2Z23A

Crystal structure of y.pestis oligo peptide binding protein oppa with tri-lysine ligand
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
517
structure length
517
Chain Sequence
b'ANVPTGVQLAEKQVLVRNNGSEPQSLDPHKIEGVPESNISRDLLEGLVINDPNGNIVPGAAESWDNKDFKVWTFNIRKDAKWSNGDPVTAQDFVYSWQRLADPKTVSPYASYLQYAHLTNIDDIITGKAAPDTLGVKALDDHTLEVTLSEPVPYLDKLLAHPLMSPVNKTVVEKFGEKWTQPQNFVGNGAYKLKDWIVNERIVLERSPTYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPDQVHVDPYLCTYYYEINNQKAPFTDARVREALKLGMDRDIIVNKVKNQGDLPAYGFTPPYTSGAELTPPEWFSWTQEKRNEVAKKLLAEAGYTKDNPLKFSLLYNTSDLHKKLAIAAASIWKKNLGVDVKLENQEWKTFLDTRHQGTYDVARAAWCADYNEPSSFLNMMLSNSSNNTTHYKSSVFDKLIEDTLKVKSEKERADLYQQAEIQLDKDSAIVPVFYYVSARLVKPYVGGYTGKDPLDNMHVKDLYIIKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Periplasmic oligopeptide-binding protein
publication title Structures of OppA and PstS from Yersinia pestis indicate variability of interactions with transmembrane domains.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Peptide binding protein
total genus 173
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2z23A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z23A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 2z23A02
2Z22A 4RA1A 3JYRA 2F6PA 4C0RA 2XX7A 4BLAA 1LSTA 4LQ2A 2B3BA 3FVGA 4R2FA 2Q2CA 3LC8A 2QJEA 1OQHA 3FVKA 3Q26A 4JDFA 3SEXA 2XD2A 4RK2A 2VOZA 3MVZA 2O1LA 4U4SA 2LAOA 3IOUA 3N26A 3K6XA 2ABHA 4NF4A 3QUJA 3DP6A 4NF6A 1DOTA 3OO9A 4NWDA 1SD3A 4IO5A 3Q25A 2AL4A 5H8FA 4O3CA 3IJOB 3VVFA 1LBCA 3G3JA 3TMGA 4DCXA 4BDRA 3M3KA 2Z8DA 1Q1KA 3PAMA 3U1OA 5AA4B 4LZ5A 1AOVA 3MAMA 1LAXA 3UIFA 3CHGA 1MY1A 2UXAA 4FORA 4QF9A 2WOPA 1MXVA 4U2RA 1KWHA 3KN7A 3PUZE 5FTHA 3E9XA 4PP0A 3OO6A 2XXIA 4OEUA 1VFEA 3O2AA 3RPWA 1DTZA 5AA2A 3RT6B 1I6QA 4ZE8A 4OYVA 4KYSA 3E4RA 5I2KB 3QUFA 4KPTA 3IL1B 4I9DA 1FQEA 2Y7RA 3BFTA 1S50A 1B6HA 1GTKA 1POTA 4GXAA 3I3VA 1YAEA 1MPDA 1LAHE 3IB2A 1B4HA 1BKAA 2XXPA 4H5FA 1FQDA 3ILTB 1ZTYA 1B7HA 1WODA 2ANJA 3OSQA 2QMXA 3S9LC 3RYBA 2PX1A 1MPBA 1R9QA 2Q2AA 3W9VA 2DWAA 5LOMA 2QS1A 3FASA 5HBCA 3L6HA 4YAHX 4LP2B 1A8FA 1S9TA 5L8DA 4NMYA 1IEJA 1MY0A 4RNSA 4H0WA 4F3GA 1USYE 1URGA 3H4ZA 2A5TA 3HPIA 3FVOA 3Q27A 3EHUA 1IXGA 3USDA 3PU5A 4FJPA 4NTLA 1A7LA 3SDFA 2QRYA 3DLNA 3KEIA 3D4GA 5I56A 3T66A 1TFDA 4EUOA 1YPNA 1B52A 3VV5A 4DE8A 3VVDA 1MM7A 3RNNA 4WEDA 1LGBC 4WKMA 1SW2A 1VE4A 2ALUA 3CFLA 2I48A 4ELOA 1N7WA 1TXFA 3RGYA 2F97A 4G68C 1N04A 3ZSFA 5I57A 4QHQA 3UGWA 3H6WA 3C31A 3R6UA 3SETA 1FTMA 2V25A 3FXQA 5K2YA 1B0LA 4MLVA 4HS7A 4P0GA 5DVIA 1OMPA 3KOSA 1SW1A 5ISUA 4X9TA 3IORA 1Y1ZA 2IA4A 2X26A 3IOVA 3C34A 1D9YA 1QW0A 3V8XB 4TLLB 1J1NA 3KGCA 1O7TA 2H25A 3RTWB 5DEXA 4EF2A 1B9JA 3CRBA 3O6GA 5ITPA 1MXYA 1M5FA 3LSXA 2QS4A 3K01A 5I58A 5BWJA 1XVYA 2F36A 4P0IA 1UIUA 4NF8A 4M1VA 4MF3A 1SVXB 3T96B 3LR1A 4IY5A 5TPAA 2Y7WA 1OLCA 2RINA 3OSRA 1MQDA 3WAEA 1LBBA 3ILUB 1AL3A 2I3VA 1SI0A 3MP8A 3KSXA 3FV1A 4R75A 3SEVA 4RJZA 2D3IA 1NKXA 3VLWA 5TU0A 4XKQA 5H8NB 4ELQA 4BDMA 1HSEA 3C33A 3O28A 4Q0CA 4H8JA 3LSFB 5TP9A 1A54A 3K1PA 4GIZA 3TCGA 4JWXA 1OLAA 4YKPA 4U1ZA 1AMFA 4AB6A 2E0SA 1B5JA 1JW1A 4GOTA 3OXNA 5CMCA 4R6HA 2GFEA 3G3FA 2ZMBA 4QFPA 2XXRA 1XOCA 2E1SA 1NNTA 3MVYA 1B3LA 5ELVA 2B3FA 3JV9A 2GH9A 2OK2A 2WOKA 2I6EA 1JETA 1PEBA 4QSEA 4ESXA 4LA9A 5I84A 4KHZE 3RLFE 1P1WA 4PETA 3TELA 2I0BA 1MDQA 1B58A 2HZKA 3DELB 1WVJA 1S7YA 3VXCA 3RY3A 1T0KA 3MQ9A 1R1NA 4GL8A 1PBPA 3TQLA 2O1MA 4GLIA 2DXYA 2XXUA 1MPCA 1MH3A 1CE2A 1JEVA 2DWIA 4F1YA 3K0VA 3I6VA 4E0WA 1OIBA 4G8HA 2P0SA 3SEYA 4XKNA 3PPOA 1O64A 5KCJB 4LUBA 3W15C 1UTHB 4POXA 1POY1 1SDXA 3AXFA 3UP9A 4G4PA 1Y3NA 5DVJA 5BUUA 2XXXA 1B5IA 4N13A 5H8SA 1B40A 2P2AA 4LZ7A 4F29A 5KDTB 2QS3A 1D3KA 5EYFA 4THIA 4F19A 5H8HA 1Y1MA 4OVJA 4KCCA 4F3BA 2DWJA 3BFUA 3LSWA 4M4GA 4DCYA 3PPRA 3GXAA 2XX9A 3CR9A 1US5A 4GWOA 3E3KA 1FQAA 3FJ7A 1ZIUA 5ITOA 4BDNA 4QSCA 4G68A 1D4NA 2HEUA 1F9BA 5AA1A 3PGFA 4HTGA 4IO3A 4TQUQ 2AL5A 3H7MA 1B0HA 1XT8A 4QFOA 5A5XA 3OD7A 3H6UA 1MQJA 2V3UA 4QFLA 4JBZA 3PMWA 1QJMA 1XHYA 4IO4A 4PFUA 3U94A 4Q5TA 4I8CA 4KYEA 2HQ0A 3G3KA 4YKJA 1B1HA 1RKMA 1IXCA 3C35A 3O6IA 1B1XA 4X48A 1N3WA 1HSJA 4OERA 1SW5A 2XXWA 3GBBA 1USYH 3FD3A 2DP8A 2XXQA 3QXMA 3OEMA 4OTEA 2G29A 2QSXA 4ZEIA 1Y9UA 4YB7A 2I4BA 1UTBA 4BDLA 2I4CA 5I2NA 1SYIA 5FHMA 2HZLA 2RF1A 5HM4B 1QULA 4EQBA 3R7XA 2HAUA 4HCYA 4RYAA 4EQ9A 1N76A 1Y4TA 4Q30B 5I59B 2O7IA 3U8QA 4HCWA 1NL5A 1B3GA 3EF7A 2R6GE 3LSLA 2CMOA 3VLUA 2QPQA 4EQ7A 2KLFA 1ANFA 1R6ZA 3IR1A 3I5OA 1RYXA 3CSBA 2DSFA 4ZEDA 3K1NA 1NFTA 3C32A 3N94A 3B6WA 3G3IA 1FTKA 3GZGA 1FQCA 1OVTA 4N07A 1B46A 3VE1B 5EHSA 4AQ4A 3EQ1A 3PUYE 3IK6B 3FZVA 1MQHA 2F6GA 2HCAA 3FXRA 1LAGE 5KZTA 2DOJA 1PC3A 3IB0A 5CBSA 1QUKA 4LQ5A 2O84X 2FA7A 3FATA 1P99A 1GV8A 3PUXE 5AA4A 3CFXA 3OO7A 3QSLA 3DP8A 1NNFA 4NF5B 5AA3A 1DSNA 3EN3A 4U1OA 5AE4A 3PMXA 4YKIA 4G77A 3V83A 4I1DA 1MQIA 1AH5A 5B70A 4YB6A 2B4LA 5DT6A 2F7AA 4H1XA 2RC9A 1MXZA 2ONSA 2Y7KA 4XKPA 1XVXA 4R2BA 4NWCA 4ELRA 1CB6A 3PMVA 1FQFA 3TDJA 4RXLA 2OJTA 1EU8A 3O29A 2YLNA 4ZEFA 1XC1A 2DE3A 3FUZA 3MW0A 3U93A 4PE5B 1B7UA 3MPLA 1IZ1A 1SQYA 3MWBA 3DM0A 1P1UA 2RKMA 3ZS6A 3IO6A 4R72A 4UACA 1QKAA 4OESA 5H8QA 4IO2A 3PD9A 1EH3A 1IXHA 4ONYA 4PQJA 3KJ7A 3H6VA 3A3UA 4O3AA 2ZYMA 5F1QA 4GFRA 1RYOA 3R26A 2WOLA 2GRVA 4NF8B 4OWDA 2V84A 5CBRA 5FTIA 2DS9A 1DTGA 4YU0A 1JEUA 4H8IA 5TPAB 4GVOA 3VXBA 4LATA 3OOAA 1NNKA 1ZJLA 3OO8A 1FTLA 2D21A 5L9SA 1PBQA 4IGTA 4POWA 4E0XA 4IB2A 2F5XA 3N5LA 1VSOA 4RK9A 5FHOA 4R73A 4IGRA 4Z0IA 3IO4A 4R6YA 3FV2A 3QYTA 2PT2A 2I58A 4R6KA 4YMBA 3H6TA 2H99A 5F7VA 4GF8A 2OBGA 1EZ9A 4RY1A 2UVJA 3SEUA 4ZE9A 1LFIA 2PYYA 3RYAA 1Z7ME 1JVYA 3DRIA 3TCFA 1LB8A 3O9PA 5EHMA 2NXOA 1MXWA 2QL3A 2HXWA 3TTNA 1R9LA 3TFLA 2UVGA 5CC2A 2Z8EA 4OETA 2IEEA 1YTVA 1LCFA 3UA8A 4GL0A 2AIXA 4JXIA 5HPQA 2OWSA 1DPPA 4BDOA 1H43A 1M5EA 1B5HA 3PUVE 3Q28A 3B6QA 4PFWA 2D5WA 3VVEA 4FEDA 3RN8A 1OQGA 5CI5A 3EHTA 4H65A 1B3EA 5JK4A 4GD5A 1ZU0A 4KCDA 3F11A 2NOOA 5CMBA 3K02A 1D9VA 3IOWA 4ZEBA 4ECFA 1N0TA 1URSA 3MP1A 1MQGA 3B7DA 3K1MA 3QAXA 1GVCA 4IO7A 2M8CA 5DVFA 2I0CA 2R71A 1P1NA 2PVUA 2O7UA 4JB7A 4H67A 3M3FA 1B2HA 3EHSA 1II5A 2XD3A 3PPPA 3SEWA 5ICTA 1FQBA 1VFDA 1B32A 2O51A 2ZNTA 4Q8RA 4PFYA 4ZZAA 1B3FA 3S9MC 3FIRA 4PFTA 1H45A 3FXUA 2HAVA 3FGSA 2V93A 4F39A 3BKIB 1ZKBA 3H03A 3VLVA 5AA2D 4DXCA 4FECA 1TFAA 2Y84A 3TTLA 4YB5A 4FAJA 1EZPA 4TOZA 2VP1A 3KN3A 1LFHA 1NH7A 5CM6A 2YPNA 3TTMA 2ZNUA 1US4A 4OZ9A 3KZGA 1M5DA 4U23A 3MUQA 4Z7EA 3HHFA 1HSLA 2GHBA 2ZXTA 3O66A 4KYDA 2RC8A 4ESWA 3Q29A 3TTKA 2AYSA 3A09A 2V3TA 4IY6A 3TODA 3HV1A 1BP5A 3E13X 3MP6A 3T93B 1YCJA 1DMBA 1MY3A 4NEDA 2DXRA 1GGGA 2Q89A 3JZJA 3M3LA 1IIWA 4TLMB 2B4MA 2X7QA 1MS7A 4FE8A 3TPAA 4ZECA 4ZZEA 4RPOA 1MXXA 2H98A 1N84A 3OEKA 1ELJA 5JTYA 1A55A 3M8UA 4WEPA 4NF4B 3CIJA 3TAJA 4NF6B 3RUMA 4MH5A 1I69A 1B3HA 4GRKA 1NH8A 3TTRA 4DIGA 3EPEA 4MLQA 1SBPA 4X1BA 4FEBA 5H8FB 2Q88A 2Z8FA 4QFNA 1UTHA 1NMUA 2PT1A 3MPKA 4C1UA 3PD8A 2R9JA 3B6TA 5M2VA 4XIGQ 3K2DA 2XXTA 4X1DA 2W7YA 2GHAA 3CFZA 2F78A 3DRKA 4KFQA 3D4CA 5KDTA 4F2QA 3ZKKA 4DXBA 3UN6A 3LUYA 3T9XB 3U92A 1H44A 2UYFA 3SESA 5AA2B 2G93A 5IAIA 1L5TA 4HW8A 2BJJX 2THIA 4OENA 2VHAA 1Y3PA 5FHNA 1LFGA 2H4IA 3K6WA 2ZYKA 1PDAA 3W9WA 3MVWA 2F7CA 4DLDA 4EDPA 4ISUA 1MM6A 3GBAA 3HSTA 2RCBA 3UORA 2FYIA 4WXJA 3VDFA 4LZ8A 3DRGA 1QUIA 3ECRA 4OEVA 1LLSA 3O97A 3TKDA 1M5BA 2XXHA 3N6TA 1IUDA 4EXLA 3FJGA 2WKYA 3SERA 3QIMA 1VR5A 3RT8A 4U22A 1MY4A 1FTJA 2UVHA 2A5SA 4F1UA 3S9NC 2ZYOA 2I3WA 4JSOA 5B7DA 2NWJA 1M5CA 1A40A 1ZMGA 2XXVA 1QKBA 4F2OA 2Q9TA 5L9MA 4OFJA 3LBSA 4O3BA 1TT1A 3HO7A 4G2ZA 2A5TB 4LVQA 3OENA 1B05A 1NNPA 4LONB 4JWOA 2DVZA 5JEIA 4ZEKA 2ZNSA 3MVXA 4RPNA 5I56B 3GLBA 4XTCQ 3P7IA 4R9GA 5H8QB 3HN0A 2VD2A 4DDDA 2F7BA 1QUJA 1JVXA 2OZZA 5I59A 3PPQA 1PB9A 2DVCA 1O63A 5I57B 2XXYA 2F8DA 2Z23A 5CMMA 4EF1A 4KD5A 2RCAA 4H6DA 2REGA 1JQFA 1N3XA 4ELPA 5I2KA 2DYXA 2DQVA 2P1SA 3CG3A 1GR2A 3MC2A 3SKPA 4GQOA 2Q8JA 4K3FA 4N6PA 3C4MA 4C1TA 1MDP1 4YZZA 2XHDA 3PUWE 3TZAA 5DEXB 4ND9A 2XX8A 3K6UA 4F22A 2HFBA 1XS5A 1B4ZA 4NE4A 5CRYA 3IOTA 1JW5A 5I58B 4NF5A 3WAFA 1LB9A 3IAZA 1Y3QA 4KQPA 3QK6A 4I62A 1PB8A 1BLFA 3TEPA 3K4UA 2H9BA 3CI8A 5K2XA 1PB7A 1QVSA 3T22A 5DTBA 2OWTA 3CG1A 3LVUA 3ONMA 1MRPA 3IX1A 1ZLQA 3MZBA 3PPNA 2PMSA 4AB5A 1SYHA 3IJXB 4DXUA 2PBWA 3CSGA 4G8NA 1H76A 2QMWA 1WDNA 4BDQA 4FATA 4QFKA 3N6UA 3S4UA 4G8MA 3VFJA 5TP9B 3TYHA 1ATGA 2V3QA 4OQOA 3O6PA 2REJA 2DWHA 3DRHA 3U72A 4YKKA 1MY2A 1IITA 4ZDMA 4R74A 2F35A 3H06B 4XXUA 1DPEA 2ESNA 1IQ7A 3G7WA 1URDA 3T9UA 4U4XA 4IO6A 3MBPA 5DYHA 1MXUA 4F31B 3TUSA 1A8EA 4UA8A 4OHNA 1BIYA 4FIMA 1JW4A 3ZKLA 4U21A 1JNFA 4JSDA 4ZS9A 3BBRA 3TQWA 4GXSB 4EXKA 4P11A 2O68A 3V89B 3OELA 3TCHA 4H5GA 3FJMA 4KI0E 1P1OA 3HHGA 3A3CA 3O6HA 3IB1A 2O69A 5CMKA 3CVGA 3OMBA 3FTOA 3S9EA 3K00A 2VD3A 2RC7A 2I49A 1LCTA 4XKRA 1I6BA 4JWYA 4OMBA 2YJPA 1EZOA 1B7ZA 3MZ1A 3S2VA 1Q35A 4QRZA 2FNCA 2UVIA 3K6VA 2UYEA 5H8NA 1OVBA 1ZBMA 1UIVA 1MG1A 1UQWA 2O6AA 4F1VA 3FVNA 3G3HA 2NUVA 5H8HB 2VGQA 2B65A 2H5YA 1MH4A 5IKBA 2NVUB 1Z7NE 2OCUA 1A99A 1BTJA 3KBRA 4F18A 3DRJA 2DE2A 1B51A 4R9FA 3H3GA 5JTYB 2OLBA 4KR5A 1IXIA 3KFMA 1I6AA 3KN8A 4F3PA 4G68B 1SW4A 5L9OA 2CZLA 1FTOA 1LAFE 4YICA 3DRFA 3MZ9A 4DZ1A 3T9HB 4OXVA 5A5XB 1TWYA 3KG2A 4F3SA 3V5AA 1Y4CA 1FCKA 3PV0E 3T9VA 2ONKE 3RQTA 4MFIA 4QSDA 2QS2A 2ONRA 2X7PA 3KOTA 3DP4A 4MBPA 2DE4A 1SI1A 1Y20A 2ZYNA 4OFLA 4YMAA 1AIVA 5J1DA 3MJNA 2Y7PA 3THIA 2F34A 4OFOA 3ODBA 1FW0A 1N7XA 1P1QA 3KSJA 3UK4A 3C9HA 3RTFB 3G3GA 2Y7IA 4L17A 3C36A 3L6GA 3KJTA 1UTBB 5ICQA 1H3DA 3HCQA 5KCJA 5I2NB
chains in the Genus database with same CATH superfamily
2Z22A 4RA1A 1EYJA 1FTAA 3JYRA 2F6PA 5ET6A 4C0RA 2XX7A 4BLAA 1LSTA 2CEXA 4LQ2A 2B3BA 3FVGA 4R2FA 2Q2CA 3LC8A 2QJEA 1OQHA 3FVKA 3Q26A 4JDFA 5J16A 3SEXA 2XD2A 4RK2A 2VOZA 1FJ6A 2VT5A 3MVZA 2O1LA 4U4SA 2LAOA 3IOUA 3N26A 3K6XA 2ABHA 1LBWA 4NF4A 3QUJA 3DP6A 4NF6A 1DOTA 3OO9A 4NWDA 1SD3A 4IO5A 3Q25A 2AL4A 5H8FA 4O3CA 3IJOB 3VVFA 1LBCA 3G3JA 3TMGA 2Y5LA 4DCXA 4BDRA 3M3KA 2Z8DA 2BJIA 1Q1KA 3PAMA 4PF6A 3U1OA 5AA4B 4LZ5A 1AOVA 3MAMA 1LAXA 3UIFA 3CHGA 1MY1A 2UXAA 4FORA 4QF9A 2WOPA 1MXVA 4U2RA 1KWHA 3KN7A 3PUZE 5FTHA 3E9XA 4PP0A 3OO6A 2XXIA 4OEUA 1VFEA 1KA0A 3O2AA 3RPWA 4PGPA 1DTZA 5AA2A 3RT6B 4AS4A 1I6QA 4ZE8A 4OYVA 4KYSA 1K9YA 3E4RA 5I2KB 4OVSA 3QUFA 4PCDA 4KPTA 3IL1B 4JVCA 2Q74A 4I9DA 1FQEA 2Y7RA 3BFTA 1S50A 1B6HA 1GTKA 1POTA 4GXAA 3I3VA 1YAEA 1MPDA 1LAHE 3IB2A 1B4HA 1BKAA 2XXPA 4H5FA 1FQDA 3ILTB 1ZTYA 4NG7A 1B7HA 1WODA 3MSTA 2ANJA 3OSQA 3IFCA 2QMXA 3S9LC 3RYBA 1FSAA 2PX1A 1MPBA 4PAIA 1R9QA 2Q2AA 3W9VA 1G0IA 2DWAA 4QBAA 5IZ3A 5LOMA 2QS1A 3FASA 5HBCA 4OVTA 3L6HA 4YAHX 4LP2B 1A8FA 1S9TA 5L8DA 4NMYA 1IEJA 1MY0A 4GWXA 4GX4A 4RNSA 2ZZVA 2JJKA 1NV1A 4H0WA 4F3GA 1USYE 1URGA 1NV6A 3U65A 3H4ZA 2A5TA 4NGUA 3HPIA 3FVOA 3Q27A 3EHUA 1IXGA 3USDA 3PU5A 2KR0A 4FJPA 2XXKA 4NTLA 1A7LA 1FPLA 3SDFA 2QRYA 3DLNA 3KEIA 3D4GA 4AS5A 3T66A 1TFDA 4EUOA 5I56A 4H45A 1YPNA 1B52A 3VV5A 4DE8A 3VVDA 5FBPA 1MM7A 3RNNA 4WEDA 2HHMA 1NUWA 1LGBC 4WKMA 1SW2A 1VE4A 2ALUA 3CFLA 2I48A 4ELOA 1N7WA 1TXFA 3RGYA 2F97A 5I3SA 4G68C 1N04A 3ZSFA 5I57A 4QHQA 3UGWA 4PE3A 3H6WA 3C31A 3R6UA 3SETA 1FTMA 2V25A 2WX9A 3FXQA 5K2YA 1B0LA 4MLVA 4HS7A 4P0GA 5DVIA 1OMPA 3KOSA 1SW1A 5ISUA 4X9TA 3IORA 1KA1A 1Y1ZA 2IA4A 2X26A 3IOVA 4PDDA 3C34A 1D9YA 1QW0A 3V8XB 4TLLB 1J1NA 3KGCA 1O7TA 2H25A 3RTWB 5EQAA 5DEXA 4HE1A 5A5LA 4EF2A 1B9JA 3CRBA 3O6GA 5ITPA 1MXYA 1M5FA 3LSXA 2QS4A 3K01A 5I58A 5BWJA 1XVYA 2F36A 4N15A 1UIUA 4P0IA 4NF8A 4O7MA 4M1VA 4MF3A 1SVXB 3T96B 3LR1A 4IY5A 5TPAA 2Y7WA 1OLCA 2RINA 3OSRA 1MQDA 4O94A 3WAEA 3ISPA 1LBBA 3ILUB 1AL3A 2I3VA 1SI0A 5T3JA 3MP8A 2CEYA 3KSXA 1K9ZA 3FV1A 2QVVA 4R75A 3SEVA 4RJZA 2D3IA 1NKXA 1RDXA 3VLWA 5TU0A 4XKQA 2FIEA 5H8NB 4ELQA 4BDMA 1HSEA 1NI9A 3C33A 3O28A 4Q0CA 4H8JA 3LSFB 5TP9A 1A54A 3K1PA 4GIZA 3TCGA 4JWXA 1OLAA 4YKPA 4U1ZA 1AMFA 4AB6A 2E0SA 1B5JA 1JW1A 4GOTA 3OXNA 3T1BA 5CMCA 4R6HA 2GFEA 3G3FA 2R8TA 2ZMBA 4QFPA 1NV2A 5ET8A 2XXRA 1XOCA 2E1SA 4PC9A 1NNTA 3MVYA 1B3LA 3BIHA 5F24A 2OWZA 2B3FA 5ELVA 3JV9A 2GH9A 5I7IA 1FBGA 2OK2A 2WOKA 2I6EA 5EQ7A 1JETA 1PEBA 4QSEA 2V4CA 4ESXA 4LA9A 5I84A 4KHZE 4MIJA 3RLFE 1P1WA 4PETA 3TELA 2I0BA 1MDQA 1B58A 2HZKA 3DELB 1WVJA 4O8MA 1LBXA 1S7YA 3VXCA 1IMFA 3RY3A 1T0KA 3MQ9A 1R1NA 4GL8A 1PBPA 3TQLA 1FPJA 4H46A 2O1MA 4GLIA 2DXYA 2XXUA 2DDKA 1MPCA 1MH3A 1CE2A 1JEVA 2DWIA 4F1YA 3K0VA 3I6VA 4E0WA 1OIBA 5ET7A 4G8HA 2P0SA 5DW8A 3SEYA 4XKNA 3PPOA 1O64A 5KCJB 4LUBA 3W15C 1UTHB 4POXA 1POY1 1SDXA 3AXFA 1Q9DA 3UP9A 4G4PA 1Y3NA 5DVJA 5BUUA 2XXXA 1B5IA 4N13A 5H8SA 1B40A 2P2AA 4LZ7A 4PFRA 4F29A 5KDTB 2QS3A 1D3KA 5EYFA 4QXDA 4THIA 4F19A 5H8HA 1Y1MA 4OVJA 4KCCA 4F3BA 2DWJA 3BFUA 3LSWA 1LBVA 4M4GA 4DCYA 3PPRA 3GXAA 2XX9A 3CR9A 4JVIA 1US5A 4GWOA 3E3KA 1FQAA 3FJ7A 2CZHA 2WBBA 1ZIUA 5ITOA 4BDNA 4QSCA 4G68A 1D4NA 2HEUA 1F9BA 5AA1A 3PGFA 4HTGA 4IO3A 4TQUQ 2AL5A 3H7MA 1B0HA 1XT8A 4QFOA 4X04A 5A5XA 3D1RA 3OD7A 3H6UA 1MQJA 2V3UA 4QFLA 4JBZA 2WBDA 3PMWA 1QJMA 1XHYA 4IO4A 4PFUA 3U94A 4Q5TA 4I8CA 4KYEA 5ET5A 2HQ0A 3G3KA 4YKJA 1B1HA 1INPA 2XWOA 1RKMA 3E78A 1IXCA 3C35A 3O6IA 4NN3A 1B1XA 4X48A 1N3WA 4OA4A 1HSJA 4OERA 1SW5A 2XXWA 3GBBA 1USYH 3GYYA 3FD3A 2DP8A 2XXQA 3QXMA 3OEMA 4OTEA 2G29A 2QSXA 4ZEIA 1Y9UA 4YB7A 2I4BA 1UTBA 4BDLA 2I4CA 5I2NA 4PAFA 1SYIA 2F3BA 5FHMA 2Y5KA 2HZLA 2RF1A 1FPGA 2ZZWA 5HM4B 4NF0A 1QULA 4EQBA 3R7XA 2OX3A 2HAUA 4HCYA 4RYAA 4EQ9A 3QMFA 1N76A 1Y4TA 4Q30B 5I59B 4XF5A 2O7IA 3U8QA 3LUZA 4HCWA 1NL5A 1B3GA 3EF7A 2R6GE 3LSLA 2CMOA 3VLUA 2QPQA 4EQ7A 2KLFA 1ANFA 1FBDA 1R6ZA 3IR1A 3I5OA 2L5VA 1RYXA 3CSBA 2DSFA 4ZEDA 1FPBA 3K1NA 1NFTA 3C32A 3N94A 3B6WA 3G3IA 1FTKA 3GZGA 1FQCA 1OVTA 4HE2A 4N07A 1B46A 3NOHA 4HE0A 3VE1B 5EHSA 4AQ4A 4MHFA 3EQ1A 3PUYE 3IK6B 4PAKA 3FZVA 1MQHA 2F6GA 2HCAA 3FXRA 1LAGE 5KZTA 2DOJA 4OVQA 1PC3A 3IB0A 5CBSA 1QUKA 4LQ5A 2O84X 2FA7A 3FATA 1P99A 1GV8A 3PUXE 2XWKA 4N6DA 5AA4A 3CFXA 3OO7A 3QSLA 3DP8A 3FBPA 1NNFA 4NF5B 5AA3A 1DSNA 3IFAA 3EN3A 4U1OA 5AE4A 3PMXA 4YKIA 4G77A 3V83A 4I1DA 1MQIA 1AH5A 5B70A 4N8GA 4YB6A 2B4LA 5DT6A 2F7AA 4H1XA 2RC9A 1MXZA 2VPNA 4PFBA 2ONSA 3FXBA 1IMAA 2CZIA 2Y7KA 4XKPA 1XVXA 4R2BA 4NWCA 4ELRA 1CB6A 3PMVA 1FQFA 3TDJA 4RXLA 2OJTA 1EU8A 3O29A 2YLNA 4ZEFA 1NV3A 1XC1A 1FJ9A 2DE3A 2QFLA 3FUZA 2KQZA 3MW0A 3U93A 4PE5B 1B7UA 3MPLA 1IZ1A 1SQYA 3MWBA 3DM0A 2RKMA 1IMEA 1P1UA 3ZS6A 3IO6A 4R72A 4UACA 1QKAA 4OESA 5H8QA 4MNCA 4IO2A 1IMCA 1EH3A 3PD9A 1IXHA 2P3NA 4ONYA 4PQJA 3KJ7A 3H6VA 3A3UA 4O3AA 2ZYMA 5F1QA 4GFRA 3RPLB 1RYOA 3R26A 2WOLA 4GX6A 2GRVA 4NF8B 4OWDA 2V84A 5CBRA 5FTIA 1FPKA 2DS9A 1DTGA 4YU0A 4P3LA 1JEUA 4H8IA 5TPAB 4GVOA 3VXBA 4LATA 3OOAA 1NNKA 1ZJLA 4N6KA 3OO8A 1FTLA 2D21A 5L9SA 1PBQA 4IGTA 4POWA 4E0XA 4IB2A 1LBYA 2F5XA 3N5LA 1VSOA 4RK9A 1FPIA 5FHOA 4R73A 4GX3A 4IGRA 4Z0IA 3IO4A 1IMBA 4R6YA 3FV2A 2ZZXA 3QYTA 2PT2A 2I58A 4R6KA 4YMBA 3H6TA 2H99A 4MX6A 5F7VA 1NUXA 4GF8A 2OBGA 1EZ9A 4RY1A 3MYUA 2UVJA 3SEUA 1FBPA 4ZE9A 1LFIA 2PYYA 3RYAA 1Z7ME 1JVYA 3DRIA 1LEVA 3TCFA 1LB8A 3O9PA 5EHMA 2NXOA 1MXWA 3ROJA 2QL3A 2HXWA 3TTNA 1EYKA 1R9LA 2HPGA 3TFLA 4MEVA 4GWSA 2UVGA 5CC2A 2Z8EA 4OETA 2IEEA 1YTVA 1LCFA 3UA8A 4GL0A 2AIXA 4JXIA 5HPQA 2OWSA 1DCUA 1DPPA 4OANA 4BDOA 1H43A 1M5EA 4NQ8A 2FVZA 1B5HA 3PUVE 4I3EA 4MJOA 3Q28A 3B6QA 4PFWA 4XEQA 2D5WA 3VVEA 4FEDA 3RN8A 1OQGA 5CI5A 3EHTA 4H65A 1B3EA 5JK4A 4GD5A 1ZU0A 4KCDA 3F11A 2NOOA 5CMBA 3K02A 4IR8A 1D9VA 3IOWA 4ZEBA 4ECFA 1N0TA 1URSA 3MP1A 1MQGA 3B7DA 3K1MA 3B8BA 3QAXA 1GVCA 4IO7A 2M8CA 5DVFA 2I0CA 2R71A 4P8BA 1P1NA 2PVUA 2O7UA 4JB7A 4H67A 4PBHA 3RYDA 3M3FA 1B2HA 3EHSA 1II5A 2XD3A 3PPPA 3SEWA 5ICTA 1FQBA 1VFDA 1B32A 2O51A 2ZNTA 4Q8RA 4PFYA 4ZZAA 2P3VA 1B3FA 3S9MC 3FIRA 1VDWA 4I3YA 4PFTA 1H45A 3FXUA 2CZKA 2HAVA 5EYGA 3FGSA 2V93A 4F39A 3BKIB 1ZKBA 3H03A 3VLVA 5AA2D 4DXCA 1XI6A 4FECA 1TFAA 2Y84A 1JP4A 3TTLA 4YB5A 5ESYA 4FAJA 1CNQA 1EZPA 1FBEA 4TOZA 2VP1A 3B50A 4GBWA 3KN3A 1LFHA 1NH7A 5CM6A 2YPNA 3TTMA 2ZNUA 1US4A 4OZ9A 3KZGA 2FHYA 1M5DA 4U23A 3PTYA 3MUQA 4N17A 4N4UA 4Z7EA 3HHFA 1HSLA 2GHBA 2ZXTA 3O66A 4KYDA 1BK4A 2RC8A 4ESWA 3Q29A 3TTKA 2AYSA 3A09A 2V3TA 1YYZA 4IY6A 3TODA 4PTKA 3HV1A 1BP5A 3E13X 3MP6A 4DI3D 4PBQA 3T93B 2PFZA 1YCJA 1DMBA 1MY3A 4NEDA 2DXRA 4NX1A 1GGGA 2Q89A 4OVRA 4N8YA 4P1LA 3JZJA 1G0HA 3M3LA 1IIWA 4TLMB 2B4MA 2X7QA 1MS7A 4FE8A 4NHBA 3TPAA 4ZECA 4ZZEA 4RPOA 1MXXA 2H98A 1N84A 3OEKA 1ELJA 5JTYA 1A55A 3M8UA 4WEPA 4NF4B 3CIJA 3TAJA 4NF6B 3RUMA 4MH5A 1I69A 1B3HA 4GRKA 1NH8A 3TTRA 3EPEA 4DIGA 4MLQA 1SBPA 4X1BA 4FEBA 5H8FB 4PGNA 2Q88A 2Z8FA 4QFNA 1UTHA 1NMUA 2PT1A 3MPKA 4C1UA 2XWIA 3PD8A 2R9JA 3B6TA 3KC0A 5M2VA 4XIGQ 3K2DA 4P47A 2XXTA 4X1DA 2W7YA 1D9QA 1SPIA 2GHAA 3CFZA 2F78A 3DRKA 4KFQA 3D4CA 1NV5A 5KDTA 4F2QA 3ZKKA 2FIXA 4DXBA 4GWWA 3UN6A 3LUYA 4PFIA 3T9XB 3U92A 1H44A 2UYFA 3SESA 5AA2B 2MKZA 2G93A 5IAIA 1L5TA 4HW8A 2BJJX 2THIA 4XFEA 4OENA 2VHAA 1Y3PA 5FHNA 1LFGA 2H4IA 3K6WA 1NUYA 3A29A 2ZYKA 1PDAA 3W9WA 3MVWA 2F7CA 4DLDA 4EDPA 4ISUA 1MM6A 3GBAA 3HSTA 2RCBA 3UORA 2FYIA 4WXJA 3VDFA 4LZ8A 3DRGA 1QUIA 3ECRA 4OEVA 1LLSA 3O97A 3TKDA 1M5BA 4GWZA 2XXHA 3N6TA 1IUDA 4EXLA 3FJGA 2WKYA 3SERA 3QIMA 1VR5A 3RT8A 4U22A 1MY4A 1FTJA 2UVHA 2A5SA 4F1UA 3S9NC 2ZYOA 2I3WA 5IZ3B 4JSOA 4JVDA 5B7DA 2NWJA 1M5CA 1A40A 1ZMGA 2XXVA 1QKBA 4F2OA 2Q9TA 5L9MA 4PF8A 1RDYA 4OFJA 3LBSA 4O3BA 1TT1A 3HO7A 1NV7A 4G2ZA 2A5TB 4P56A 4LVQA 3OENA 1B05A 4KXPA 1NNPA 1DK4A 4LONB 5IZ1A 4JWOA 2DVZA 5JEIA 3HFUA 4ZEKA 1NV0A 3MVXA 2ZNSA 4OVPA 4RPNA 5I56B 3GLBA 4XTCQ 1FBFA 5EYHA 3P7IA 1FBCA 4R9GA 5H8QB 3HN0A 3BIGA 2VD2A 4DDDA 2GQ1A 2F7BA 1QUJA 1JVXA 2OZZA 5I59A 3PPQA 2VPOA 1PB9A 2DVCA 1O63A 5I57B 2XXYA 2F8DA 2Z23A 5CMMA 4EF1A 4KD5A 2RCAA 4H6DA 2REGA 1JQFA 3T0JA 3KBZA 1FRPA 4G61A 1N3XA 1DBZA 4ELPA 2DYXA 2DQVA 2P1SA 3CG3A 5I2KA 1GR2A 3MC2A 4P1EA 3SKPA 4GQOA 2Q8JA 4K3FA 4NAPA 3SZPA 4N6PA 3C4MA 4C1TA 1MDP1 4YZZA 2XHDA 3PUWE 3TZAA 5DEXB 4ND9A 2XX8A 3K6UA 2PFYA 4F22A 2HFBA 1XS5A 1B4ZA 4NE4A 5CRYA 3IOTA 1JW5A 5I58B 4LN5A 4NF5A 2WYPA 3WAFA 1LB9A 3IAZA 1Y3QA 4KQPA 3QK6A 4I62A 4DI4B 4X8RA 1PB8A 4MNIA 1BLFA 2HXRA 3K4UA 3TEPA 2H9BA 3CI8A 5K2XA 1PB7A 1QVSA 3T22A 4MNPA 5DTBA 2OWTA 3CG1A 3LVUA 3ONMA 1MRPA 3IX1A 1ZLQA 3MZBA 3PPNA 2PMSA 4AB5A 2Q8MA 1EYIA 1SYHA 3IJXB 1FPEA 4DXUA 2PBWA 3CSGA 4G8NA 4GWYA 1H76A 2QMWA 1WDNA 4BDQA 4FATA 4QFKA 3N6UA 3EKIA 4G8MA 3S4UA 5TP9B 3VFJA 3TYHA 1ATGA 2V3QA 4OQOA 3O6PA 2REJA 2DWHA 5EQ9A 3DRHA 3U72A 4YKKA 1MY2A 1IITA 5IZZA 4ZDMA 4R74A 2F35A 3H06B 3RPLA 1YZ0A 4XXUA 1DPEA 2ESNA 5LDZA 1IQ7A 3G7WA 1URDA 3T9UA 4U4XA 4IO6A 3MBPA 5DYHA 1MXUA 4F31B 3TUSA 1A8EA 4GBVA 2XA5A 2WYKA 1FBHA 4MCOA 4UA8A 1YXIA 4OHNA 1BIYA 4P9KA 4FIMA 2QVRA 1JW4A 5I5PA 3ZKLA 4U21A 1JNFA 4O7IA 4JSDA 4ZS9A 1QGXA 3BBRA 3TQWA 4GXSB 4EXKA 4N91A 4P11A 1KZ8A 3KC1A 2O68A 3V89B 3OELA 4N81A 3TCHA 4H5GA 3FJMA 4KI0E 1P1OA 2FBPA 3HHGA 3A3CA 3O6HA 5IM2A 3IB1A 4UABA 2O69A 5CMKA 3CVGA 3OMBA 3FTOA 3S9EA 3K00A 2VD3A 2RC7A 1IMDA 2I49A 1LCTA 4XKRA 1I6BA 4JWYA 4OMBA 2YJPA 1EZOA 1B7ZA 3MZ1A 3S2VA 5EQ8A 1Q35A 4QRZA 2FNCA 2UVIA 3K6VA 2UYEA 4HXVA 5H8NA 1OVBA 1ZBMA 1UIVA 1MG1A 1UQWA 3LV0A 1FPDA 2O6AA 4F1VA 3FVNA 3G3HA 2NUVA 5H8HB 2QVUA 2VGQA 3E79A 5IGAA 2B65A 2H5YA 1MH4A 5IKBA 2NVUB 1Z7NE 2OCUA 1A99A 1BTJA 3KBRA 2WEFA 4F18A 3DRJA 2DE2A 1B51A 4R9FA 3H3GA 5JTYB 2OLBA 4KR5A 1IXIA 4FBPA 3KFMA 1I6AA 3KN8A 4F3PA 4G68B 5LTCA 1SW4A 5L9OA 2CZLA 1FTOA 1AWBA 4PDHA 1LAFE 4YICA 3DRFA 3MZ9A 4DZ1A 3T9HB 4OXVA 5A5XB 1TWYA 4MMPA 4GWUA 1FPFA 3KG2A 4F3SA 3V5AA 1Y4CA 1FCKA 3PV0E 3T9VA 1NUZA 2ONKE 3RQTA 2F3DA 4MFIA 4QSDA 2QS2A 2ONRA 2X7PA 3KOTA 3DP4A 4MBPA 2DE4A 1SI1A 1Y20A 2ZYNA 4OFLA 4YMAA 1AIVA 5J1DA 4I40A 3MJNA 2Y7PA 2PCRA 2F34A 3ODBA 4OFOA 3THIA 1FW0A 1RDZA 1N7XA 1P1QA 3KSJA 4MAGA 3UK4A 3C9HA 3RTFB 2XWVA 3G3GA 2Y7IA 1NV4A 4L17A 3C36A 3L6GA 1LBZA 3KJTA 1UTBB 5ICQA 1H3DA 3HCQA 5KCJA 5I2NB
chains in the Genus database with same CATH topology
2Z22A 4RA1A 3JYRA 2F6PA 4C0RA 2XX7A 4BLAA 1LSTA 4LQ2A 2B3BA 3FVGA 4R2FA 2Q2CA 3LC8A 2QJEA 1OQHA 3FVKA 3Q26A 4JDFA 3SEXA 2XD2A 4RK2A 2VOZA 3MVZA 2O1LA 4U4SA 2LAOA 3IOUA 3N26A 3K6XA 2ABHA 4NF4A 3QUJA 3DP6A 4NF6A 1DOTA 3OO9A 4NWDA 1SD3A 4IO5A 3Q25A 2AL4A 5H8FA 4O3CA 3IJOB 3VVFA 1LBCA 3G3JA 3TMGA 4DCXA 4BDRA 3M3KA 2Z8DA 1Q1KA 3PAMA 3U1OA 5AA4B 4LZ5A 1AOVA 3MAMA 1LAXA 3UIFA 3CHGA 1MY1A 2UXAA 4FORA 4QF9A 2WOPA 1MXVA 4U2RA 1KWHA 3KN7A 3PUZE 5FTHA 3E9XA 4PP0A 3OO6A 2XXIA 4OEUA 1VFEA 3O2AA 3RPWA 1DTZA 5AA2A 3RT6B 1I6QA 4ZE8A 4OYVA 4KYSA 3E4RA 5I2KB 3QUFA 4KPTA 3IL1B 4I9DA 1FQEA 2Y7RA 3BFTA 1S50A 1B6HA 1GTKA 1POTA 4GXAA 3I3VA 1YAEA 1MPDA 1LAHE 3IB2A 1B4HA 1BKAA 2XXPA 4H5FA 1FQDA 3ILTB 1ZTYA 1B7HA 1WODA 2ANJA 3OSQA 2QMXA 3S9LC 3RYBA 2PX1A 1MPBA 1R9QA 2Q2AA 3W9VA 2DWAA 5LOMA 2QS1A 3FASA 5HBCA 3L6HA 4YAHX 4LP2B 1A8FA 1S9TA 5L8DA 4NMYA 1IEJA 1MY0A 4RNSA 4H0WA 4F3GA 1USYE 1URGA 3H4ZA 2A5TA 3HPIA 3FVOA 3Q27A 3EHUA 1IXGA 3USDA 3PU5A 4FJPA 4NTLA 1A7LA 3SDFA 2QRYA 3DLNA 3KEIA 3D4GA 5I56A 3T66A 1TFDA 4EUOA 1YPNA 1B52A 3VV5A 4DE8A 3VVDA 1MM7A 3RNNA 4WEDA 1LGBC 4WKMA 1SW2A 1VE4A 2ALUA 3CFLA 2I48A 4ELOA 1N7WA 1TXFA 3RGYA 2F97A 4G68C 1N04A 3ZSFA 5I57A 4QHQA 3UGWA 3H6WA 3C31A 3R6UA 3SETA 1FTMA 2V25A 3FXQA 5K2YA 1B0LA 4MLVA 4HS7A 4P0GA 5DVIA 1OMPA 3KOSA 1SW1A 5ISUA 4X9TA 3IORA 1Y1ZA 2IA4A 2X26A 3IOVA 3C34A 1D9YA 1QW0A 3V8XB 4TLLB 1J1NA 3KGCA 1O7TA 2H25A 3RTWB 5DEXA 4EF2A 1B9JA 3CRBA 3O6GA 5ITPA 1MXYA 1M5FA 3LSXA 2QS4A 3K01A 5I58A 5BWJA 1XVYA 2F36A 4P0IA 1UIUA 4NF8A 4M1VA 4MF3A 1SVXB 3T96B 3LR1A 4IY5A 5TPAA 2Y7WA 1OLCA 2RINA 3OSRA 1MQDA 3WAEA 1LBBA 3ILUB 1AL3A 2I3VA 1SI0A 3MP8A 3KSXA 3FV1A 4R75A 3SEVA 4RJZA 2D3IA 1NKXA 3VLWA 5TU0A 4XKQA 5H8NB 4ELQA 4BDMA 1HSEA 3C33A 3O28A 4Q0CA 4H8JA 3LSFB 5TP9A 1A54A 3K1PA 4GIZA 3TCGA 4JWXA 1OLAA 4YKPA 4U1ZA 1AMFA 4AB6A 2E0SA 1B5JA 1JW1A 4GOTA 3OXNA 5CMCA 4R6HA 2GFEA 3G3FA 2ZMBA 4QFPA 2XXRA 1XOCA 2E1SA 1NNTA 3MVYA 1B3LA 5ELVA 2B3FA 3JV9A 2GH9A 2OK2A 2WOKA 2I6EA 1JETA 1PEBA 4QSEA 4ESXA 4LA9A 5I84A 4KHZE 3RLFE 1P1WA 4PETA 3TELA 2I0BA 1MDQA 1B58A 2HZKA 3DELB 1WVJA 1S7YA 3VXCA 3RY3A 1T0KA 3MQ9A 1R1NA 4GL8A 1PBPA 3TQLA 2O1MA 4GLIA 2DXYA 2XXUA 1MPCA 1MH3A 1CE2A 1JEVA 2DWIA 4F1YA 3K0VA 3I6VA 4E0WA 1OIBA 4G8HA 2P0SA 3SEYA 4XKNA 3PPOA 1O64A 5KCJB 4LUBA 3W15C 1UTHB 4POXA 1POY1 1SDXA 3AXFA 3UP9A 4G4PA 1Y3NA 5DVJA 5BUUA 2XXXA 1B5IA 4N13A 5H8SA 1B40A 2P2AA 4LZ7A 4F29A 5KDTB 2QS3A 1D3KA 5EYFA 4THIA 4F19A 5H8HA 1Y1MA 4OVJA 4KCCA 4F3BA 2DWJA 3BFUA 3LSWA 4M4GA 4DCYA 3PPRA 3GXAA 2XX9A 3CR9A 1US5A 4GWOA 3E3KA 1FQAA 3FJ7A 1ZIUA 5ITOA 4BDNA 4QSCA 4G68A 1D4NA 2HEUA 1F9BA 5AA1A 3PGFA 4HTGA 4IO3A 4TQUQ 2AL5A 3H7MA 1B0HA 1XT8A 4QFOA 5A5XA 3OD7A 3H6UA 1MQJA 2V3UA 4QFLA 4JBZA 3PMWA 1QJMA 1XHYA 4IO4A 4PFUA 3U94A 4Q5TA 4I8CA 4KYEA 2HQ0A 3G3KA 4YKJA 1B1HA 1RKMA 1IXCA 3C35A 3O6IA 1B1XA 4X48A 1N3WA 1HSJA 4OERA 1SW5A 2XXWA 3GBBA 1USYH 3FD3A 2DP8A 2XXQA 3QXMA 3OEMA 4OTEA 2G29A 2QSXA 4ZEIA 1Y9UA 4YB7A 2I4BA 1UTBA 4BDLA 2I4CA 5I2NA 1SYIA 5FHMA 2HZLA 2RF1A 5HM4B 1QULA 4EQBA 3R7XA 2HAUA 4HCYA 4RYAA 4EQ9A 1N76A 1Y4TA 4Q30B 5I59B 2O7IA 3U8QA 4HCWA 1NL5A 1B3GA 3EF7A 2R6GE 3LSLA 2CMOA 3VLUA 2QPQA 4EQ7A 2KLFA 1ANFA 1R6ZA 3IR1A 3I5OA 1RYXA 3CSBA 2DSFA 4ZEDA 3K1NA 1NFTA 3C32A 3N94A 3B6WA 3G3IA 1FTKA 3GZGA 1FQCA 1OVTA 4N07A 1B46A 3VE1B 5EHSA 4AQ4A 3EQ1A 3PUYE 3IK6B 3FZVA 1MQHA 2F6GA 2HCAA 3FXRA 1LAGE 5KZTA 2DOJA 1PC3A 3IB0A 5CBSA 1QUKA 4LQ5A 2O84X 2FA7A 3FATA 1P99A 1GV8A 3PUXE 5AA4A 3CFXA 3OO7A 3QSLA 3DP8A 1NNFA 4NF5B 5AA3A 1DSNA 3EN3A 4U1OA 5AE4A 3PMXA 4YKIA 4G77A 3V83A 4I1DA 1MQIA 1AH5A 5B70A 4YB6A 2B4LA 5DT6A 2F7AA 4H1XA 2RC9A 1MXZA 2ONSA 2Y7KA 4XKPA 1XVXA 4R2BA 4NWCA 4ELRA 1CB6A 3PMVA 1FQFA 3TDJA 4RXLA 2OJTA 1EU8A 3O29A 2YLNA 4ZEFA 1XC1A 2DE3A 3FUZA 3MW0A 3U93A 4PE5B 1B7UA 3MPLA 1IZ1A 1SQYA 3MWBA 3DM0A 1P1UA 2RKMA 3ZS6A 3IO6A 4R72A 4UACA 1QKAA 4OESA 5H8QA 4IO2A 3PD9A 1EH3A 1IXHA 4ONYA 4PQJA 3KJ7A 3H6VA 3A3UA 4O3AA 2ZYMA 5F1QA 4GFRA 1RYOA 3R26A 2WOLA 2GRVA 4NF8B 4OWDA 2V84A 5CBRA 5FTIA 2DS9A 1DTGA 4YU0A 1JEUA 4H8IA 5TPAB 4GVOA 3VXBA 4LATA 3OOAA 1NNKA 1ZJLA 3OO8A 1FTLA 2D21A 5L9SA 1PBQA 4IGTA 4POWA 4E0XA 4IB2A 2F5XA 3N5LA 1VSOA 4RK9A 5FHOA 4R73A 4IGRA 4Z0IA 3IO4A 4R6YA 3FV2A 3QYTA 2PT2A 2I58A 4R6KA 4YMBA 3H6TA 2H99A 5F7VA 4GF8A 2OBGA 1EZ9A 4RY1A 2UVJA 3SEUA 4ZE9A 1LFIA 2PYYA 3RYAA 1Z7ME 1JVYA 3DRIA 3TCFA 1LB8A 3O9PA 5EHMA 2NXOA 1MXWA 2QL3A 2HXWA 3TTNA 1R9LA 3TFLA 2UVGA 5CC2A 2Z8EA 4OETA 2IEEA 1YTVA 1LCFA 3UA8A 4GL0A 2AIXA 4JXIA 5HPQA 2OWSA 1DPPA 4BDOA 1H43A 1M5EA 1B5HA 3PUVE 3Q28A 3B6QA 4PFWA 2D5WA 3VVEA 4FEDA 3RN8A 1OQGA 5CI5A 3EHTA 4H65A 1B3EA 5JK4A 4GD5A 1ZU0A 4KCDA 3F11A 2NOOA 5CMBA 3K02A 1D9VA 3IOWA 4ZEBA 4ECFA 1N0TA 1URSA 3MP1A 1MQGA 3B7DA 3K1MA 3QAXA 1GVCA 4IO7A 2M8CA 5DVFA 2I0CA 2R71A 1P1NA 2PVUA 2O7UA 4JB7A 4H67A 3M3FA 1B2HA 3EHSA 1II5A 2XD3A 3PPPA 3SEWA 5ICTA 1FQBA 1VFDA 1B32A 2O51A 2ZNTA 4Q8RA 4PFYA 4ZZAA 1B3FA 3S9MC 3FIRA 4PFTA 1H45A 3FXUA 2HAVA 3FGSA 2V93A 4F39A 3BKIB 1ZKBA 3H03A 3VLVA 5AA2D 4DXCA 4FECA 1TFAA 2Y84A 3TTLA 4YB5A 4FAJA 1EZPA 4TOZA 2VP1A 3KN3A 1LFHA 1NH7A 5CM6A 2YPNA 3TTMA 2ZNUA 1US4A 4OZ9A 3KZGA 1M5DA 4U23A 3MUQA 4Z7EA 3HHFA 1HSLA 2GHBA 2ZXTA 3O66A 4KYDA 2RC8A 4ESWA 3Q29A 3TTKA 2AYSA 3A09A 2V3TA 4IY6A 3TODA 3HV1A 1BP5A 3E13X 3MP6A 3T93B 1YCJA 1DMBA 1MY3A 4NEDA 2DXRA 1GGGA 2Q89A 3JZJA 3M3LA 1IIWA 4TLMB 2B4MA 2X7QA 1MS7A 4FE8A 3TPAA 4ZECA 4ZZEA 4RPOA 1MXXA 2H98A 1N84A 3OEKA 1ELJA 5JTYA 1A55A 3M8UA 4WEPA 4NF4B 3CIJA 3TAJA 4NF6B 3RUMA 4MH5A 1I69A 1B3HA 4GRKA 1NH8A 3TTRA 4DIGA 3EPEA 4MLQA 1SBPA 4X1BA 4FEBA 5H8FB 2Q88A 2Z8FA 4QFNA 1UTHA 1NMUA 2PT1A 3MPKA 4C1UA 3PD8A 2R9JA 3B6TA 5M2VA 4XIGQ 3K2DA 2XXTA 4X1DA 2W7YA 2GHAA 3CFZA 2F78A 3DRKA 4KFQA 3D4CA 5KDTA 4F2QA 3ZKKA 4DXBA 3UN6A 3LUYA 3T9XB 3U92A 1H44A 2UYFA 3SESA 5AA2B 2G93A 5IAIA 1L5TA 4HW8A 2BJJX 2THIA 4OENA 2VHAA 1Y3PA 5FHNA 1LFGA 2H4IA 3K6WA 2ZYKA 1PDAA 3W9WA 3MVWA 2F7CA 4DLDA 4EDPA 4ISUA 1MM6A 3GBAA 3HSTA 2RCBA 3UORA 2FYIA 4WXJA 3VDFA 4LZ8A 3DRGA 1QUIA 3ECRA 4OEVA 1LLSA 3O97A 3TKDA 1M5BA 2XXHA 3N6TA 1IUDA 4EXLA 3FJGA 2WKYA 3SERA 3QIMA 1VR5A 3RT8A 4U22A 1MY4A 1FTJA 2UVHA 2A5SA 4F1UA 3S9NC 2ZYOA 2I3WA 4JSOA 5B7DA 2NWJA 1M5CA 1A40A 1ZMGA 2XXVA 1QKBA 4F2OA 2Q9TA 5L9MA 4OFJA 3LBSA 4O3BA 1TT1A 3HO7A 4G2ZA 2A5TB 4LVQA 3OENA 1B05A 1NNPA 4LONB 4JWOA 2DVZA 5JEIA 4ZEKA 2ZNSA 3MVXA 4RPNA 5I56B 3GLBA 4XTCQ 3P7IA 4R9GA 5H8QB 3HN0A 2VD2A 4DDDA 2F7BA 1QUJA 1JVXA 2OZZA 5I59A 3PPQA 1PB9A 2DVCA 1O63A 5I57B 2XXYA 2F8DA 2Z23A 5CMMA 4EF1A 4KD5A 2RCAA 4H6DA 2REGA 1JQFA 1N3XA 4ELPA 5I2KA 2DYXA 2DQVA 2P1SA 3CG3A 1GR2A 3MC2A 3SKPA 4GQOA 2Q8JA 4K3FA 4N6PA 3C4MA 4C1TA 1MDP1 4YZZA 2XHDA 3PUWE 3TZAA 5DEXB 4ND9A 2XX8A 3K6UA 4F22A 2HFBA 1XS5A 1B4ZA 4NE4A 5CRYA 3IOTA 1JW5A 5I58B 4NF5A 3WAFA 1LB9A 3IAZA 1Y3QA 4KQPA 3QK6A 4I62A 1PB8A 1BLFA 3TEPA 3K4UA 2H9BA 3CI8A 5K2XA 1PB7A 1QVSA 3T22A 5DTBA 2OWTA 3CG1A 3LVUA 3ONMA 1MRPA 3IX1A 1ZLQA 3MZBA 3PPNA 2PMSA 4AB5A 1SYHA 3IJXB 4DXUA 2PBWA 3CSGA 4G8NA 1H76A 2QMWA 1WDNA 4BDQA 4FATA 4QFKA 3N6UA 3S4UA 4G8MA 3VFJA 5TP9B 3TYHA 1ATGA 2V3QA 4OQOA 3O6PA 2REJA 2DWHA 3DRHA 3U72A 4YKKA 1MY2A 1IITA 4ZDMA 4R74A 2F35A 3H06B 4XXUA 1DPEA 2ESNA 1IQ7A 3G7WA 1URDA 3T9UA 4U4XA 4IO6A 3MBPA 5DYHA 1MXUA 4F31B 3TUSA 1A8EA 4UA8A 4OHNA 1BIYA 4FIMA 1JW4A 3ZKLA 4U21A 1JNFA 4JSDA 4ZS9A 3BBRA 3TQWA 4GXSB 4EXKA 4P11A 2O68A 3V89B 3OELA 3TCHA 4H5GA 3FJMA 4KI0E 1P1OA 3HHGA 3A3CA 3O6HA 3IB1A 2O69A 5CMKA 3CVGA 3OMBA 3FTOA 3S9EA 3K00A 2VD3A 2RC7A 2I49A 1LCTA 4XKRA 1I6BA 4JWYA 4OMBA 2YJPA 1EZOA 1B7ZA 3MZ1A 3S2VA 1Q35A 4QRZA 2FNCA 2UVIA 3K6VA 2UYEA 5H8NA 1OVBA 1ZBMA 1UIVA 1MG1A 1UQWA 2O6AA 4F1VA 3FVNA 3G3HA 2NUVA 5H8HB 2VGQA 2B65A 2H5YA 1MH4A 5IKBA 2NVUB 1Z7NE 2OCUA 1A99A 1BTJA 3KBRA 4F18A 3DRJA 2DE2A 1B51A 4R9FA 3H3GA 5JTYB 2OLBA 4KR5A 1IXIA 3KFMA 1I6AA 3KN8A 4F3PA 4G68B 1SW4A 5L9OA 2CZLA 1FTOA 1LAFE 4YICA 3DRFA 3MZ9A 4DZ1A 3T9HB 4OXVA 5A5XB 1TWYA 3KG2A 4F3SA 3V5AA 1Y4CA 1FCKA 3PV0E 3T9VA 2ONKE 3RQTA 4MFIA 4QSDA 2QS2A 2ONRA 2X7PA 3KOTA 3DP4A 4MBPA 2DE4A 1SI1A 1Y20A 2ZYNA 4OFLA 4YMAA 1AIVA 5J1DA 3MJNA 2Y7PA 3THIA 2F34A 4OFOA 3ODBA 1FW0A 1N7XA 1P1QA 3KSJA 3UK4A 3C9HA 3RTFB 3G3GA 2Y7IA 4L17A 3C36A 3L6GA 3KJTA 1UTBB 5ICQA 1H3DA 3HCQA 5KCJA 5I2NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z22 A;  4RA1 A;  3JYR A;  2F6P A;  4C0R A;  2XX7 A;  4BLA A;  1LST A;  4LQ2 A;  2B3B A;  3FVG A;  4R2F A;  2Q2C A;  3LC8 A;  2QJE A;  1OQH A;  3FVK A;  3Q26 A;  4JDF A;  3SEX A;  2XD2 A;  4RK2 A;  2VOZ A;  3MVZ A;  2O1L A;  4U4S A;  2LAO A;  3IOU A;  3N26 A;  3K6X A;  2ABH A;  4NF4 A;  3QUJ A;  3DP6 A;  4NF6 A;  1DOT A;  3OO9 A;  4NWD A;  1SD3 A;  4IO5 A;  3Q25 A;  2AL4 A;  5H8F A;  4O3C A;  3IJO B;  3VVF A;  1LBC A;  3G3J A;  3TMG A;  4DCX A;  4BDR A;  3M3K A;  2Z8D A;  1Q1K A;  3PAM A;  3U1O A;  5AA4 B;  4LZ5 A;  1AOV A;  3MAM A;  1LAX A;  3UIF A;  3CHG A;  1MY1 A;  2UXA A;  4FOR A;  4QF9 A;  2WOP A;  1MXV A;  4U2R A;  1KWH A;  3KN7 A;  3PUZ E;  5FTH A;  3E9X A;  4PP0 A;  3OO6 A;  2XXI A;  4OEU A;  1VFE A;  3O2A A;  3RPW A;  1DTZ A;  5AA2 A;  3RT6 B;  1I6Q A;  4ZE8 A;  4OYV A;  4KYS A;  3E4R A;  5I2K B;  3QUF A;  4KPT A;  3IL1 B;  4I9D A;  1FQE A;  2Y7R A;  3BFT A;  1S50 A;  1B6H A;  1GTK A;  1POT A;  4GXA A;  3I3V A;  1YAE A;  1MPD A;  1LAH E;  3IB2 A;  1B4H A;  1BKA A;  2XXP A;  4H5F A;  1FQD A;  3ILT B;  1ZTY A;  1B7H A;  1WOD A;  2ANJ A;  3OSQ A;  2QMX A;  3S9L C;  3RYB A;  2PX1 A;  1MPB A;  1R9Q A;  2Q2A A;  3W9V A;  2DWA A;  5LOM A;  2QS1 A;  3FAS A;  5HBC A;  3L6H A;  4YAH X;  4LP2 B;  1A8F A;  1S9T A;  5L8D A;  4NMY A;  1IEJ A;  1MY0 A;  4RNS A;  4H0W A;  4F3G A;  1USY E;  1URG A;  3H4Z A;  2A5T A;  3HPI A;  3FVO A;  3Q27 A;  3EHU A;  1IXG A;  3USD A;  3PU5 A;  4FJP A;  4NTL A;  1A7L A;  3SDF A;  2QRY A;  3DLN A;  3KEI A;  3D4G A;  5I56 A;  3T66 A;  1TFD A;  4EUO A;  1YPN A;  1B52 A;  3VV5 A;  4DE8 A;  3VVD A;  1MM7 A;  3RNN A;  4WED A;  1LGB C;  4WKM A;  1SW2 A;  1VE4 A;  2ALU A;  3CFL A;  2I48 A;  4ELO A;  1N7W A;  1TXF A;  3RGY A;  2F97 A;  4G68 C;  1N04 A;  3ZSF A;  5I57 A;  4QHQ A;  3UGW A;  3H6W A;  3C31 A;  3R6U A;  3SET A;  1FTM A;  2V25 A;  3FXQ A;  5K2Y A;  1B0L A;  4MLV A;  4HS7 A;  4P0G A;  5DVI A;  1OMP A;  3KOS A;  1SW1 A;  5ISU A;  4X9T A;  3IOR A;  1Y1Z A;  2IA4 A;  2X26 A;  3IOV A;  3C34 A;  1D9Y A;  1QW0 A;  3V8X B;  4TLL B;  1J1N A;  3KGC A;  1O7T A;  2H25 A;  3RTW B;  5DEX A;  4EF2 A;  1B9J A;  3CRB A;  3O6G A;  5ITP A;  1MXY A;  1M5F A;  3LSX A;  2QS4 A;  3K01 A;  5I58 A;  5BWJ A;  1XVY A;  2F36 A;  4P0I A;  1UIU A;  4NF8 A;  4M1V A;  4MF3 A;  1SVX B;  3T96 B;  3LR1 A;  4IY5 A;  5TPA A;  2Y7W A;  1OLC A;  2RIN A;  3OSR A;  1MQD A;  3WAE A;  1LBB A;  3ILU B;  1AL3 A;  2I3V A;  1SI0 A;  3MP8 A;  3KSX A;  3FV1 A;  4R75 A;  3SEV A;  4RJZ A;  2D3I A;  1NKX A;  3VLW A;  5TU0 A;  4XKQ A;  5H8N B;  4ELQ A;  4BDM A;  1HSE A;  3C33 A;  3O28 A;  4Q0C A;  4H8J A;  3LSF B;  5TP9 A;  1A54 A;  3K1P A;  4GIZ A;  3TCG A;  4JWX A;  1OLA A;  4YKP A;  4U1Z A;  1AMF A;  4AB6 A;  2E0S A;  1B5J A;  1JW1 A;  4GOT A;  3OXN A;  5CMC A;  4R6H A;  2GFE A;  3G3F A;  2ZMB A;  4QFP A;  2XXR A;  1XOC A;  2E1S A;  1NNT A;  3MVY A;  1B3L A;  5ELV A;  2B3F A;  3JV9 A;  2GH9 A;  2OK2 A;  2WOK A;  2I6E A;  1JET A;  1PEB A;  4QSE A;  4ESX A;  4LA9 A;  5I84 A;  4KHZ E;  3RLF E;  1P1W A;  4PET A;  3TEL A;  2I0B A;  1MDQ A;  1B58 A;  2HZK A;  3DEL B;  1WVJ A;  1S7Y A;  3VXC A;  3RY3 A;  1T0K A;  3MQ9 A;  1R1N A;  4GL8 A;  1PBP A;  3TQL A;  2O1M A;  4GLI A;  2DXY A;  2XXU A;  1MPC A;  1MH3 A;  1CE2 A;  1JEV A;  2DWI A;  4F1Y A;  3K0V A;  3I6V A;  4E0W A;  1OIB A;  4G8H A;  2P0S A;  3SEY A;  4XKN A;  3PPO A;  1O64 A;  5KCJ B;  4LUB A;  3W15 C;  1UTH B;  4POX A;  1POY 1;  1SDX A;  3AXF A;  3UP9 A;  4G4P A;  1Y3N A;  5DVJ A;  5BUU A;  2XXX A;  1B5I A;  4N13 A;  5H8S A;  1B40 A;  2P2A A;  4LZ7 A;  4F29 A;  5KDT B;  2QS3 A;  1D3K A;  5EYF A;  4THI A;  4F19 A;  5H8H A;  1Y1M A;  4OVJ A;  4KCC A;  4F3B A;  2DWJ A;  3BFU A;  3LSW A;  4M4G A;  4DCY A;  3PPR A;  3GXA A;  2XX9 A;  3CR9 A;  1US5 A;  4GWO A;  3E3K A;  1FQA A;  3FJ7 A;  1ZIU A;  5ITO A;  4BDN A;  4QSC A;  4G68 A;  1D4N A;  2HEU A;  1F9B A;  5AA1 A;  3PGF A;  4HTG A;  4IO3 A;  4TQU Q;  2AL5 A;  3H7M A;  1B0H A;  1XT8 A;  4QFO A;  5A5X A;  3OD7 A;  3H6U A;  1MQJ A;  2V3U A;  4QFL A;  4JBZ A;  3PMW A;  1QJM A;  1XHY A;  4IO4 A;  4PFU A;  3U94 A;  4Q5T A;  4I8C A;  4KYE A;  2HQ0 A;  3G3K A;  4YKJ A;  1B1H A;  1RKM A;  1IXC A;  3C35 A;  3O6I A;  1B1X A;  4X48 A;  1N3W A;  1HSJ A;  4OER A;  1SW5 A;  2XXW A;  3GBB A;  1USY H;  3FD3 A;  2DP8 A;  2XXQ A;  3QXM A;  3OEM A;  4OTE A;  2G29 A;  2QSX A;  4ZEI A;  1Y9U A;  4YB7 A;  2I4B A;  1UTB A;  4BDL A;  2I4C A;  5I2N A;  1SYI A;  5FHM A;  2HZL A;  2RF1 A;  5HM4 B;  1QUL A;  4EQB A;  3R7X A;  2HAU A;  4HCY A;  4RYA A;  4EQ9 A;  1N76 A;  1Y4T A;  4Q30 B;  5I59 B;  2O7I A;  3U8Q A;  4HCW A;  1NL5 A;  1B3G A;  3EF7 A;  2R6G E;  3LSL A;  2CMO A;  3VLU A;  2QPQ A;  4EQ7 A;  2KLF A;  1ANF A;  1R6Z A;  3IR1 A;  3I5O A;  1RYX A;  3CSB A;  2DSF A;  4ZED A;  3K1N A;  1NFT A;  3C32 A;  3N94 A;  3B6W A;  3G3I A;  1FTK A;  3GZG A;  1FQC A;  1OVT A;  4N07 A;  1B46 A;  3VE1 B;  5EHS A;  4AQ4 A;  3EQ1 A;  3PUY E;  3IK6 B;  3FZV A;  1MQH A;  2F6G A;  2HCA A;  3FXR A;  1LAG E;  5KZT A;  2DOJ A;  1PC3 A;  3IB0 A;  5CBS A;  1QUK A;  4LQ5 A;  2O84 X;  2FA7 A;  3FAT A;  1P99 A;  1GV8 A;  3PUX E;  5AA4 A;  3CFX A;  3OO7 A;  3QSL A;  3DP8 A;  1NNF A;  4NF5 B;  5AA3 A;  1DSN A;  3EN3 A;  4U1O A;  5AE4 A;  3PMX A;  4YKI A;  4G77 A;  3V83 A;  4I1D A;  1MQI A;  1AH5 A;  5B70 A;  4YB6 A;  2B4L A;  5DT6 A;  2F7A A;  4H1X A;  2RC9 A;  1MXZ A;  2ONS A;  2Y7K A;  4XKP A;  1XVX A;  4R2B A;  4NWC A;  4ELR A;  1CB6 A;  3PMV A;  1FQF A;  3TDJ A;  4RXL A;  2OJT A;  1EU8 A;  3O29 A;  2YLN A;  4ZEF A;  1XC1 A;  2DE3 A;  3FUZ A;  3MW0 A;  3U93 A;  4PE5 B;  1B7U A;  3MPL A;  1IZ1 A;  1SQY A;  3MWB A;  3DM0 A;  1P1U A;  2RKM A;  3ZS6 A;  3IO6 A;  4R72 A;  4UAC A;  1QKA A;  4OES A;  5H8Q A;  4IO2 A;  3PD9 A;  1EH3 A;  1IXH A;  4ONY A;  4PQJ A;  3KJ7 A;  3H6V A;  3A3U A;  4O3A A;  2ZYM A;  5F1Q A;  4GFR A;  1RYO A;  3R26 A;  2WOL A;  2GRV A;  4NF8 B;  4OWD A;  2V84 A;  5CBR A;  5FTI A;  2DS9 A;  1DTG A;  4YU0 A;  1JEU A;  4H8I A;  5TPA B;  4GVO A;  3VXB A;  4LAT A;  3OOA A;  1NNK A;  1ZJL A;  3OO8 A;  1FTL A;  2D21 A;  5L9S A;  1PBQ A;  4IGT A;  4POW A;  4E0X A;  4IB2 A;  2F5X A;  3N5L A;  1VSO A;  4RK9 A;  5FHO A;  4R73 A;  4IGR A;  4Z0I A;  3IO4 A;  4R6Y A;  3FV2 A;  3QYT A;  2PT2 A;  2I58 A;  4R6K A;  4YMB A;  3H6T A;  2H99 A;  5F7V A;  4GF8 A;  2OBG A;  1EZ9 A;  4RY1 A;  2UVJ A;  3SEU A;  4ZE9 A;  1LFI A;  2PYY A;  3RYA A;  1Z7M E;  1JVY A;  3DRI A;  3TCF A;  1LB8 A;  3O9P A;  5EHM A;  2NXO A;  1MXW A;  2QL3 A;  2HXW A;  3TTN A;  1R9L A;  3TFL A;  2UVG A;  5CC2 A;  2Z8E A;  4OET A;  2IEE A;  1YTV A;  1LCF A;  3UA8 A;  4GL0 A;  2AIX A;  4JXI A;  5HPQ A;  2OWS A;  1DPP A;  4BDO A;  1H43 A;  1M5E A;  1B5H A;  3PUV E;  3Q28 A;  3B6Q A;  4PFW A;  2D5W A;  3VVE A;  4FED A;  3RN8 A;  1OQG A;  5CI5 A;  3EHT A;  4H65 A;  1B3E A;  5JK4 A;  4GD5 A;  1ZU0 A;  4KCD A;  3F11 A;  2NOO A;  5CMB A;  3K02 A;  1D9V A;  3IOW A;  4ZEB A;  4ECF A;  1N0T A;  1URS A;  3MP1 A;  1MQG A;  3B7D A;  3K1M A;  3QAX A;  1GVC A;  4IO7 A;  2M8C A;  5DVF A;  2I0C A;  2R71 A;  1P1N A;  2PVU A;  2O7U A;  4JB7 A;  4H67 A;  3M3F A;  1B2H A;  3EHS A;  1II5 A;  2XD3 A;  3PPP A;  3SEW A;  5ICT A;  1FQB A;  1VFD A;  1B32 A;  2O51 A;  2ZNT A;  4Q8R A;  4PFY A;  4ZZA A;  1B3F A;  3S9M C;  3FIR A;  4PFT A;  1H45 A;  3FXU A;  2HAV A;  3FGS A;  2V93 A;  4F39 A;  3BKI B;  1ZKB A;  3H03 A;  3VLV A;  5AA2 D;  4DXC A;  4FEC A;  1TFA A;  2Y84 A;  3TTL A;  4YB5 A;  4FAJ A;  1EZP A;  4TOZ A;  2VP1 A;  3KN3 A;  1LFH A;  1NH7 A;  5CM6 A;  2YPN A;  3TTM A;  2ZNU A;  1US4 A;  4OZ9 A;  3KZG A;  1M5D A;  4U23 A;  3MUQ A;  4Z7E A;  3HHF A;  1HSL A;  2GHB A;  2ZXT A;  3O66 A;  4KYD A;  2RC8 A;  4ESW A;  3Q29 A;  3TTK A;  2AYS A;  3A09 A;  2V3T A;  4IY6 A;  3TOD A;  3HV1 A;  1BP5 A;  3E13 X;  3MP6 A;  3T93 B;  1YCJ A;  1DMB A;  1MY3 A;  4NED A;  2DXR A;  1GGG A;  2Q89 A;  3JZJ A;  3M3L A;  1IIW A;  4TLM B;  2B4M A;  2X7Q A;  1MS7 A;  4FE8 A;  3TPA A;  4ZEC A;  4ZZE A;  4RPO A;  1MXX A;  2H98 A;  1N84 A;  3OEK A;  1ELJ A;  5JTY A;  1A55 A;  3M8U A;  4WEP A;  4NF4 B;  3CIJ A;  3TAJ A;  4NF6 B;  3RUM A;  4MH5 A;  1I69 A;  1B3H A;  4GRK A;  1NH8 A;  3TTR A;  4DIG A;  3EPE A;  4MLQ A;  1SBP A;  4X1B A;  4FEB A;  5H8F B;  2Q88 A;  2Z8F A;  4QFN A;  1UTH A;  1NMU A;  2PT1 A;  3MPK A;  4C1U A;  3PD8 A;  2R9J A;  3B6T A;  5M2V A;  4XIG Q;  3K2D A;  2XXT A;  4X1D A;  2W7Y A;  2GHA A;  3CFZ A;  2F78 A;  3DRK A;  4KFQ A;  3D4C A;  5KDT A;  4F2Q A;  3ZKK A;  4DXB A;  3UN6 A;  3LUY A;  3T9X B;  3U92 A;  1H44 A;  2UYF A;  3SES A;  5AA2 B;  2G93 A;  5IAI A;  1L5T A;  4HW8 A;  2BJJ X;  2THI A;  4OEN A;  2VHA A;  1Y3P A;  5FHN A;  1LFG A;  2H4I A;  3K6W A;  2ZYK A;  1PDA A;  3W9W A;  3MVW A;  2F7C A;  4DLD A;  4EDP A;  4ISU A;  1MM6 A;  3GBA A;  3HST A;  2RCB A;  3UOR A;  2FYI A;  4WXJ A;  3VDF A;  4LZ8 A;  3DRG A;  1QUI A;  3ECR A;  4OEV A;  1LLS A;  3O97 A;  3TKD A;  1M5B A;  2XXH A;  3N6T A;  1IUD A;  4EXL A;  3FJG A;  2WKY A;  3SER A;  3QIM A;  1VR5 A;  3RT8 A;  4U22 A;  1MY4 A;  1FTJ A;  2UVH A;  2A5S A;  4F1U A;  3S9N C;  2ZYO A;  2I3W A;  4JSO A;  5B7D A;  2NWJ A;  1M5C A;  1A40 A;  1ZMG A;  2XXV A;  1QKB A;  4F2O A;  2Q9T A;  5L9M A;  4OFJ A;  3LBS A;  4O3B A;  1TT1 A;  3HO7 A;  4G2Z A;  2A5T B;  4LVQ A;  3OEN A;  1B05 A;  1NNP A;  4LON B;  4JWO A;  2DVZ A;  5JEI A;  4ZEK A;  2ZNS A;  3MVX A;  4RPN A;  5I56 B;  3GLB A;  4XTC Q;  3P7I A;  4R9G A;  5H8Q B;  3HN0 A;  2VD2 A;  4DDD A;  2F7B A;  1QUJ A;  1JVX A;  2OZZ A;  5I59 A;  3PPQ A;  1PB9 A;  2DVC A;  1O63 A;  5I57 B;  2XXY A;  2F8D A;  2Z23 A;  5CMM A;  4EF1 A;  4KD5 A;  2RCA A;  4H6D A;  2REG A;  1JQF A;  1N3X A;  4ELP A;  5I2K A;  2DYX A;  2DQV A;  2P1S A;  3CG3 A;  1GR2 A;  3MC2 A;  3SKP A;  4GQO A;  2Q8J A;  4K3F A;  4N6P A;  3C4M A;  4C1T A;  1MDP 1;  4YZZ A;  2XHD A;  3PUW E;  3TZA A;  5DEX B;  4ND9 A;  2XX8 A;  3K6U A;  4F22 A;  2HFB A;  1XS5 A;  1B4Z A;  4NE4 A;  5CRY A;  3IOT A;  1JW5 A;  5I58 B;  4NF5 A;  3WAF A;  1LB9 A;  3IAZ A;  1Y3Q A;  4KQP A;  3QK6 A;  4I62 A;  1PB8 A;  1BLF A;  3TEP A;  3K4U A;  2H9B A;  3CI8 A;  5K2X A;  1PB7 A;  1QVS A;  3T22 A;  5DTB A;  2OWT A;  3CG1 A;  3LVU A;  3ONM A;  1MRP A;  3IX1 A;  1ZLQ A;  3MZB A;  3PPN A;  2PMS A;  4AB5 A;  1SYH A;  3IJX B;  4DXU A;  2PBW A;  3CSG A;  4G8N A;  1H76 A;  2QMW A;  1WDN A;  4BDQ A;  4FAT A;  4QFK A;  3N6U A;  3S4U A;  4G8M A;  3VFJ A;  5TP9 B;  3TYH A;  1ATG A;  2V3Q A;  4OQO A;  3O6P A;  2REJ A;  2DWH A;  3DRH A;  3U72 A;  4YKK A;  1MY2 A;  1IIT A;  4ZDM A;  4R74 A;  2F35 A;  3H06 B;  4XXU A;  1DPE A;  2ESN A;  1IQ7 A;  3G7W A;  1URD A;  3T9U A;  4U4X A;  4IO6 A;  3MBP A;  5DYH A;  1MXU A;  4F31 B;  3TUS A;  1A8E A;  4UA8 A;  4OHN A;  1BIY A;  4FIM A;  1JW4 A;  3ZKL A;  4U21 A;  1JNF A;  4JSD A;  4ZS9 A;  3BBR A;  3TQW A;  4GXS B;  4EXK A;  4P11 A;  2O68 A;  3V89 B;  3OEL A;  3TCH A;  4H5G A;  3FJM A;  4KI0 E;  1P1O A;  3HHG A;  3A3C A;  3O6H A;  3IB1 A;  2O69 A;  5CMK A;  3CVG A;  3OMB A;  3FTO A;  3S9E A;  3K00 A;  2VD3 A;  2RC7 A;  2I49 A;  1LCT A;  4XKR A;  1I6B A;  4JWY A;  4OMB A;  2YJP A;  1EZO A;  1B7Z A;  3MZ1 A;  3S2V A;  1Q35 A;  4QRZ A;  2FNC A;  2UVI A;  3K6V A;  2UYE A;  5H8N A;  1OVB A;  1ZBM A;  1UIV A;  1MG1 A;  1UQW A;  2O6A A;  4F1V A;  3FVN A;  3G3H A;  2NUV A;  5H8H B;  2VGQ A;  2B65 A;  2H5Y A;  1MH4 A;  5IKB A;  2NVU B;  1Z7N E;  2OCU A;  1A99 A;  1BTJ A;  3KBR A;  4F18 A;  3DRJ A;  2DE2 A;  1B51 A;  4R9F A;  3H3G A;  5JTY B;  2OLB A;  4KR5 A;  1IXI A;  3KFM A;  1I6A A;  3KN8 A;  4F3P A;  4G68 B;  1SW4 A;  5L9O A;  2CZL A;  1FTO A;  1LAF E;  4YIC A;  3DRF A;  3MZ9 A;  4DZ1 A;  3T9H B;  4OXV A;  5A5X B;  1TWY A;  3KG2 A;  4F3S A;  3V5A A;  1Y4C A;  1FCK A;  3PV0 E;  3T9V A;  2ONK E;  3RQT A;  4MFI A;  4QSD A;  2QS2 A;  2ONR A;  2X7P A;  3KOT A;  3DP4 A;  4MBP A;  2DE4 A;  1SI1 A;  1Y20 A;  2ZYN A;  4OFL A;  4YMA A;  1AIV A;  5J1D A;  3MJN A;  2Y7P A;  3THI A;  2F34 A;  4OFO A;  3ODB A;  1FW0 A;  1N7X A;  1P1Q A;  3KSJ A;  3UK4 A;  3C9H A;  3RTF B;  3G3G A;  2Y7I A;  4L17 A;  3C36 A;  3L6G A;  3KJT A;  1UTB B;  5ICQ A;  1H3D A;  3HCQ A;  5KCJ A;  5I2N B; 
#chains in the Genus database with same CATH topology
 2Z22 A;  4RA1 A;  1EYJ A;  1FTA A;  3JYR A;  2F6P A;  5ET6 A;  4C0R A;  2XX7 A;  4BLA A;  1LST A;  2CEX A;  4LQ2 A;  2B3B A;  3FVG A;  4R2F A;  2Q2C A;  3LC8 A;  2QJE A;  1OQH A;  3FVK A;  3Q26 A;  4JDF A;  5J16 A;  3SEX A;  2XD2 A;  4RK2 A;  2VOZ A;  1FJ6 A;  2VT5 A;  3MVZ A;  2O1L A;  4U4S A;  2LAO A;  3IOU A;  3N26 A;  3K6X A;  2ABH A;  1LBW A;  4NF4 A;  3QUJ A;  3DP6 A;  4NF6 A;  1DOT A;  3OO9 A;  4NWD A;  1SD3 A;  4IO5 A;  3Q25 A;  2AL4 A;  5H8F A;  4O3C A;  3IJO B;  3VVF A;  1LBC A;  3G3J A;  3TMG A;  2Y5L A;  4DCX A;  4BDR A;  3M3K A;  2Z8D A;  2BJI A;  1Q1K A;  3PAM A;  4PF6 A;  3U1O A;  5AA4 B;  4LZ5 A;  1AOV A;  3MAM A;  1LAX A;  3UIF A;  3CHG A;  1MY1 A;  2UXA A;  4FOR A;  4QF9 A;  2WOP A;  1MXV A;  4U2R A;  1KWH A;  3KN7 A;  3PUZ E;  5FTH A;  3E9X A;  4PP0 A;  3OO6 A;  2XXI A;  4OEU A;  1VFE A;  1KA0 A;  3O2A A;  3RPW A;  4PGP A;  1DTZ A;  5AA2 A;  3RT6 B;  4AS4 A;  1I6Q A;  4ZE8 A;  4OYV A;  4KYS A;  1K9Y A;  3E4R A;  5I2K B;  4OVS A;  3QUF A;  4PCD A;  4KPT A;  3IL1 B;  4JVC A;  2Q74 A;  4I9D A;  1FQE A;  2Y7R A;  3BFT A;  1S50 A;  1B6H A;  1GTK A;  1POT A;  4GXA A;  3I3V A;  1YAE A;  1MPD A;  1LAH E;  3IB2 A;  1B4H A;  1BKA A;  2XXP A;  4H5F A;  1FQD A;  3ILT B;  1ZTY A;  4NG7 A;  1B7H A;  1WOD A;  3MST A;  2ANJ A;  3OSQ A;  3IFC A;  2QMX A;  3S9L C;  3RYB A;  1FSA A;  2PX1 A;  1MPB A;  4PAI A;  1R9Q A;  2Q2A A;  3W9V A;  1G0I A;  2DWA A;  4QBA A;  5IZ3 A;  5LOM A;  2QS1 A;  3FAS A;  5HBC A;  4OVT A;  3L6H A;  4YAH X;  4LP2 B;  1A8F A;  1S9T A;  5L8D A;  4NMY A;  1IEJ A;  1MY0 A;  4GWX A;  4GX4 A;  4RNS A;  2ZZV A;  2JJK A;  1NV1 A;  4H0W A;  4F3G A;  1USY E;  1URG A;  1NV6 A;  3U65 A;  3H4Z A;  2A5T A;  4NGU A;  3HPI A;  3FVO A;  3Q27 A;  3EHU A;  1IXG A;  3USD A;  3PU5 A;  2KR0 A;  4FJP A;  2XXK A;  4NTL A;  1A7L A;  1FPL A;  3SDF A;  2QRY A;  3DLN A;  3KEI A;  3D4G A;  4AS5 A;  3T66 A;  1TFD A;  4EUO A;  5I56 A;  4H45 A;  1YPN A;  1B52 A;  3VV5 A;  4DE8 A;  3VVD A;  5FBP A;  1MM7 A;  3RNN A;  4WED A;  2HHM A;  1NUW A;  1LGB C;  4WKM A;  1SW2 A;  1VE4 A;  2ALU A;  3CFL A;  2I48 A;  4ELO A;  1N7W A;  1TXF A;  3RGY A;  2F97 A;  5I3S A;  4G68 C;  1N04 A;  3ZSF A;  5I57 A;  4QHQ A;  3UGW A;  4PE3 A;  3H6W A;  3C31 A;  3R6U A;  3SET A;  1FTM A;  2V25 A;  2WX9 A;  3FXQ A;  5K2Y A;  1B0L A;  4MLV A;  4HS7 A;  4P0G A;  5DVI A;  1OMP A;  3KOS A;  1SW1 A;  5ISU A;  4X9T A;  3IOR A;  1KA1 A;  1Y1Z A;  2IA4 A;  2X26 A;  3IOV A;  4PDD A;  3C34 A;  1D9Y A;  1QW0 A;  3V8X B;  4TLL B;  1J1N A;  3KGC A;  1O7T A;  2H25 A;  3RTW B;  5EQA A;  5DEX A;  4HE1 A;  5A5L A;  4EF2 A;  1B9J A;  3CRB A;  3O6G A;  5ITP A;  1MXY A;  1M5F A;  3LSX A;  2QS4 A;  3K01 A;  5I58 A;  5BWJ A;  1XVY A;  2F36 A;  4N15 A;  1UIU A;  4P0I A;  4NF8 A;  4O7M A;  4M1V A;  4MF3 A;  1SVX B;  3T96 B;  3LR1 A;  4IY5 A;  5TPA A;  2Y7W A;  1OLC A;  2RIN A;  3OSR A;  1MQD A;  4O94 A;  3WAE A;  3ISP A;  1LBB A;  3ILU B;  1AL3 A;  2I3V A;  1SI0 A;  5T3J A;  3MP8 A;  2CEY A;  3KSX A;  1K9Z A;  3FV1 A;  2QVV A;  4R75 A;  3SEV A;  4RJZ A;  2D3I A;  1NKX A;  1RDX A;  3VLW A;  5TU0 A;  4XKQ A;  2FIE A;  5H8N B;  4ELQ A;  4BDM A;  1HSE A;  1NI9 A;  3C33 A;  3O28 A;  4Q0C A;  4H8J A;  3LSF B;  5TP9 A;  1A54 A;  3K1P A;  4GIZ A;  3TCG A;  4JWX A;  1OLA A;  4YKP A;  4U1Z A;  1AMF A;  4AB6 A;  2E0S A;  1B5J A;  1JW1 A;  4GOT A;  3OXN A;  3T1B A;  5CMC A;  4R6H A;  2GFE A;  3G3F A;  2R8T A;  2ZMB A;  4QFP A;  1NV2 A;  5ET8 A;  2XXR A;  1XOC A;  2E1S A;  4PC9 A;  1NNT A;  3MVY A;  1B3L A;  3BIH A;  5F24 A;  2OWZ A;  2B3F A;  5ELV A;  3JV9 A;  2GH9 A;  5I7I A;  1FBG A;  2OK2 A;  2WOK A;  2I6E A;  5EQ7 A;  1JET A;  1PEB A;  4QSE A;  2V4C A;  4ESX A;  4LA9 A;  5I84 A;  4KHZ E;  4MIJ A;  3RLF E;  1P1W A;  4PET A;  3TEL A;  2I0B A;  1MDQ A;  1B58 A;  2HZK A;  3DEL B;  1WVJ A;  4O8M A;  1LBX A;  1S7Y A;  3VXC A;  1IMF A;  3RY3 A;  1T0K A;  3MQ9 A;  1R1N A;  4GL8 A;  1PBP A;  3TQL A;  1FPJ A;  4H46 A;  2O1M A;  4GLI A;  2DXY A;  2XXU A;  2DDK A;  1MPC A;  1MH3 A;  1CE2 A;  1JEV A;  2DWI A;  4F1Y A;  3K0V A;  3I6V A;  4E0W A;  1OIB A;  5ET7 A;  4G8H A;  2P0S A;  5DW8 A;  3SEY A;  4XKN A;  3PPO A;  1O64 A;  5KCJ B;  4LUB A;  3W15 C;  1UTH B;  4POX A;  1POY 1;  1SDX A;  3AXF A;  1Q9D A;  3UP9 A;  4G4P A;  1Y3N A;  5DVJ A;  5BUU A;  2XXX A;  1B5I A;  4N13 A;  5H8S A;  1B40 A;  2P2A A;  4LZ7 A;  4PFR A;  4F29 A;  5KDT B;  2QS3 A;  1D3K A;  5EYF A;  4QXD A;  4THI A;  4F19 A;  5H8H A;  1Y1M A;  4OVJ A;  4KCC A;  4F3B A;  2DWJ A;  3BFU A;  3LSW A;  1LBV A;  4M4G A;  4DCY A;  3PPR A;  3GXA A;  2XX9 A;  3CR9 A;  4JVI A;  1US5 A;  4GWO A;  3E3K A;  1FQA A;  3FJ7 A;  2CZH A;  2WBB A;  1ZIU A;  5ITO A;  4BDN A;  4QSC A;  4G68 A;  1D4N A;  2HEU A;  1F9B A;  5AA1 A;  3PGF A;  4HTG A;  4IO3 A;  4TQU Q;  2AL5 A;  3H7M A;  1B0H A;  1XT8 A;  4QFO A;  4X04 A;  5A5X A;  3D1R A;  3OD7 A;  3H6U A;  1MQJ A;  2V3U A;  4QFL A;  4JBZ A;  2WBD A;  3PMW A;  1QJM A;  1XHY A;  4IO4 A;  4PFU A;  3U94 A;  4Q5T A;  4I8C A;  4KYE A;  5ET5 A;  2HQ0 A;  3G3K A;  4YKJ A;  1B1H A;  1INP A;  2XWO A;  1RKM A;  3E78 A;  1IXC A;  3C35 A;  3O6I A;  4NN3 A;  1B1X A;  4X48 A;  1N3W A;  4OA4 A;  1HSJ A;  4OER A;  1SW5 A;  2XXW A;  3GBB A;  1USY H;  3GYY A;  3FD3 A;  2DP8 A;  2XXQ A;  3QXM A;  3OEM A;  4OTE A;  2G29 A;  2QSX A;  4ZEI A;  1Y9U A;  4YB7 A;  2I4B A;  1UTB A;  4BDL A;  2I4C A;  5I2N A;  4PAF A;  1SYI A;  2F3B A;  5FHM A;  2Y5K A;  2HZL A;  2RF1 A;  1FPG A;  2ZZW A;  5HM4 B;  4NF0 A;  1QUL A;  4EQB A;  3R7X A;  2OX3 A;  2HAU A;  4HCY A;  4RYA A;  4EQ9 A;  3QMF A;  1N76 A;  1Y4T A;  4Q30 B;  5I59 B;  4XF5 A;  2O7I A;  3U8Q A;  3LUZ A;  4HCW A;  1NL5 A;  1B3G A;  3EF7 A;  2R6G E;  3LSL A;  2CMO A;  3VLU A;  2QPQ A;  4EQ7 A;  2KLF A;  1ANF A;  1FBD A;  1R6Z A;  3IR1 A;  3I5O A;  2L5V A;  1RYX A;  3CSB A;  2DSF A;  4ZED A;  1FPB A;  3K1N A;  1NFT A;  3C32 A;  3N94 A;  3B6W A;  3G3I A;  1FTK A;  3GZG A;  1FQC A;  1OVT A;  4HE2 A;  4N07 A;  1B46 A;  3NOH A;  4HE0 A;  3VE1 B;  5EHS A;  4AQ4 A;  4MHF A;  3EQ1 A;  3PUY E;  3IK6 B;  4PAK A;  3FZV A;  1MQH A;  2F6G A;  2HCA A;  3FXR A;  1LAG E;  5KZT A;  2DOJ A;  4OVQ A;  1PC3 A;  3IB0 A;  5CBS A;  1QUK A;  4LQ5 A;  2O84 X;  2FA7 A;  3FAT A;  1P99 A;  1GV8 A;  3PUX E;  2XWK A;  4N6D A;  5AA4 A;  3CFX A;  3OO7 A;  3QSL A;  3DP8 A;  3FBP A;  1NNF A;  4NF5 B;  5AA3 A;  1DSN A;  3IFA A;  3EN3 A;  4U1O A;  5AE4 A;  3PMX A;  4YKI A;  4G77 A;  3V83 A;  4I1D A;  1MQI A;  1AH5 A;  5B70 A;  4N8G A;  4YB6 A;  2B4L A;  5DT6 A;  2F7A A;  4H1X A;  2RC9 A;  1MXZ A;  2VPN A;  4PFB A;  2ONS A;  3FXB A;  1IMA A;  2CZI A;  2Y7K A;  4XKP A;  1XVX A;  4R2B A;  4NWC A;  4ELR A;  1CB6 A;  3PMV A;  1FQF A;  3TDJ A;  4RXL A;  2OJT A;  1EU8 A;  3O29 A;  2YLN A;  4ZEF A;  1NV3 A;  1XC1 A;  1FJ9 A;  2DE3 A;  2QFL A;  3FUZ A;  2KQZ A;  3MW0 A;  3U93 A;  4PE5 B;  1B7U A;  3MPL A;  1IZ1 A;  1SQY A;  3MWB A;  3DM0 A;  2RKM A;  1IME A;  1P1U A;  3ZS6 A;  3IO6 A;  4R72 A;  4UAC A;  1QKA A;  4OES A;  5H8Q A;  4MNC A;  4IO2 A;  1IMC A;  1EH3 A;  3PD9 A;  1IXH A;  2P3N A;  4ONY A;  4PQJ A;  3KJ7 A;  3H6V A;  3A3U A;  4O3A A;  2ZYM A;  5F1Q A;  4GFR A;  3RPL B;  1RYO A;  3R26 A;  2WOL A;  4GX6 A;  2GRV A;  4NF8 B;  4OWD A;  2V84 A;  5CBR A;  5FTI A;  1FPK A;  2DS9 A;  1DTG A;  4YU0 A;  4P3L A;  1JEU A;  4H8I A;  5TPA B;  4GVO A;  3VXB A;  4LAT A;  3OOA A;  1NNK A;  1ZJL A;  4N6K A;  3OO8 A;  1FTL A;  2D21 A;  5L9S A;  1PBQ A;  4IGT A;  4POW A;  4E0X A;  4IB2 A;  1LBY A;  2F5X A;  3N5L A;  1VSO A;  4RK9 A;  1FPI A;  5FHO A;  4R73 A;  4GX3 A;  4IGR A;  4Z0I A;  3IO4 A;  1IMB A;  4R6Y A;  3FV2 A;  2ZZX A;  3QYT A;  2PT2 A;  2I58 A;  4R6K A;  4YMB A;  3H6T A;  2H99 A;  4MX6 A;  5F7V A;  1NUX A;  4GF8 A;  2OBG A;  1EZ9 A;  4RY1 A;  3MYU A;  2UVJ A;  3SEU A;  1FBP A;  4ZE9 A;  1LFI A;  2PYY A;  3RYA A;  1Z7M E;  1JVY A;  3DRI A;  1LEV A;  3TCF A;  1LB8 A;  3O9P A;  5EHM A;  2NXO A;  1MXW A;  3ROJ A;  2QL3 A;  2HXW A;  3TTN A;  1EYK A;  1R9L A;  2HPG A;  3TFL A;  4MEV A;  4GWS A;  2UVG A;  5CC2 A;  2Z8E A;  4OET A;  2IEE A;  1YTV A;  1LCF A;  3UA8 A;  4GL0 A;  2AIX A;  4JXI A;  5HPQ A;  2OWS A;  1DCU A;  1DPP A;  4OAN A;  4BDO A;  1H43 A;  1M5E A;  4NQ8 A;  2FVZ A;  1B5H A;  3PUV E;  4I3E A;  4MJO A;  3Q28 A;  3B6Q A;  4PFW A;  4XEQ A;  2D5W A;  3VVE A;  4FED A;  3RN8 A;  1OQG A;  5CI5 A;  3EHT A;  4H65 A;  1B3E A;  5JK4 A;  4GD5 A;  1ZU0 A;  4KCD A;  3F11 A;  2NOO A;  5CMB A;  3K02 A;  4IR8 A;  1D9V A;  3IOW A;  4ZEB A;  4ECF A;  1N0T A;  1URS A;  3MP1 A;  1MQG A;  3B7D A;  3K1M A;  3B8B A;  3QAX A;  1GVC A;  4IO7 A;  2M8C A;  5DVF A;  2I0C A;  2R71 A;  4P8B A;  1P1N A;  2PVU A;  2O7U A;  4JB7 A;  4H67 A;  4PBH A;  3RYD A;  3M3F A;  1B2H A;  3EHS A;  1II5 A;  2XD3 A;  3PPP A;  3SEW A;  5ICT A;  1FQB A;  1VFD A;  1B32 A;  2O51 A;  2ZNT A;  4Q8R A;  4PFY A;  4ZZA A;  2P3V A;  1B3F A;  3S9M C;  3FIR A;  1VDW A;  4I3Y A;  4PFT A;  1H45 A;  3FXU A;  2CZK A;  2HAV A;  5EYG A;  3FGS A;  2V93 A;  4F39 A;  3BKI B;  1ZKB A;  3H03 A;  3VLV A;  5AA2 D;  4DXC A;  1XI6 A;  4FEC A;  1TFA A;  2Y84 A;  1JP4 A;  3TTL A;  4YB5 A;  5ESY A;  4FAJ A;  1CNQ A;  1EZP A;  1FBE A;  4TOZ A;  2VP1 A;  3B50 A;  4GBW A;  3KN3 A;  1LFH A;  1NH7 A;  5CM6 A;  2YPN A;  3TTM A;  2ZNU A;  1US4 A;  4OZ9 A;  3KZG A;  2FHY A;  1M5D A;  4U23 A;  3PTY A;  3MUQ A;  4N17 A;  4N4U A;  4Z7E A;  3HHF A;  1HSL A;  2GHB A;  2ZXT A;  3O66 A;  4KYD A;  1BK4 A;  2RC8 A;  4ESW A;  3Q29 A;  3TTK A;  2AYS A;  3A09 A;  2V3T A;  1YYZ A;  4IY6 A;  3TOD A;  4PTK A;  3HV1 A;  1BP5 A;  3E13 X;  3MP6 A;  4DI3 D;  4PBQ A;  3T93 B;  2PFZ A;  1YCJ A;  1DMB A;  1MY3 A;  4NED A;  2DXR A;  4NX1 A;  1GGG A;  2Q89 A;  4OVR A;  4N8Y A;  4P1L A;  3JZJ A;  1G0H A;  3M3L A;  1IIW A;  4TLM B;  2B4M A;  2X7Q A;  1MS7 A;  4FE8 A;  4NHB A;  3TPA A;  4ZEC A;  4ZZE A;  4RPO A;  1MXX A;  2H98 A;  1N84 A;  3OEK A;  1ELJ A;  5JTY A;  1A55 A;  3M8U A;  4WEP A;  4NF4 B;  3CIJ A;  3TAJ A;  4NF6 B;  3RUM A;  4MH5 A;  1I69 A;  1B3H A;  4GRK A;  1NH8 A;  3TTR A;  3EPE A;  4DIG A;  4MLQ A;  1SBP A;  4X1B A;  4FEB A;  5H8F B;  4PGN A;  2Q88 A;  2Z8F A;  4QFN A;  1UTH A;  1NMU A;  2PT1 A;  3MPK A;  4C1U A;  2XWI A;  3PD8 A;  2R9J A;  3B6T A;  3KC0 A;  5M2V A;  4XIG Q;  3K2D A;  4P47 A;  2XXT A;  4X1D A;  2W7Y A;  1D9Q A;  1SPI A;  2GHA A;  3CFZ A;  2F78 A;  3DRK A;  4KFQ A;  3D4C A;  1NV5 A;  5KDT A;  4F2Q A;  3ZKK A;  2FIX A;  4DXB A;  4GWW A;  3UN6 A;  3LUY A;  4PFI A;  3T9X B;  3U92 A;  1H44 A;  2UYF A;  3SES A;  5AA2 B;  2MKZ A;  2G93 A;  5IAI A;  1L5T A;  4HW8 A;  2BJJ X;  2THI A;  4XFE A;  4OEN A;  2VHA A;  1Y3P A;  5FHN A;  1LFG A;  2H4I A;  3K6W A;  1NUY A;  3A29 A;  2ZYK A;  1PDA A;  3W9W A;  3MVW A;  2F7C A;  4DLD A;  4EDP A;  4ISU A;  1MM6 A;  3GBA A;  3HST A;  2RCB A;  3UOR A;  2FYI A;  4WXJ A;  3VDF A;  4LZ8 A;  3DRG A;  1QUI A;  3ECR A;  4OEV A;  1LLS A;  3O97 A;  3TKD A;  1M5B A;  4GWZ A;  2XXH A;  3N6T A;  1IUD A;  4EXL A;  3FJG A;  2WKY A;  3SER A;  3QIM A;  1VR5 A;  3RT8 A;  4U22 A;  1MY4 A;  1FTJ A;  2UVH A;  2A5S A;  4F1U A;  3S9N C;  2ZYO A;  2I3W A;  5IZ3 B;  4JSO A;  4JVD A;  5B7D A;  2NWJ A;  1M5C A;  1A40 A;  1ZMG A;  2XXV A;  1QKB A;  4F2O A;  2Q9T A;  5L9M A;  4PF8 A;  1RDY A;  4OFJ A;  3LBS A;  4O3B A;  1TT1 A;  3HO7 A;  1NV7 A;  4G2Z A;  2A5T B;  4P56 A;  4LVQ A;  3OEN A;  1B05 A;  4KXP A;  1NNP A;  1DK4 A;  4LON B;  5IZ1 A;  4JWO A;  2DVZ A;  5JEI A;  3HFU A;  4ZEK A;  1NV0 A;  3MVX A;  2ZNS A;  4OVP A;  4RPN A;  5I56 B;  3GLB A;  4XTC Q;  1FBF A;  5EYH A;  3P7I A;  1FBC A;  4R9G A;  5H8Q B;  3HN0 A;  3BIG A;  2VD2 A;  4DDD A;  2GQ1 A;  2F7B A;  1QUJ A;  1JVX A;  2OZZ A;  5I59 A;  3PPQ A;  2VPO A;  1PB9 A;  2DVC A;  1O63 A;  5I57 B;  2XXY A;  2F8D A;  2Z23 A;  5CMM A;  4EF1 A;  4KD5 A;  2RCA A;  4H6D A;  2REG A;  1JQF A;  3T0J A;  3KBZ A;  1FRP A;  4G61 A;  1N3X A;  1DBZ A;  4ELP A;  2DYX A;  2DQV A;  2P1S A;  3CG3 A;  5I2K A;  1GR2 A;  3MC2 A;  4P1E A;  3SKP A;  4GQO A;  2Q8J A;  4K3F A;  4NAP A;  3SZP A;  4N6P A;  3C4M A;  4C1T A;  1MDP 1;  4YZZ A;  2XHD A;  3PUW E;  3TZA A;  5DEX B;  4ND9 A;  2XX8 A;  3K6U A;  2PFY A;  4F22 A;  2HFB A;  1XS5 A;  1B4Z A;  4NE4 A;  5CRY A;  3IOT A;  1JW5 A;  5I58 B;  4LN5 A;  4NF5 A;  2WYP A;  3WAF A;  1LB9 A;  3IAZ A;  1Y3Q A;  4KQP A;  3QK6 A;  4I62 A;  4DI4 B;  4X8R A;  1PB8 A;  4MNI A;  1BLF A;  2HXR A;  3K4U A;  3TEP A;  2H9B A;  3CI8 A;  5K2X A;  1PB7 A;  1QVS A;  3T22 A;  4MNP A;  5DTB A;  2OWT A;  3CG1 A;  3LVU A;  3ONM A;  1MRP A;  3IX1 A;  1ZLQ A;  3MZB A;  3PPN A;  2PMS A;  4AB5 A;  2Q8M A;  1EYI A;  1SYH A;  3IJX B;  1FPE A;  4DXU A;  2PBW A;  3CSG A;  4G8N A;  4GWY A;  1H76 A;  2QMW A;  1WDN A;  4BDQ A;  4FAT A;  4QFK A;  3N6U A;  3EKI A;  4G8M A;  3S4U A;  5TP9 B;  3VFJ A;  3TYH A;  1ATG A;  2V3Q A;  4OQO A;  3O6P A;  2REJ A;  2DWH A;  5EQ9 A;  3DRH A;  3U72 A;  4YKK A;  1MY2 A;  1IIT A;  5IZZ A;  4ZDM A;  4R74 A;  2F35 A;  3H06 B;  3RPL A;  1YZ0 A;  4XXU A;  1DPE A;  2ESN A;  5LDZ A;  1IQ7 A;  3G7W A;  1URD A;  3T9U A;  4U4X A;  4IO6 A;  3MBP A;  5DYH A;  1MXU A;  4F31 B;  3TUS A;  1A8E A;  4GBV A;  2XA5 A;  2WYK A;  1FBH A;  4MCO A;  4UA8 A;  1YXI A;  4OHN A;  1BIY A;  4P9K A;  4FIM A;  2QVR A;  1JW4 A;  5I5P A;  3ZKL A;  4U21 A;  1JNF A;  4O7I A;  4JSD A;  4ZS9 A;  1QGX A;  3BBR A;  3TQW A;  4GXS B;  4EXK A;  4N91 A;  4P11 A;  1KZ8 A;  3KC1 A;  2O68 A;  3V89 B;  3OEL A;  4N81 A;  3TCH A;  4H5G A;  3FJM A;  4KI0 E;  1P1O A;  2FBP A;  3HHG A;  3A3C A;  3O6H A;  5IM2 A;  3IB1 A;  4UAB A;  2O69 A;  5CMK A;  3CVG A;  3OMB A;  3FTO A;  3S9E A;  3K00 A;  2VD3 A;  2RC7 A;  1IMD A;  2I49 A;  1LCT A;  4XKR A;  1I6B A;  4JWY A;  4OMB A;  2YJP A;  1EZO A;  1B7Z A;  3MZ1 A;  3S2V A;  5EQ8 A;  1Q35 A;  4QRZ A;  2FNC A;  2UVI A;  3K6V A;  2UYE A;  4HXV A;  5H8N A;  1OVB A;  1ZBM A;  1UIV A;  1MG1 A;  1UQW A;  3LV0 A;  1FPD A;  2O6A A;  4F1V A;  3FVN A;  3G3H A;  2NUV A;  5H8H B;  2QVU A;  2VGQ A;  3E79 A;  5IGA A;  2B65 A;  2H5Y A;  1MH4 A;  5IKB A;  2NVU B;  1Z7N E;  2OCU A;  1A99 A;  1BTJ A;  3KBR A;  2WEF A;  4F18 A;  3DRJ A;  2DE2 A;  1B51 A;  4R9F A;  3H3G A;  5JTY B;  2OLB A;  4KR5 A;  1IXI A;  4FBP A;  3KFM A;  1I6A A;  3KN8 A;  4F3P A;  4G68 B;  5LTC A;  1SW4 A;  5L9O A;  2CZL A;  1FTO A;  1AWB A;  4PDH A;  1LAF E;  4YIC A;  3DRF A;  3MZ9 A;  4DZ1 A;  3T9H B;  4OXV A;  5A5X B;  1TWY A;  4MMP A;  4GWU A;  1FPF A;  3KG2 A;  4F3S A;  3V5A A;  1Y4C A;  1FCK A;  3PV0 E;  3T9V A;  1NUZ A;  2ONK E;  3RQT A;  2F3D A;  4MFI A;  4QSD A;  2QS2 A;  2ONR A;  2X7P A;  3KOT A;  3DP4 A;  4MBP A;  2DE4 A;  1SI1 A;  1Y20 A;  2ZYN A;  4OFL A;  4YMA A;  1AIV A;  5J1D A;  4I40 A;  3MJN A;  2Y7P A;  2PCR A;  2F34 A;  3ODB A;  4OFO A;  3THI A;  1FW0 A;  1RDZ A;  1N7X A;  1P1Q A;  3KSJ A;  4MAG A;  3UK4 A;  3C9H A;  3RTF B;  2XWV A;  3G3G A;  2Y7I A;  1NV4 A;  4L17 A;  3C36 A;  3L6G A;  1LBZ A;  3KJT A;  1UTB B;  5ICQ A;  1H3D A;  3HCQ A;  5KCJ A;  5I2N B; 
#chains in the Genus database with same CATH homology
 2Z22 A;  4RA1 A;  3JYR A;  2F6P A;  4C0R A;  2XX7 A;  4BLA A;  1LST A;  4LQ2 A;  2B3B A;  3FVG A;  4R2F A;  2Q2C A;  3LC8 A;  2QJE A;  1OQH A;  3FVK A;  3Q26 A;  4JDF A;  3SEX A;  2XD2 A;  4RK2 A;  2VOZ A;  3MVZ A;  2O1L A;  4U4S A;  2LAO A;  3IOU A;  3N26 A;  3K6X A;  2ABH A;  4NF4 A;  3QUJ A;  3DP6 A;  4NF6 A;  1DOT A;  3OO9 A;  4NWD A;  1SD3 A;  4IO5 A;  3Q25 A;  2AL4 A;  5H8F A;  4O3C A;  3IJO B;  3VVF A;  1LBC A;  3G3J A;  3TMG A;  4DCX A;  4BDR A;  3M3K A;  2Z8D A;  1Q1K A;  3PAM A;  3U1O A;  5AA4 B;  4LZ5 A;  1AOV A;  3MAM A;  1LAX A;  3UIF A;  3CHG A;  1MY1 A;  2UXA A;  4FOR A;  4QF9 A;  2WOP A;  1MXV A;  4U2R A;  1KWH A;  3KN7 A;  3PUZ E;  5FTH A;  3E9X A;  4PP0 A;  3OO6 A;  2XXI A;  4OEU A;  1VFE A;  3O2A A;  3RPW A;  1DTZ A;  5AA2 A;  3RT6 B;  1I6Q A;  4ZE8 A;  4OYV A;  4KYS A;  3E4R A;  5I2K B;  3QUF A;  4KPT A;  3IL1 B;  4I9D A;  1FQE A;  2Y7R A;  3BFT A;  1S50 A;  1B6H A;  1GTK A;  1POT A;  4GXA A;  3I3V A;  1YAE A;  1MPD A;  1LAH E;  3IB2 A;  1B4H A;  1BKA A;  2XXP A;  4H5F A;  1FQD A;  3ILT B;  1ZTY A;  1B7H A;  1WOD A;  2ANJ A;  3OSQ A;  2QMX A;  3S9L C;  3RYB A;  2PX1 A;  1MPB A;  1R9Q A;  2Q2A A;  3W9V A;  2DWA A;  5LOM A;  2QS1 A;  3FAS A;  5HBC A;  3L6H A;  4YAH X;  4LP2 B;  1A8F A;  1S9T A;  5L8D A;  4NMY A;  1IEJ A;  1MY0 A;  4RNS A;  4H0W A;  4F3G A;  1USY E;  1URG A;  3H4Z A;  2A5T A;  3HPI A;  3FVO A;  3Q27 A;  3EHU A;  1IXG A;  3USD A;  3PU5 A;  4FJP A;  4NTL A;  1A7L A;  3SDF A;  2QRY A;  3DLN A;  3KEI A;  3D4G A;  5I56 A;  3T66 A;  1TFD A;  4EUO A;  1YPN A;  1B52 A;  3VV5 A;  4DE8 A;  3VVD A;  1MM7 A;  3RNN A;  4WED A;  1LGB C;  4WKM A;  1SW2 A;  1VE4 A;  2ALU A;  3CFL A;  2I48 A;  4ELO A;  1N7W A;  1TXF A;  3RGY A;  2F97 A;  4G68 C;  1N04 A;  3ZSF A;  5I57 A;  4QHQ A;  3UGW A;  3H6W A;  3C31 A;  3R6U A;  3SET A;  1FTM A;  2V25 A;  3FXQ A;  5K2Y A;  1B0L A;  4MLV A;  4HS7 A;  4P0G A;  5DVI A;  1OMP A;  3KOS A;  1SW1 A;  5ISU A;  4X9T A;  3IOR A;  1Y1Z A;  2IA4 A;  2X26 A;  3IOV A;  3C34 A;  1D9Y A;  1QW0 A;  3V8X B;  4TLL B;  1J1N A;  3KGC A;  1O7T A;  2H25 A;  3RTW B;  5DEX A;  4EF2 A;  1B9J A;  3CRB A;  3O6G A;  5ITP A;  1MXY A;  1M5F A;  3LSX A;  2QS4 A;  3K01 A;  5I58 A;  5BWJ A;  1XVY A;  2F36 A;  4P0I A;  1UIU A;  4NF8 A;  4M1V A;  4MF3 A;  1SVX B;  3T96 B;  3LR1 A;  4IY5 A;  5TPA A;  2Y7W A;  1OLC A;  2RIN A;  3OSR A;  1MQD A;  3WAE A;  1LBB A;  3ILU B;  1AL3 A;  2I3V A;  1SI0 A;  3MP8 A;  3KSX A;  3FV1 A;  4R75 A;  3SEV A;  4RJZ A;  2D3I A;  1NKX A;  3VLW A;  5TU0 A;  4XKQ A;  5H8N B;  4ELQ A;  4BDM A;  1HSE A;  3C33 A;  3O28 A;  4Q0C A;  4H8J A;  3LSF B;  5TP9 A;  1A54 A;  3K1P A;  4GIZ A;  3TCG A;  4JWX A;  1OLA A;  4YKP A;  4U1Z A;  1AMF A;  4AB6 A;  2E0S A;  1B5J A;  1JW1 A;  4GOT A;  3OXN A;  5CMC A;  4R6H A;  2GFE A;  3G3F A;  2ZMB A;  4QFP A;  2XXR A;  1XOC A;  2E1S A;  1NNT A;  3MVY A;  1B3L A;  5ELV A;  2B3F A;  3JV9 A;  2GH9 A;  2OK2 A;  2WOK A;  2I6E A;  1JET A;  1PEB A;  4QSE A;  4ESX A;  4LA9 A;  5I84 A;  4KHZ E;  3RLF E;  1P1W A;  4PET A;  3TEL A;  2I0B A;  1MDQ A;  1B58 A;  2HZK A;  3DEL B;  1WVJ A;  1S7Y A;  3VXC A;  3RY3 A;  1T0K A;  3MQ9 A;  1R1N A;  4GL8 A;  1PBP A;  3TQL A;  2O1M A;  4GLI A;  2DXY A;  2XXU A;  1MPC A;  1MH3 A;  1CE2 A;  1JEV A;  2DWI A;  4F1Y A;  3K0V A;  3I6V A;  4E0W A;  1OIB A;  4G8H A;  2P0S A;  3SEY A;  4XKN A;  3PPO A;  1O64 A;  5KCJ B;  4LUB A;  3W15 C;  1UTH B;  4POX A;  1POY 1;  1SDX A;  3AXF A;  3UP9 A;  4G4P A;  1Y3N A;  5DVJ A;  5BUU A;  2XXX A;  1B5I A;  4N13 A;  5H8S A;  1B40 A;  2P2A A;  4LZ7 A;  4F29 A;  5KDT B;  2QS3 A;  1D3K A;  5EYF A;  4THI A;  4F19 A;  5H8H A;  1Y1M A;  4OVJ A;  4KCC A;  4F3B A;  2DWJ A;  3BFU A;  3LSW A;  4M4G A;  4DCY A;  3PPR A;  3GXA A;  2XX9 A;  3CR9 A;  1US5 A;  4GWO A;  3E3K A;  1FQA A;  3FJ7 A;  1ZIU A;  5ITO A;  4BDN A;  4QSC A;  4G68 A;  1D4N A;  2HEU A;  1F9B A;  5AA1 A;  3PGF A;  4HTG A;  4IO3 A;  4TQU Q;  2AL5 A;  3H7M A;  1B0H A;  1XT8 A;  4QFO A;  5A5X A;  3OD7 A;  3H6U A;  1MQJ A;  2V3U A;  4QFL A;  4JBZ A;  3PMW A;  1QJM A;  1XHY A;  4IO4 A;  4PFU A;  3U94 A;  4Q5T A;  4I8C A;  4KYE A;  2HQ0 A;  3G3K A;  4YKJ A;  1B1H A;  1RKM A;  1IXC A;  3C35 A;  3O6I A;  1B1X A;  4X48 A;  1N3W A;  1HSJ A;  4OER A;  1SW5 A;  2XXW A;  3GBB A;  1USY H;  3FD3 A;  2DP8 A;  2XXQ A;  3QXM A;  3OEM A;  4OTE A;  2G29 A;  2QSX A;  4ZEI A;  1Y9U A;  4YB7 A;  2I4B A;  1UTB A;  4BDL A;  2I4C A;  5I2N A;  1SYI A;  5FHM A;  2HZL A;  2RF1 A;  5HM4 B;  1QUL A;  4EQB A;  3R7X A;  2HAU A;  4HCY A;  4RYA A;  4EQ9 A;  1N76 A;  1Y4T A;  4Q30 B;  5I59 B;  2O7I A;  3U8Q A;  4HCW A;  1NL5 A;  1B3G A;  3EF7 A;  2R6G E;  3LSL A;  2CMO A;  3VLU A;  2QPQ A;  4EQ7 A;  2KLF A;  1ANF A;  1R6Z A;  3IR1 A;  3I5O A;  1RYX A;  3CSB A;  2DSF A;  4ZED A;  3K1N A;  1NFT A;  3C32 A;  3N94 A;  3B6W A;  3G3I A;  1FTK A;  3GZG A;  1FQC A;  1OVT A;  4N07 A;  1B46 A;  3VE1 B;  5EHS A;  4AQ4 A;  3EQ1 A;  3PUY E;  3IK6 B;  3FZV A;  1MQH A;  2F6G A;  2HCA A;  3FXR A;  1LAG E;  5KZT A;  2DOJ A;  1PC3 A;  3IB0 A;  5CBS A;  1QUK A;  4LQ5 A;  2O84 X;  2FA7 A;  3FAT A;  1P99 A;  1GV8 A;  3PUX E;  5AA4 A;  3CFX A;  3OO7 A;  3QSL A;  3DP8 A;  1NNF A;  4NF5 B;  5AA3 A;  1DSN A;  3EN3 A;  4U1O A;  5AE4 A;  3PMX A;  4YKI A;  4G77 A;  3V83 A;  4I1D A;  1MQI A;  1AH5 A;  5B70 A;  4YB6 A;  2B4L A;  5DT6 A;  2F7A A;  4H1X A;  2RC9 A;  1MXZ A;  2ONS A;  2Y7K A;  4XKP A;  1XVX A;  4R2B A;  4NWC A;  4ELR A;  1CB6 A;  3PMV A;  1FQF A;  3TDJ A;  4RXL A;  2OJT A;  1EU8 A;  3O29 A;  2YLN A;  4ZEF A;  1XC1 A;  2DE3 A;  3FUZ A;  3MW0 A;  3U93 A;  4PE5 B;  1B7U A;  3MPL A;  1IZ1 A;  1SQY A;  3MWB A;  3DM0 A;  1P1U A;  2RKM A;  3ZS6 A;  3IO6 A;  4R72 A;  4UAC A;  1QKA A;  4OES A;  5H8Q A;  4IO2 A;  3PD9 A;  1EH3 A;  1IXH A;  4ONY A;  4PQJ A;  3KJ7 A;  3H6V A;  3A3U A;  4O3A A;  2ZYM A;  5F1Q A;  4GFR A;  1RYO A;  3R26 A;  2WOL A;  2GRV A;  4NF8 B;  4OWD A;  2V84 A;  5CBR A;  5FTI A;  2DS9 A;  1DTG A;  4YU0 A;  1JEU A;  4H8I A;  5TPA B;  4GVO A;  3VXB A;  4LAT A;  3OOA A;  1NNK A;  1ZJL A;  3OO8 A;  1FTL A;  2D21 A;  5L9S A;  1PBQ A;  4IGT A;  4POW A;  4E0X A;  4IB2 A;  2F5X A;  3N5L A;  1VSO A;  4RK9 A;  5FHO A;  4R73 A;  4IGR A;  4Z0I A;  3IO4 A;  4R6Y A;  3FV2 A;  3QYT A;  2PT2 A;  2I58 A;  4R6K A;  4YMB A;  3H6T A;  2H99 A;  5F7V A;  4GF8 A;  2OBG A;  1EZ9 A;  4RY1 A;  2UVJ A;  3SEU A;  4ZE9 A;  1LFI A;  2PYY A;  3RYA A;  1Z7M E;  1JVY A;  3DRI A;  3TCF A;  1LB8 A;  3O9P A;  5EHM A;  2NXO A;  1MXW A;  2QL3 A;  2HXW A;  3TTN A;  1R9L A;  3TFL A;  2UVG A;  5CC2 A;  2Z8E A;  4OET A;  2IEE A;  1YTV A;  1LCF A;  3UA8 A;  4GL0 A;  2AIX A;  4JXI A;  5HPQ A;  2OWS A;  1DPP A;  4BDO A;  1H43 A;  1M5E A;  1B5H A;  3PUV E;  3Q28 A;  3B6Q A;  4PFW A;  2D5W A;  3VVE A;  4FED A;  3RN8 A;  1OQG A;  5CI5 A;  3EHT A;  4H65 A;  1B3E A;  5JK4 A;  4GD5 A;  1ZU0 A;  4KCD A;  3F11 A;  2NOO A;  5CMB A;  3K02 A;  1D9V A;  3IOW A;  4ZEB A;  4ECF A;  1N0T A;  1URS A;  3MP1 A;  1MQG A;  3B7D A;  3K1M A;  3QAX A;  1GVC A;  4IO7 A;  2M8C A;  5DVF A;  2I0C A;  2R71 A;  1P1N A;  2PVU A;  2O7U A;  4JB7 A;  4H67 A;  3M3F A;  1B2H A;  3EHS A;  1II5 A;  2XD3 A;  3PPP A;  3SEW A;  5ICT A;  1FQB A;  1VFD A;  1B32 A;  2O51 A;  2ZNT A;  4Q8R A;  4PFY A;  4ZZA A;  1B3F A;  3S9M C;  3FIR A;  4PFT A;  1H45 A;  3FXU A;  2HAV A;  3FGS A;  2V93 A;  4F39 A;  3BKI B;  1ZKB A;  3H03 A;  3VLV A;  5AA2 D;  4DXC A;  4FEC A;  1TFA A;  2Y84 A;  3TTL A;  4YB5 A;  4FAJ A;  1EZP A;  4TOZ A;  2VP1 A;  3KN3 A;  1LFH A;  1NH7 A;  5CM6 A;  2YPN A;  3TTM A;  2ZNU A;  1US4 A;  4OZ9 A;  3KZG A;  1M5D A;  4U23 A;  3MUQ A;  4Z7E A;  3HHF A;  1HSL A;  2GHB A;  2ZXT A;  3O66 A;  4KYD A;  2RC8 A;  4ESW A;  3Q29 A;  3TTK A;  2AYS A;  3A09 A;  2V3T A;  4IY6 A;  3TOD A;  3HV1 A;  1BP5 A;  3E13 X;  3MP6 A;  3T93 B;  1YCJ A;  1DMB A;  1MY3 A;  4NED A;  2DXR A;  1GGG A;  2Q89 A;  3JZJ A;  3M3L A;  1IIW A;  4TLM B;  2B4M A;  2X7Q A;  1MS7 A;  4FE8 A;  3TPA A;  4ZEC A;  4ZZE A;  4RPO A;  1MXX A;  2H98 A;  1N84 A;  3OEK A;  1ELJ A;  5JTY A;  1A55 A;  3M8U A;  4WEP A;  4NF4 B;  3CIJ A;  3TAJ A;  4NF6 B;  3RUM A;  4MH5 A;  1I69 A;  1B3H A;  4GRK A;  1NH8 A;  3TTR A;  4DIG A;  3EPE A;  4MLQ A;  1SBP A;  4X1B A;  4FEB A;  5H8F B;  2Q88 A;  2Z8F A;  4QFN A;  1UTH A;  1NMU A;  2PT1 A;  3MPK A;  4C1U A;  3PD8 A;  2R9J A;  3B6T A;  5M2V A;  4XIG Q;  3K2D A;  2XXT A;  4X1D A;  2W7Y A;  2GHA A;  3CFZ A;  2F78 A;  3DRK A;  4KFQ A;  3D4C A;  5KDT A;  4F2Q A;  3ZKK A;  4DXB A;  3UN6 A;  3LUY A;  3T9X B;  3U92 A;  1H44 A;  2UYF A;  3SES A;  5AA2 B;  2G93 A;  5IAI A;  1L5T A;  4HW8 A;  2BJJ X;  2THI A;  4OEN A;  2VHA A;  1Y3P A;  5FHN A;  1LFG A;  2H4I A;  3K6W A;  2ZYK A;  1PDA A;  3W9W A;  3MVW A;  2F7C A;  4DLD A;  4EDP A;  4ISU A;  1MM6 A;  3GBA A;  3HST A;  2RCB A;  3UOR A;  2FYI A;  4WXJ A;  3VDF A;  4LZ8 A;  3DRG A;  1QUI A;  3ECR A;  4OEV A;  1LLS A;  3O97 A;  3TKD A;  1M5B A;  2XXH A;  3N6T A;  1IUD A;  4EXL A;  3FJG A;  2WKY A;  3SER A;  3QIM A;  1VR5 A;  3RT8 A;  4U22 A;  1MY4 A;  1FTJ A;  2UVH A;  2A5S A;  4F1U A;  3S9N C;  2ZYO A;  2I3W A;  4JSO A;  5B7D A;  2NWJ A;  1M5C A;  1A40 A;  1ZMG A;  2XXV A;  1QKB A;  4F2O A;  2Q9T A;  5L9M A;  4OFJ A;  3LBS A;  4O3B A;  1TT1 A;  3HO7 A;  4G2Z A;  2A5T B;  4LVQ A;  3OEN A;  1B05 A;  1NNP A;  4LON B;  4JWO A;  2DVZ A;  5JEI A;  4ZEK A;  2ZNS A;  3MVX A;  4RPN A;  5I56 B;  3GLB A;  4XTC Q;  3P7I A;  4R9G A;  5H8Q B;  3HN0 A;  2VD2 A;  4DDD A;  2F7B A;  1QUJ A;  1JVX A;  2OZZ A;  5I59 A;  3PPQ A;  1PB9 A;  2DVC A;  1O63 A;  5I57 B;  2XXY A;  2F8D A;  2Z23 A;  5CMM A;  4EF1 A;  4KD5 A;  2RCA A;  4H6D A;  2REG A;  1JQF A;  1N3X A;  4ELP A;  5I2K A;  2DYX A;  2DQV A;  2P1S A;  3CG3 A;  1GR2 A;  3MC2 A;  3SKP A;  4GQO A;  2Q8J A;  4K3F A;  4N6P A;  3C4M A;  4C1T A;  1MDP 1;  4YZZ A;  2XHD A;  3PUW E;  3TZA A;  5DEX B;  4ND9 A;  2XX8 A;  3K6U A;  4F22 A;  2HFB A;  1XS5 A;  1B4Z A;  4NE4 A;  5CRY A;  3IOT A;  1JW5 A;  5I58 B;  4NF5 A;  3WAF A;  1LB9 A;  3IAZ A;  1Y3Q A;  4KQP A;  3QK6 A;  4I62 A;  1PB8 A;  1BLF A;  3TEP A;  3K4U A;  2H9B A;  3CI8 A;  5K2X A;  1PB7 A;  1QVS A;  3T22 A;  5DTB A;  2OWT A;  3CG1 A;  3LVU A;  3ONM A;  1MRP A;  3IX1 A;  1ZLQ A;  3MZB A;  3PPN A;  2PMS A;  4AB5 A;  1SYH A;  3IJX B;  4DXU A;  2PBW A;  3CSG A;  4G8N A;  1H76 A;  2QMW A;  1WDN A;  4BDQ A;  4FAT A;  4QFK A;  3N6U A;  3S4U A;  4G8M A;  3VFJ A;  5TP9 B;  3TYH A;  1ATG A;  2V3Q A;  4OQO A;  3O6P A;  2REJ A;  2DWH A;  3DRH A;  3U72 A;  4YKK A;  1MY2 A;  1IIT A;  4ZDM A;  4R74 A;  2F35 A;  3H06 B;  4XXU A;  1DPE A;  2ESN A;  1IQ7 A;  3G7W A;  1URD A;  3T9U A;  4U4X A;  4IO6 A;  3MBP A;  5DYH A;  1MXU A;  4F31 B;  3TUS A;  1A8E A;  4UA8 A;  4OHN A;  1BIY A;  4FIM A;  1JW4 A;  3ZKL A;  4U21 A;  1JNF A;  4JSD A;  4ZS9 A;  3BBR A;  3TQW A;  4GXS B;  4EXK A;  4P11 A;  2O68 A;  3V89 B;  3OEL A;  3TCH A;  4H5G A;  3FJM A;  4KI0 E;  1P1O A;  3HHG A;  3A3C A;  3O6H A;  3IB1 A;  2O69 A;  5CMK A;  3CVG A;  3OMB A;  3FTO A;  3S9E A;  3K00 A;  2VD3 A;  2RC7 A;  2I49 A;  1LCT A;  4XKR A;  1I6B A;  4JWY A;  4OMB A;  2YJP A;  1EZO A;  1B7Z A;  3MZ1 A;  3S2V A;  1Q35 A;  4QRZ A;  2FNC A;  2UVI A;  3K6V A;  2UYE A;  5H8N A;  1OVB A;  1ZBM A;  1UIV A;  1MG1 A;  1UQW A;  2O6A A;  4F1V A;  3FVN A;  3G3H A;  2NUV A;  5H8H B;  2VGQ A;  2B65 A;  2H5Y A;  1MH4 A;  5IKB A;  2NVU B;  1Z7N E;  2OCU A;  1A99 A;  1BTJ A;  3KBR A;  4F18 A;  3DRJ A;  2DE2 A;  1B51 A;  4R9F A;  3H3G A;  5JTY B;  2OLB A;  4KR5 A;  1IXI A;  3KFM A;  1I6A A;  3KN8 A;  4F3P A;  4G68 B;  1SW4 A;  5L9O A;  2CZL A;  1FTO A;  1LAF E;  4YIC A;  3DRF A;  3MZ9 A;  4DZ1 A;  3T9H B;  4OXV A;  5A5X B;  1TWY A;  3KG2 A;  4F3S A;  3V5A A;  1Y4C A;  1FCK A;  3PV0 E;  3T9V A;  2ONK E;  3RQT A;  4MFI A;  4QSD A;  2QS2 A;  2ONR A;  2X7P A;  3KOT A;  3DP4 A;  4MBP A;  2DE4 A;  1SI1 A;  1Y20 A;  2ZYN A;  4OFL A;  4YMA A;  1AIV A;  5J1D A;  3MJN A;  2Y7P A;  3THI A;  2F34 A;  4OFO A;  3ODB A;  1FW0 A;  1N7X A;  1P1Q A;  3KSJ A;  3UK4 A;  3C9H A;  3RTF B;  3G3G A;  2Y7I A;  4L17 A;  3C36 A;  3L6G A;  3KJT A;  1UTB B;  5ICQ A;  1H3D A;  3HCQ A;  5KCJ A;  5I2N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...