2Z23A

Crystal structure of y.pestis oligo peptide binding protein oppa with tri-lysine ligand
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
517
structure length
517
Chain Sequence
ANVPTGVQLAEKQVLVRNNGSEPQSLDPHKIEGVPESNISRDLLEGLVINDPNGNIVPGAAESWDNKDFKVWTFNIRKDAKWSNGDPVTAQDFVYSWQRLADPKTVSPYASYLQYAHLTNIDDIITGKAAPDTLGVKALDDHTLEVTLSEPVPYLDKLLAHPLMSPVNKTVVEKFGEKWTQPQNFVGNGAYKLKDWIVNERIVLERSPTYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPDQVHVDPYLCTYYYEINNQKAPFTDARVREALKLGMDRDIIVNKVKNQGDLPAYGFTPPYTSGAELTPPEWFSWTQEKRNEVAKKLLAEAGYTKDNPLKFSLLYNTSDLHKKLAIAAASIWKKNLGVDVKLENQEWKTFLDTRHQGTYDVARAAWCADYNEPSSFLNMMLSNSSNNTTHYKSSVFDKLIEDTLKVKSEKERADLYQQAEIQLDKDSAIVPVFYYVSARLVKPYVGGYTGKDPLDNMHVKDLYIIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of OppA and PstS from Yersinia pestis indicate variability of interactions with transmembrane domains.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Peptide binding protein
molecule keywords Periplasmic oligopeptide-binding protein
total genus 173
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2z23A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z23A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 2z23A02
3OEMA 3U92A 1URDA 4DCXA 3T96B 5AA2B 4G68C 1PDAA 2QJEA 3TZAA 2HXWA 3O29A 3K6XA 5B7DA 3Q26A 1B58A 1D3KA 2GH9A 4XKRA 4LZ8A 4BDRA 5AA2D 5BUUA 5ITOA 2OBGA 1ELJA 4G68B 3MZBA 1VFEA 2CMOA 3K0VA 1P1UA 2KLFA 5FHNA 3RN8A 4G8NA 1FQDA 4H1XA 1H45A 1M5CA 4GL8A 5H8HA 2Q9TA 5EYFA 3VLUA 1USYH 3OOAA 4YMBA 3GBBA 1AIVA 4F18A 4HCYA 5TU0A 1H76A 4QFNA 2RINA 3Q28A 4RYAA 4ZDMA 4F1UA 2V3QA 5A5XB 2B3FA 2HAUA 3CR9A 4H67A 5F7VA 3U93A 5IAIA 1MRPA 3TCFA 4GD5A 3A3UA 3IL1B 4R2FA 2QSXA 1ZIUA 3T66A 2Y7KA 3TTRA 4I62A 1S50A 4QFLA 2M8CA 4Q8RA 4OQOA 4U1OA 3RY3A 5I59B 4U4XA 2UVGA 1FTOA 3SESA 5LOMA 1SW1A 2Y84A 4NF4A 5FHMA 2QS2A 2NWJA 1R1NA 2ZYNA 3DP8A 4KHZE 4QF9A 5AA3A 5J1DA 3IAZA 3FXUA 4LQ5A 1N3XA 4FATA 3FXQA 1VE4A 1IUDA 1B5JA 4YB5A 2DP8A 1SBPA 3HHFA 3EF7A 3PPRA 4JBZA 4M4GA 1LAFE 3DM0A 1R9LA 4H8IA 4Q0CA 2VGQA 3N6TA 3UA8A 2DE2A 3PMVA 3GXAA 1N84A 3U94A 3KFMA 1GTKA 2DVZA 2X7QA 1A99A 1VR5A 5HBCA 1IIWA 1N7XA 3K2DA 4F3SA 5IKBA 3PUYE 1RYXA 4RK9A 1IQ7A 5CI5A 5CMBA 5KDTA 1NNTA 4L17A 1B9JA 3S9LC 3MZ9A 4KFQA 4XKPA 2H4IA 3TMGA 1MY4A 4NF6B 4G2ZA 2Z23A 2GFEA 1LSTA 2Q88A 3KZGA 4KCDA 3UK4A 2PMSA 3L6HA 3MZ1A 3UIFA 1XC1A 4PFYA 2BJJX 1OLCA 2O84X 2V3TA 4R6HA 2ALUA 3TUSA 4H6DA 5A5XA 1N76A 2WKYA 5I56A 4IO2A 1DMBA 3TPAA 2B3BA 3H6TA 2CZLA 3EHUA 4LQ2A 3T9VA 1CB6A 3TCGA 2HZKA 4JWYA 4NF5B 3MVWA 1A8EA 4YICA 3S2VA 1LFHA 1II5A 2OK2A 1OVTA 2Z8EA 1UTBA 3N94A 1JQFA 2YPNA 2O6AA 4WXJA 1AOVA 2QMWA 3PD8A 4PE5B 1NH7A 3ZKLA 1MQHA 1MH4A 2OCUA 3OMBA 3V89B 5KCJA 2PBWA 3SETA 4ZZEA 1A55A 3SKPA 3PUXE 3IOTA 4BDLA 3H4ZA 1B7HA 5H8FA 1Y4CA 4GRKA 3I6VA 1UTHA 3EN3A 4RJZA 4PFUA 1B51A 4MH5A 3LSXA 3LVUA 1ANFA 4R74A 2F6GA 3TTNA 1EH3A 4FEBA 5DVIA 2R9JA 4RPNA 1ZTYA 1PC3A 2ZXTA 3PU5A 4QFPA 4YB7A 4F2QA 4HW8A 3VVDA 3FXRA 4MBPA 1MY0A 4OYVA 5KZTA 1PEBA 4H8JA 3TQWA 1I69A 1R6ZA 3UORA 3ZKKA 3O97A 2H9BA 5AA4B 4MFIA 1IZ1A 3USDA 1MM7A 1XHYA 1JW4A 2NOOA 1PBPA 2HAVA 3M3FA 4POXA 2WOPA 5HM4B 1SQYA 2O1LA 1XOCA 1OQGA 3CG1A 4DZ1A 2H99A 5H8SA 5TP9B 5I59A 4OXVA 4PETA 1DPEA 1ATGA 1FTJA 3DLNA 1MXXA 1NMUA 2GHBA 4DXCA 2ANJA 4ZEKA 3RTWB 5DVFA 1GR2A 1B0LA 2XXQA 1B3LA 4KPTA 1KWHA 4MLQA 4O3CA 4EF2A 3O6GA 4F3GA 3TCHA 4OERA 3FTOA 4OFOA 1XT8A 2XXPA 3O6IA 4ONYA 3E3KA 1FTMA 3G3IA 1Y3NA 1LAXA 3N26A 4IY6A 3HSTA 4OEVA 4OFLA 3OEKA 3QYTA 3VDFA 1EZOA 1OLAA 1MQIA 3SEUA 1Q1KA 3OO7A 1Y1MA 5H8FB 4DIGA 2AL5A 5KDTB 2Q2CA 4Z0IA 3O6HA 5DVJA 2REGA 3M8UA 1RYOA 3RLFE 2QS1A 1IXIA 4TOZA 4ZEDA 3V83A 3H3GA 1BTJA 1JVYA 2I0BA 2ZYMA 4NF6A 4U21A 4LVQA 1B7UA 4WKMA 4ZE8A 2DWAA 4ELPA 1FTLA 5AA1A 1ZJLA 3MWBA 3LBSA 1P1WA 5K2YA 2FNCA 1FQBA 2V84A 1ZKBA 3QUFA 4JWXA 1B3FA 2E1SA 3ONMA 3L6GA 3N6UA 1MXVA 3DRIA 3QXMA 3SEWA 1SW2A 3B6TA 2XXVA 3TELA 3KN3A 3U1OA 1YTVA 3H6VA 1P1QA 1T0KA 1TT1A 2QMXA 4FE8A 4JXIA 2NUVA 4P0IA 3QUJA 4Q5TA 3RT8A 1IXGA 2XD3A 5DTBA 4OTEA 2XXIA 3C4MA 1BIYA 2F5XA 2VP1A 5FHOA 4F2OA 3ECRA 3IX1A 3O6PA 2I6EA 2F7AA 1J1NA 3GLBA 4ZE9A 4JDFA 1A8FA 2A5TA 5I58A 3C31A 2RCBA 3PUWE 5L9MA 5CMKA 2A5SA 3PAMA 1QJMA 1AMFA 1VFDA 2O7UA 3BKIB 3C35A 1QVSA 3LSLA 4IO7A 1L5TA 3W15C 3QSLA 1Y3QA 3CI8A 3KSJA 4U22A 1I6BA 3T9XB 4ZS9A 1NH8A 3G7WA 1MM6A 3O28A 4N07A 2ZYOA 1MPCA 3MQ9A 3W9WA 5B70A 2O7IA 3QAXA 1R9QA 1AH5A 1ZBMA 4PQJA 4TLMB 3SEYA 5H8NB 1JNFA 1LBCA 2ZNTA 3FASA 3PGFA 1I6AA 2ZNUA 3OO8A 4HCWA 3TTMA 4JSDA 3H03A 3FJ7A 1CE2A 1TXFA 3G3KA 5EHMA 4MLVA 3K6VA 1LFGA 3MVZA 3M3KA 1SI0A 3KEIA 1A7LA 1MXYA 4GVOA 1YCJA 2R71A 5H8QB 4F31B 4ZZAA 4POWA 2DE4A 4ZEFA 3FD3A 5I57B 3TODA 4BDMA 2H25A 1OMPA 4OESA 1P1NA 3EHSA 2O68A 4OMBA 1PB9A 2F7CA 2Y7WA 4OFJA 4RK2A 1PB7A 3SEXA 1WDNA 4G77A 2VD3A 3VXBA 1M5FA 1SW5A 2QRYA 5ITPA 1B2HA 1IXHA 4Z7EA 2UYEA 4GIZA 4NF8B 2WOLA 4LA9A 1F9BA 1URSA 2YLNA 3K01A 1OVBA 3LSFB 4KI0E 4KYEA 3MC2A 1S9TA 3Q29A 4XTCQ 5I56B 3MVYA 5I84A 3OXNA 4GF8A 4R9GA 4ESWA 1ZMGA 2F7BA 1B1XA 3DELB 3T9UA 3ZSFA 5F1QA 1DTGA 2I3WA 3T9HB 1JEUA 4M1VA 2OZZA 3CVGA 2DS9A 3SERA 3U72A 3RT6B 1FQEA 1P1OA 2ONKE 2E0SA 2ZNSA 5JEIA 1LCTA 1HSJA 1UQWA 1MXUA 1OIBA 1BLFA 3MAMA 4IB2A 1HSEA 1B05A 5I2KB 1EZPA 2D21A 2UVJA 4Q30B 3PV0E 3K6WA 1BP5A 1GVCA 4EQ7A 5I2NB 4QFKA 4IGTA 2PYYA 4IO5A 4OVJA 5M2VA 2ESNA 4F39A 1JW5A 1QW0A 2F34A 3IOWA 1WODA 1QUKA 2P1SA 3K1PA 4E0WA 3ILTB 3JYRA 3O9PA 3PPOA 1S7YA 2RCAA 4OWDA 4X48A 4YB6A 5JK4A 1O64A 2RC7A 3IOUA 1M5EA 4AQ4A 5AA4A 3WAEA 4U4SA 4LUBA 1A54A 3IJXB 3N5LA 3MBPA 4R6YA 3TKDA 2IA4A 1MY2A 1NFTA 5AE4A 4EQ9A 4XXUA 4H5GA 4PP0A 3T93B 5JTYA 2G29A 4IY5A 1SYHA 3RPWA 5CC2A 5KCJB 5DEXB 1M5DA 1D4NA 3FVOA 3R26A 1B52A 2I4CA 4JWOA 4TLLB 5FTIA 2LAOA 4UACA 4C1UA 4F3BA 4XIGQ 3MW0A 3P7IA 1D9VA 1MG1A 3FATA 2XX9A 1LCFA 1N3WA 4PFWA 2THIA 2PX1A 3IOVA 3MJNA 1MY3A 3R7XA 3H06B 3Q25A 4ELRA 4ESXA 4O3BA 2AL4A 2XX7A 2XXUA 1LB8A 3IR1A 2I3VA 3THIA 3HCQA 2OWSA 4RNSA 5CM6A 1M5BA 3HV1A 4O3AA 3OO9A 2XD2A 3KGCA 3FJMA 4RPOA 4H65A 4P0GA 2DXYA 2X7PA 4DLDA 1BKAA 2DSFA 3PPQA 1Z7NE 3DRFA 4I9DA 1DPPA 2RF1A 4LATA 1NL5A 3MP8A 3OELA 5ICQA 1TFDA 3RNNA 2Y7IA 2XHDA 3KJ7A 1ZU0A 3VXCA 3S4UA 1URGA 4F19A 3VLVA 3CHGA 1MPBA 5HPQA 1SD3A 4RY1A 4NF5A 2ONRA 1FQCA 2FYIA 3E4RA 4F22A 1B46A 2Z8FA 4P11A 4RA1A 1PB8A 4ISUA 2Q2AA 5FTHA 2O1MA 3ODBA 1MQDA 3SDFA 5L9SA 3M3LA 1YPNA 1B5IA 4ZEBA 3RQTA 3C33A 3A3CA 2XXWA 4QFOA 3MPKA 4MF3A 4N6PA 3FVGA 1GV8A 2Q8JA 3RGYA 1LGBC 1Q35A 2WOKA 3LC8A 4LZ5A 1US4A 3TEPA 2A5TB 5I58B 4QSEA 1UTHB 2RC8A 4ZEIA 4U1ZA 1B1HA 1N04A 3PMWA 2H5YA 2DWJA 4AB6A 4EDPA 5I2NA 4YKJA 3AXFA 3IO6A 3LSWA 1JEVA 3R6UA 3RTFB 3UP9A 4BDQA 1QULA 1B3GA 2D5WA 4PFTA 4KQPA 3DP6A 4OETA 2OLBA 3FGSA 4YU0A 3FVKA 1SYIA 3OSRA 5ISUA 4X1BA 4U2RA 1SW4A 3I5OA 4XKNA 3C34A 3FJGA 3DP4A 4EQBA 2OWTA 3C9HA 3TTKA 5H8NA 5CBRA 1TWYA 3I3VA 1B3HA 2R6GE 1JETA 2V93A 1VSOA 2IEEA 2O69A 1B5HA 4IO3A 3TQLA 1POTA 4YMAA 1ZLQA 4GWOA 1FQFA 3CFZA 4FJPA 3FUZA 3FZVA 4H5FA 1MH3A 4LP2B 4NWCA 4QHQA 3UGWA 4DDDA 3KN8A 4YKKA 2VOZA 4X9TA 5H8QA 4F1YA 3FV2A 1MPDA 1Y9UA 4JSOA 2G93A 4U23A 2DOJA 3K4UA 1NNFA 1UTBB 3K1MA 3VV5A 4BLAA 2UXAA 1O63A 4IO4A 1B4HA 3BFTA 4ZECA 1I6QA 3JZJA 4C0RA 4ELQA 3WAFA 4NMYA 2XXRA 3G3GA 5AA2A 1OQHA 3CFXA 1IITA 2HQ0A 3A09A 3TTLA 3V8XB 2H98A 4G68A 2QS3A 4YAHX 1SDXA 3KJTA 5EHSA 3QK6A 4QRZA 4HS7A 4YKPA 1QUJA 1LBBA 1Y3PA 1B40A 2VD2A 3DRJA 1LB9A 2W7YA 3C32A 3K00A 3LUYA 3MP6A 4KYSA 3IB1A 4THIA 2I58A 4JB7A 5K2XA 2HFBA 2RKMA 2F36A 3KOTA 1TFAA 2UYFA 4KR5A 3KG2A 3MUQA 1O7TA 4TQUQ 1RKMA 1MDQA 2I49A 3K1NA 2DXRA 2F8DA 4EUOA 2XX8A 4ELOA 1LLSA 3B6WA 2AYSA 1AL3A 3ILUB 3H7MA 3O66A 1FQAA 2UVIA 4R2BA 1QKAA 4GXSB 3G3HA 4EXKA 1H44A 2DQVA 2HZLA 4GOTA 4WEPA 4BDNA 4DXBA 3CSGA 3ZS6A 2FA7A 5I57A 3O2AA 4IO6A 1B0HA 4QSDA 5CMCA 5BWJA 5TPAA 4DCYA 1FCKA 3CG3A 3E13X 3OD7A 3S9MC 1B6HA 3D4GA 3G3FA 1QUIA 1B7ZA 2DVCA 1SVXB 4YKIA 3KBRA 3TYHA 4QSCA 1B4ZA 1MS7A 1MXWA 3D4CA 4GQOA 4UA8A 4OEUA 2B65A 2PVUA 4GLIA 5CMMA 4OHNA 1MDP1 3CFLA 4YZZA 3C36A 5JTYB 3T22A 5DEXA 3LR1A 4BDOA 3S9EA 4ND9A 1NNPA 3PPNA 1H43A 3IK6B 4XKQA 2Y7RA 3B7DA 3HO7A 4H0WA 3IORA 4GL0A 1LAGE 1SI1A 2QPQA 4LONB 4K3FA 1PBQA 2X26A 2GRVA 3HPIA 3PMXA 2XXYA 4GXAA 4EXLA 4I8CA 1MQGA 4NEDA 1Y20A 2XXXA 3H6WA 2F97A 3OSQA 4AB5A 1YAEA 3QIMA 3OO6A 2NVUB 3H6UA 2I0CA 1Y1ZA 2I4BA 3OENA 4G4PA 4DXUA 1MXZA 3SEVA 1FW0A 1LAHE 1USYE 2ABHA 3K6UA 4KD5A 2YJPA 4FIMA 5DT6A 1EZ9A 5L9OA 2XXTA 1N7WA 2UVHA 2HCAA 3PUVE 4F3PA 4F1VA 2V25A 3HN0A 2PT1A 2I48A 3IB0A 4NF8A 3PD9A 2Z22A 4R73A 5ICTA 3BFUA 1XVXA 4NTLA 4FAJA 2NXOA 4C1TA 2PT2A 3RYBA 5CRYA 1JVXA 3F11A 3FVNA 3CSBA 1QKBA 4FEDA 4GFRA 2F6PA 3FV1A 3GBAA 4FORA 2B4MA 3IJOB 2P2AA 4KCCA 3PUZE 4LZ7A 2F78A 2HEUA 2VHAA 3DRKA 1FTKA 3KSXA 4HTGA 3RYAA 3K02A 4NF4B 3MP1A 3VE1B 3Q27A 4OZ9A 3CRBA 2B4LA 4FECA 3VFJA 3V5AA 4F29A 1HSLA 1XS5A 3PPPA 3VVEA 1B3EA 1POY1 4OENA 1XVYA 5L8DA 3IO4A 5ELVA 4G8MA 4G8HA 1NNKA 3KOSA 4R6KA 3MVXA 2QS4A 5TP9A 1GGGA 2DWIA 2V3UA 5I2KA 2ONSA 1P99A 1H3DA 1DOTA 3EPEA 1D9YA 1LFIA 3U8QA 3DRGA 1B32A 3EQ1A 5H8HB 1WVJA 4NE4A 3W9VA 1US5A 2AIXA 3G3JA 2Z8DA 3KN7A 4R9FA 3IB2A 1EU8A 3TDJA 5TPAB 3DRHA 1JW1A 4EF1A 2RC9A 4ECFA 3TFLA 3BBRA 3RUMA 2DWHA 2GHAA 2O51A 2ZYKA 3FIRA 4NWDA 3VLWA 1UIUA 2QL3A 3EHTA 4KYDA 2XXHA 2ZMBA 1Z7ME 4RXLA 3B6QA 2DYXA 3JV9A 3UN6A 2OJTA 1A40A 4R75A 3VVFA 5CBSA 3GZGA 1UIVA 1MY1A 2REJA 2D3IA 1NKXA 2P0SA 4R72A 1DSNA 1IXCA 1IEJA 2Q89A 3MPLA 3E9XA 3HHGA 4X1DA 5DYHA 1N0TA 3S9NC 1Y4TA 2DE3A 3CIJA 4N13A 3TAJA 4WEDA 4I1DA 1MQJA 4DE8A 1DTZA 4E0XA 2Y7PA 4IGRA 2F35A
chains in the Genus database with same CATH superfamily
4PF8A 4BDRA 2GH9A 4N81A 4G68B 1VFEA 4GL8A 2Q9TA 2JJKA 4O7IA 4HCYA 4QFNA 2RINA 5I5PA 2B3FA 5F7VA 4H67A 4R2FA 3IL1B 2QSXA 4Q8RA 4OQOA 4NF4A 5FHMA 2NWJA 3DP8A 4FATA 1VE4A 1IUDA 3SESA 3HHFA 1R9LA 1N84A 1NV5A 3BIHA 3PUYE 1RYXA 5KDTA 4KFQA 2Z23A 2Q88A 2PMSA 1OLCA 5EQ8A 2ALUA 3TUSA 2WKYA 2HZKA 2L5VA 3MVWA 1A8EA 4JVIA 2QVUA 2OK2A 2VPNA 1EYJA 1RDXA 1MH4A 2OCUA 3OMBA 2PBWA 3SETA 1B7HA 1UTHA 4R74A 2F6GA 1EH3A 4FEBA 4RPNA 4HW8A 4MNCA 4F2QA 4NX1A 3TQWA 3UORA 2H9BA 1IZ1A 3USDA 1XHYA 1PBPA 2PFYA 1SQYA 5H8SA 4OXVA 1FTJA 3DLNA 1MXXA 1NMUA 5DVFA 1GR2A 1B3LA 2Y5KA 4EF2A 3FTOA 1QGXA 1LAXA 1LEVA 3OEKA 4OEVA 1EZOA 2OX3A 4OVTA 4Z0IA 2REGA 3M8UA 1FJ6A 2DWAA 5AA1A 1P1WA 5K2YA 4JWXA 1B3FA 3L6GA 3DRIA 1TT1A 2QMXA 2NUVA 2XXIA 4PF6A 2VP1A 4P1LA 4F31B 4OVPA 4EXKA 4JDFA 1J1NA 5I58A 1VFDA 1QVSA 1Y3QA 3KBZA 2O7IA 1AH5A 4PQJA 3SEYA 1JNFA 1LBCA 3FASA 5EQ9A 3H03A 3FJ7A 1CE2A 3G3KA 3T0JA 5H8QB 1YCJA 3FD3A 4BDMA 5FBPA 4OMBA 1WDNA 2BJIA 1B2HA 2WOLA 1YZ0A 1URSA 3LSFB 4KI0E 4O94A 4XTCQ 5I56B 1LBWA 3T9HB 3SERA 1FBEA 1UQWA 3MAMA 2WYKA 1HSEA 1FPDA 2D21A 1GVCA 3PV0E 3K6WA 4IGTA 4F39A 4E0WA 1QUKA 2RCAA 4OWDA 4X48A 4YB6A 2OWZA 4AQ4A 5AA4A 3IJXB 3TKDA 4H5GA 5JTYA 1SYHA 1FRPA 1M5DA 4AS4A 5FTIA 4C1UA 4F3BA 1CNQA 1IMBA 4UACA 4XIGQ 3MW0A 1MG1A 1VDWA 2XX9A 4FBPA 4PFWA 2PX1A 1MY3A 4ELRA 4ESXA 2AL4A 2XXUA 1LB8A 2QVVA 4RNSA 3FJMA 1NUZA 4P0GA 4GWZA 2X7PA 4DLDA 2RF1A 1DPPA 1TFDA 3RNNA 1URGA 3CHGA 1FQCA 3E4RA 4F22A 1NV2A 2Z8FA 1PB8A 2Q2AA 3U65A 3ODBA 5I3SA 3M3LA 4P3LA 4RK9A 3RQTA 4MF3A 1Q35A 3LC8A 4NGUA 1B1HA 3IO6A 4BDQA 3DP6A 4YU0A 1SYIA 3OSRA 4U2RA 4XKNA 2OWTA 3C9HA 1JETA 2IEEA 2O69A 4FJPA 3FUZA 3FV2A 1Y9UA 4BLAA 3VV5A 1O63A 4IO4A 3JZJA 4C0RA 4ELQA 5AA2A 3CFXA 4NQ8A 3V8XB 4MX6A 1SPIA 5EHSA 4HS7A 1QUJA 4OVSA 1LB9A 3A29A 4THIA 3IB1A 4JB7A 4KR5A 2HXRA 5IZ3B 1MDQA 2I49A 2F8DA 4ELOA 1FQAA 4GXSB 1B0HA 5J16A 4GX3A 4DCYA 3E13X 3D4GA 4N6KA 2DVCA 1SVXB 3KBRA 1MS7A 2B65A 4GLIA 5ET7A 2F3DA 3S9EA 3PPNA 3HO7A 3B7DA 3IORA 2QPQA 4LONB 1PBQA 4QXDA 1Y20A 2XXXA 3H6WA 2I4BA 3OENA 4DXUA 1MXZA 3SEVA 1USYE 2ABHA 1EZ9A 2XXTA 4MAGA 2UVHA 2HCAA 4R73A 5ICTA 4FAJA 4DI4B 3RYBA 1JVXA 4KCCA 3FV1A 2F78A 2WEFA 3K02A 4OZ9A 3CRBA 2B4LA 1JP4A 1XS5A 4G8MA 4G8HA 5TP9A 2DWIA 1DOTA 4GWXA 4NE4A 3W9VA 2Z8DA 5TPAB 2RC9A 3TFLA 3RUMA 2DWHA 2O51A 3FIRA 3EHTA 4KYDA 2XXHA 2ZMBA 3UN6A 2WYPA 4R72A 1DSNA 1IEJA 2Q89A 3MPLA 3HHGA 2F3BA 4PTKA 1DTZA 4IGRA 3T93B 2ZZVA 3OEMA 4DCXA 4G68C 1PDAA 2HXWA 5B7DA 3K6XA 3Q26A 5AA2D 2PFZA 1ELJA 1P1UA 2WX9A 4H1XA 5H8HA 1USYH 3GBBA 1AIVA 5TU0A 3RPLA 4P1EA 4RYAA 3U93A 3TCFA 4GD5A 3RY3A 3LUZA 2UVGA 2ZYNA 4QF9A 5AA3A 3IAZA 1N3XA 4YB5A 2DP8A 3PPRA 1LAFE 4Q0CA 3PMVA 1GTKA 2DVZA 2X7QA 1VR5A 1N7XA 5CI5A 1IQ7A 5CMBA 4L17A 1B9JA 3S9LC 3MZ9A 1MY4A 2GFEA 2HHMA 3UIFA 2BJJX 4PFYA 2FVZA 5A5XA 3T9VA 2CZLA 2XA5A 3TCGA 4PGNA 3N94A 2YPNA 1AOVA 2QMWA 3PD8A 3V89B 3H4ZA 5H8FA 3EN3A 4PFUA 1B51A 5DVIA 4YB7A 3PU5A 4QFPA 3VVDA 3FXRA 1MY0A 3ZKKA 1AWBA 1JW4A 2NOOA 2HAVA 2O1LA 1XOCA 1Q9DA 4GWSA 3T1BA 2ANJA 4PDDA 4ZEKA 1KWHA 4MLQA 4O3CA 3O6GA 3ROJA 4OFOA 3O6IA 3G3IA 4MH5A 4OFLA 1OLAA 3OO7A 2AL5A 5KDTB 3O6HA 1NV0A 4ZEDA 1JVYA 4U21A 1BK4A 4LVQA 4WKMA 5DW8A 1FQBA 1ZKBA 3N6UA 1MXVA 4HXVA 3SEWA 1SW2A 3H6VA 1T0KA 4FE8A 4P0IA 3RT8A 2XD3A 2F7AA 1A8FA 4XEQA 3PUWE 1FPJA 2WBBA 5L9MA 5CMKA 2A5SA 4N8GA 1QJMA 1AMFA 1L5TA 3LSLA 3C35A 3CI8A 4U22A 4ZS9A 5I7IA 3W9WA 4NN3A 3OO8A 4G61A 4JSDA 1TXFA 3MVZA 3KEIA 4ZZAA 1FPLA 4ZEFA 4PAKA 2H25A 1P1NA 1PB9A 3SEXA 1SW5A 4Z7EA 2R8TA 4PBHA 1F9BA 3K01A 2VPOA 3MVYA 4GF8A 4GX4A 3DELB 3T9UA 3ZSFA 4I3YA 4M1VA 2OZZA 3RT6B 1P1OA 2ZNSA 5JEIA 1MXUA 1BLFA 1B05A 4QFKA 1NV1A 5F24A 1JW5A 1WODA 3ILTB 1S7YA 4OA4A 1O64A 2RC7A 3LV0A 4U4SA 2XWKA 1RDYA 4EQ9A 5DEXB 3FVOA 4JWOA 1YXIA 1D9VA 3THIA 2FHYA 3PTYA 1M5BA 3HV1A 1NL5A 5ICQA 2Y7IA 2XHDA 3KJ7A 4F19A 1SD3A 2FYIA 4P11A 3MYUA 1MQDA 3SDFA 4ZEBA 4DI3D 3C33A 3A3CA 2Q8JA 5KCJB 3RGYA 4LZ5A 3TEPA 5I58B 4QSEA 4ZEIA 1N04A 4EDPA 3AXFA 3UP9A 4PFTA 2PCRA 3FGSA 2FIEA 2HPGA 2XXKA 1SW4A 1FBFA 4I3EA 2V93A 3RYDA 1ZLQA 4GWOA 1FQFA 3CFZA 4QHQA 3FZVA 4DDDA 4YKKA 3GYYA 4X9TA 5H8QA 4F1YA 1MPDA 4JSOA 2DOJA 3K4UA 1NNFA 1B4HA 4P9KA 2HQ0A 3KC0A 3HFUA 2P3NA 2H98A 3KJTA 1KA1A 1Y3PA 1B40A 4KYSA 3DRJA 3K00A 3LUYA 5K2XA 2RKMA 3KOTA 2UYFA 3KG2A 1FPBA 1O7TA 2DXRA 1XI6A 2AYSA 1AL3A 3O66A 4MIJA 1QKAA 4KXPA 4BDNA 2HZLA 4NHBA 2FA7A 4IO6A 5CMCA 1FBDA 1FCKA 3OD7A 3S9MC 1QUIA 4YKIA 4DZ1A 4OHNA 1MDP1 4NF0A 5JTYB 3C36A 3LR1A 4XKQA 3MSTA 4H0WA 2KQZA 1LAGE 2X26A 3PMXA 4GXAA 4I8CA 4MHFA 3QIMA 2I0CA 1Y1ZA 1KA0A 1LAHE 4KD5A 5L9OA 2CZKA 1FBPA 1N7WA 3PUVE 4F3PA 1DBZA 2PT1A 4NF8A 3BFUA 4C1TA 2NXOA 5CRYA 3F11A 3CSBA 3ISPA 4FEDA 4GFRA 4FORA 2VHAA 3DRKA 3Q27A 3VFJA 3VVEA 1B3EA 1POY1 1XVYA 5L8DA 2QS4A 1NI9A 1GGGA 5I2KA 1P99A 3U8QA 4R9FA 3G3JA 4N6DA 4EF1A 1NV7A 4O7MA 4NWDA 1UIUA 1Z7ME 3B6QA 2DYXA 3JV9A 1A40A 4R75A 1IMCA 3GZGA 1MY1A 1IXCA 3E9XA 4X1DA 1N0TA 1IMAA 4N13A 1G0IA 5ET6A 4DE8A 2F35A 3U92A 1URDA 5AA2B 2QJEA 4PFRA 3O29A 1D3KA 4XKRA 5BUUA 5ITOA 3MZBA 2CMOA 3K0VA 2KLFA 5FHNA 1FQDA 1H45A 1M5CA 4YMBA 1H76A 4F1UA 2V3QA 2HAUA 5IAIA 1ZIUA 4I62A 2M8CA 5I59B 4U4XA 1FTOA 5LOMA 3E79A 2QS2A 4XF5A 1IMDA 5J1DA 3FXUA 4LQ5A 1B5JA 4OVQA 4H8IA 2VGQA 5HBCA 1A99A 1IIWA 5IKBA 1RDZA 1NNTA 4XKPA 2H4IA 3TMGA 4NF6B 4G2ZA 4KCDA 1LSTA 3UK4A 2V3TA 1N76A 3TPAA 2B3BA 3H6TA 4LQ2A 3V83A 1FPKA 3S2VA 1LFHA 1II5A 1OVTA 1UTBA 1JQFA 2O6AA 4WXJA 4GWUA 4PE5B 4GX6A 5KCJA 4ZZEA 3PUXE 4BDLA 1Y4CA 4GRKA 3LVUA 1ANFA 2MKZA 3TTNA 1DCUA 2ZZWA 1PC3A 4H8JA 1I69A 3O97A 1MM7A 5HM4B 3CG1A 4N17A 5TP9B 4PETA 1ATGA 4DXCA 2XXQA 4IR8A 4F3GA 3TCHA 4OERA 1XT8A 3E3KA 1FTMA 3N26A 1Y3NA 4IY6A 3VDFA 1MQIA 1Q1KA 1Y1MA 4DIGA 1RYOA 3RLFE 1IXIA 4TOZA 2ZYMA 1B7UA 5LDZA 1ZJLA 1D9QA 3LBSA 4PFIA 2E1SA 3ONMA 4N15A 3U1OA 3B6TA 3KN3A 1YTVA 1P1QA 4PAIA 4JXIA 3E78A 1YYZA 4OTEA 3C4MA 1BIYA 2F5XA 5FHOA 4F2OA 4N4UA 3O6PA 2I6EA 3GLBA 4ZE9A 3RPLB 4GBWA 2A5TA 3C31A 2RCBA 1LBVA 2XWIA 3PAMA 2O7UA 4IO7A 3KSJA 4PE3A 3G7WA 2ZYOA 1ZBMA 4TLMB 5H8NB 3PGFA 1I6AA 4HCWA 3TTMA 3FBPA 5EHMA 4MLVA 3M3KA 1MXYA 2DE4A 1OMPA 2F7CA 2Y7WA 4RK2A 1PB7A 4G77A 2VD3A 2QRYA 2UYEA 4NF8B 5HPQA 1OVBA 1S9TA 3Q29A 2FIXA 4R9GA 1B1XA 1DTGA 2I3WA 1JEUA 3CVGA 5EQ7A 2DS9A 1FQEA 1LCTA 4IB2A 4H45A 5I2KB 1EZPA 2UVJA 4EQ7A 5IZ1A 3IFCA 5I2NB 5M2VA 1NV4A 3PPOA 3JYRA 3O9PA 3IOUA 4JVDA 3WAEA 2IA4A 1NFTA 4XXUA 2G29A 2I4CA 3P7IA 3IOVA 1LCFA 1N3WA 3R7XA 1FBHA 4PAFA 3H06B 4O3BA 3HCQA 2WBDA 4O3AA 4H65A 2DXYA 2DSFA 1G0HA 3PPQA 4LATA 4I9DA 3B50A 4UABA 3OELA 3VXCA 3KC1A 3VLVA 1MPBA 1NUYA 4NF5A 2ONRA 1B46A 4GWWA 4RA1A 5FTHA 2O1MA 2XXWA 1GV8A 3TELA 2CZHA 4U1ZA 2H5YA 4YKJA 5A5LA 3R6UA 3LSWA 5IM2A 1JEVA 3RTFB 4KQPA 4OETA 1NUWA 3FVKA 4O8MA 5ISUA 4PFBA 4N8YA 3FJGA 3C34A 3TTKA 3I3VA 2R6GE 1VSOA 3TQLA 4H5FA 4NWCA 3KN8A 2VOZA 4U23A 1UTBB 4ZECA 1I6QA 3WAFA 2XXRA 3A09A 1IMEA 4G68A 2QS3A 4YAHX 4YKPA 4PCDA 1LBBA 2VD2A 2W7YA 2QFLA 4PDHA 2F36A 3MUQA 3K1NA 2XX8A 1LLSA 1K9ZA 2UVIA 3G3HA 1H44A 4GOTA 4WEPA 4DXBA 1EYKA 5BWJA 3EKIA 1B6HA 3BIGA 2GQ1A 1MXWA 3D4CA 4GQOA 5IGAA 2PVUA 5CMMA 3CFLA 4YZZA 5DEXA 3FXBA 4XFEA 1NNPA 1H43A 3IK6B 2Y7RA 1LBYA 4GL0A 1SI1A 4JVCA 3HPIA 1MQGA 4NEDA 2XWOA 4QBAA 1YAEA 3OO6A 2NVUB 3B8BA 1FPFA 4G4PA 1FW0A 2YJPA 4FIMA 4PBQA 2V25A 3HN0A 2Z22A 5LTCA 1XVXA 2PT2A 3IFAA 3FVNA 3GBAA 2F6PA 2B4MA 3IJOB 2P2AA 3PUZE 2HEUA 1FTKA 4HTGA 4NF4B 3MP1A 4FECA 2DDKA 4F29A 4OENA 3IO4A 4R6KA 1NNKA 4N91A 1H3DA 3DRGA 5H8HB 3EQ1A 1WVJA 1US5A 1EU8A 3TDJA 4NG7A 3DRHA 4ECFA 2ZYKA 2QL3A 4RXLA 2OJTA 3VVFA 1UIVA 2P0SA 5DYHA 4I40A 3S9NC 1Y4TA 5ET8A 3TAJA 4I1DA 4E0XA 3T96B 3TZAA 1B58A 4LZ8A 1K9YA 2OBGA 3RN8A 4G8NA 5EYFA 3VLUA 3OOAA 4F18A 2XWVA 2V4CA 3Q28A 4ZDMA 5A5XB 3CR9A 1FBGA 1MRPA 3A3UA 3T66A 2Y7KA 3TTRA 1S50A 4QFLA 4U1OA 4H46A 1SW1A 2Y84A 5T3JA 1R1NA 4KHZE 3FXQA 5I57A 1SBPA 3EF7A 4JBZA 4M4GA 3DM0A 3N6TA 3UA8A 2DE2A 3GXAA 3U94A 3KFMA 4P47A 4PGPA 4F3SA 3K2DA 4GBVA 4MNPA 3KZGA 4NAPA 3L6HA 3MZ1A 1XC1A 2O84X 4R6HA 4H6DA 5I56A 4IO2A 1DMBA 3EHUA 1CB6A 4JWYA 4NF5B 4YICA 2Z8EA 1NH7A 3ZKLA 1MQHA 2Q74A 3SKPA 1A55A 3IOTA 3I6VA 4RJZA 3LSXA 5IZZA 2R9JA 1ZTYA 2ZXTA 4X8RA 1FBCA 4MBPA 4OYVA 5KZTA 1PEBA 1R6ZA 1FJ9A 5AA4B 4MFIA 3M3FA 4POXA 2WOPA 1OQGA 2H99A 5I59A 1DPEA 2GHBA 2CEYA 3RTWB 1B0LA 4KPTA 2XXPA 4ONYA 3HSTA 3QYTA 3SEUA 5H8FB 4HE1A 2Q2CA 5DVJA 4X04A 4AS5A 2QS1A 3H3GA 1BTJA 4NF6A 2I0BA 1INPA 4ZE8A 4ELPA 1FTLA 3MWBA 2FNCA 2V84A 3QUFA 3QXMA 2XXVA 1NUXA 3QUJA 4Q5TA 1IXGA 5DTBA 2P3VA 4MMPA 3ECRA 3IX1A 3SZPA 1IMFA 2FBPA 3BKIB 3W15C 3QSLA 1EYIA 1I6BA 3T9XB 1NH8A 1MM6A 3O28A 4N07A 1MPCA 3MQ9A 5B70A 4GWYA 3QAXA 1R9QA 2ZNTA 2Y5LA 2ZNUA 2CZIA 3K6VA 1LFGA 1SI0A 1A7LA 4GVOA 2R71A 4POWA 3TODA 4OESA 3EHSA 4MCOA 2O68A 4OFJA 3VXBA 1M5FA 5ITPA 1IXHA 5EQAA 4GIZA 4LA9A 2YLNA 4KYEA 3MC2A 5I84A 3OXNA 4ESWA 1ZMGA 2F7BA 5F1QA 3U72A 2ONKE 5IZ3A 2E0SA 1HSJA 1OIBA 4Q30B 1BP5A 4OVRA 2PYYA 4IO5A 4OVJA 2ESNA 1QW0A 3IOWA 2F34A 1LBZA 2P1SA 3K1PA 5ESYA 5JK4A 1FPIA 5ET5A 1M5EA 4LUBA 1A54A 3N5LA 4R6YA 3MBPA 1MY2A 4LN5A 5AE4A 4PP0A 4IY5A 3RPWA 5CC2A 1D4NA 3R26A 1B52A 4TLLB 2LAOA 4P8BA 3FATA 1DK4A 3MJNA 2THIA 3Q25A 5EYGA 2XX7A 3IR1A 3QMFA 2I3VA 2OWSA 5CM6A 3OO9A 2XD2A 3KGCA 4RPOA 1BKAA 1Z7NE 3DRFA 3MP8A 1ZU0A 3S4UA 3D1RA 4RY1A 4ISUA 5L9SA 1YPNA 1B5IA 3MPKA 4QFOA 4N6PA 3FVGA 1LGBC 2WOKA 1US4A 3NOHA 2A5TB 1UTHB 2RC8A 1FSAA 5I57B 3PMWA 4AB6A 2DWJA 5I2NA 4OANA 1QULA 2ZZXA 1B3GA 2D5WA 2OLBA 2Q8MA 4X1BA 4EQBA 3I5OA 3DP4A 5H8NA 5CBRA 1TWYA 1B3HA 1B5HA 4IO3A 1POTA 4YMAA 1LBXA 4LP2B 1MH3A 3UGWA 1KZ8A 4PC9A 2G93A 3K1MA 5EYHA 2UXAA 1NV3A 3BFTA 4HE0A 4NMYA 3G3GA 1OQHA 1IITA 1FPEA 3TTLA 2CEXA 1SDXA 3QK6A 4QRZA 4MNIA 3C32A 3MP6A 2I58A 2HFBA 1TFAA 4TQUQ 1RKMA 4EUOA 3B6WA 3ILUB 3H7MA 4R2BA 2DQVA 3CSGA 3ZS6A 3O2AA 4QSDA 4HE2A 5TPAA 3CG3A 3G3FA 1B7ZA 3TYHA 4QSCA 1B4ZA 4UA8A 4OEUA 3T22A 4BDOA 4ND9A 2KR0A 4K3FA 4EXLA 2GRVA 2XXYA 4AB5A 2F97A 3OSQA 4MEVA 3H6UA 5DT6A 3K6UA 4F1VA 3IB0A 2I48A 3PD9A 4NTLA 1FPGA 1QKBA 4LZ7A 3KSXA 3RYAA 3VE1B 3V5AA 1HSLA 3PPPA 5ELVA 3KOSA 3MVXA 2V3UA 2ONSA 3EPEA 1D9YA 1LFIA 1B32A 4MJOA 2AIXA 3KN7A 3IB2A 1FTAA 1JW1A 4P56A 3BBRA 2GHAA 3VLWA 5CBSA 2REJA 2D3IA 1NKXA 1NV6A 2QVRA 2DE3A 2VT5A 3CIJA 4WEDA 1MQJA 2Y7PA
chains in the Genus database with same CATH topology
3OEMA 3U92A 1URDA 4DCXA 3T96B 5AA2B 4G68C 1PDAA 2QJEA 3TZAA 2HXWA 3O29A 3K6XA 5B7DA 3Q26A 1B58A 1D3KA 2GH9A 4XKRA 4LZ8A 4BDRA 5AA2D 5BUUA 5ITOA 2OBGA 1ELJA 4G68B 3MZBA 1VFEA 2CMOA 3K0VA 1P1UA 2KLFA 5FHNA 3RN8A 4G8NA 1FQDA 4H1XA 1H45A 1M5CA 4GL8A 5H8HA 2Q9TA 5EYFA 3VLUA 1USYH 3OOAA 4YMBA 3GBBA 1AIVA 4F18A 4HCYA 5TU0A 1H76A 4QFNA 2RINA 3Q28A 4RYAA 4ZDMA 4F1UA 2V3QA 5A5XB 2B3FA 2HAUA 3CR9A 4H67A 5F7VA 3U93A 5IAIA 1MRPA 3TCFA 4GD5A 3A3UA 3IL1B 4R2FA 2QSXA 1ZIUA 3T66A 2Y7KA 3TTRA 4I62A 1S50A 4QFLA 2M8CA 4Q8RA 4OQOA 4U1OA 3RY3A 5I59B 4U4XA 2UVGA 1FTOA 3SESA 5LOMA 1SW1A 2Y84A 4NF4A 5FHMA 2QS2A 2NWJA 1R1NA 2ZYNA 3DP8A 4KHZE 4QF9A 5AA3A 5J1DA 3IAZA 3FXUA 4LQ5A 1N3XA 4FATA 3FXQA 1VE4A 1IUDA 1B5JA 4YB5A 2DP8A 1SBPA 3HHFA 3EF7A 3PPRA 4JBZA 4M4GA 1LAFE 3DM0A 1R9LA 4H8IA 4Q0CA 2VGQA 3N6TA 3UA8A 2DE2A 3PMVA 3GXAA 1N84A 3U94A 3KFMA 1GTKA 2DVZA 2X7QA 1A99A 1VR5A 5HBCA 1IIWA 1N7XA 3K2DA 4F3SA 5IKBA 3PUYE 1RYXA 4RK9A 1IQ7A 5CI5A 5CMBA 5KDTA 1NNTA 4L17A 1B9JA 3S9LC 3MZ9A 4KFQA 4XKPA 2H4IA 3TMGA 1MY4A 4NF6B 4G2ZA 2Z23A 2GFEA 1LSTA 2Q88A 3KZGA 4KCDA 3UK4A 2PMSA 3L6HA 3MZ1A 3UIFA 1XC1A 4PFYA 2BJJX 1OLCA 2O84X 2V3TA 4R6HA 2ALUA 3TUSA 4H6DA 5A5XA 1N76A 2WKYA 5I56A 4IO2A 1DMBA 3TPAA 2B3BA 3H6TA 2CZLA 3EHUA 4LQ2A 3T9VA 1CB6A 3TCGA 2HZKA 4JWYA 4NF5B 3MVWA 1A8EA 4YICA 3S2VA 1LFHA 1II5A 2OK2A 1OVTA 2Z8EA 1UTBA 3N94A 1JQFA 2YPNA 2O6AA 4WXJA 1AOVA 2QMWA 3PD8A 4PE5B 1NH7A 3ZKLA 1MQHA 1MH4A 2OCUA 3OMBA 3V89B 5KCJA 2PBWA 3SETA 4ZZEA 1A55A 3SKPA 3PUXE 3IOTA 4BDLA 3H4ZA 1B7HA 5H8FA 1Y4CA 4GRKA 3I6VA 1UTHA 3EN3A 4RJZA 4PFUA 1B51A 4MH5A 3LSXA 3LVUA 1ANFA 4R74A 2F6GA 3TTNA 1EH3A 4FEBA 5DVIA 2R9JA 4RPNA 1ZTYA 1PC3A 2ZXTA 3PU5A 4QFPA 4YB7A 4F2QA 4HW8A 3VVDA 3FXRA 4MBPA 1MY0A 4OYVA 5KZTA 1PEBA 4H8JA 3TQWA 1I69A 1R6ZA 3UORA 3ZKKA 3O97A 2H9BA 5AA4B 4MFIA 1IZ1A 3USDA 1MM7A 1XHYA 1JW4A 2NOOA 1PBPA 2HAVA 3M3FA 4POXA 2WOPA 5HM4B 1SQYA 2O1LA 1XOCA 1OQGA 3CG1A 4DZ1A 2H99A 5H8SA 5TP9B 5I59A 4OXVA 4PETA 1DPEA 1ATGA 1FTJA 3DLNA 1MXXA 1NMUA 2GHBA 4DXCA 2ANJA 4ZEKA 3RTWB 5DVFA 1GR2A 1B0LA 2XXQA 1B3LA 4KPTA 1KWHA 4MLQA 4O3CA 4EF2A 3O6GA 4F3GA 3TCHA 4OERA 3FTOA 4OFOA 1XT8A 2XXPA 3O6IA 4ONYA 3E3KA 1FTMA 3G3IA 1Y3NA 1LAXA 3N26A 4IY6A 3HSTA 4OEVA 4OFLA 3OEKA 3QYTA 3VDFA 1EZOA 1OLAA 1MQIA 3SEUA 1Q1KA 3OO7A 1Y1MA 5H8FB 4DIGA 2AL5A 5KDTB 2Q2CA 4Z0IA 3O6HA 5DVJA 2REGA 3M8UA 1RYOA 3RLFE 2QS1A 1IXIA 4TOZA 4ZEDA 3V83A 3H3GA 1BTJA 1JVYA 2I0BA 2ZYMA 4NF6A 4U21A 4LVQA 1B7UA 4WKMA 4ZE8A 2DWAA 4ELPA 1FTLA 5AA1A 1ZJLA 3MWBA 3LBSA 1P1WA 5K2YA 2FNCA 1FQBA 2V84A 1ZKBA 3QUFA 4JWXA 1B3FA 2E1SA 3ONMA 3L6GA 3N6UA 1MXVA 3DRIA 3QXMA 3SEWA 1SW2A 3B6TA 2XXVA 3TELA 3KN3A 3U1OA 1YTVA 3H6VA 1P1QA 1T0KA 1TT1A 2QMXA 4FE8A 4JXIA 2NUVA 4P0IA 3QUJA 4Q5TA 3RT8A 1IXGA 2XD3A 5DTBA 4OTEA 2XXIA 3C4MA 1BIYA 2F5XA 2VP1A 5FHOA 4F2OA 3ECRA 3IX1A 3O6PA 2I6EA 2F7AA 1J1NA 3GLBA 4ZE9A 4JDFA 1A8FA 2A5TA 5I58A 3C31A 2RCBA 3PUWE 5L9MA 5CMKA 2A5SA 3PAMA 1QJMA 1AMFA 1VFDA 2O7UA 3BKIB 3C35A 1QVSA 3LSLA 4IO7A 1L5TA 3W15C 3QSLA 1Y3QA 3CI8A 3KSJA 4U22A 1I6BA 3T9XB 4ZS9A 1NH8A 3G7WA 1MM6A 3O28A 4N07A 2ZYOA 1MPCA 3MQ9A 3W9WA 5B70A 2O7IA 3QAXA 1R9QA 1AH5A 1ZBMA 4PQJA 4TLMB 3SEYA 5H8NB 1JNFA 1LBCA 2ZNTA 3FASA 3PGFA 1I6AA 2ZNUA 3OO8A 4HCWA 3TTMA 4JSDA 3H03A 3FJ7A 1CE2A 1TXFA 3G3KA 5EHMA 4MLVA 3K6VA 1LFGA 3MVZA 3M3KA 1SI0A 3KEIA 1A7LA 1MXYA 4GVOA 1YCJA 2R71A 5H8QB 4F31B 4ZZAA 4POWA 2DE4A 4ZEFA 3FD3A 5I57B 3TODA 4BDMA 2H25A 1OMPA 4OESA 1P1NA 3EHSA 2O68A 4OMBA 1PB9A 2F7CA 2Y7WA 4OFJA 4RK2A 1PB7A 3SEXA 1WDNA 4G77A 2VD3A 3VXBA 1M5FA 1SW5A 2QRYA 5ITPA 1B2HA 1IXHA 4Z7EA 2UYEA 4GIZA 4NF8B 2WOLA 4LA9A 1F9BA 1URSA 2YLNA 3K01A 1OVBA 3LSFB 4KI0E 4KYEA 3MC2A 1S9TA 3Q29A 4XTCQ 5I56B 3MVYA 5I84A 3OXNA 4GF8A 4R9GA 4ESWA 1ZMGA 2F7BA 1B1XA 3DELB 3T9UA 3ZSFA 5F1QA 1DTGA 2I3WA 3T9HB 1JEUA 4M1VA 2OZZA 3CVGA 2DS9A 3SERA 3U72A 3RT6B 1FQEA 1P1OA 2ONKE 2E0SA 2ZNSA 5JEIA 1LCTA 1HSJA 1UQWA 1MXUA 1OIBA 1BLFA 3MAMA 4IB2A 1HSEA 1B05A 5I2KB 1EZPA 2D21A 2UVJA 4Q30B 3PV0E 3K6WA 1BP5A 1GVCA 4EQ7A 5I2NB 4QFKA 4IGTA 2PYYA 4IO5A 4OVJA 5M2VA 2ESNA 4F39A 1JW5A 1QW0A 2F34A 3IOWA 1WODA 1QUKA 2P1SA 3K1PA 4E0WA 3ILTB 3JYRA 3O9PA 3PPOA 1S7YA 2RCAA 4OWDA 4X48A 4YB6A 5JK4A 1O64A 2RC7A 3IOUA 1M5EA 4AQ4A 5AA4A 3WAEA 4U4SA 4LUBA 1A54A 3IJXB 3N5LA 3MBPA 4R6YA 3TKDA 2IA4A 1MY2A 1NFTA 5AE4A 4EQ9A 4XXUA 4H5GA 4PP0A 3T93B 5JTYA 2G29A 4IY5A 1SYHA 3RPWA 5CC2A 5KCJB 5DEXB 1M5DA 1D4NA 3FVOA 3R26A 1B52A 2I4CA 4JWOA 4TLLB 5FTIA 2LAOA 4UACA 4C1UA 4F3BA 4XIGQ 3MW0A 3P7IA 1D9VA 1MG1A 3FATA 2XX9A 1LCFA 1N3WA 4PFWA 2THIA 2PX1A 3IOVA 3MJNA 1MY3A 3R7XA 3H06B 3Q25A 4ELRA 4ESXA 4O3BA 2AL4A 2XX7A 2XXUA 1LB8A 3IR1A 2I3VA 3THIA 3HCQA 2OWSA 4RNSA 5CM6A 1M5BA 3HV1A 4O3AA 3OO9A 2XD2A 3KGCA 3FJMA 4RPOA 4H65A 4P0GA 2DXYA 2X7PA 4DLDA 1BKAA 2DSFA 3PPQA 1Z7NE 3DRFA 4I9DA 1DPPA 2RF1A 4LATA 1NL5A 3MP8A 3OELA 5ICQA 1TFDA 3RNNA 2Y7IA 2XHDA 3KJ7A 1ZU0A 3VXCA 3S4UA 1URGA 4F19A 3VLVA 3CHGA 1MPBA 5HPQA 1SD3A 4RY1A 4NF5A 2ONRA 1FQCA 2FYIA 3E4RA 4F22A 1B46A 2Z8FA 4P11A 4RA1A 1PB8A 4ISUA 2Q2AA 5FTHA 2O1MA 3ODBA 1MQDA 3SDFA 5L9SA 3M3LA 1YPNA 1B5IA 4ZEBA 3RQTA 3C33A 3A3CA 2XXWA 4QFOA 3MPKA 4MF3A 4N6PA 3FVGA 1GV8A 2Q8JA 3RGYA 1LGBC 1Q35A 2WOKA 3LC8A 4LZ5A 1US4A 3TEPA 2A5TB 5I58B 4QSEA 1UTHB 2RC8A 4ZEIA 4U1ZA 1B1HA 1N04A 3PMWA 2H5YA 2DWJA 4AB6A 4EDPA 5I2NA 4YKJA 3AXFA 3IO6A 3LSWA 1JEVA 3R6UA 3RTFB 3UP9A 4BDQA 1QULA 1B3GA 2D5WA 4PFTA 4KQPA 3DP6A 4OETA 2OLBA 3FGSA 4YU0A 3FVKA 1SYIA 3OSRA 5ISUA 4X1BA 4U2RA 1SW4A 3I5OA 4XKNA 3C34A 3FJGA 3DP4A 4EQBA 2OWTA 3C9HA 3TTKA 5H8NA 5CBRA 1TWYA 3I3VA 1B3HA 2R6GE 1JETA 2V93A 1VSOA 2IEEA 2O69A 1B5HA 4IO3A 3TQLA 1POTA 4YMAA 1ZLQA 4GWOA 1FQFA 3CFZA 4FJPA 3FUZA 3FZVA 4H5FA 1MH3A 4LP2B 4NWCA 4QHQA 3UGWA 4DDDA 3KN8A 4YKKA 2VOZA 4X9TA 5H8QA 4F1YA 3FV2A 1MPDA 1Y9UA 4JSOA 2G93A 4U23A 2DOJA 3K4UA 1NNFA 1UTBB 3K1MA 3VV5A 4BLAA 2UXAA 1O63A 4IO4A 1B4HA 3BFTA 4ZECA 1I6QA 3JZJA 4C0RA 4ELQA 3WAFA 4NMYA 2XXRA 3G3GA 5AA2A 1OQHA 3CFXA 1IITA 2HQ0A 3A09A 3TTLA 3V8XB 2H98A 4G68A 2QS3A 4YAHX 1SDXA 3KJTA 5EHSA 3QK6A 4QRZA 4HS7A 4YKPA 1QUJA 1LBBA 1Y3PA 1B40A 2VD2A 3DRJA 1LB9A 2W7YA 3C32A 3K00A 3LUYA 3MP6A 4KYSA 3IB1A 4THIA 2I58A 4JB7A 5K2XA 2HFBA 2RKMA 2F36A 3KOTA 1TFAA 2UYFA 4KR5A 3KG2A 3MUQA 1O7TA 4TQUQ 1RKMA 1MDQA 2I49A 3K1NA 2DXRA 2F8DA 4EUOA 2XX8A 4ELOA 1LLSA 3B6WA 2AYSA 1AL3A 3ILUB 3H7MA 3O66A 1FQAA 2UVIA 4R2BA 1QKAA 4GXSB 3G3HA 4EXKA 1H44A 2DQVA 2HZLA 4GOTA 4WEPA 4BDNA 4DXBA 3CSGA 3ZS6A 2FA7A 5I57A 3O2AA 4IO6A 1B0HA 4QSDA 5CMCA 5BWJA 5TPAA 4DCYA 1FCKA 3CG3A 3E13X 3OD7A 3S9MC 1B6HA 3D4GA 3G3FA 1QUIA 1B7ZA 2DVCA 1SVXB 4YKIA 3KBRA 3TYHA 4QSCA 1B4ZA 1MS7A 1MXWA 3D4CA 4GQOA 4UA8A 4OEUA 2B65A 2PVUA 4GLIA 5CMMA 4OHNA 1MDP1 3CFLA 4YZZA 3C36A 5JTYB 3T22A 5DEXA 3LR1A 4BDOA 3S9EA 4ND9A 1NNPA 3PPNA 1H43A 3IK6B 4XKQA 2Y7RA 3B7DA 3HO7A 4H0WA 3IORA 4GL0A 1LAGE 1SI1A 2QPQA 4LONB 4K3FA 1PBQA 2X26A 2GRVA 3HPIA 3PMXA 2XXYA 4GXAA 4EXLA 4I8CA 1MQGA 4NEDA 1Y20A 2XXXA 3H6WA 2F97A 3OSQA 4AB5A 1YAEA 3QIMA 3OO6A 2NVUB 3H6UA 2I0CA 1Y1ZA 2I4BA 3OENA 4G4PA 4DXUA 1MXZA 3SEVA 1FW0A 1LAHE 1USYE 2ABHA 3K6UA 4KD5A 2YJPA 4FIMA 5DT6A 1EZ9A 5L9OA 2XXTA 1N7WA 2UVHA 2HCAA 3PUVE 4F3PA 4F1VA 2V25A 3HN0A 2PT1A 2I48A 3IB0A 4NF8A 3PD9A 2Z22A 4R73A 5ICTA 3BFUA 1XVXA 4NTLA 4FAJA 2NXOA 4C1TA 2PT2A 3RYBA 5CRYA 1JVXA 3F11A 3FVNA 3CSBA 1QKBA 4FEDA 4GFRA 2F6PA 3FV1A 3GBAA 4FORA 2B4MA 3IJOB 2P2AA 4KCCA 3PUZE 4LZ7A 2F78A 2HEUA 2VHAA 3DRKA 1FTKA 3KSXA 4HTGA 3RYAA 3K02A 4NF4B 3MP1A 3VE1B 3Q27A 4OZ9A 3CRBA 2B4LA 4FECA 3VFJA 3V5AA 4F29A 1HSLA 1XS5A 3PPPA 3VVEA 1B3EA 1POY1 4OENA 1XVYA 5L8DA 3IO4A 5ELVA 4G8MA 4G8HA 1NNKA 3KOSA 4R6KA 3MVXA 2QS4A 5TP9A 1GGGA 2DWIA 2V3UA 5I2KA 2ONSA 1P99A 1H3DA 1DOTA 3EPEA 1D9YA 1LFIA 3U8QA 3DRGA 1B32A 3EQ1A 5H8HB 1WVJA 4NE4A 3W9VA 1US5A 2AIXA 3G3JA 2Z8DA 3KN7A 4R9FA 3IB2A 1EU8A 3TDJA 5TPAB 3DRHA 1JW1A 4EF1A 2RC9A 4ECFA 3TFLA 3BBRA 3RUMA 2DWHA 2GHAA 2O51A 2ZYKA 3FIRA 4NWDA 3VLWA 1UIUA 2QL3A 3EHTA 4KYDA 2XXHA 2ZMBA 1Z7ME 4RXLA 3B6QA 2DYXA 3JV9A 3UN6A 2OJTA 1A40A 4R75A 3VVFA 5CBSA 3GZGA 1UIVA 1MY1A 2REJA 2D3IA 1NKXA 2P0SA 4R72A 1DSNA 1IXCA 1IEJA 2Q89A 3MPLA 3E9XA 3HHGA 4X1DA 5DYHA 1N0TA 3S9NC 1Y4TA 2DE3A 3CIJA 4N13A 3TAJA 4WEDA 4I1DA 1MQJA 4DE8A 1DTZA 4E0XA 2Y7PA 4IGRA 2F35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEM A;  3U92 A;  1URD A;  4DCX A;  3T96 B;  5AA2 B;  4G68 C;  1PDA A;  2QJE A;  3TZA A;  2HXW A;  3O29 A;  3K6X A;  5B7D A;  3Q26 A;  1B58 A;  1D3K A;  2GH9 A;  4XKR A;  4LZ8 A;  4BDR A;  5AA2 D;  5BUU A;  5ITO A;  2OBG A;  1ELJ A;  4G68 B;  3MZB A;  1VFE A;  2CMO A;  3K0V A;  1P1U A;  2KLF A;  5FHN A;  3RN8 A;  4G8N A;  1FQD A;  4H1X A;  1H45 A;  1M5C A;  4GL8 A;  5H8H A;  2Q9T A;  5EYF A;  3VLU A;  1USY H;  3OOA A;  4YMB A;  3GBB A;  1AIV A;  4F18 A;  4HCY A;  5TU0 A;  1H76 A;  4QFN A;  2RIN A;  3Q28 A;  4RYA A;  4ZDM A;  4F1U A;  2V3Q A;  5A5X B;  2B3F A;  2HAU A;  3CR9 A;  4H67 A;  5F7V A;  3U93 A;  5IAI A;  1MRP A;  3TCF A;  4GD5 A;  3A3U A;  3IL1 B;  4R2F A;  2QSX A;  1ZIU A;  3T66 A;  2Y7K A;  3TTR A;  4I62 A;  1S50 A;  4QFL A;  2M8C A;  4Q8R A;  4OQO A;  4U1O A;  3RY3 A;  5I59 B;  4U4X A;  2UVG A;  1FTO A;  3SES A;  5LOM A;  1SW1 A;  2Y84 A;  4NF4 A;  5FHM A;  2QS2 A;  2NWJ A;  1R1N A;  2ZYN A;  3DP8 A;  4KHZ E;  4QF9 A;  5AA3 A;  5J1D A;  3IAZ A;  3FXU A;  4LQ5 A;  1N3X A;  4FAT A;  3FXQ A;  1VE4 A;  1IUD A;  1B5J A;  4YB5 A;  2DP8 A;  1SBP A;  3HHF A;  3EF7 A;  3PPR A;  4JBZ A;  4M4G A;  1LAF E;  3DM0 A;  1R9L A;  4H8I A;  4Q0C A;  2VGQ A;  3N6T A;  3UA8 A;  2DE2 A;  3PMV A;  3GXA A;  1N84 A;  3U94 A;  3KFM A;  1GTK A;  2DVZ A;  2X7Q A;  1A99 A;  1VR5 A;  5HBC A;  1IIW A;  1N7X A;  3K2D A;  4F3S A;  5IKB A;  3PUY E;  1RYX A;  4RK9 A;  1IQ7 A;  5CI5 A;  5CMB A;  5KDT A;  1NNT A;  4L17 A;  1B9J A;  3S9L C;  3MZ9 A;  4KFQ A;  4XKP A;  2H4I A;  3TMG A;  1MY4 A;  4NF6 B;  4G2Z A;  2Z23 A;  2GFE A;  1LST A;  2Q88 A;  3KZG A;  4KCD A;  3UK4 A;  2PMS A;  3L6H A;  3MZ1 A;  3UIF A;  1XC1 A;  4PFY A;  2BJJ X;  1OLC A;  2O84 X;  2V3T A;  4R6H A;  2ALU A;  3TUS A;  4H6D A;  5A5X A;  1N76 A;  2WKY A;  5I56 A;  4IO2 A;  1DMB A;  3TPA A;  2B3B A;  3H6T A;  2CZL A;  3EHU A;  4LQ2 A;  3T9V A;  1CB6 A;  3TCG A;  2HZK A;  4JWY A;  4NF5 B;  3MVW A;  1A8E A;  4YIC A;  3S2V A;  1LFH A;  1II5 A;  2OK2 A;  1OVT A;  2Z8E A;  1UTB A;  3N94 A;  1JQF A;  2YPN A;  2O6A A;  4WXJ A;  1AOV A;  2QMW A;  3PD8 A;  4PE5 B;  1NH7 A;  3ZKL A;  1MQH A;  1MH4 A;  2OCU A;  3OMB A;  3V89 B;  5KCJ A;  2PBW A;  3SET A;  4ZZE A;  1A55 A;  3SKP A;  3PUX E;  3IOT A;  4BDL A;  3H4Z A;  1B7H A;  5H8F A;  1Y4C A;  4GRK A;  3I6V A;  1UTH A;  3EN3 A;  4RJZ A;  4PFU A;  1B51 A;  4MH5 A;  3LSX A;  3LVU A;  1ANF A;  4R74 A;  2F6G A;  3TTN A;  1EH3 A;  4FEB A;  5DVI A;  2R9J A;  4RPN A;  1ZTY A;  1PC3 A;  2ZXT A;  3PU5 A;  4QFP A;  4YB7 A;  4F2Q A;  4HW8 A;  3VVD A;  3FXR A;  4MBP A;  1MY0 A;  4OYV A;  5KZT A;  1PEB A;  4H8J A;  3TQW A;  1I69 A;  1R6Z A;  3UOR A;  3ZKK A;  3O97 A;  2H9B A;  5AA4 B;  4MFI A;  1IZ1 A;  3USD A;  1MM7 A;  1XHY A;  1JW4 A;  2NOO A;  1PBP A;  2HAV A;  3M3F A;  4POX A;  2WOP A;  5HM4 B;  1SQY A;  2O1L A;  1XOC A;  1OQG A;  3CG1 A;  4DZ1 A;  2H99 A;  5H8S A;  5TP9 B;  5I59 A;  4OXV A;  4PET A;  1DPE A;  1ATG A;  1FTJ A;  3DLN A;  1MXX A;  1NMU A;  2GHB A;  4DXC A;  2ANJ A;  4ZEK A;  3RTW B;  5DVF A;  1GR2 A;  1B0L A;  2XXQ A;  1B3L A;  4KPT A;  1KWH A;  4MLQ A;  4O3C A;  4EF2 A;  3O6G A;  4F3G A;  3TCH A;  4OER A;  3FTO A;  4OFO A;  1XT8 A;  2XXP A;  3O6I A;  4ONY A;  3E3K A;  1FTM A;  3G3I A;  1Y3N A;  1LAX A;  3N26 A;  4IY6 A;  3HST A;  4OEV A;  4OFL A;  3OEK A;  3QYT A;  3VDF A;  1EZO A;  1OLA A;  1MQI A;  3SEU A;  1Q1K A;  3OO7 A;  1Y1M A;  5H8F B;  4DIG A;  2AL5 A;  5KDT B;  2Q2C A;  4Z0I A;  3O6H A;  5DVJ A;  2REG A;  3M8U A;  1RYO A;  3RLF E;  2QS1 A;  1IXI A;  4TOZ A;  4ZED A;  3V83 A;  3H3G A;  1BTJ A;  1JVY A;  2I0B A;  2ZYM A;  4NF6 A;  4U21 A;  4LVQ A;  1B7U A;  4WKM A;  4ZE8 A;  2DWA A;  4ELP A;  1FTL A;  5AA1 A;  1ZJL A;  3MWB A;  3LBS A;  1P1W A;  5K2Y A;  2FNC A;  1FQB A;  2V84 A;  1ZKB A;  3QUF A;  4JWX A;  1B3F A;  2E1S A;  3ONM A;  3L6G A;  3N6U A;  1MXV A;  3DRI A;  3QXM A;  3SEW A;  1SW2 A;  3B6T A;  2XXV A;  3TEL A;  3KN3 A;  3U1O A;  1YTV A;  3H6V A;  1P1Q A;  1T0K A;  1TT1 A;  2QMX A;  4FE8 A;  4JXI A;  2NUV A;  4P0I A;  3QUJ A;  4Q5T A;  3RT8 A;  1IXG A;  2XD3 A;  5DTB A;  4OTE A;  2XXI A;  3C4M A;  1BIY A;  2F5X A;  2VP1 A;  5FHO A;  4F2O A;  3ECR A;  3IX1 A;  3O6P A;  2I6E A;  2F7A A;  1J1N A;  3GLB A;  4ZE9 A;  4JDF A;  1A8F A;  2A5T A;  5I58 A;  3C31 A;  2RCB A;  3PUW E;  5L9M A;  5CMK A;  2A5S A;  3PAM A;  1QJM A;  1AMF A;  1VFD A;  2O7U A;  3BKI B;  3C35 A;  1QVS A;  3LSL A;  4IO7 A;  1L5T A;  3W15 C;  3QSL A;  1Y3Q A;  3CI8 A;  3KSJ A;  4U22 A;  1I6B A;  3T9X B;  4ZS9 A;  1NH8 A;  3G7W A;  1MM6 A;  3O28 A;  4N07 A;  2ZYO A;  1MPC A;  3MQ9 A;  3W9W A;  5B70 A;  2O7I A;  3QAX A;  1R9Q A;  1AH5 A;  1ZBM A;  4PQJ A;  4TLM B;  3SEY A;  5H8N B;  1JNF A;  1LBC A;  2ZNT A;  3FAS A;  3PGF A;  1I6A A;  2ZNU A;  3OO8 A;  4HCW A;  3TTM A;  4JSD A;  3H03 A;  3FJ7 A;  1CE2 A;  1TXF A;  3G3K A;  5EHM A;  4MLV A;  3K6V A;  1LFG A;  3MVZ A;  3M3K A;  1SI0 A;  3KEI A;  1A7L A;  1MXY A;  4GVO A;  1YCJ A;  2R71 A;  5H8Q B;  4F31 B;  4ZZA A;  4POW A;  2DE4 A;  4ZEF A;  3FD3 A;  5I57 B;  3TOD A;  4BDM A;  2H25 A;  1OMP A;  4OES A;  1P1N A;  3EHS A;  2O68 A;  4OMB A;  1PB9 A;  2F7C A;  2Y7W A;  4OFJ A;  4RK2 A;  1PB7 A;  3SEX A;  1WDN A;  4G77 A;  2VD3 A;  3VXB A;  1M5F A;  1SW5 A;  2QRY A;  5ITP A;  1B2H A;  1IXH A;  4Z7E A;  2UYE A;  4GIZ A;  4NF8 B;  2WOL A;  4LA9 A;  1F9B A;  1URS A;  2YLN A;  3K01 A;  1OVB A;  3LSF B;  4KI0 E;  4KYE A;  3MC2 A;  1S9T A;  3Q29 A;  4XTC Q;  5I56 B;  3MVY A;  5I84 A;  3OXN A;  4GF8 A;  4R9G A;  4ESW A;  1ZMG A;  2F7B A;  1B1X A;  3DEL B;  3T9U A;  3ZSF A;  5F1Q A;  1DTG A;  2I3W A;  3T9H B;  1JEU A;  4M1V A;  2OZZ A;  3CVG A;  2DS9 A;  3SER A;  3U72 A;  3RT6 B;  1FQE A;  1P1O A;  2ONK E;  2E0S A;  2ZNS A;  5JEI A;  1LCT A;  1HSJ A;  1UQW A;  1MXU A;  1OIB A;  1BLF A;  3MAM A;  4IB2 A;  1HSE A;  1B05 A;  5I2K B;  1EZP A;  2D21 A;  2UVJ A;  4Q30 B;  3PV0 E;  3K6W A;  1BP5 A;  1GVC A;  4EQ7 A;  5I2N B;  4QFK A;  4IGT A;  2PYY A;  4IO5 A;  4OVJ A;  5M2V A;  2ESN A;  4F39 A;  1JW5 A;  1QW0 A;  2F34 A;  3IOW A;  1WOD A;  1QUK A;  2P1S A;  3K1P A;  4E0W A;  3ILT B;  3JYR A;  3O9P A;  3PPO A;  1S7Y A;  2RCA A;  4OWD A;  4X48 A;  4YB6 A;  5JK4 A;  1O64 A;  2RC7 A;  3IOU A;  1M5E A;  4AQ4 A;  5AA4 A;  3WAE A;  4U4S A;  4LUB A;  1A54 A;  3IJX B;  3N5L A;  3MBP A;  4R6Y A;  3TKD A;  2IA4 A;  1MY2 A;  1NFT A;  5AE4 A;  4EQ9 A;  4XXU A;  4H5G A;  4PP0 A;  3T93 B;  5JTY A;  2G29 A;  4IY5 A;  1SYH A;  3RPW A;  5CC2 A;  5KCJ B;  5DEX B;  1M5D A;  1D4N A;  3FVO A;  3R26 A;  1B52 A;  2I4C A;  4JWO A;  4TLL B;  5FTI A;  2LAO A;  4UAC A;  4C1U A;  4F3B A;  4XIG Q;  3MW0 A;  3P7I A;  1D9V A;  1MG1 A;  3FAT A;  2XX9 A;  1LCF A;  1N3W A;  4PFW A;  2THI A;  2PX1 A;  3IOV A;  3MJN A;  1MY3 A;  3R7X A;  3H06 B;  3Q25 A;  4ELR A;  4ESX A;  4O3B A;  2AL4 A;  2XX7 A;  2XXU A;  1LB8 A;  3IR1 A;  2I3V A;  3THI A;  3HCQ A;  2OWS A;  4RNS A;  5CM6 A;  1M5B A;  3HV1 A;  4O3A A;  3OO9 A;  2XD2 A;  3KGC A;  3FJM A;  4RPO A;  4H65 A;  4P0G A;  2DXY A;  2X7P A;  4DLD A;  1BKA A;  2DSF A;  3PPQ A;  1Z7N E;  3DRF A;  4I9D A;  1DPP A;  2RF1 A;  4LAT A;  1NL5 A;  3MP8 A;  3OEL A;  5ICQ A;  1TFD A;  3RNN A;  2Y7I A;  2XHD A;  3KJ7 A;  1ZU0 A;  3VXC A;  3S4U A;  1URG A;  4F19 A;  3VLV A;  3CHG A;  1MPB A;  5HPQ A;  1SD3 A;  4RY1 A;  4NF5 A;  2ONR A;  1FQC A;  2FYI A;  3E4R A;  4F22 A;  1B46 A;  2Z8F A;  4P11 A;  4RA1 A;  1PB8 A;  4ISU A;  2Q2A A;  5FTH A;  2O1M A;  3ODB A;  1MQD A;  3SDF A;  5L9S A;  3M3L A;  1YPN A;  1B5I A;  4ZEB A;  3RQT A;  3C33 A;  3A3C A;  2XXW A;  4QFO A;  3MPK A;  4MF3 A;  4N6P A;  3FVG A;  1GV8 A;  2Q8J A;  3RGY A;  1LGB C;  1Q35 A;  2WOK A;  3LC8 A;  4LZ5 A;  1US4 A;  3TEP A;  2A5T B;  5I58 B;  4QSE A;  1UTH B;  2RC8 A;  4ZEI A;  4U1Z A;  1B1H A;  1N04 A;  3PMW A;  2H5Y A;  2DWJ A;  4AB6 A;  4EDP A;  5I2N A;  4YKJ A;  3AXF A;  3IO6 A;  3LSW A;  1JEV A;  3R6U A;  3RTF B;  3UP9 A;  4BDQ A;  1QUL A;  1B3G A;  2D5W A;  4PFT A;  4KQP A;  3DP6 A;  4OET A;  2OLB A;  3FGS A;  4YU0 A;  3FVK A;  1SYI A;  3OSR A;  5ISU A;  4X1B A;  4U2R A;  1SW4 A;  3I5O A;  4XKN A;  3C34 A;  3FJG A;  3DP4 A;  4EQB A;  2OWT A;  3C9H A;  3TTK A;  5H8N A;  5CBR A;  1TWY A;  3I3V A;  1B3H A;  2R6G E;  1JET A;  2V93 A;  1VSO A;  2IEE A;  2O69 A;  1B5H A;  4IO3 A;  3TQL A;  1POT A;  4YMA A;  1ZLQ A;  4GWO A;  1FQF A;  3CFZ A;  4FJP A;  3FUZ A;  3FZV A;  4H5F A;  1MH3 A;  4LP2 B;  4NWC A;  4QHQ A;  3UGW A;  4DDD A;  3KN8 A;  4YKK A;  2VOZ A;  4X9T A;  5H8Q A;  4F1Y A;  3FV2 A;  1MPD A;  1Y9U A;  4JSO A;  2G93 A;  4U23 A;  2DOJ A;  3K4U A;  1NNF A;  1UTB B;  3K1M A;  3VV5 A;  4BLA A;  2UXA A;  1O63 A;  4IO4 A;  1B4H A;  3BFT A;  4ZEC A;  1I6Q A;  3JZJ A;  4C0R A;  4ELQ A;  3WAF A;  4NMY A;  2XXR A;  3G3G A;  5AA2 A;  1OQH A;  3CFX A;  1IIT A;  2HQ0 A;  3A09 A;  3TTL A;  3V8X B;  2H98 A;  4G68 A;  2QS3 A;  4YAH X;  1SDX A;  3KJT A;  5EHS A;  3QK6 A;  4QRZ A;  4HS7 A;  4YKP A;  1QUJ A;  1LBB A;  1Y3P A;  1B40 A;  2VD2 A;  3DRJ A;  1LB9 A;  2W7Y A;  3C32 A;  3K00 A;  3LUY A;  3MP6 A;  4KYS A;  3IB1 A;  4THI A;  2I58 A;  4JB7 A;  5K2X A;  2HFB A;  2RKM A;  2F36 A;  3KOT A;  1TFA A;  2UYF A;  4KR5 A;  3KG2 A;  3MUQ A;  1O7T A;  4TQU Q;  1RKM A;  1MDQ A;  2I49 A;  3K1N A;  2DXR A;  2F8D A;  4EUO A;  2XX8 A;  4ELO A;  1LLS A;  3B6W A;  2AYS A;  1AL3 A;  3ILU B;  3H7M A;  3O66 A;  1FQA A;  2UVI A;  4R2B A;  1QKA A;  4GXS B;  3G3H A;  4EXK A;  1H44 A;  2DQV A;  2HZL A;  4GOT A;  4WEP A;  4BDN A;  4DXB A;  3CSG A;  3ZS6 A;  2FA7 A;  5I57 A;  3O2A A;  4IO6 A;  1B0H A;  4QSD A;  5CMC A;  5BWJ A;  5TPA A;  4DCY A;  1FCK A;  3CG3 A;  3E13 X;  3OD7 A;  3S9M C;  1B6H A;  3D4G A;  3G3F A;  1QUI A;  1B7Z A;  2DVC A;  1SVX B;  4YKI A;  3KBR A;  3TYH A;  4QSC A;  1B4Z A;  1MS7 A;  1MXW A;  3D4C A;  4GQO A;  4UA8 A;  4OEU A;  2B65 A;  2PVU A;  4GLI A;  5CMM A;  4OHN A;  1MDP 1;  3CFL A;  4YZZ A;  3C36 A;  5JTY B;  3T22 A;  5DEX A;  3LR1 A;  4BDO A;  3S9E A;  4ND9 A;  1NNP A;  3PPN A;  1H43 A;  3IK6 B;  4XKQ A;  2Y7R A;  3B7D A;  3HO7 A;  4H0W A;  3IOR A;  4GL0 A;  1LAG E;  1SI1 A;  2QPQ A;  4LON B;  4K3F A;  1PBQ A;  2X26 A;  2GRV A;  3HPI A;  3PMX A;  2XXY A;  4GXA A;  4EXL A;  4I8C A;  1MQG A;  4NED A;  1Y20 A;  2XXX A;  3H6W A;  2F97 A;  3OSQ A;  4AB5 A;  1YAE A;  3QIM A;  3OO6 A;  2NVU B;  3H6U A;  2I0C A;  1Y1Z A;  2I4B A;  3OEN A;  4G4P A;  4DXU A;  1MXZ A;  3SEV A;  1FW0 A;  1LAH E;  1USY E;  2ABH A;  3K6U A;  4KD5 A;  2YJP A;  4FIM A;  5DT6 A;  1EZ9 A;  5L9O A;  2XXT A;  1N7W A;  2UVH A;  2HCA A;  3PUV E;  4F3P A;  4F1V A;  2V25 A;  3HN0 A;  2PT1 A;  2I48 A;  3IB0 A;  4NF8 A;  3PD9 A;  2Z22 A;  4R73 A;  5ICT A;  3BFU A;  1XVX A;  4NTL A;  4FAJ A;  2NXO A;  4C1T A;  2PT2 A;  3RYB A;  5CRY A;  1JVX A;  3F11 A;  3FVN A;  3CSB A;  1QKB A;  4FED A;  4GFR A;  2F6P A;  3FV1 A;  3GBA A;  4FOR A;  2B4M A;  3IJO B;  2P2A A;  4KCC A;  3PUZ E;  4LZ7 A;  2F78 A;  2HEU A;  2VHA A;  3DRK A;  1FTK A;  3KSX A;  4HTG A;  3RYA A;  3K02 A;  4NF4 B;  3MP1 A;  3VE1 B;  3Q27 A;  4OZ9 A;  3CRB A;  2B4L A;  4FEC A;  3VFJ A;  3V5A A;  4F29 A;  1HSL A;  1XS5 A;  3PPP A;  3VVE A;  1B3E A;  1POY 1;  4OEN A;  1XVY A;  5L8D A;  3IO4 A;  5ELV A;  4G8M A;  4G8H A;  1NNK A;  3KOS A;  4R6K A;  3MVX A;  2QS4 A;  5TP9 A;  1GGG A;  2DWI A;  2V3U A;  5I2K A;  2ONS A;  1P99 A;  1H3D A;  1DOT A;  3EPE A;  1D9Y A;  1LFI A;  3U8Q A;  3DRG A;  1B32 A;  3EQ1 A;  5H8H B;  1WVJ A;  4NE4 A;  3W9V A;  1US5 A;  2AIX A;  3G3J A;  2Z8D A;  3KN7 A;  4R9F A;  3IB2 A;  1EU8 A;  3TDJ A;  5TPA B;  3DRH A;  1JW1 A;  4EF1 A;  2RC9 A;  4ECF A;  3TFL A;  3BBR A;  3RUM A;  2DWH A;  2GHA A;  2O51 A;  2ZYK A;  3FIR A;  4NWD A;  3VLW A;  1UIU A;  2QL3 A;  3EHT A;  4KYD A;  2XXH A;  2ZMB A;  1Z7M E;  4RXL A;  3B6Q A;  2DYX A;  3JV9 A;  3UN6 A;  2OJT A;  1A40 A;  4R75 A;  3VVF A;  5CBS A;  3GZG A;  1UIV A;  1MY1 A;  2REJ A;  2D3I A;  1NKX A;  2P0S A;  4R72 A;  1DSN A;  1IXC A;  1IEJ A;  2Q89 A;  3MPL A;  3E9X A;  3HHG A;  4X1D A;  5DYH A;  1N0T A;  3S9N C;  1Y4T A;  2DE3 A;  3CIJ A;  4N13 A;  3TAJ A;  4WED A;  4I1D A;  1MQJ A;  4DE8 A;  1DTZ A;  4E0X A;  2Y7P A;  4IGR A;  2F35 A; 
#chains in the Genus database with same CATH topology
 4PF8 A;  4BDR A;  2GH9 A;  4N81 A;  4G68 B;  1VFE A;  4GL8 A;  2Q9T A;  2JJK A;  4O7I A;  4HCY A;  4QFN A;  2RIN A;  5I5P A;  2B3F A;  5F7V A;  4H67 A;  4R2F A;  3IL1 B;  2QSX A;  4Q8R A;  4OQO A;  4NF4 A;  5FHM A;  2NWJ A;  3DP8 A;  4FAT A;  1VE4 A;  1IUD A;  3SES A;  3HHF A;  1R9L A;  1N84 A;  1NV5 A;  3BIH A;  3PUY E;  1RYX A;  5KDT A;  4KFQ A;  2Z23 A;  2Q88 A;  2PMS A;  1OLC A;  5EQ8 A;  2ALU A;  3TUS A;  2WKY A;  2HZK A;  2L5V A;  3MVW A;  1A8E A;  4JVI A;  2QVU A;  2OK2 A;  2VPN A;  1EYJ A;  1RDX A;  1MH4 A;  2OCU A;  3OMB A;  2PBW A;  3SET A;  1B7H A;  1UTH A;  4R74 A;  2F6G A;  1EH3 A;  4FEB A;  4RPN A;  4HW8 A;  4MNC A;  4F2Q A;  4NX1 A;  3TQW A;  3UOR A;  2H9B A;  1IZ1 A;  3USD A;  1XHY A;  1PBP A;  2PFY A;  1SQY A;  5H8S A;  4OXV A;  1FTJ A;  3DLN A;  1MXX A;  1NMU A;  5DVF A;  1GR2 A;  1B3L A;  2Y5K A;  4EF2 A;  3FTO A;  1QGX A;  1LAX A;  1LEV A;  3OEK A;  4OEV A;  1EZO A;  2OX3 A;  4OVT A;  4Z0I A;  2REG A;  3M8U A;  1FJ6 A;  2DWA A;  5AA1 A;  1P1W A;  5K2Y A;  4JWX A;  1B3F A;  3L6G A;  3DRI A;  1TT1 A;  2QMX A;  2NUV A;  2XXI A;  4PF6 A;  2VP1 A;  4P1L A;  4F31 B;  4OVP A;  4EXK A;  4JDF A;  1J1N A;  5I58 A;  1VFD A;  1QVS A;  1Y3Q A;  3KBZ A;  2O7I A;  1AH5 A;  4PQJ A;  3SEY A;  1JNF A;  1LBC A;  3FAS A;  5EQ9 A;  3H03 A;  3FJ7 A;  1CE2 A;  3G3K A;  3T0J A;  5H8Q B;  1YCJ A;  3FD3 A;  4BDM A;  5FBP A;  4OMB A;  1WDN A;  2BJI A;  1B2H A;  2WOL A;  1YZ0 A;  1URS A;  3LSF B;  4KI0 E;  4O94 A;  4XTC Q;  5I56 B;  1LBW A;  3T9H B;  3SER A;  1FBE A;  1UQW A;  3MAM A;  2WYK A;  1HSE A;  1FPD A;  2D21 A;  1GVC A;  3PV0 E;  3K6W A;  4IGT A;  4F39 A;  4E0W A;  1QUK A;  2RCA A;  4OWD A;  4X48 A;  4YB6 A;  2OWZ A;  4AQ4 A;  5AA4 A;  3IJX B;  3TKD A;  4H5G A;  5JTY A;  1SYH A;  1FRP A;  1M5D A;  4AS4 A;  5FTI A;  4C1U A;  4F3B A;  1CNQ A;  1IMB A;  4UAC A;  4XIG Q;  3MW0 A;  1MG1 A;  1VDW A;  2XX9 A;  4FBP A;  4PFW A;  2PX1 A;  1MY3 A;  4ELR A;  4ESX A;  2AL4 A;  2XXU A;  1LB8 A;  2QVV A;  4RNS A;  3FJM A;  1NUZ A;  4P0G A;  4GWZ A;  2X7P A;  4DLD A;  2RF1 A;  1DPP A;  1TFD A;  3RNN A;  1URG A;  3CHG A;  1FQC A;  3E4R A;  4F22 A;  1NV2 A;  2Z8F A;  1PB8 A;  2Q2A A;  3U65 A;  3ODB A;  5I3S A;  3M3L A;  4P3L A;  4RK9 A;  3RQT A;  4MF3 A;  1Q35 A;  3LC8 A;  4NGU A;  1B1H A;  3IO6 A;  4BDQ A;  3DP6 A;  4YU0 A;  1SYI A;  3OSR A;  4U2R A;  4XKN A;  2OWT A;  3C9H A;  1JET A;  2IEE A;  2O69 A;  4FJP A;  3FUZ A;  3FV2 A;  1Y9U A;  4BLA A;  3VV5 A;  1O63 A;  4IO4 A;  3JZJ A;  4C0R A;  4ELQ A;  5AA2 A;  3CFX A;  4NQ8 A;  3V8X B;  4MX6 A;  1SPI A;  5EHS A;  4HS7 A;  1QUJ A;  4OVS A;  1LB9 A;  3A29 A;  4THI A;  3IB1 A;  4JB7 A;  4KR5 A;  2HXR A;  5IZ3 B;  1MDQ A;  2I49 A;  2F8D A;  4ELO A;  1FQA A;  4GXS B;  1B0H A;  5J16 A;  4GX3 A;  4DCY A;  3E13 X;  3D4G A;  4N6K A;  2DVC A;  1SVX B;  3KBR A;  1MS7 A;  2B65 A;  4GLI A;  5ET7 A;  2F3D A;  3S9E A;  3PPN A;  3HO7 A;  3B7D A;  3IOR A;  2QPQ A;  4LON B;  1PBQ A;  4QXD A;  1Y20 A;  2XXX A;  3H6W A;  2I4B A;  3OEN A;  4DXU A;  1MXZ A;  3SEV A;  1USY E;  2ABH A;  1EZ9 A;  2XXT A;  4MAG A;  2UVH A;  2HCA A;  4R73 A;  5ICT A;  4FAJ A;  4DI4 B;  3RYB A;  1JVX A;  4KCC A;  3FV1 A;  2F78 A;  2WEF A;  3K02 A;  4OZ9 A;  3CRB A;  2B4L A;  1JP4 A;  1XS5 A;  4G8M A;  4G8H A;  5TP9 A;  2DWI A;  1DOT A;  4GWX A;  4NE4 A;  3W9V A;  2Z8D A;  5TPA B;  2RC9 A;  3TFL A;  3RUM A;  2DWH A;  2O51 A;  3FIR A;  3EHT A;  4KYD A;  2XXH A;  2ZMB A;  3UN6 A;  2WYP A;  4R72 A;  1DSN A;  1IEJ A;  2Q89 A;  3MPL A;  3HHG A;  2F3B A;  4PTK A;  1DTZ A;  4IGR A;  3T93 B;  2ZZV A;  3OEM A;  4DCX A;  4G68 C;  1PDA A;  2HXW A;  5B7D A;  3K6X A;  3Q26 A;  5AA2 D;  2PFZ A;  1ELJ A;  1P1U A;  2WX9 A;  4H1X A;  5H8H A;  1USY H;  3GBB A;  1AIV A;  5TU0 A;  3RPL A;  4P1E A;  4RYA A;  3U93 A;  3TCF A;  4GD5 A;  3RY3 A;  3LUZ A;  2UVG A;  2ZYN A;  4QF9 A;  5AA3 A;  3IAZ A;  1N3X A;  4YB5 A;  2DP8 A;  3PPR A;  1LAF E;  4Q0C A;  3PMV A;  1GTK A;  2DVZ A;  2X7Q A;  1VR5 A;  1N7X A;  5CI5 A;  1IQ7 A;  5CMB A;  4L17 A;  1B9J A;  3S9L C;  3MZ9 A;  1MY4 A;  2GFE A;  2HHM A;  3UIF A;  2BJJ X;  4PFY A;  2FVZ A;  5A5X A;  3T9V A;  2CZL A;  2XA5 A;  3TCG A;  4PGN A;  3N94 A;  2YPN A;  1AOV A;  2QMW A;  3PD8 A;  3V89 B;  3H4Z A;  5H8F A;  3EN3 A;  4PFU A;  1B51 A;  5DVI A;  4YB7 A;  3PU5 A;  4QFP A;  3VVD A;  3FXR A;  1MY0 A;  3ZKK A;  1AWB A;  1JW4 A;  2NOO A;  2HAV A;  2O1L A;  1XOC A;  1Q9D A;  4GWS A;  3T1B A;  2ANJ A;  4PDD A;  4ZEK A;  1KWH A;  4MLQ A;  4O3C A;  3O6G A;  3ROJ A;  4OFO A;  3O6I A;  3G3I A;  4MH5 A;  4OFL A;  1OLA A;  3OO7 A;  2AL5 A;  5KDT B;  3O6H A;  1NV0 A;  4ZED A;  1JVY A;  4U21 A;  1BK4 A;  4LVQ A;  4WKM A;  5DW8 A;  1FQB A;  1ZKB A;  3N6U A;  1MXV A;  4HXV A;  3SEW A;  1SW2 A;  3H6V A;  1T0K A;  4FE8 A;  4P0I A;  3RT8 A;  2XD3 A;  2F7A A;  1A8F A;  4XEQ A;  3PUW E;  1FPJ A;  2WBB A;  5L9M A;  5CMK A;  2A5S A;  4N8G A;  1QJM A;  1AMF A;  1L5T A;  3LSL A;  3C35 A;  3CI8 A;  4U22 A;  4ZS9 A;  5I7I A;  3W9W A;  4NN3 A;  3OO8 A;  4G61 A;  4JSD A;  1TXF A;  3MVZ A;  3KEI A;  4ZZA A;  1FPL A;  4ZEF A;  4PAK A;  2H25 A;  1P1N A;  1PB9 A;  3SEX A;  1SW5 A;  4Z7E A;  2R8T A;  4PBH A;  1F9B A;  3K01 A;  2VPO A;  3MVY A;  4GF8 A;  4GX4 A;  3DEL B;  3T9U A;  3ZSF A;  4I3Y A;  4M1V A;  2OZZ A;  3RT6 B;  1P1O A;  2ZNS A;  5JEI A;  1MXU A;  1BLF A;  1B05 A;  4QFK A;  1NV1 A;  5F24 A;  1JW5 A;  1WOD A;  3ILT B;  1S7Y A;  4OA4 A;  1O64 A;  2RC7 A;  3LV0 A;  4U4S A;  2XWK A;  1RDY A;  4EQ9 A;  5DEX B;  3FVO A;  4JWO A;  1YXI A;  1D9V A;  3THI A;  2FHY A;  3PTY A;  1M5B A;  3HV1 A;  1NL5 A;  5ICQ A;  2Y7I A;  2XHD A;  3KJ7 A;  4F19 A;  1SD3 A;  2FYI A;  4P11 A;  3MYU A;  1MQD A;  3SDF A;  4ZEB A;  4DI3 D;  3C33 A;  3A3C A;  2Q8J A;  5KCJ B;  3RGY A;  4LZ5 A;  3TEP A;  5I58 B;  4QSE A;  4ZEI A;  1N04 A;  4EDP A;  3AXF A;  3UP9 A;  4PFT A;  2PCR A;  3FGS A;  2FIE A;  2HPG A;  2XXK A;  1SW4 A;  1FBF A;  4I3E A;  2V93 A;  3RYD A;  1ZLQ A;  4GWO A;  1FQF A;  3CFZ A;  4QHQ A;  3FZV A;  4DDD A;  4YKK A;  3GYY A;  4X9T A;  5H8Q A;  4F1Y A;  1MPD A;  4JSO A;  2DOJ A;  3K4U A;  1NNF A;  1B4H A;  4P9K A;  2HQ0 A;  3KC0 A;  3HFU A;  2P3N A;  2H98 A;  3KJT A;  1KA1 A;  1Y3P A;  1B40 A;  4KYS A;  3DRJ A;  3K00 A;  3LUY A;  5K2X A;  2RKM A;  3KOT A;  2UYF A;  3KG2 A;  1FPB A;  1O7T A;  2DXR A;  1XI6 A;  2AYS A;  1AL3 A;  3O66 A;  4MIJ A;  1QKA A;  4KXP A;  4BDN A;  2HZL A;  4NHB A;  2FA7 A;  4IO6 A;  5CMC A;  1FBD A;  1FCK A;  3OD7 A;  3S9M C;  1QUI A;  4YKI A;  4DZ1 A;  4OHN A;  1MDP 1;  4NF0 A;  5JTY B;  3C36 A;  3LR1 A;  4XKQ A;  3MST A;  4H0W A;  2KQZ A;  1LAG E;  2X26 A;  3PMX A;  4GXA A;  4I8C A;  4MHF A;  3QIM A;  2I0C A;  1Y1Z A;  1KA0 A;  1LAH E;  4KD5 A;  5L9O A;  2CZK A;  1FBP A;  1N7W A;  3PUV E;  4F3P A;  1DBZ A;  2PT1 A;  4NF8 A;  3BFU A;  4C1T A;  2NXO A;  5CRY A;  3F11 A;  3CSB A;  3ISP A;  4FED A;  4GFR A;  4FOR A;  2VHA A;  3DRK A;  3Q27 A;  3VFJ A;  3VVE A;  1B3E A;  1POY 1;  1XVY A;  5L8D A;  2QS4 A;  1NI9 A;  1GGG A;  5I2K A;  1P99 A;  3U8Q A;  4R9F A;  3G3J A;  4N6D A;  4EF1 A;  1NV7 A;  4O7M A;  4NWD A;  1UIU A;  1Z7M E;  3B6Q A;  2DYX A;  3JV9 A;  1A40 A;  4R75 A;  1IMC A;  3GZG A;  1MY1 A;  1IXC A;  3E9X A;  4X1D A;  1N0T A;  1IMA A;  4N13 A;  1G0I A;  5ET6 A;  4DE8 A;  2F35 A;  3U92 A;  1URD A;  5AA2 B;  2QJE A;  4PFR A;  3O29 A;  1D3K A;  4XKR A;  5BUU A;  5ITO A;  3MZB A;  2CMO A;  3K0V A;  2KLF A;  5FHN A;  1FQD A;  1H45 A;  1M5C A;  4YMB A;  1H76 A;  4F1U A;  2V3Q A;  2HAU A;  5IAI A;  1ZIU A;  4I62 A;  2M8C A;  5I59 B;  4U4X A;  1FTO A;  5LOM A;  3E79 A;  2QS2 A;  4XF5 A;  1IMD A;  5J1D A;  3FXU A;  4LQ5 A;  1B5J A;  4OVQ A;  4H8I A;  2VGQ A;  5HBC A;  1A99 A;  1IIW A;  5IKB A;  1RDZ A;  1NNT A;  4XKP A;  2H4I A;  3TMG A;  4NF6 B;  4G2Z A;  4KCD A;  1LST A;  3UK4 A;  2V3T A;  1N76 A;  3TPA A;  2B3B A;  3H6T A;  4LQ2 A;  3V83 A;  1FPK A;  3S2V A;  1LFH A;  1II5 A;  1OVT A;  1UTB A;  1JQF A;  2O6A A;  4WXJ A;  4GWU A;  4PE5 B;  4GX6 A;  5KCJ A;  4ZZE A;  3PUX E;  4BDL A;  1Y4C A;  4GRK A;  3LVU A;  1ANF A;  2MKZ A;  3TTN A;  1DCU A;  2ZZW A;  1PC3 A;  4H8J A;  1I69 A;  3O97 A;  1MM7 A;  5HM4 B;  3CG1 A;  4N17 A;  5TP9 B;  4PET A;  1ATG A;  4DXC A;  2XXQ A;  4IR8 A;  4F3G A;  3TCH A;  4OER A;  1XT8 A;  3E3K A;  1FTM A;  3N26 A;  1Y3N A;  4IY6 A;  3VDF A;  1MQI A;  1Q1K A;  1Y1M A;  4DIG A;  1RYO A;  3RLF E;  1IXI A;  4TOZ A;  2ZYM A;  1B7U A;  5LDZ A;  1ZJL A;  1D9Q A;  3LBS A;  4PFI A;  2E1S A;  3ONM A;  4N15 A;  3U1O A;  3B6T A;  3KN3 A;  1YTV A;  1P1Q A;  4PAI A;  4JXI A;  3E78 A;  1YYZ A;  4OTE A;  3C4M A;  1BIY A;  2F5X A;  5FHO A;  4F2O A;  4N4U A;  3O6P A;  2I6E A;  3GLB A;  4ZE9 A;  3RPL B;  4GBW A;  2A5T A;  3C31 A;  2RCB A;  1LBV A;  2XWI A;  3PAM A;  2O7U A;  4IO7 A;  3KSJ A;  4PE3 A;  3G7W A;  2ZYO A;  1ZBM A;  4TLM B;  5H8N B;  3PGF A;  1I6A A;  4HCW A;  3TTM A;  3FBP A;  5EHM A;  4MLV A;  3M3K A;  1MXY A;  2DE4 A;  1OMP A;  2F7C A;  2Y7W A;  4RK2 A;  1PB7 A;  4G77 A;  2VD3 A;  2QRY A;  2UYE A;  4NF8 B;  5HPQ A;  1OVB A;  1S9T A;  3Q29 A;  2FIX A;  4R9G A;  1B1X A;  1DTG A;  2I3W A;  1JEU A;  3CVG A;  5EQ7 A;  2DS9 A;  1FQE A;  1LCT A;  4IB2 A;  4H45 A;  5I2K B;  1EZP A;  2UVJ A;  4EQ7 A;  5IZ1 A;  3IFC A;  5I2N B;  5M2V A;  1NV4 A;  3PPO A;  3JYR A;  3O9P A;  3IOU A;  4JVD A;  3WAE A;  2IA4 A;  1NFT A;  4XXU A;  2G29 A;  2I4C A;  3P7I A;  3IOV A;  1LCF A;  1N3W A;  3R7X A;  1FBH A;  4PAF A;  3H06 B;  4O3B A;  3HCQ A;  2WBD A;  4O3A A;  4H65 A;  2DXY A;  2DSF A;  1G0H A;  3PPQ A;  4LAT A;  4I9D A;  3B50 A;  4UAB A;  3OEL A;  3VXC A;  3KC1 A;  3VLV A;  1MPB A;  1NUY A;  4NF5 A;  2ONR A;  1B46 A;  4GWW A;  4RA1 A;  5FTH A;  2O1M A;  2XXW A;  1GV8 A;  3TEL A;  2CZH A;  4U1Z A;  2H5Y A;  4YKJ A;  5A5L A;  3R6U A;  3LSW A;  5IM2 A;  1JEV A;  3RTF B;  4KQP A;  4OET A;  1NUW A;  3FVK A;  4O8M A;  5ISU A;  4PFB A;  4N8Y A;  3FJG A;  3C34 A;  3TTK A;  3I3V A;  2R6G E;  1VSO A;  3TQL A;  4H5F A;  4NWC A;  3KN8 A;  2VOZ A;  4U23 A;  1UTB B;  4ZEC A;  1I6Q A;  3WAF A;  2XXR A;  3A09 A;  1IME A;  4G68 A;  2QS3 A;  4YAH X;  4YKP A;  4PCD A;  1LBB A;  2VD2 A;  2W7Y A;  2QFL A;  4PDH A;  2F36 A;  3MUQ A;  3K1N A;  2XX8 A;  1LLS A;  1K9Z A;  2UVI A;  3G3H A;  1H44 A;  4GOT A;  4WEP A;  4DXB A;  1EYK A;  5BWJ A;  3EKI A;  1B6H A;  3BIG A;  2GQ1 A;  1MXW A;  3D4C A;  4GQO A;  5IGA A;  2PVU A;  5CMM A;  3CFL A;  4YZZ A;  5DEX A;  3FXB A;  4XFE A;  1NNP A;  1H43 A;  3IK6 B;  2Y7R A;  1LBY A;  4GL0 A;  1SI1 A;  4JVC A;  3HPI A;  1MQG A;  4NED A;  2XWO A;  4QBA A;  1YAE A;  3OO6 A;  2NVU B;  3B8B A;  1FPF A;  4G4P A;  1FW0 A;  2YJP A;  4FIM A;  4PBQ A;  2V25 A;  3HN0 A;  2Z22 A;  5LTC A;  1XVX A;  2PT2 A;  3IFA A;  3FVN A;  3GBA A;  2F6P A;  2B4M A;  3IJO B;  2P2A A;  3PUZ E;  2HEU A;  1FTK A;  4HTG A;  4NF4 B;  3MP1 A;  4FEC A;  2DDK A;  4F29 A;  4OEN A;  3IO4 A;  4R6K A;  1NNK A;  4N91 A;  1H3D A;  3DRG A;  5H8H B;  3EQ1 A;  1WVJ A;  1US5 A;  1EU8 A;  3TDJ A;  4NG7 A;  3DRH A;  4ECF A;  2ZYK A;  2QL3 A;  4RXL A;  2OJT A;  3VVF A;  1UIV A;  2P0S A;  5DYH A;  4I40 A;  3S9N C;  1Y4T A;  5ET8 A;  3TAJ A;  4I1D A;  4E0X A;  3T96 B;  3TZA A;  1B58 A;  4LZ8 A;  1K9Y A;  2OBG A;  3RN8 A;  4G8N A;  5EYF A;  3VLU A;  3OOA A;  4F18 A;  2XWV A;  2V4C A;  3Q28 A;  4ZDM A;  5A5X B;  3CR9 A;  1FBG A;  1MRP A;  3A3U A;  3T66 A;  2Y7K A;  3TTR A;  1S50 A;  4QFL A;  4U1O A;  4H46 A;  1SW1 A;  2Y84 A;  5T3J A;  1R1N A;  4KHZ E;  3FXQ A;  5I57 A;  1SBP A;  3EF7 A;  4JBZ A;  4M4G A;  3DM0 A;  3N6T A;  3UA8 A;  2DE2 A;  3GXA A;  3U94 A;  3KFM A;  4P47 A;  4PGP A;  4F3S A;  3K2D A;  4GBV A;  4MNP A;  3KZG A;  4NAP A;  3L6H A;  3MZ1 A;  1XC1 A;  2O84 X;  4R6H A;  4H6D A;  5I56 A;  4IO2 A;  1DMB A;  3EHU A;  1CB6 A;  4JWY A;  4NF5 B;  4YIC A;  2Z8E A;  1NH7 A;  3ZKL A;  1MQH A;  2Q74 A;  3SKP A;  1A55 A;  3IOT A;  3I6V A;  4RJZ A;  3LSX A;  5IZZ A;  2R9J A;  1ZTY A;  2ZXT A;  4X8R A;  1FBC A;  4MBP A;  4OYV A;  5KZT A;  1PEB A;  1R6Z A;  1FJ9 A;  5AA4 B;  4MFI A;  3M3F A;  4POX A;  2WOP A;  1OQG A;  2H99 A;  5I59 A;  1DPE A;  2GHB A;  2CEY A;  3RTW B;  1B0L A;  4KPT A;  2XXP A;  4ONY A;  3HST A;  3QYT A;  3SEU A;  5H8F B;  4HE1 A;  2Q2C A;  5DVJ A;  4X04 A;  4AS5 A;  2QS1 A;  3H3G A;  1BTJ A;  4NF6 A;  2I0B A;  1INP A;  4ZE8 A;  4ELP A;  1FTL A;  3MWB A;  2FNC A;  2V84 A;  3QUF A;  3QXM A;  2XXV A;  1NUX A;  3QUJ A;  4Q5T A;  1IXG A;  5DTB A;  2P3V A;  4MMP A;  3ECR A;  3IX1 A;  3SZP A;  1IMF A;  2FBP A;  3BKI B;  3W15 C;  3QSL A;  1EYI A;  1I6B A;  3T9X B;  1NH8 A;  1MM6 A;  3O28 A;  4N07 A;  1MPC A;  3MQ9 A;  5B70 A;  4GWY A;  3QAX A;  1R9Q A;  2ZNT A;  2Y5L A;  2ZNU A;  2CZI A;  3K6V A;  1LFG A;  1SI0 A;  1A7L A;  4GVO A;  2R71 A;  4POW A;  3TOD A;  4OES A;  3EHS A;  4MCO A;  2O68 A;  4OFJ A;  3VXB A;  1M5F A;  5ITP A;  1IXH A;  5EQA A;  4GIZ A;  4LA9 A;  2YLN A;  4KYE A;  3MC2 A;  5I84 A;  3OXN A;  4ESW A;  1ZMG A;  2F7B A;  5F1Q A;  3U72 A;  2ONK E;  5IZ3 A;  2E0S A;  1HSJ A;  1OIB A;  4Q30 B;  1BP5 A;  4OVR A;  2PYY A;  4IO5 A;  4OVJ A;  2ESN A;  1QW0 A;  3IOW A;  2F34 A;  1LBZ A;  2P1S A;  3K1P A;  5ESY A;  5JK4 A;  1FPI A;  5ET5 A;  1M5E A;  4LUB A;  1A54 A;  3N5L A;  4R6Y A;  3MBP A;  1MY2 A;  4LN5 A;  5AE4 A;  4PP0 A;  4IY5 A;  3RPW A;  5CC2 A;  1D4N A;  3R26 A;  1B52 A;  4TLL B;  2LAO A;  4P8B A;  3FAT A;  1DK4 A;  3MJN A;  2THI A;  3Q25 A;  5EYG A;  2XX7 A;  3IR1 A;  3QMF A;  2I3V A;  2OWS A;  5CM6 A;  3OO9 A;  2XD2 A;  3KGC A;  4RPO A;  1BKA A;  1Z7N E;  3DRF A;  3MP8 A;  1ZU0 A;  3S4U A;  3D1R A;  4RY1 A;  4ISU A;  5L9S A;  1YPN A;  1B5I A;  3MPK A;  4QFO A;  4N6P A;  3FVG A;  1LGB C;  2WOK A;  1US4 A;  3NOH A;  2A5T B;  1UTH B;  2RC8 A;  1FSA A;  5I57 B;  3PMW A;  4AB6 A;  2DWJ A;  5I2N A;  4OAN A;  1QUL A;  2ZZX A;  1B3G A;  2D5W A;  2OLB A;  2Q8M A;  4X1B A;  4EQB A;  3I5O A;  3DP4 A;  5H8N A;  5CBR A;  1TWY A;  1B3H A;  1B5H A;  4IO3 A;  1POT A;  4YMA A;  1LBX A;  4LP2 B;  1MH3 A;  3UGW A;  1KZ8 A;  4PC9 A;  2G93 A;  3K1M A;  5EYH A;  2UXA A;  1NV3 A;  3BFT A;  4HE0 A;  4NMY A;  3G3G A;  1OQH A;  1IIT A;  1FPE A;  3TTL A;  2CEX A;  1SDX A;  3QK6 A;  4QRZ A;  4MNI A;  3C32 A;  3MP6 A;  2I58 A;  2HFB A;  1TFA A;  4TQU Q;  1RKM A;  4EUO A;  3B6W A;  3ILU B;  3H7M A;  4R2B A;  2DQV A;  3CSG A;  3ZS6 A;  3O2A A;  4QSD A;  4HE2 A;  5TPA A;  3CG3 A;  3G3F A;  1B7Z A;  3TYH A;  4QSC A;  1B4Z A;  4UA8 A;  4OEU A;  3T22 A;  4BDO A;  4ND9 A;  2KR0 A;  4K3F A;  4EXL A;  2GRV A;  2XXY A;  4AB5 A;  2F97 A;  3OSQ A;  4MEV A;  3H6U A;  5DT6 A;  3K6U A;  4F1V A;  3IB0 A;  2I48 A;  3PD9 A;  4NTL A;  1FPG A;  1QKB A;  4LZ7 A;  3KSX A;  3RYA A;  3VE1 B;  3V5A A;  1HSL A;  3PPP A;  5ELV A;  3KOS A;  3MVX A;  2V3U A;  2ONS A;  3EPE A;  1D9Y A;  1LFI A;  1B32 A;  4MJO A;  2AIX A;  3KN7 A;  3IB2 A;  1FTA A;  1JW1 A;  4P56 A;  3BBR A;  2GHA A;  3VLW A;  5CBS A;  2REJ A;  2D3I A;  1NKX A;  1NV6 A;  2QVR A;  2DE3 A;  2VT5 A;  3CIJ A;  4WED A;  1MQJ A;  2Y7P A; 
#chains in the Genus database with same CATH homology
 3OEM A;  3U92 A;  1URD A;  4DCX A;  3T96 B;  5AA2 B;  4G68 C;  1PDA A;  2QJE A;  3TZA A;  2HXW A;  3O29 A;  3K6X A;  5B7D A;  3Q26 A;  1B58 A;  1D3K A;  2GH9 A;  4XKR A;  4LZ8 A;  4BDR A;  5AA2 D;  5BUU A;  5ITO A;  2OBG A;  1ELJ A;  4G68 B;  3MZB A;  1VFE A;  2CMO A;  3K0V A;  1P1U A;  2KLF A;  5FHN A;  3RN8 A;  4G8N A;  1FQD A;  4H1X A;  1H45 A;  1M5C A;  4GL8 A;  5H8H A;  2Q9T A;  5EYF A;  3VLU A;  1USY H;  3OOA A;  4YMB A;  3GBB A;  1AIV A;  4F18 A;  4HCY A;  5TU0 A;  1H76 A;  4QFN A;  2RIN A;  3Q28 A;  4RYA A;  4ZDM A;  4F1U A;  2V3Q A;  5A5X B;  2B3F A;  2HAU A;  3CR9 A;  4H67 A;  5F7V A;  3U93 A;  5IAI A;  1MRP A;  3TCF A;  4GD5 A;  3A3U A;  3IL1 B;  4R2F A;  2QSX A;  1ZIU A;  3T66 A;  2Y7K A;  3TTR A;  4I62 A;  1S50 A;  4QFL A;  2M8C A;  4Q8R A;  4OQO A;  4U1O A;  3RY3 A;  5I59 B;  4U4X A;  2UVG A;  1FTO A;  3SES A;  5LOM A;  1SW1 A;  2Y84 A;  4NF4 A;  5FHM A;  2QS2 A;  2NWJ A;  1R1N A;  2ZYN A;  3DP8 A;  4KHZ E;  4QF9 A;  5AA3 A;  5J1D A;  3IAZ A;  3FXU A;  4LQ5 A;  1N3X A;  4FAT A;  3FXQ A;  1VE4 A;  1IUD A;  1B5J A;  4YB5 A;  2DP8 A;  1SBP A;  3HHF A;  3EF7 A;  3PPR A;  4JBZ A;  4M4G A;  1LAF E;  3DM0 A;  1R9L A;  4H8I A;  4Q0C A;  2VGQ A;  3N6T A;  3UA8 A;  2DE2 A;  3PMV A;  3GXA A;  1N84 A;  3U94 A;  3KFM A;  1GTK A;  2DVZ A;  2X7Q A;  1A99 A;  1VR5 A;  5HBC A;  1IIW A;  1N7X A;  3K2D A;  4F3S A;  5IKB A;  3PUY E;  1RYX A;  4RK9 A;  1IQ7 A;  5CI5 A;  5CMB A;  5KDT A;  1NNT A;  4L17 A;  1B9J A;  3S9L C;  3MZ9 A;  4KFQ A;  4XKP A;  2H4I A;  3TMG A;  1MY4 A;  4NF6 B;  4G2Z A;  2Z23 A;  2GFE A;  1LST A;  2Q88 A;  3KZG A;  4KCD A;  3UK4 A;  2PMS A;  3L6H A;  3MZ1 A;  3UIF A;  1XC1 A;  4PFY A;  2BJJ X;  1OLC A;  2O84 X;  2V3T A;  4R6H A;  2ALU A;  3TUS A;  4H6D A;  5A5X A;  1N76 A;  2WKY A;  5I56 A;  4IO2 A;  1DMB A;  3TPA A;  2B3B A;  3H6T A;  2CZL A;  3EHU A;  4LQ2 A;  3T9V A;  1CB6 A;  3TCG A;  2HZK A;  4JWY A;  4NF5 B;  3MVW A;  1A8E A;  4YIC A;  3S2V A;  1LFH A;  1II5 A;  2OK2 A;  1OVT A;  2Z8E A;  1UTB A;  3N94 A;  1JQF A;  2YPN A;  2O6A A;  4WXJ A;  1AOV A;  2QMW A;  3PD8 A;  4PE5 B;  1NH7 A;  3ZKL A;  1MQH A;  1MH4 A;  2OCU A;  3OMB A;  3V89 B;  5KCJ A;  2PBW A;  3SET A;  4ZZE A;  1A55 A;  3SKP A;  3PUX E;  3IOT A;  4BDL A;  3H4Z A;  1B7H A;  5H8F A;  1Y4C A;  4GRK A;  3I6V A;  1UTH A;  3EN3 A;  4RJZ A;  4PFU A;  1B51 A;  4MH5 A;  3LSX A;  3LVU A;  1ANF A;  4R74 A;  2F6G A;  3TTN A;  1EH3 A;  4FEB A;  5DVI A;  2R9J A;  4RPN A;  1ZTY A;  1PC3 A;  2ZXT A;  3PU5 A;  4QFP A;  4YB7 A;  4F2Q A;  4HW8 A;  3VVD A;  3FXR A;  4MBP A;  1MY0 A;  4OYV A;  5KZT A;  1PEB A;  4H8J A;  3TQW A;  1I69 A;  1R6Z A;  3UOR A;  3ZKK A;  3O97 A;  2H9B A;  5AA4 B;  4MFI A;  1IZ1 A;  3USD A;  1MM7 A;  1XHY A;  1JW4 A;  2NOO A;  1PBP A;  2HAV A;  3M3F A;  4POX A;  2WOP A;  5HM4 B;  1SQY A;  2O1L A;  1XOC A;  1OQG A;  3CG1 A;  4DZ1 A;  2H99 A;  5H8S A;  5TP9 B;  5I59 A;  4OXV A;  4PET A;  1DPE A;  1ATG A;  1FTJ A;  3DLN A;  1MXX A;  1NMU A;  2GHB A;  4DXC A;  2ANJ A;  4ZEK A;  3RTW B;  5DVF A;  1GR2 A;  1B0L A;  2XXQ A;  1B3L A;  4KPT A;  1KWH A;  4MLQ A;  4O3C A;  4EF2 A;  3O6G A;  4F3G A;  3TCH A;  4OER A;  3FTO A;  4OFO A;  1XT8 A;  2XXP A;  3O6I A;  4ONY A;  3E3K A;  1FTM A;  3G3I A;  1Y3N A;  1LAX A;  3N26 A;  4IY6 A;  3HST A;  4OEV A;  4OFL A;  3OEK A;  3QYT A;  3VDF A;  1EZO A;  1OLA A;  1MQI A;  3SEU A;  1Q1K A;  3OO7 A;  1Y1M A;  5H8F B;  4DIG A;  2AL5 A;  5KDT B;  2Q2C A;  4Z0I A;  3O6H A;  5DVJ A;  2REG A;  3M8U A;  1RYO A;  3RLF E;  2QS1 A;  1IXI A;  4TOZ A;  4ZED A;  3V83 A;  3H3G A;  1BTJ A;  1JVY A;  2I0B A;  2ZYM A;  4NF6 A;  4U21 A;  4LVQ A;  1B7U A;  4WKM A;  4ZE8 A;  2DWA A;  4ELP A;  1FTL A;  5AA1 A;  1ZJL A;  3MWB A;  3LBS A;  1P1W A;  5K2Y A;  2FNC A;  1FQB A;  2V84 A;  1ZKB A;  3QUF A;  4JWX A;  1B3F A;  2E1S A;  3ONM A;  3L6G A;  3N6U A;  1MXV A;  3DRI A;  3QXM A;  3SEW A;  1SW2 A;  3B6T A;  2XXV A;  3TEL A;  3KN3 A;  3U1O A;  1YTV A;  3H6V A;  1P1Q A;  1T0K A;  1TT1 A;  2QMX A;  4FE8 A;  4JXI A;  2NUV A;  4P0I A;  3QUJ A;  4Q5T A;  3RT8 A;  1IXG A;  2XD3 A;  5DTB A;  4OTE A;  2XXI A;  3C4M A;  1BIY A;  2F5X A;  2VP1 A;  5FHO A;  4F2O A;  3ECR A;  3IX1 A;  3O6P A;  2I6E A;  2F7A A;  1J1N A;  3GLB A;  4ZE9 A;  4JDF A;  1A8F A;  2A5T A;  5I58 A;  3C31 A;  2RCB A;  3PUW E;  5L9M A;  5CMK A;  2A5S A;  3PAM A;  1QJM A;  1AMF A;  1VFD A;  2O7U A;  3BKI B;  3C35 A;  1QVS A;  3LSL A;  4IO7 A;  1L5T A;  3W15 C;  3QSL A;  1Y3Q A;  3CI8 A;  3KSJ A;  4U22 A;  1I6B A;  3T9X B;  4ZS9 A;  1NH8 A;  3G7W A;  1MM6 A;  3O28 A;  4N07 A;  2ZYO A;  1MPC A;  3MQ9 A;  3W9W A;  5B70 A;  2O7I A;  3QAX A;  1R9Q A;  1AH5 A;  1ZBM A;  4PQJ A;  4TLM B;  3SEY A;  5H8N B;  1JNF A;  1LBC A;  2ZNT A;  3FAS A;  3PGF A;  1I6A A;  2ZNU A;  3OO8 A;  4HCW A;  3TTM A;  4JSD A;  3H03 A;  3FJ7 A;  1CE2 A;  1TXF A;  3G3K A;  5EHM A;  4MLV A;  3K6V A;  1LFG A;  3MVZ A;  3M3K A;  1SI0 A;  3KEI A;  1A7L A;  1MXY A;  4GVO A;  1YCJ A;  2R71 A;  5H8Q B;  4F31 B;  4ZZA A;  4POW A;  2DE4 A;  4ZEF A;  3FD3 A;  5I57 B;  3TOD A;  4BDM A;  2H25 A;  1OMP A;  4OES A;  1P1N A;  3EHS A;  2O68 A;  4OMB A;  1PB9 A;  2F7C A;  2Y7W A;  4OFJ A;  4RK2 A;  1PB7 A;  3SEX A;  1WDN A;  4G77 A;  2VD3 A;  3VXB A;  1M5F A;  1SW5 A;  2QRY A;  5ITP A;  1B2H A;  1IXH A;  4Z7E A;  2UYE A;  4GIZ A;  4NF8 B;  2WOL A;  4LA9 A;  1F9B A;  1URS A;  2YLN A;  3K01 A;  1OVB A;  3LSF B;  4KI0 E;  4KYE A;  3MC2 A;  1S9T A;  3Q29 A;  4XTC Q;  5I56 B;  3MVY A;  5I84 A;  3OXN A;  4GF8 A;  4R9G A;  4ESW A;  1ZMG A;  2F7B A;  1B1X A;  3DEL B;  3T9U A;  3ZSF A;  5F1Q A;  1DTG A;  2I3W A;  3T9H B;  1JEU A;  4M1V A;  2OZZ A;  3CVG A;  2DS9 A;  3SER A;  3U72 A;  3RT6 B;  1FQE A;  1P1O A;  2ONK E;  2E0S A;  2ZNS A;  5JEI A;  1LCT A;  1HSJ A;  1UQW A;  1MXU A;  1OIB A;  1BLF A;  3MAM A;  4IB2 A;  1HSE A;  1B05 A;  5I2K B;  1EZP A;  2D21 A;  2UVJ A;  4Q30 B;  3PV0 E;  3K6W A;  1BP5 A;  1GVC A;  4EQ7 A;  5I2N B;  4QFK A;  4IGT A;  2PYY A;  4IO5 A;  4OVJ A;  5M2V A;  2ESN A;  4F39 A;  1JW5 A;  1QW0 A;  2F34 A;  3IOW A;  1WOD A;  1QUK A;  2P1S A;  3K1P A;  4E0W A;  3ILT B;  3JYR A;  3O9P A;  3PPO A;  1S7Y A;  2RCA A;  4OWD A;  4X48 A;  4YB6 A;  5JK4 A;  1O64 A;  2RC7 A;  3IOU A;  1M5E A;  4AQ4 A;  5AA4 A;  3WAE A;  4U4S A;  4LUB A;  1A54 A;  3IJX B;  3N5L A;  3MBP A;  4R6Y A;  3TKD A;  2IA4 A;  1MY2 A;  1NFT A;  5AE4 A;  4EQ9 A;  4XXU A;  4H5G A;  4PP0 A;  3T93 B;  5JTY A;  2G29 A;  4IY5 A;  1SYH A;  3RPW A;  5CC2 A;  5KCJ B;  5DEX B;  1M5D A;  1D4N A;  3FVO A;  3R26 A;  1B52 A;  2I4C A;  4JWO A;  4TLL B;  5FTI A;  2LAO A;  4UAC A;  4C1U A;  4F3B A;  4XIG Q;  3MW0 A;  3P7I A;  1D9V A;  1MG1 A;  3FAT A;  2XX9 A;  1LCF A;  1N3W A;  4PFW A;  2THI A;  2PX1 A;  3IOV A;  3MJN A;  1MY3 A;  3R7X A;  3H06 B;  3Q25 A;  4ELR A;  4ESX A;  4O3B A;  2AL4 A;  2XX7 A;  2XXU A;  1LB8 A;  3IR1 A;  2I3V A;  3THI A;  3HCQ A;  2OWS A;  4RNS A;  5CM6 A;  1M5B A;  3HV1 A;  4O3A A;  3OO9 A;  2XD2 A;  3KGC A;  3FJM A;  4RPO A;  4H65 A;  4P0G A;  2DXY A;  2X7P A;  4DLD A;  1BKA A;  2DSF A;  3PPQ A;  1Z7N E;  3DRF A;  4I9D A;  1DPP A;  2RF1 A;  4LAT A;  1NL5 A;  3MP8 A;  3OEL A;  5ICQ A;  1TFD A;  3RNN A;  2Y7I A;  2XHD A;  3KJ7 A;  1ZU0 A;  3VXC A;  3S4U A;  1URG A;  4F19 A;  3VLV A;  3CHG A;  1MPB A;  5HPQ A;  1SD3 A;  4RY1 A;  4NF5 A;  2ONR A;  1FQC A;  2FYI A;  3E4R A;  4F22 A;  1B46 A;  2Z8F A;  4P11 A;  4RA1 A;  1PB8 A;  4ISU A;  2Q2A A;  5FTH A;  2O1M A;  3ODB A;  1MQD A;  3SDF A;  5L9S A;  3M3L A;  1YPN A;  1B5I A;  4ZEB A;  3RQT A;  3C33 A;  3A3C A;  2XXW A;  4QFO A;  3MPK A;  4MF3 A;  4N6P A;  3FVG A;  1GV8 A;  2Q8J A;  3RGY A;  1LGB C;  1Q35 A;  2WOK A;  3LC8 A;  4LZ5 A;  1US4 A;  3TEP A;  2A5T B;  5I58 B;  4QSE A;  1UTH B;  2RC8 A;  4ZEI A;  4U1Z A;  1B1H A;  1N04 A;  3PMW A;  2H5Y A;  2DWJ A;  4AB6 A;  4EDP A;  5I2N A;  4YKJ A;  3AXF A;  3IO6 A;  3LSW A;  1JEV A;  3R6U A;  3RTF B;  3UP9 A;  4BDQ A;  1QUL A;  1B3G A;  2D5W A;  4PFT A;  4KQP A;  3DP6 A;  4OET A;  2OLB A;  3FGS A;  4YU0 A;  3FVK A;  1SYI A;  3OSR A;  5ISU A;  4X1B A;  4U2R A;  1SW4 A;  3I5O A;  4XKN A;  3C34 A;  3FJG A;  3DP4 A;  4EQB A;  2OWT A;  3C9H A;  3TTK A;  5H8N A;  5CBR A;  1TWY A;  3I3V A;  1B3H A;  2R6G E;  1JET A;  2V93 A;  1VSO A;  2IEE A;  2O69 A;  1B5H A;  4IO3 A;  3TQL A;  1POT A;  4YMA A;  1ZLQ A;  4GWO A;  1FQF A;  3CFZ A;  4FJP A;  3FUZ A;  3FZV A;  4H5F A;  1MH3 A;  4LP2 B;  4NWC A;  4QHQ A;  3UGW A;  4DDD A;  3KN8 A;  4YKK A;  2VOZ A;  4X9T A;  5H8Q A;  4F1Y A;  3FV2 A;  1MPD A;  1Y9U A;  4JSO A;  2G93 A;  4U23 A;  2DOJ A;  3K4U A;  1NNF A;  1UTB B;  3K1M A;  3VV5 A;  4BLA A;  2UXA A;  1O63 A;  4IO4 A;  1B4H A;  3BFT A;  4ZEC A;  1I6Q A;  3JZJ A;  4C0R A;  4ELQ A;  3WAF A;  4NMY A;  2XXR A;  3G3G A;  5AA2 A;  1OQH A;  3CFX A;  1IIT A;  2HQ0 A;  3A09 A;  3TTL A;  3V8X B;  2H98 A;  4G68 A;  2QS3 A;  4YAH X;  1SDX A;  3KJT A;  5EHS A;  3QK6 A;  4QRZ A;  4HS7 A;  4YKP A;  1QUJ A;  1LBB A;  1Y3P A;  1B40 A;  2VD2 A;  3DRJ A;  1LB9 A;  2W7Y A;  3C32 A;  3K00 A;  3LUY A;  3MP6 A;  4KYS A;  3IB1 A;  4THI A;  2I58 A;  4JB7 A;  5K2X A;  2HFB A;  2RKM A;  2F36 A;  3KOT A;  1TFA A;  2UYF A;  4KR5 A;  3KG2 A;  3MUQ A;  1O7T A;  4TQU Q;  1RKM A;  1MDQ A;  2I49 A;  3K1N A;  2DXR A;  2F8D A;  4EUO A;  2XX8 A;  4ELO A;  1LLS A;  3B6W A;  2AYS A;  1AL3 A;  3ILU B;  3H7M A;  3O66 A;  1FQA A;  2UVI A;  4R2B A;  1QKA A;  4GXS B;  3G3H A;  4EXK A;  1H44 A;  2DQV A;  2HZL A;  4GOT A;  4WEP A;  4BDN A;  4DXB A;  3CSG A;  3ZS6 A;  2FA7 A;  5I57 A;  3O2A A;  4IO6 A;  1B0H A;  4QSD A;  5CMC A;  5BWJ A;  5TPA A;  4DCY A;  1FCK A;  3CG3 A;  3E13 X;  3OD7 A;  3S9M C;  1B6H A;  3D4G A;  3G3F A;  1QUI A;  1B7Z A;  2DVC A;  1SVX B;  4YKI A;  3KBR A;  3TYH A;  4QSC A;  1B4Z A;  1MS7 A;  1MXW A;  3D4C A;  4GQO A;  4UA8 A;  4OEU A;  2B65 A;  2PVU A;  4GLI A;  5CMM A;  4OHN A;  1MDP 1;  3CFL A;  4YZZ A;  3C36 A;  5JTY B;  3T22 A;  5DEX A;  3LR1 A;  4BDO A;  3S9E A;  4ND9 A;  1NNP A;  3PPN A;  1H43 A;  3IK6 B;  4XKQ A;  2Y7R A;  3B7D A;  3HO7 A;  4H0W A;  3IOR A;  4GL0 A;  1LAG E;  1SI1 A;  2QPQ A;  4LON B;  4K3F A;  1PBQ A;  2X26 A;  2GRV A;  3HPI A;  3PMX A;  2XXY A;  4GXA A;  4EXL A;  4I8C A;  1MQG A;  4NED A;  1Y20 A;  2XXX A;  3H6W A;  2F97 A;  3OSQ A;  4AB5 A;  1YAE A;  3QIM A;  3OO6 A;  2NVU B;  3H6U A;  2I0C A;  1Y1Z A;  2I4B A;  3OEN A;  4G4P A;  4DXU A;  1MXZ A;  3SEV A;  1FW0 A;  1LAH E;  1USY E;  2ABH A;  3K6U A;  4KD5 A;  2YJP A;  4FIM A;  5DT6 A;  1EZ9 A;  5L9O A;  2XXT A;  1N7W A;  2UVH A;  2HCA A;  3PUV E;  4F3P A;  4F1V A;  2V25 A;  3HN0 A;  2PT1 A;  2I48 A;  3IB0 A;  4NF8 A;  3PD9 A;  2Z22 A;  4R73 A;  5ICT A;  3BFU A;  1XVX A;  4NTL A;  4FAJ A;  2NXO A;  4C1T A;  2PT2 A;  3RYB A;  5CRY A;  1JVX A;  3F11 A;  3FVN A;  3CSB A;  1QKB A;  4FED A;  4GFR A;  2F6P A;  3FV1 A;  3GBA A;  4FOR A;  2B4M A;  3IJO B;  2P2A A;  4KCC A;  3PUZ E;  4LZ7 A;  2F78 A;  2HEU A;  2VHA A;  3DRK A;  1FTK A;  3KSX A;  4HTG A;  3RYA A;  3K02 A;  4NF4 B;  3MP1 A;  3VE1 B;  3Q27 A;  4OZ9 A;  3CRB A;  2B4L A;  4FEC A;  3VFJ A;  3V5A A;  4F29 A;  1HSL A;  1XS5 A;  3PPP A;  3VVE A;  1B3E A;  1POY 1;  4OEN A;  1XVY A;  5L8D A;  3IO4 A;  5ELV A;  4G8M A;  4G8H A;  1NNK A;  3KOS A;  4R6K A;  3MVX A;  2QS4 A;  5TP9 A;  1GGG A;  2DWI A;  2V3U A;  5I2K A;  2ONS A;  1P99 A;  1H3D A;  1DOT A;  3EPE A;  1D9Y A;  1LFI A;  3U8Q A;  3DRG A;  1B32 A;  3EQ1 A;  5H8H B;  1WVJ A;  4NE4 A;  3W9V A;  1US5 A;  2AIX A;  3G3J A;  2Z8D A;  3KN7 A;  4R9F A;  3IB2 A;  1EU8 A;  3TDJ A;  5TPA B;  3DRH A;  1JW1 A;  4EF1 A;  2RC9 A;  4ECF A;  3TFL A;  3BBR A;  3RUM A;  2DWH A;  2GHA A;  2O51 A;  2ZYK A;  3FIR A;  4NWD A;  3VLW A;  1UIU A;  2QL3 A;  3EHT A;  4KYD A;  2XXH A;  2ZMB A;  1Z7M E;  4RXL A;  3B6Q A;  2DYX A;  3JV9 A;  3UN6 A;  2OJT A;  1A40 A;  4R75 A;  3VVF A;  5CBS A;  3GZG A;  1UIV A;  1MY1 A;  2REJ A;  2D3I A;  1NKX A;  2P0S A;  4R72 A;  1DSN A;  1IXC A;  1IEJ A;  2Q89 A;  3MPL A;  3E9X A;  3HHG A;  4X1D A;  5DYH A;  1N0T A;  3S9N C;  1Y4T A;  2DE3 A;  3CIJ A;  4N13 A;  3TAJ A;  4WED A;  4I1D A;  1MQJ A;  4DE8 A;  1DTZ A;  4E0X A;  2Y7P A;  4IGR A;  2F35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...