A;  3MUQ A;  1URG A;  4Z0I A;  4IO4 A;  4F31 B;  4P1E A;  1N04 A;  4FBP A;  4ECF A;  4MFI A;  2UVI A;  2NXO A;  4U1O A;  3GZG A;  3MVY A;  2WOP A;  2FIX A;  4N4U A;  2QVR A;  4PP0 A;  2XXK A;  1JNF A;  5H8S A;  1ELJ A;  4IO2 A;  3R26 A;  3O97 A;  3PPP A;  4ELR A;  5FBP A;  4MH5 A;  2ZZW A;  5I56 A;  4GRK A;  1LBZ A;  4G2Z A;  3O29 A;  3KEI A;  2XXH A;  3LSW A;  3SKP A;  1MXX A;  3SER A;  2ZYK A;  3FVG A;  4MF3 A;  4IO5 A;  5L9M A;  4EQ7 A;  3N6T A;  3JV9 A;  3IAZ A;  3QYT A;  3FJG A;  1Y4C A;  2HXW A;  3VLW A;  2B65 A;  4R6Y A;  4YKK A;  1Y1Z A;  2OZZ A;  3E3K A;  4GVO A;  2NUV A;  1B3E A;  1OQG A;  5CMB A;  4H45 A;  1FBD A;  4JBZ A;  4RK9 A;  4IO6 A;  2R71 A;  5CM6 A;  4GWO A;  2F6P A;  1UIV A;  3HST A;  2WBB A;  4KHZ E;  1DCU A;  2R6G E;  4PF8 A;  3H3G A;  4OVQ A;  1LFI A;  2X7Q A;  3OO7 A;  3TQL A;  3ISP A;  1YPN A;  5TU0 A;  1RKM A;  1FQE A;  2DWJ A;  5IAI A;  3TDJ A;  2P0S A;  3CR9 A;  3EPE A;  4GWW A;  3DP8 A;  2E1S A;  2XXX A;  4KFQ A;  1OVB A;  4P8B A;  5L8D A;  1G0I A;  4KYE A;  3MYU A;  4LA9 A;  3FJM A;  3PUZ E;  3R6U A;  3T9U A;  4PF6 A;  1SDX A;  4PCD A;  4O94 A;  1LBB A;  3TEL A;  1BTJ A;  5TPA A;  1SW1 A;  1GTK A;  4UA8 A;  3PMX A;  3TCF A;  4PE3 A;  4HE0 A;  1H76 A;  4OEU A;  5ICQ A;  4JWY A;  3MP6 A;  4QSE A;  2HZK A;  4DXB A;  1SPI A;  4THI A;  1SD3 A;  2GH9 A;  4U21 A;  4F2Q A;  1Y3N A;  3GBA A;  5AA2 A;  3ZS6 A;  4EXL A;  3TUS A;  1JEV A;  1MQD A;  3RYB A;  1OMP A;  3TAJ A;  5A5X A;  1TFD A;  2XD2 A;  1SBP A;  4PGP A;  2DS9 A;  1FBP A;  4LUB A;  5J1D A;  3RNN A;  1Q9D A;  4H1X A;  2WKY A;  1PB7 A;  2V25 A;  1MY4 A;  4YB5 A;  3K02 A;  1N76 A;  2H99 A;  4H65 A;  1JVY A;  3VLU A;  3MJN A;  3Q25 A;  5ET7 A;  2F7C A;  3FXR A;  3N5L A;  3N6U A;  1MQG A;  5ET8 A;  1EYJ A;  5B70 A;  3TQW A;  2QMW A;  1R1N A;  4R9G A;  1OLC A;  3IOR A;  2XXT A;  3C9H A;  2DYX A;  3E13 X;  1MQI A;  5CMC A;  1A54 A;  2AIX A;  3K6W A;  1Z7N E;  3VDF A;  1ZKB A;  5CRY A;  4N91 A;  1IUD A;  4IO3 A;  4GFR A;  1XT8 A;  5FHO A;  1RYX A;  4PBH A;  3IFA A;  1XI6 A;  1B3L A;  4PAK A;  1CB6 A;  1EYI A;  2Q2C A;  1JET A;  4RNS A;  1D9V A;  3KOS A;  3LVU A;  2XWV A;  4H6D A;  1H43 A;  2HQ0 A;  3CFL A;  2QRY A;  3OEL A;  4ELO A;  2AYS A;  2QS1 A;  3O2A A;  3OO8 A;  1NUX A;  5ICT A;  4PAF A;  2F3B A;  4H8I A;  1TFA A;  1YZ0 A;  2CZK A;  5KDT A;  3CI8 A;  1LEV A;  5I58 A;  1IMB A;  1PBQ A;  4G8M A;  3RTF B;  1IXH A;  3K6U A;  5I3S A;  3PPQ A;  4GWU A;  2RKM A;  3DRK A;  3PD9 A;  4WXJ A;  3VV5 A;  2F97 A;  4MX6 A;  1LFH A;  4ZDM A;  3HN0 A;  4HS7 A;  5DVF A;  4UAC A;  3MVZ A;  5DW8 A;  4OFJ A;  3KSJ A;  4OWD A;  3NOH A;  4JWX A;  4OVS A;  3ZKL A;  4I62 A;  3EHS A;  1JW4 A;  3MAM A;  3IB0 A;  3FUZ A;  4XTC Q;  1FPE A;  4LZ7 A;  1EH3 A;  4QFK A;  3K1P A;  1A40 A;  3LUZ A;  4ESW A;  2GQ1 A;  3EHU A;  3L6G A;  2E0S A;  3T1B A;  3C32 A;  4H46 A;  4RJZ A;  2O69 A;  2VT5 A;  3KGC A;  4NF8 B;  4EF2 A;  4M4G A;  5FTH A;  2QFL A;  3WAE A;  1LBV A;  1M5D A;  3QIM A;  3CFZ A;  1AH5 A;  1DOT A;  1NH7 A;  3L6H A;  2HAU A;  4KYD A;  1IXC A;  1N3X A;  4GQO A;  5T3J A;  2WEF A;  1DTG A;  2PBW A;  4NMY A;  4PBQ A;  5LOM A;  2Y84 A;  3ECR A;  4G8N A;  1B4H A;  1BLF A;  3MZ1 A;  2H4I A;  2XD3 A;  3VLV A;  2F36 A;  1RDZ A;  4HE1 A;  3QUJ A;  4JB7 A;  1FTK A;  1B2H A;  4EXK A;  2AL4 A;  3DP6 A;  4NHB A;  4G8H A;  4F3G A;  1QUI A;  3GBB A;  1FTJ A;  2Z8E A;  4P1L A;  3KN7 A;  1FTL A;  2RC8 A;  5DVJ A;  4PFU A;  3Q28 A;  1JW5 A;  4U1Z A;  3T93 B;  2Q8J A;  3H6W A;  1YXI A;  4LQ5 A;  1EZO A;  2UXA A;  2ZYN A;  5AA4 A;  1SI1 A;  3PD8 A;  4F29 A;  3ZSF A;  1M5F A;  3D1R A;  1QVS A;  5ITP A;  1EZ9 A;  4QXD A;  4NWC A;  3TEP A;  3G3G A;  4N15 A;  5I2N B;  4N8Y A;  2A5T B;  1BK4 A;  4MNP A;  1LLS A;  2OJT A;  4XIG Q;  2PX1 A;  4U4X A;  4MNI A;  3A3U A;  2HCA A;  5H8N A;  3FGS A;  4Q30 B;  3IOV A;  1LAX A;  2FHY A;  3FV2 A;  5K2Y A;  1XVX A;  1NNT A;  1NV3 A;  5EHM A;  4P11 A;  4P56 A;  1FBE A;  2DE2 A;  3PUX E;  2A5S A;  3DRF A;  4PAI A;  2XXR A;  1FQF A;  3KBZ A;  3N26 A;  1FTO A;  3CIJ A;  3BIH A;  4GX4 A;  3DEL B;  4IY6 A;  4BDQ A;  4OYV A;  3PUW E;  1MH4 A;  2B3F A;  4HCW A;  2ZNT A;  1N3W A;  5HPQ A;  1FCK A;  4I3Y A;  1MG1 A;  4YZZ A;  4XKP A;  2GHA A;  1VFE A;  2F7A A;  5CMK A; 
#chains in the Genus database with same CATH homology
 4KR5 A;  1MS7 A;  3K1N A;  5L9M A;  4JSO A;  4EQ7 A;  3N6T A;  2UVJ A;  1B6H A;  3JV9 A;  3IAZ A;  3QYT A;  4LVQ A;  3V89 B;  3MZ9 A;  3S9E A;  4DCY A;  4XKN A;  2GHB A;  3TTR A;  4XKQ A;  3O6I A;  3FJG A;  3ILU B;  1Y4C A;  4X9T A;  2HXW A;  3VLW A;  2B65 A;  4R6Y A;  4YKK A;  1B46 A;  1Y1Z A;  4EUO A;  2OZZ A;  3E3K A;  4GVO A;  2NUV A;  1XVY A;  3CRB A;  3HO7 A;  1B3E A;  3LSF B;  3JZJ A;  2PT2 A;  3OD7 A;  4FED A;  4MLQ A;  1OQG A;  4YKP A;  5CMB A;  1AL3 A;  3FXQ A;  5I56 B;  1MRP A;  4FOR A;  4LZ8 A;  3V5A A;  1B3F A;  3TCG A;  3OMB A;  5H8F B;  3CHG A;  1LAH E;  3EQ1 A;  4KD5 A;  1GVC A;  3K4U A;  5TPA B;  4JBZ A;  1XOC A;  1O64 A;  1SVX B;  4RK9 A;  5FHM A;  3IL1 B;  2OBG A;  4HTG A;  4IO6 A;  2R71 A;  4F39 A;  4NTL A;  4ZEI A;  1FQB A;  2P1S A;  5CM6 A;  2ZNU A;  3T22 A;  5F7V A;  3KJ7 A;  3S9N C;  3QSL A;  3WAF A;  2F35 A;  3OXN A;  2RCA A;  4BLA A;  4GWO A;  2F6P A;  4AQ4 A;  3MBP A;  2DOJ A;  1UIV A;  4XKR A;  2XXW A;  2XXP A;  3ONM A;  3HST A;  3SEY A;  2I4B A;  2Z8D A;  2VD3 A;  3HHG A;  4KHZ E;  1MXW A;  2R6G E;  1SW4 A;  2AL5 A;  1NNF A;  3H3G A;  2FYI A;  4DXU A;  4F19 A;  5CC2 A;  1UTH A;  5JK4 A;  2X26 A;  1LFI A;  4OET A;  2X7Q A;  3MP8 A;  1MXZ A;  3HPI A;  3OO7 A;  1POY 1;  4F3B A;  3BFT A;  2ZXT A;  4FEB A;  3TQL A;  3TTK A;  1ANF A;  1D9Y A;  1MXV A;  4GLI A;  2XHD A;  2DP8 A;  1Y3P A;  1YPN A;  5I57 A;  5TU0 A;  1R9L A;  2FA7 A;  1RKM A;  1D3K A;  1FQE A;  2DWJ A;  5IAI A;  3FIR A;  2FNC A;  3TDJ A;  1PDA A;  3K0V A;  2P0S A;  5DT6 A;  4F3S A;  4BDO A;  4KCC A;  3H03 A;  2DWI A;  3B6Q A;  1NMU A;  2I49 A;  3CR9 A;  3EPE A;  4P0G A;  5I57 B;  2KLF A;  2XXY A;  1QJM A;  2O1L A;  3T96 B;  1A7L A;  1SI0 A;  4OFL A;  3DP8 A;  2DQV A;  3M3L A;  1B3H A;  4E0X A;  2E1S A;  2XXX A;  3CFX A;  3MPK A;  4NF6 B;  2F7B A;  4OZ9 A;  4X1D A;  3RUM A;  2XXU A;  4KFQ A;  1NFT A;  1UTH B;  3O9P A;  1J1N A;  2IEE A;  5AA1 A;  1OVB A;  1B4Z A;  3USD A;  4K3F A;  3RY3 A;  4WKM A;  5L8D A;  4PFT A;  4ZS9 A;  3UA8 A;  4AB6 A;  1Y4T A;  3K00 A;  4O3C A;  4KYE A;  1MPC A;  1MDQ A;  4LA9 A;  5I84 A;  3FJM A;  3PUZ E;  3R6U A;  3T9U A;  4R9F A;  5ELV A;  4WEP A;  2QS3 A;  1SDX A;  3FXU A;  4O3A A;  3LSL A;  2A5T A;  2ZYO A;  1LBB A;  1MY0 A;  3MW0 A;  3UP9 A;  1N0T A;  3KG2 A;  3Q29 A;  3TEL A;  1YCJ A;  1BTJ A;  1R6Z A;  3Q27 A;  4NF6 A;  5TPA A;  1MY1 A;  1SW1 A;  3MZB A;  3RQT A;  1GTK A;  4TQU Q;  5H8F A;  4UA8 A;  4DDD A;  1D4N A;  3PMX A;  3ZKK A;  3TCF A;  3LBS A;  1VSO A;  1B7U A;  1H76 A;  2Y7K A;  4OEU A;  3DLN A;  4JXI A;  4QSC A;  3KN8 A;  1SW2 A;  3W9V A;  4EDP A;  1HSJ A;  3S9L C;  3TKD A;  5ICQ A;  4JWY A;  3ILT B;  5FTI A;  1YTV A;  2RIN A;  1LBC A;  2I0C A;  5AA3 A;  1MQJ A;  3MP6 A;  4QSE A;  5AA4 B;  2HZK A;  4DXB A;  2ABH A;  3OOA A;  4THI A;  1SD3 A;  2HFB A;  1O7T A;  2NWJ A;  4C0R A;  1DPE A;  2GH9 A;  3QUF A;  4H67 A;  2Q9T A;  3VXC A;  4LP2 B;  2CMO A;  4U21 A;  4NF5 A;  4DCX A;  3R7X A;  5AE4 A;  4F2Q A;  1Y3N A;  3E9X A;  3PMV A;  3GBA A;  3D4G A;  5AA2 A;  3ZS6 A;  3T9V A;  4EXL A;  3TUS A;  1R9Q A;  4BDR A;  4DZ1 A;  2Q88 A;  1JEV A;  1I6B A;  3SEU A;  3RT6 B;  1MQD A;  1BP5 A;  3CG1 A;  4U2R A;  3RYB A;  5DYH A;  5K2X A;  1B5J A;  3TTN A;  3MVX A;  5M2V A;  2Z22 A;  1OMP A;  3TAJ A;  5A5X A;  2I3V A;  4NF4 A;  5H8H A;  4QFL A;  1TFD A;  1OIB A;  1S50 A;  4I9D A;  1P1O A;  3DP4 A;  3PUY E;  4R2F A;  2F6G A;  5I2N A;  2XD2 A;  1A8E A;  1SBP A;  3OEM A;  3LSX A;  4Z7E A;  2VGQ A;  4BDN A;  4RA1 A;  1QUK A;  1LFG A;  4FJP A;  3SET A;  2XX7 A;  3FV1 A;  3U92 A;  4G4P A;  1B7H A;  3TOD A;  4Q5T A;  1M5E A;  2QL3 A;  1S9T A;  1FQA A;  2DS9 A;  2G29 A;  3C36 A;  2OWT A;  4PQJ A;  3FJ7 A;  4LUB A;  4RK2 A;  3S4U A;  3HV1 A;  3RNN A;  1QW0 A;  4ESX A;  5J1D A;  1PEB A;  4H1X A;  1LCT A;  2WKY A;  1PB7 A;  2VHA A;  2UVG A;  3IO6 A;  2V25 A;  1MY4 A;  4IO7 A;  4YB5 A;  1NKX A;  3K02 A;  3O6H A;  3U93 A;  1UQW A;  3HCQ A;  4EQ9 A;  1N76 A;  2ZMB A;  2H99 A;  2VP1 A;  3FD3 A;  4H65 A;  4KQP A;  1JVY A;  1P1U A;  4O3B A;  3UGW A;  4F3P A;  4I1D A;  3VLU A;  3MJN A;  4IB2 A;  3FZV A;  3OEN A;  1P1N A;  2F7C A;  3FXR A;  3N5L A;  3N6U A;  1MQG A;  3Q25 A;  4GOT A;  5H8Q B;  3VVD A;  1VR5 A;  5B70 A;  3OEK A;  3TQW A;  2QMW A;  1R1N A;  4R9G A;  1MM6 A;  1OLC A;  1XS5 A;  2O7I A;  4GF8 A;  5ISU A;  2XXT A;  3B6W A;  3C9H A;  3CVG A;  3IOR A;  2DYX A;  1LAG E;  1SQY A;  3E13 X;  4ZE8 A;  1MQI A;  4GL0 A;  4U4S A;  2NVU B;  3P7I A;  4OVJ A;  5I2K B;  3U8Q A;  2H5Y A;  2O7U A;  2I6E A;  2UYF A;  5CMC A;  3UIF A;  5CMK A;  1A54 A;  1FQC A;  3H6T A;  5EYF A;  4PFY A;  1IZ1 A;  4JDF A;  2R9J A;  2AIX A;  3SEW A;  3K6W A;  3U1O A;  3U72 A;  1Z7N E;  3VDF A;  1MM7 A;  4F1V A;  4G68 C;  1ZKB A;  1OLA A;  2DE4 A;  3GXA A;  3H4Z A;  5CRY A;  4NF8 A;  1Y1M A;  4QSD A;  2DWH A;  3OO6 A;  5CMM A;  3FAT A;  3RN8 A;  1IUD A;  4IO3 A;  3W15 C;  4R72 A;  1LB9 A;  1ZMG A;  4GFR A;  1XT8 A;  4JWO A;  1RYX A;  4XXU A;  5FHO A;  3W9W A;  1MXY A;  3ODB A;  1H3D A;  4DXC A;  2H98 A;  2O84 X;  3OSR A;  3TCH A;  3I5O A;  4P0I A;  5EHS A;  1QUJ A;  1B3L A;  2PYY A;  2LAO A;  3H6U A;  2OWS A;  2V93 A;  1CB6 A;  2Q2C A;  4E0W A;  3E4R A;  1RYO A;  4G68 A;  1JET A;  1MPB A;  4RNS A;  1D9V A;  4QFP A;  1NNK A;  3LVU A;  1S7Y A;  1UTB B;  2P2A A;  3KOS A;  3C34 A;  3IK6 B;  4RPN A;  4H6D A;  4OXV A;  1B58 A;  2WOL A;  1H43 A;  2HQ0 A;  3DRI A;  3CFL A;  4ISU A;  1B9J A;  5IKB A;  4ZZA A;  4F22 A;  1LST A;  2QRY A;  1XHY A;  3OEL A;  1B0H A;  5JTY A;  4ELO A;  2AYS A;  1VFD A;  2REG A;  3IOU A;  1B05 A;  4IGT A;  3O6G A;  2QS1 A;  3O2A A;  3OO8 A;  1H45 A;  1B5I A;  4YKJ A;  1IXG A;  4F18 A;  5DVI A;  3THI A;  5ICT A;  1N84 A;  4ZZE A;  3G3F A;  3TPA A;  5I59 A;  1B3G A;  1GGG A;  1TFA A;  4H8I A;  5KDT A;  3CSB A;  1GR2 A;  1Y3Q A;  2UYE A;  2Z8F A;  4KPT A;  5H8N B;  5DTB A;  3CI8 A;  3TTL A;  3FVO A;  5I58 A;  1PBQ A;  4G8M A;  3SEX A;  3RTF B;  4ONY A;  1IXH A;  2UVH A;  3EHT A;  2H25 A;  1ZTY A;  3K6U A;  4YMB A;  4LAT A;  3PPQ A;  4BDM A;  4PE5 B;  2B4L A;  2RKM A;  3DRH A;  5BUU A;  1USY E;  1YAE A;  4ELP A;  5KCJ A;  3KN3 A;  4R6K A;  3DRK A;  3PD9 A;  4KCD A;  4QFN A;  4N6P A;  4WXJ A;  3VV5 A;  2B4M A;  2F97 A;  4QF9 A;  2YLN A;  4U23 A;  2O1M A;  4DIG A;  1LFH A;  2VD2 A;  1JQF A;  4ZDM A;  4RPO A;  3HN0 A;  4HS7 A;  5DVF A;  1FW0 A;  2HAV A;  2Z23 A;  3K6V A;  2RC9 A;  4KI0 E;  4UAC A;  1TT1 A;  2HEU A;  3MVZ A;  4R74 A;  4EQB A;  3V83 A;  1M5C A;  1MQH A;  4JSD A;  3IOT A;  2F34 A;  4POW A;  4QFO A;  3C31 A;  4ZE9 A;  4OMB A;  2ZNS A;  4TLM B;  3PPR A;  3VXB A;  3FVK A;  3M3K A;  4OFJ A;  1I69 A;  4FE8 A;  3KSJ A;  3TTM A;  1A8F A;  4RY1 A;  3VE1 B;  3PAM A;  1N7W A;  3MP1 A;  4OWD A;  4X1B A;  5I59 B;  2D3I A;  4AB5 A;  4ZEB A;  4WED A;  3DM0 A;  4JWX A;  1B40 A;  4KYS A;  3IB1 A;  5DEX A;  2O51 A;  3ZKL A;  4I62 A;  1LAF E;  4Q0C A;  1B1X A;  3EHS A;  3GLB A;  1B0L A;  1SW5 A;  5HBC A;  4ZED A;  1DTZ A;  2Y7P A;  1JW4 A;  1SYI A;  3B6T A;  2QS2 A;  3IB0 A;  3MAM A;  3T66 A;  2RC7 A;  4GD5 A;  4EF1 A;  3FUZ A;  3MC2 A;  3KBR A;  4F1U A;  3KFM A;  4YB6 A;  4XTC Q;  4LZ7 A;  3S2V A;  4FEC A;  4C1T A;  3LUY A;  3AXF A;  1CE2 A;  1EH3 A;  4QFK A;  1A55 A;  1MPD A;  3BBR A;  3JYR A;  2REJ A;  1A40 A;  2X7P A;  3K1P A;  4G68 B;  4HCY A;  1IIW A;  3OO9 A;  1GV8 A;  4BDL A;  4ESW A;  3EHU A;  3L6G A;  1MH3 A;  2OCU A;  1P1Q A;  2E0S A;  2XXV A;  3VVE A;  4F1Y A;  4F2O A;  3I6V A;  3IX1 A;  1O63 A;  3C32 A;  4ND9 A;  4POX A;  4R6H A;  3T9X B;  2WOK A;  3RTW B;  4RJZ A;  2ZYM A;  2O69 A;  1ZU0 A;  1HSE A;  5TP9 B;  5TP9 A;  1QUL A;  1T0K A;  4NWD A;  2QPQ A;  1IQ7 A;  4YB7 A;  1I6A A;  3K2D A;  5AA2 D;  2DVZ A;  1XC1 A;  3C33 A;  3KGC A;  4MLV A;  1LGB C;  3H7M A;  4NF8 B;  1AIV A;  4EF2 A;  2I0B A;  2ONK E;  1ZJL A;  4M4G A;  5FTH A;  2RCB A;  1JVX A;  2XX8 A;  4X48 A;  5F1Q A;  4R2B A;  3WAE A;  1NNP A;  1B1H A;  2O68 A;  4MBP A;  4QRZ A;  3FAS A;  3VVF A;  3RLF E;  1VE4 A;  5B7D A;  1EU8 A;  2V3Q A;  3UK4 A;  2DWA A;  1NH8 A;  1M5D A;  3QIM A;  3CFZ A;  4R73 A;  1AH5 A;  1DOT A;  2DVC A;  4M1V A;  2YPN A;  3UN6 A;  2F78 A;  2I48 A;  2ALU A;  2Y7W A;  1NH7 A;  3L6H A;  1N7X A;  2HAU A;  4KYD A;  4DE8 A;  1B52 A;  4RYA A;  2PVU A;  3PPO A;  1B32 A;  3SEV A;  1UTB A;  3MQ9 A;  1IXC A;  3IO4 A;  1N3X A;  5HM4 B;  3B7D A;  5H8Q A;  2M8C A;  3MWB A;  4GQO A;  4TOZ A;  3A09 A;  2NOO A;  4LZ5 A;  4YMA A;  4LQ2 A;  1A99 A;  4H0W A;  1NL5 A;  3LC8 A;  4NED A;  1UIU A;  4Q8R A;  4OES A;  1DTG A;  3UOR A;  3TYH A;  1OQH A;  2PBW A;  2Q2A A;  3A3C A;  3N94 A;  3DRJ A;  4NMY A;  2Y7R A;  1L5T A;  3TZA A;  2Y84 A;  5LOM A;  1AMF A;  3FTO A;  1DPP A;  2XX9 A;  3ECR A;  4G8N A;  1US4 A;  1B4H A;  1BLF A;  1USY H;  2XXI A;  2H4I A;  2XD3 A;  3MZ1 A;  2F36 A;  3VLV A;  3QK6 A;  1Q1K A;  1Y20 A;  3F11 A;  1B7Z A;  2F5X A;  3QUJ A;  1MXU A;  2OLB A;  1II5 A;  4YAH X;  2BJJ X;  4JB7 A;  3K1M A;  1FTK A;  2ESN A;  1B2H A;  2GRV A;  2HZL A;  4I8C A;  1MY3 A;  1I6Q A;  2AL4 A;  4OHN A;  4OTE A;  3RYA A;  3DP6 A;  2I3W A;  3K01 A;  4G8H A;  5H8H B;  3C4M A;  1PC3 A;  4F3G A;  4N07 A;  5A5X B;  3G3I A;  5KCJ B;  3TFL A;  1QUI A;  3S9M C;  1EZP A;  1URD A;  1WOD A;  3GBB A;  4YU0 A;  1Q35 A;  3EN3 A;  1FTJ A;  2Z8E A;  2ANJ A;  4N13 A;  1B51 A;  2F8D A;  5I2K A;  3KZG A;  3O6P A;  3KN7 A;  1FTL A;  3LR1 A;  4LON B;  2RC8 A;  5DVJ A;  4ZEK A;  4PFU A;  4L17 A;  3IR1 A;  4HW8 A;  4G77 A;  2I58 A;  3OSQ A;  2PT1 A;  2O6A A;  4PET A;  4C1U A;  3Q28 A;  4IGR A;  1JW5 A;  1Y9U A;  4U1Z A;  5DEX B;  2Q8J A;  3T93 B;  4OFO A;  1POT A;  3H6W A;  1IXI A;  4GL8 A;  1DMB A;  4H5G A;  4LQ5 A;  3MVW A;  1EZO A;  4DLD A;  3G3J A;  2DE3 A;  2UXA A;  2ZYN A;  3G7W A;  1SI1 A;  5AA4 A;  4GIZ A;  3RGY A;  3PD8 A;  4F29 A;  1ZLQ A;  3ZSF A;  5CBS A;  1F9B A;  3VFJ A;  1M5F A;  5FHN A;  2THI A;  3M3F A;  3G3K A;  1QVS A;  2OK2 A;  5ITP A;  3RPW A;  4FIM A;  3KOT A;  1EZ9 A;  1BIY A;  1P99 A;  3IJO B;  3PV0 E;  2V3T A;  2D5W A;  3BFU A;  4NE4 A;  3IB2 A;  4OER A;  4ZEC A;  3I3V A;  1ZIU A;  4NWC A;  3TEP A;  1KWH A;  3G3G A;  1P1W A;  3QAX A;  3O66 A;  1DSN A;  3MPL A;  2QMX A;  3PU5 A;  4IY5 A;  4FAT A;  4ELQ A;  5I2N B;  1LB8 A;  5ITO A;  2DXR A;  4H8J A;  3U94 A;  4FAJ A;  1LCF A;  1ATG A;  3CG3 A;  2A5T B;  4U22 A;  3RT8 A;  4NF4 B;  4OEV A;  1JEU A;  5CI5 A;  5BWJ A;  2IA4 A;  1URS A;  1LLS A;  2OJT A;  4ZEF A;  4XIG Q;  4PFW A;  1TWY A;  1BKA A;  1QKB A;  1FTM A;  1JW1 A;  2B3B A;  2G93 A;  2PX1 A;  4U4X A;  3IJX B;  3DRG A;  4YIC A;  1IEJ A;  5I58 B;  2RF1 A;  1QKA A;  1HSL A;  1US5 A;  5AA2 B;  3FVN A;  3A3U A;  3D4C A;  4RXL A;  2HCA A;  5H8N A;  5L9S A;  1IIT A;  3FGS A;  2QJE A;  4H5F A;  4OQO A;  4YKI A;  5KDT B;  4NF5 B;  3M8U A;  2VOZ A;  2ONR A;  2I4C A;  3TMG A;  5KZT A;  3V8X B;  2XXQ A;  2DXY A;  3C35 A;  4Q30 B;  3HHF A;  3MUQ A;  3IOV A;  2D21 A;  1URG A;  4R75 A;  4IO4 A;  4Z0I A;  4F31 B;  1AOV A;  1LAX A;  3PGF A;  5JTY B;  5JEI A;  3QXM A;  1N04 A;  4ECF A;  4EXK A;  1OVT A;  3PPN A;  4MFI A;  1WDN A;  3FV2 A;  1XVX A;  1NNT A;  5K2Y A;  3SES A;  5EHM A;  4GXS B;  4P11 A;  2UVI A;  1Z7M E;  1H44 A;  2PMS A;  2Q89 A;  2GFE A;  2H9B A;  3KJT A;  3Q26 A;  3T9H B;  3O28 A;  2NXO A;  3K6X A;  4OEN A;  4U1O A;  1FQD A;  3CSG A;  3GZG A;  2Y7I A;  2DE2 A;  3MVY A;  2A5S A;  2WOP A;  3PUX E;  5L9O A;  4GXA A;  1PBP A;  3DRF A;  2XXR A;  1FQF A;  3N26 A;  1FTO A;  3CIJ A;  3EF7 A;  4PP0 A;  2QS4 A;  1MY2 A;  5CBR A;  3DEL B;  3H06 B;  1JNF A;  1B5H A;  4TLL B;  5H8S A;  1PB9 A;  1ELJ A;  4IY6 A;  4BDQ A;  2V3U A;  4OYV A;  3PMW A;  3PUW E;  4IO2 A;  1MH4 A;  2B3F A;  4HCW A;  2W7Y A;  2ZNT A;  2CZL A;  3R26 A;  1N3W A;  3O97 A;  5HPQ A;  2ONS A;  1PB8 A;  1FCK A;  2QSX A;  3PPP A;  2DSF A;  3KSX A;  3BKI B;  4ELR A;  1TXF A;  4QHQ A;  3SDF A;  4MH5 A;  1MG1 A;  5I56 A;  3G3H A;  3PUV E;  4GRK A;  4YZZ A;  4XKP A;  2GHA A;  4G2Z A;  3O29 A;  1ZBM A;  3KEI A;  1VFE A;  3IOW A;  1MDP 1;  1WVJ A;  2XXH A;  3LSW A;  1SYH A;  1MXX A;  2F7A A;  2V84 A;  2YJP A;  3SER A;  3SKP A;  1M5B A;  2ZYK A;  3FVG A;  3H6V A;  4MF3 A;  4IO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...