2Z23A

Crystal structure of y.pestis oligo peptide binding protein oppa with tri-lysine ligand
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
517
structure length
517
Chain Sequence
ANVPTGVQLAEKQVLVRNNGSEPQSLDPHKIEGVPESNISRDLLEGLVINDPNGNIVPGAAESWDNKDFKVWTFNIRKDAKWSNGDPVTAQDFVYSWQRLADPKTVSPYASYLQYAHLTNIDDIITGKAAPDTLGVKALDDHTLEVTLSEPVPYLDKLLAHPLMSPVNKTVVEKFGEKWTQPQNFVGNGAYKLKDWIVNERIVLERSPTYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPDQVHVDPYLCTYYYEINNQKAPFTDARVREALKLGMDRDIIVNKVKNQGDLPAYGFTPPYTSGAELTPPEWFSWTQEKRNEVAKKLLAEAGYTKDNPLKFSLLYNTSDLHKKLAIAAASIWKKNLGVDVKLENQEWKTFLDTRHQGTYDVARAAWCADYNEPSSFLNMMLSNSSNNTTHYKSSVFDKLIEDTLKVKSEKERADLYQQAEIQLDKDSAIVPVFYYVSARLVKPYVGGYTGKDPLDNMHVKDLYIIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Periplasmic oligopeptide-binding protein
publication title Structures of OppA and PstS from Yersinia pestis indicate variability of interactions with transmembrane domains.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Peptide binding protein
total genus 173
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2z23A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z23A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 2z23A02
4M4GA 4F29A 3S4UA 3OEKA 4JXIA 1MRPA 3TDJA 1OVBA 1XC1A 4KFQA 5L9OA 3KOSA 5H8QA 1M5BA 5H8SA 5TPAA 5BUUA 4X1DA 5I57A 1MY4A 3ZS6A 3ILUB 1N0TA 3K2DA 4PP0A 3OXNA 5L9MA 4BDOA 4OESA 3BKIB 4Q0CA 3M3LA 5KDTA 4IO5A 5TU0A 2XXVA 3GBBA 4F18A 3B7DA 3MZ1A 4R9GA 1MDQA 3VVFA 4FIMA 5I59B 3IX1A 4MLVA 4U21A 2OWTA 2OCUA 1BIYA 4U2RA 3DM0A 1D3KA 4R2BA 4BDQA 4KCCA 2RCBA 3LR1A 2XHDA 3SKPA 3V5AA 3G3JA 3RNNA 3TODA 3EQ1A 3T9VA 4BLAA 1VE4A 3IJXB 3PPRA 4G8NA 2Y7IA 1NL5A 3IOWA 3H6TA 5CBSA 1RKMA 3LSXA 3SEUA 4R75A 4ELQA 4OFJA 1QVSA 4F1VA 2V3QA 5DYHA 1N3XA 4ZEFA 5CMKA 1EZ9A 2F78A 3CVGA 2ZYOA 1MQHA 4HCYA 4O3AA 1RYXA 4NF8B 1PC3A 4P0GA 2X7QA 3MBPA 1UTBA 3Q29A 4IGRA 3ODBA 1MS7A 1GTKA 2UYEA 2B4LA 1MXVA 3U1OA 4DE8A 4ZEIA 3G3IA 4LUBA 1DMBA 4TOZA 2PYYA 1MH4A 1RYOA 4IO6A 2QRYA 4YKKA 1MH3A 4XKQA 1QW0A 2F6GA 2V3UA 2Z8DA 2ZXTA 3ILTB 2DSFA 3HN0A 5IKBA 3H7MA 3T66A 3MVXA 3T9HB 4U4XA 3G3HA 3SEYA 4NF6A 3MPKA 3KG2A 1AL3A 5AA2A 1O64A 1QUKA 4IGTA 2LAOA 3H3GA 3UIFA 5AE4A 1MY1A 3IO6A 3F11A 4NF8A 1N84A 3TUSA 1MQIA 4OYVA 1MY3A 3K0VA 4MF3A 1LLSA 2DVZA 4F2OA 4PFYA 1OQGA 3RY3A 4F3GA 1XOCA 2H25A 3CSBA 4EQBA 3MQ9A 4RYAA 2QS1A 1B9JA 2ANJA 4F31B 4O3CA 5TP9A 4OFOA 1POY1 3TAJA 2HAVA 2DQVA 2HXWA 2Z22A 3QSLA 3DRFA 1TWYA 1Y4TA 3IL1B 1JW5A 1B1HA 4NWCA 4H65A 1A40A 4H0WA 4BDRA 2DE2A 2HCAA 3MWBA 1QUIA 2PVUA 2P1SA 3PPQA 3IB2A 3KBRA 3TTRA 2ZMBA 3LSWA 2R6GE 4KD5A 5CBRA 5EHMA 3FXQA 3GBAA 2B3FA 3SESA 2AYSA 1FTLA 2HAUA 5CMCA 1SW5A 3Q25A 3L6HA 2XXUA 2XXIA 1H43A 1N04A 3O6HA 3A3CA 4EQ7A 2GH9A 2WOKA 1CB6A 1PB7A 3ZKKA 4QFKA 4GLIA 3K6VA 3OD7A 3TTKA 3CFZA 4DDDA 1GVCA 5A5XA 3KJ7A 3PPOA 2PX1A 4PFUA 3KJTA 1B4HA 3IO4A 3O9PA 2GRVA 4ISUA 4OEVA 1TXFA 3D4CA 3OSQA 3CRBA 3R26A 1XS5A 4Q8RA 3PV0E 2D5WA 2UVGA 3CG1A 3SEVA 1DPPA 3EHUA 4I62A 4KI0E 5I56B 1O7TA 3GLBA 3SEXA 1B7ZA 3U8QA 3IK6B 4YU0A 1IQ7A 3H4ZA 4POXA 4X1BA 3RTFB 2I4CA 4O3BA 1YAEA 2OBGA 4WKMA 4YMBA 1US4A 2UVJA 4JWOA 4KPTA 2RKMA 1H3DA 4QSCA 1SYIA 3VE1B 3MW0A 3DP8A 3WAFA 1VFEA 1LB8A 1VFDA 3TPAA 4L17A 4PQJA 4LQ5A 4OVJA 1IXIA 1POTA 4H67A 3MP8A 1LB9A 3PD8A 3VV5A 3RYBA 4G68B 4ELOA 2XXPA 3C33A 2XX9A 1PBPA 3K1NA 4MH5A 1MPBA 4ZEKA 1A55A 2X26A 1NKXA 1XT8A 3DRGA 3UK4A 4EQ9A 5I56A 4NF4A 4Q30B 3G3FA 2RC8A 3I6VA 3TQLA 2HFBA 3N26A 3PUXE 1LAFE 4OXVA 5I2KB 1SW1A 3T93B 3C36A 3RYAA 1Q1KA 5BWJA 2OZZA 1FQBA 5HM4B 4EXLA 3I5OA 5H8HA 3TFLA 1MPDA 3LBSA 3TTNA 4LZ5A 4U1ZA 4HW8A 2WOPA 2F7AA 1H45A 1EZOA 4GVOA 1LCTA 2XX7A 1B6HA 1FTMA 2YJPA 5HBCA 2M8CA 2DXYA 3FJMA 2E0SA 5H8NA 4MLQA 2NXOA 1B3FA 2KLFA 3OMBA 4XKNA 1OLAA 1URDA 3MP6A 2ESNA 4Q5TA 1S7YA 3EPEA 5DTBA 3WAEA 4AB5A 3TMGA 5EHSA 1PEBA 2I49A 4TLMB 2HQ0A 3E9XA 2A5TA 5CM6A 3S9LC 4ZEDA 1ZBMA 4JWYA 3C32A 3IOUA 3TCHA 1B51A 3MJNA 2AL4A 4EDPA 2QL3A 3PPNA 2XXYA 5F1QA 4ONYA 4IO7A 3SERA 4F3SA 1B5IA 4R73A 1BKAA 1T0KA 1YCJA 4NE4A 1I6BA 3S9NC 2RC9A 1F9BA 2F8DA 3K6UA 1PB8A 3FV1A 2ZNTA 1MG1A 3PD9A 1S50A 3OSRA 2Z23A 1MM7A 5JTYA 2V84A 1QULA 3EF7A 3KN3A 4H1XA 3S2VA 1Y20A 3UORA 3VFJA 4R6KA 4XIGQ 4QRZA 4OENA 1WODA 5AA4B 3THIA 4GFRA 2XXWA 4XKRA 2V3TA 4WXJA 1ATGA 3DP6A 3T96B 3VLVA 2Q2AA 2QJEA 3ZKLA 5DT6A 4RNSA 1LSTA 3VLUA 4XTCQ 2VD2A 3KSXA 3FIRA 3G3GA 5I58B 2HZLA 1CE2A 2B65A 4YKIA 2A5SA 3V83A 4GXAA 1SYHA 3FV2A 2H98A 3G3KA 4R9FA 3M8UA 4R74A 3EHTA 2FA7A 4F3PA 1SW2A 4XKPA 4JWXA 5ITOA 3RLFE 1Y1ZA 2HZKA 4R6YA 3TTLA 1EU8A 4I9DA 5I59A 1TFDA 4DCXA 3RQTA 3OO7A 2D3IA 1MXWA 4RPOA 1SVXB 2VP1A 1FQEA 4NF5B 4OERA 3U93A 3PUZE 3IORA 3Q26A 3QK6A 4GXSB 4POWA 3N94A 1B2HA 1USYH 5I58A 4ZE9A 1ELJA 1Z7NE 5KCJB 5AA2D 4OHNA 1GR2A 1URGA 3FZVA 1IIWA 1SD3A 3UGWA 4G77A 1PDAA 4DXCA 3Q28A 2WOLA 4M1VA 1ANFA 3L6GA 3UP9A 1IEJA 4KCDA 4F1UA 1GGGA 1A54A 2QSXA 3RUMA 3MVYA 3BFTA 3A3UA 3OELA 2ALUA 4IO2A 3IB0A 4NTLA 5F7VA 3IB1A 1P1OA 4F3BA 2IEEA 1B46A 1JNFA 3PUVE 3RGYA 3BFUA 5K2XA 4H8JA 2RCAA 4YB7A 2YPNA 3TYHA 3GZGA 2H4IA 4KHZE 3U94A 2VHAA 1LFHA 3RN8A 4Z0IA 2G29A 3LVUA 4I8CA 3ZSFA 2F5XA 1P1WA 5ELVA 3JYRA 2Q2CA 1SW4A 1B0LA 3ONMA 3C9HA 2PBWA 1S9TA 3MPLA 1SQYA 4KYSA 3B6QA 1BTJA 1JVYA 5H8FB 4YMAA 5DVJA 2DVCA 2V25A 3V89B 3AXFA 1LBBA 3QXMA 4OMBA 3TCGA 1Y3PA 4OTEA 3JZJA 4U22A 3DLNA 4H6DA 3OO6A 3DRJA 1I6AA 5K2YA 3MUQA 4GF8A 4FEDA 1ZTYA 1IXCA 1D9VA 1M5CA 4JSDA 1D9YA 3DP4A 4YICA 1ZIUA 1XVYA 4G4PA 4QSEA 5I2NB 4F1YA 1LBCA 3UA8A 4JDFA 4THIA 1R1NA 3O28A 4IY5A 3MP1A 1L5TA 3IOTA 1JW4A 3VDFA 5AA1A 4BDLA 2QMXA 2GFEA 3CG3A 2ZNSA 1P99A 4WEDA 3O6PA 3DRHA 4KQPA 1WVJA 1YPNA 1OLCA 2NWJA 3G7WA 1AOVA 1N7WA 1LFIA 4E0WA 3KZGA 3DRKA 1FTJA 3RT6B 4KR5A 2O68A 4ECFA 3K1PA 2H99A 1FW0A 3B6TA 4G8MA 3KSJA 4GRKA 4RY1A 4YB6A 4QSDA 4DXBA 5DVIA 2DYXA 2I58A 3FJ7A 3TTMA 2ZYNA 3IOVA 2O51A 3FUZA 1BP5A 4QFLA 2DP8A 3CFLA 1B3EA 3RT8A 2I0CA 3IJOB 4PE5B 3O29A 4QFPA 3PUWE 1Y3NA 1ZU0A 2Q8JA 3A09A 3PGFA 4YAHX 3C4MA 1FTOA 3P7IA 2DWJA 4ZDMA 2UYFA 4EF2A 1OMPA 2ONKE 3LSLA 4JSOA 5IAIA 3VXCA 3RPWA 1JQFA 3VLWA 2NVUB 3H6WA 2ZYMA 3CR9A 3HHGA 4OZ9A 4H5GA 3FJGA 3OO9A 2Z8FA 1B5JA 3PMXA 2Y7PA 4XXUA 1MY2A 5B7DA 1B40A 1UTHB 1MDP1 3TELA 3FTOA 5L9SA 2VD3A 4QFNA 5AA3A 4R72A 3TKDA 1OIBA 3QUJA 2O1LA 3QAXA 3LC8A 4G68A 4YB5A 1URSA 5H8QB 3CSGA 4ESXA 3C34A 5CMMA 5I57B 4LP2B 2XD2A 1Q35A 2F36A 3Q27A 4AB6A 5KDTB 5J1DA 4RPNA 4H8IA 3D4GA 3MVWA 3QUFA 4HCWA 2OWSA 3JV9A 2P0SA 3OO8A 1QJMA 4HTGA 1O63A 4K3FA 5I2KA 2RF1A 4DIGA 3FATA 3E4RA 2O84X 3LUYA 4FECA 2THIA 5I84A 3K02A 5CRYA 1UTHA 5JK4A 1MQJA 4QHQA 1MM6A 1Y4CA 2QMWA 4ZEBA 5JEIA 1DTGA 4DXUA 3SDFA 4RA1A 3R7XA 1Y3QA 3K4UA 4C1TA 4WEPA 3LSFB 1B3LA 2CMOA 4TQUQ 4UACA 3CIJA 4BDNA 4GD5A 2XX8A 2UXAA 1FQAA 3OENA 1FTKA 3T9XB 4LVQA 1IXHA 1A99A 3PMWA 4KYDA 1R6ZA 1MXZA 2PT2A 4FORA 2B4MA 4ELRA 3VVDA 2UVHA 1DPEA 2XXXA 2V93A 1JEVA 4QFOA 1NH7A 3H6UA 1UTBB 1UIUA 3N5LA 2ONRA 2F35A 4FATA 2PT1A 3TCFA 1IUDA 1B7UA 1NNKA 1LGBC 3SEWA 3KEIA 1VSOA 4NWDA 2I48A 4EXKA 3C31A 4OFLA 3RTWB 2O1MA 1QKBA 1HSEA 2Y7RA 2D21A 4OETA 2NOOA 4X9TA 3K00A 1DTZA 2DWIA 4LONB 1EZPA 2GHBA 1OQHA 2DE4A 1JVXA 4NF6B 3PMVA 1UQWA 5AA2B 4X48A 3HHFA 3R6UA 2F34A 1MY0A 5CMBA 4ZECA 5FTIA 4F19A 1A8EA 4IY6A 1KWHA 2XXTA 5AA4A 5CI5A 4FEBA 1P1QA 1B32A 1LAGE 1B58A 3O2AA 2IA4A 3O97A 3KGCA 4PFWA 1IXGA 2QS3A 2DS9A 3H03A 2I3WA 3VXBA 4OEUA 1B1XA 1WDNA 3V8XB 1ZMGA 1AH5A 2Y84A 1FQCA 4U1OA 3HO7A 1ZLQA 2I0BA 4NMYA 3E13X 1FQFA 4Z7EA 1I6QA 1XHYA 4P11A 1NNPA 3W15C 2Q9TA 1TFAA 1B0HA 4ESWA 1M5DA 5CC2A 2DXRA 1MXYA 1QKAA 5TP9B 1JEUA 5DVFA 1HSLA 1P1UA 3QYTA 3IR1A 1VR5A 2R9JA 3VVEA 3T9UA 3FVGA 3OEMA 3S9MC 2XXQA 1AMFA 5ICTA 1Y1MA 4GQOA 2Z8EA 4N07A 2H5YA 3IAZA 2B3BA 2ONSA 1B05A 4NF5A 1FCKA 1NFTA 1SI0A 1TT1A 1GV8A 5ISUA 3PAMA 1ZJLA 2AIXA 1B3HA 2I6EA 1LFGA 4N6PA 4YKPA 3E3KA 5KCJA 1N76A 4RK2A 4HS7A 1LAHE 3FVNA 4ND9A 3EN3A 4R6HA 1BLFA 4ELPA 4QF9A 1I69A 4G68C 4LQ2A 2FNCA 2ZYKA 3OOAA 2CZLA 3M3KA 2R71A 3TZAA 1QUJA 3N6UA 4G2ZA 1MXXA 5A5XB 2QPQA 1PB9A 3K01A 1D4NA 1M5FA 2RINA 4NEDA 2F7BA 1R9LA 4IO3A 1USYE 2OK2A 1B5HA 3FVOA 1J1NA 4G8HA 3DRIA 1LAXA 4PETA 2DWAA 2W7YA 4JB7A 4TLLB 3PPPA 4PFTA 4GL0A 2Y7WA 1MQDA 3U92A 4AQ4A 4C1UA 1HSJA 4FJPA 2Q88A 1H76A 3S9EA 3HSTA 5ICQA 2VGQA 1IITA 4F39A 2YLNA 4OWDA 1NMUA 2F7CA 3FVKA 3MAMA 3MVZA 1JETA 5DEXB 5HPQA 4ZE8A 4MFIA 4OQOA 1II5A 2REGA 4RJZA 5LOMA 2XXRA 5H8FA 2UVIA 2XXHA 2AL5A 3KN7A 4DLDA 2O7UA 1MQGA 4IB2A 1B52A 5FTHA 2Q89A 4GL8A 1N3WA 1EH3A 3T22A 3O6GA 5EYFA 1PBQA 1MXUA 3TEPA 4LA9A 2WKYA 5KZTA 3KOTA 2QS2A 2NUVA 3W9WA 1IZ1A 2I4BA 4H5FA 4NF4B 2DOJA 3U72A 1US5A 3HV1A 2RC7A 1SDXA 4RXLA 2F97A 3CHGA 2Y7KA 2HEUA 5I2NA 1A7LA 2FYIA 4ZS9A 3PU5A 3H6VA 3W9VA 2O6AA 1LCFA 3MZ9A 1NNFA 3H06B 2OLBA 4GIZA 5DEXA 4GOTA 1Y9UA 2E1SA 5ITPA 3PUYE 1AIVA 5FHMA 5H8HB 1NNTA 3EHSA 5M2VA 1ZKBA 3ECRA 4ZZEA 1N7XA 1XVXA 4EF1A 2PMSA 2XD3A 1NH8A 1DOTA 1B3GA 3BBRA 1DSNA 3DELB 1H44A 3CI8A 2P2AA 3GXAA 4DZ1A 4F22A 5H8NB 2G93A 4U23A 5FHNA 4UA8A 1FQDA 4BDMA 4RK9A 2GHAA 4LZ7A 3M3FA 3TQWA 3O66A 1UIVA 3HCQA 4JBZA 4FAJA 1OVTA 3KFMA 1SBPA 4LZ8A 3MZBA 1A8FA 2OJTA 5L8DA 3FGSA 4EUOA 3FASA 2A5TB 3K6WA 1JW1A 4GWOA 4YZZA 3MC2A 4ZZAA 1B7HA 1R9QA 2O7IA 3CFXA 4P0IA 3K1MA 4MBPA 1Z7ME 2I3VA 3SETA 5TPAB 5B70A 4DCYA 3FXUA 4E0XA 2ABHA 3HPIA 3USDA 1MPCA 3I3VA 3FXRA 3C35A 4F2QA 4YKJA 3FD3A 2VOZA 1M5EA 3KN8A 3UN6A 4C0RA 2DWHA 5JTYB 1SI1A 4IO4A 1YTVA 5FHOA 1P1NA 4U4SA 2BJJX 2ZNUA 1B4ZA 2H9BA 4R2FA 3B6WA 4N13A 3O6IA 3QIMA 2O69A 4I1DA 2X7PA 2DE3A 2F6PA 3N6TA 4LATA 3K6XA 4KYEA 2QS4A 2REJA 4FE8A
chains in the Genus database with same CATH superfamily
4M4GA 4F29A 3S4UA 3OEKA 4JXIA 4N6DA 1MRPA 1FSAA 3TDJA 1OVBA 1XC1A 4KFQA 3RPLB 5L9OA 4HXVA 3KOSA 5EYGA 1M5BA 5H8QA 5H8SA 5TPAA 5BUUA 5EQ8A 4X1DA 4H46A 1MY4A 5I57A 3ZS6A 3ILUB 1N0TA 3K2DA 4PP0A 4N6KA 3OXNA 5L9MA 4BDOA 4OESA 3BKIB 4Q0CA 3M3LA 5KDTA 4IO5A 5TU0A 2XXVA 3GBBA 4F18A 3B7DA 3MZ1A 4R9GA 1MDQA 3VVFA 4FIMA 5I59B 3IX1A 4MLVA 1INPA 4U21A 2OWTA 2OCUA 1BIYA 4U2RA 3DM0A 1D3KA 4N15A 4R2BA 4BDQA 4KCCA 1LBXA 2RCBA 3LR1A 2XHDA 3SKPA 3V5AA 3G3JA 3RNNA 1K9YA 3TODA 3EQ1A 3T9VA 4BLAA 1VE4A 3IJXB 3PPRA 4G8NA 2Y7IA 1NL5A 3IOWA 3H6TA 5CBSA 1RKMA 3LSXA 3SEUA 1JP4A 4R75A 4ELQA 4OFJA 1QVSA 4F1VA 2V3QA 5DYHA 2P3NA 1N3XA 4ZEFA 5CMKA 1EZ9A 2F78A 3CVGA 2ZYOA 1MQHA 2QVVA 4HCYA 4H45A 4O3AA 2HPGA 1RYXA 4NF8B 1PC3A 3D1RA 4OVPA 4P0GA 2X7QA 3MBPA 2WBBA 1UTBA 3Q29A 4IGRA 3ODBA 1MS7A 1GTKA 2UYEA 3LV0A 2B4LA 1MXVA 3U1OA 4DE8A 2BJIA 4ZEIA 3G3IA 4LUBA 1DMBA 4TOZA 2PYYA 1MH4A 1RYOA 4IO6A 2QRYA 4YKKA 1MH3A 4XKQA 1QW0A 2F6GA 2V3UA 2Z8DA 2ZXTA 3ILTB 1FPKA 2DSFA 3HN0A 5IKBA 3H7MA 3T66A 3MVXA 3T9HB 4MJOA 4U4XA 1NV4A 4GX3A 3G3HA 3SEYA 1G0IA 4NF6A 3MPKA 3KG2A 1AL3A 1K9ZA 5AA2A 1FPIA 1O64A 1QUKA 4IGTA 2LAOA 2VPOA 3H3GA 3UIFA 4O8MA 5AE4A 1MY1A 3IO6A 3F11A 4NF8A 1N84A 3TUSA 1MQIA 4OYVA 4JVDA 1MY3A 3K0VA 4MF3A 4OVTA 1LLSA 4O94A 2DVZA 3QMFA 5I5PA 4F2OA 4PFYA 1OQGA 3RY3A 4F3GA 2HHMA 1XOCA 2H25A 1NV0A 3CSBA 4EQBA 3MQ9A 5T3JA 1DCUA 4RYAA 2QS1A 1B9JA 2ANJA 4F31B 4O3CA 1NV7A 5TP9A 2L5VA 4OFOA 1POY1 3TAJA 2HAVA 2DQVA 2HXWA 2Z22A 3QSLA 3DRFA 1TWYA 1Y4TA 3IL1B 4P1LA 1NV1A 1JW5A 1IMAA 1B1HA 4NWCA 4H65A 1A40A 4H0WA 4BDRA 2DE2A 2HCAA 3MWBA 1QUIA 2PVUA 4NGUA 2P1SA 3PPQA 3IB2A 3KBRA 3TTRA 2ZMBA 3LSWA 2R6GE 4KD5A 5CBRA 5EHMA 3FXQA 3GBAA 2B3FA 3SESA 2AYSA 1FTLA 2HAUA 5CMCA 1SW5A 3Q25A 3L6HA 2XXUA 2XXIA 4GX6A 1H43A 1N04A 3O6HA 3A3CA 4EQ7A 1FBCA 1RDXA 2GH9A 2WOKA 1CB6A 1PB7A 3ZKKA 2CEXA 4QFKA 4GLIA 3K6VA 3OD7A 3TTKA 3CFZA 4DDDA 4PAIA 1GVCA 5A5XA 3KJ7A 4P1EA 3PPOA 2ZZXA 2PX1A 4PFUA 3KJTA 1B4HA 3IO4A 3O9PA 4MCOA 2GRVA 4ISUA 4PGPA 4OEVA 1TXFA 3D4CA 3OSQA 1FBHA 3CRBA 3R26A 4GWYA 4G61A 1XS5A 1QGXA 4Q8RA 5ET5A 3PV0E 2D5WA 2UVGA 3CG1A 3SEVA 1FPLA 1DPPA 3EHUA 4I62A 4KI0E 4X8RA 1O7TA 5I56B 3GLBA 3SEXA 1B7ZA 3U8QA 1VDWA 3IK6B 1XI6A 4YU0A 3A29A 1IQ7A 3H4ZA 4POXA 4X1BA 3RTFB 2I4CA 4O3BA 4NG7A 1YAEA 2OBGA 4WKMA 4YMBA 1US4A 2UVJA 4JWOA 4KPTA 2RKMA 1H3DA 2PFZA 1DK4A 4QSCA 4PE3A 1SYIA 3VE1B 3MW0A 3DP8A 3WAFA 1VFEA 1LB8A 1VFDA 3TPAA 4L17A 4PQJA 4HE0A 4LQ5A 4OVJA 1IXIA 1POTA 3BIGA 4H67A 3MP8A 1LB9A 3PD8A 3U65A 3VV5A 3RYBA 4G68B 4ELOA 2XXPA 3C33A 2XX9A 1PBPA 3K1NA 4MH5A 1MPBA 4P47A 4ZEKA 1A55A 2X26A 1NKXA 1XT8A 3DRGA 3UK4A 4EQ9A 5I56A 4NF4A 4Q30B 3G3FA 2RC8A 3I6VA 3TQLA 2HFBA 3N26A 3PUXE 1LAFE 4OXVA 1NV5A 5I2KB 1SW1A 3T93B 3C36A 3RYAA 2XXKA 1Q1KA 5BWJA 2OZZA 1FQBA 4PDDA 5HM4B 4EXLA 3I5OA 5H8HA 3TFLA 1MPDA 3LBSA 3TTNA 4LZ5A 2WBDA 4U1ZA 4PFBA 4HW8A 2WOPA 2F7AA 1H45A 1EZOA 4GVOA 1LCTA 2XX7A 1YXIA 1B6HA 1FTMA 2YJPA 5HBCA 2M8CA 2DXYA 1NUWA 1KA0A 3FJMA 2E0SA 2R8TA 1NUYA 5H8NA 4MLQA 4AS4A 2NXOA 1B3FA 2KLFA 3OMBA 4XKNA 1OLAA 1URDA 3MP6A 2ESNA 1EYJA 4PFRA 5FBPA 4Q5TA 1YYZA 1S7YA 3EPEA 5DTBA 3WAEA 4AB5A 3TMGA 5LTCA 5EHSA 1PEBA 2I49A 4TLMB 2HQ0A 3E9XA 2A5TA 5CM6A 3S9LC 4ZEDA 1ZBMA 4JWYA 1LBYA 3C32A 3IOUA 4MX6A 3TCHA 4UABA 1B51A 3MJNA 2AL4A 3SZPA 4EDPA 2QL3A 3PPNA 2XXYA 5F1QA 4ONYA 4IO7A 2F3DA 3SERA 1B5IA 4R73A 4F3SA 1BKAA 1T0KA 1YCJA 1NI9A 4NE4A 1I6BA 3S9NC 2RC9A 1F9BA 2F8DA 3K6UA 1PB8A 3FV1A 2XWIA 2ZNTA 1MG1A 3PD9A 1S50A 3OSRA 2Z23A 1MM7A 5JTYA 2V84A 1QULA 3EF7A 3KN3A 4H1XA 3S2VA 1Y20A 3EKIA 3UORA 3VFJA 5LDZA 4R6KA 4XIGQ 1FRPA 4QRZA 4OENA 1WODA 5AA4B 3T0JA 3B8BA 3THIA 4GFRA 2XXWA 4XKRA 4PTKA 2V3TA 4WXJA 1ATGA 3DP6A 3T96B 3VLVA 2PFYA 2Q2AA 4PBQA 2QJEA 3ZKLA 5DT6A 4RNSA 1LBWA 1LSTA 3VLUA 2VD2A 3KSXA 4XTCQ 3FIRA 3G3GA 5I58B 2HZLA 1CE2A 2B65A 4YKIA 2A5SA 5F24A 3RPLA 3V83A 4GXAA 1SYHA 3FV2A 4N81A 2H98A 3G3KA 4R9FA 3M8UA 4R74A 3EHTA 2FA7A 4F3PA 1SW2A 4I40A 2OX3A 4XKPA 4JWXA 4PCDA 4N8YA 5ITOA 3RLFE 1Y1ZA 2HZKA 4XFEA 4MNCA 4R6YA 3TTLA 1EU8A 4I9DA 5I59A 1TFDA 4OANA 4DCXA 3RQTA 3OO7A 2D3IA 1MXWA 4RPOA 1SVXB 2VP1A 1FQEA 4NF5B 4OERA 3U93A 3PUZE 4NX1A 3IORA 3Q26A 3QK6A 2Q74A 4GXSB 4POWA 3N94A 2CEYA 1B2HA 1USYH 5I58A 4ZE9A 2XWKA 1ELJA 1Z7NE 1BK4A 5KCJB 4OVSA 3ISPA 5AA2D 4OHNA 1GR2A 1URGA 3FZVA 1IIWA 1SD3A 3GYYA 3UGWA 4G77A 1PDAA 2KR0A 4DXCA 3Q28A 2WOLA 1FTAA 4M1VA 1ANFA 3L6GA 3UP9A 1IEJA 2ZZWA 4KCDA 4N91A 1FBGA 4OVQA 4LN5A 4F1UA 1GGGA 1A54A 2QSXA 3RUMA 3MVYA 4N17A 3BFTA 3A3UA 2Y5LA 3OELA 2ALUA 2QVRA 1IMFA 3BIHA 4IO2A 3IB0A 4NTLA 5F7VA 3IB1A 4PAFA 3E78A 1P1OA 4F3BA 1AWBA 2IEEA 1B46A 1JNFA 3PUVE 3RGYA 3BFUA 5K2XA 4H8JA 2RCAA 4PFIA 4YB7A 4GX4A 2YPNA 3TYHA 3GZGA 2H4IA 4KHZE 3NOHA 3U94A 2VHAA 5IZ3B 1LFHA 3RN8A 4Z0IA 4XF5A 4O7MA 2G29A 3LVUA 4I8CA 3ZSFA 2F5XA 1P1WA 1NUXA 5ELVA 3JYRA 2Q2CA 1SW4A 1B0LA 3ONMA 3C9HA 2PBWA 1S9TA 3MPLA 1SQYA 3IFAA 4KYSA 3B6QA 1BTJA 3HFUA 1JVYA 5H8FB 4YMAA 5DVJA 2DVCA 3KC0A 2V25A 3V89B 4GBWA 4PF6A 3E79A 2QFLA 3AXFA 1LBBA 3QXMA 4OMBA 3TCGA 1Y3PA 4OTEA 2FBPA 3JZJA 1RDZA 4U22A 3DLNA 4H6DA 3OO6A 3DRJA 1I6AA 5K2YA 3MUQA 4GF8A 4FEDA 1ZTYA 1IXCA 1D9VA 4DI4B 1M5CA 4JSDA 4JVCA 1D9YA 3DP4A 4YICA 1ZIUA 1XVYA 4G4PA 4QSEA 1FBPA 5I2NB 3B50A 4F1YA 1LBCA 2CZKA 3UA8A 4JDFA 4THIA 1R1NA 3O28A 4IY5A 5ET7A 3MP1A 1L5TA 3IOTA 1JW4A 3VDFA 5AA1A 4OA4A 4BDLA 2QMXA 4HE2A 3RYDA 2GFEA 3CG3A 2ZNSA 4GWZA 2HXRA 1P99A 4WEDA 3O6PA 3DRHA 1FBDA 4KQPA 4PDHA 1WVJA 5EQ7A 1YPNA 1OLCA 2NWJA 3G7WA 5J16A 1AOVA 1N7WA 1LFIA 4E0WA 3KZGA 3DRKA 1FTJA 3RT6B 1DBZA 4KR5A 2O68A 4ECFA 3K1PA 2H99A 1FW0A 3B6TA 4G8MA 3KSJA 5A5LA 4GRKA 4RY1A 4YB6A 4QSDA 4DXBA 5DVIA 1IMEA 4P3LA 2DYXA 2I58A 1YZ0A 3FJ7A 3TTMA 2ZYNA 3IOVA 2O51A 3FUZA 1BP5A 4QFLA 2WYPA 2DP8A 3CFLA 1B3EA 3RT8A 2I0CA 1NUZA 2PCRA 3IJOB 4PE5B 3O29A 4QFPA 3PUWE 1Y3NA 5IZZA 1ZU0A 2Q8JA 3A09A 3PGFA 4YAHX 3C4MA 1FTOA 1EYKA 3P7IA 2DWJA 4PC9A 4ZDMA 2UYFA 5EQAA 4EF2A 1OMPA 2ONKE 3LSLA 4JSOA 2FHYA 3LUZA 5IAIA 3VXCA 3FBPA 3RPWA 1JQFA 3VLWA 2NVUB 5I7IA 3H6WA 2ZYMA 3CR9A 3HHGA 4OZ9A 4H5GA 3FJGA 2CZHA 3OO9A 2Z8FA 4NF0A 1B5JA 3IFCA 3PMXA 2Y7PA 4XXUA 3T1BA 1MY2A 5B7DA 1B40A 1UTHB 1MDP1 3TELA 3FTOA 5L9SA 2VD3A 4QFNA 5AA3A 4R72A 4PAKA 4PF8A 3TKDA 1OIBA 3QUJA 2FIXA 2O1LA 3QAXA 3LC8A 4GBVA 4G68A 4YB5A 1URSA 4JVIA 5H8QB 3CSGA 4ESXA 3C34A 5CMMA 5I57B 4LP2B 2XD2A 1Q35A 2F36A 5I3SA 3Q27A 4AB6A 5KDTB 5J1DA 4RPNA 4H8IA 3D4GA 3MVWA 3QUFA 4HCWA 2OWSA 3KBZA 3JV9A 2P0SA 4N4UA 3OO8A 1QJMA 4HTGA 1O63A 4K3FA 5I2KA 2RF1A 4P56A 4DIGA 3FATA 3E4RA 2O84X 3LUYA 4FECA 2THIA 5I84A 3K02A 5CRYA 1UTHA 5EYHA 4HE1A 4GWWA 5JK4A 1MQJA 4QHQA 1MM6A 1Y4CA 2QMWA 4ZEBA 5JEIA 1DTGA 4DXUA 3SDFA 4RA1A 1KA1A 4P9KA 3R7XA 1Y3QA 3K4UA 4C1TA 4NHBA 4WEPA 3LSFB 1B3LA 2CMOA 4TQUQ 4UACA 3CIJA 4BDNA 4GD5A 2XX8A 2UXAA 1FQAA 3OENA 1FTKA 3T9XB 4LVQA 1IXHA 1A99A 3PMWA 4KYDA 1R6ZA 1MXZA 4PBHA 2PT2A 4FORA 2B4MA 4ELRA 3VVDA 2UVHA 1DPEA 2XXXA 2V93A 1JEVA 4QFOA 5IM2A 1NH7A 3H6UA 4KXPA 1UTBB 1UIUA 3N5LA 2ONRA 2F35A 4FATA 2PT1A 3TCFA 4O7IA 1IUDA 1B7UA 1NNKA 1LGBC 3SEWA 3KEIA 1VSOA 4NWDA 2I48A 2FIEA 4EXKA 3C31A 4PGNA 4OFLA 3RTWB 2O1MA 1QKBA 1FBEA 1HSEA 2Y7RA 4X04A 1FPGA 2D21A 4OETA 2NOOA 4X9TA 3K00A 1DTZA 2P3VA 2DWIA 4LONB 1EZPA 2GHBA 1OQHA 3ROJA 2DE4A 1JVXA 4NF6B 3PMVA 1UQWA 5AA2B 1CNQA 4GWSA 4X48A 3HHFA 3R6UA 2F34A 4MNPA 1MY0A 5CMBA 4ZECA 4P8BA 5FTIA 4F19A 1A8EA 2Y5KA 1Q9DA 4IY6A 4FBPA 2DDKA 1KWHA 2XXTA 5AA4A 1D9QA 4FEBA 5CI5A 1P1QA 1B32A 1FPFA 1LAGE 1B58A 3O2AA 2IA4A 3O97A 3KGCA 4PFWA 1IXGA 2QS3A 2DS9A 3H03A 2I3WA 3V8XB 4OEUA 1B1XA 1WDNA 3VXBA 1ZMGA 1AH5A 1IMDA 5ET8A 2Y84A 1FQCA 4U1OA 3HO7A 1ZLQA 2I0BA 4NMYA 4DI3D 3E13X 1RDYA 5ET6A 1FQFA 4Z7EA 1I6QA 1XHYA 5IZ1A 4P11A 1NNPA 3W15C 2Q9TA 1TFAA 1B0HA 4ESWA 1M5DA 5CC2A 2DXRA 1MXYA 1QKAA 5TP9B 1JEUA 2XWVA 5DVFA 1HSLA 1P1UA 3QYTA 1FPDA 3IR1A 4I3YA 1VR5A 5EQ9A 2R9JA 3VVEA 3T9UA 3FVGA 2VPNA 3OEMA 3MSTA 3S9MC 2XXQA 1AMFA 4NN3A 5ICTA 1IMCA 1Y1MA 4GQOA 2Z8EA 4N07A 2H5YA 3IAZA 2B3BA 2ONSA 1B05A 4NF5A 1FCKA 1NFTA 1SI0A 1TT1A 4QBAA 1GV8A 1KZ8A 2WYKA 5ISUA 3PAMA 1ZJLA 2AIXA 1B3HA 2I6EA 1LFGA 4N6PA 4YKPA 3E3KA 1FPBA 5KCJA 1N76A 4RK2A 4HS7A 1LAHE 3FVNA 4ND9A 3EN3A 4R6HA 4GWUA 1BLFA 4ELPA 4QF9A 1I69A 4G68C 2V4CA 5ESYA 4LQ2A 2FNCA 2ZYKA 3OOAA 2CZLA 3M3KA 1FJ9A 2R71A 3TZAA 1QUJA 3N6UA 4G2ZA 1MXXA 5A5XB 2QPQA 1PB9A 3K01A 1D4NA 1M5FA 2RINA 4NEDA 2F7BA 1R9LA 4IO3A 1USYE 2OK2A 1B5HA 3FVOA 1J1NA 2FVZA 4G8HA 3DRIA 1LAXA 4PETA 2DWAA 2W7YA 4JB7A 4TLLB 3PPPA 4NAPA 4PFTA 4GL0A 2Y7WA 1MQDA 3U92A 4AQ4A 4C1UA 1FPEA 1HSJA 4FJPA 2Q88A 5DW8A 1H76A 3S9EA 1FJ6A 3HSTA 5ICQA 2VGQA 4N8GA 1IITA 5IZ3A 4F39A 2YLNA 2F3BA 1FBFA 4OVRA 2GQ1A 4OWDA 1NMUA 2F7CA 3FVKA 3MAMA 3MVZA 1JETA 4AS5A 2CZIA 5DEXB 5HPQA 4MIJA 4ZE8A 4MFIA 4OQOA 4GWXA 1II5A 2REGA 4RJZA 5LOMA 2XXRA 5H8FA 2UVIA 2XXHA 2AL5A 1LBVA 3KN7A 4DLDA 4MEVA 2O7UA 1MQGA 4IB2A 1B52A 5FTHA 2Q89A 4GL8A 1N3WA 1EH3A 3T22A 2MKZA 3O6GA 1FPJA 5EYFA 1PBQA 4MMPA 2QVUA 1MXUA 3TEPA 3MYUA 4LA9A 1NV3A 2WKYA 5KZTA 3KOTA 2QS2A 2NUVA 3W9WA 1IZ1A 2I4BA 4H5FA 1SPIA 4NF4B 2DOJA 3U72A 1US5A 3HV1A 2RC7A 1SDXA 4RXLA 4QXDA 2F97A 3CHGA 2Y7KA 2HEUA 5IGAA 2XA5A 5I2NA 1A7LA 2FYIA 4ZS9A 3PU5A 3H6VA 3W9VA 2O6AA 1LCFA 3MZ9A 1NNFA 4MNIA 3H06B 2Q8MA 2OLBA 4GIZA 1NV2A 3PTYA 5DEXA 4GOTA 1Y9UA 2E1SA 5ITPA 2KQZA 3PUYE 1AIVA 1NV6A 5FHMA 5H8HB 4MHFA 1NNTA 4NQ8A 3EHSA 5M2VA 1ZKBA 3ECRA 4ZZEA 1N7XA 1XVXA 4EF1A 1G0HA 2PMSA 2XD3A 4MAGA 1NH8A 1DOTA 1B3GA 3BBRA 1DSNA 3DELB 1H44A 3CI8A 2P2AA 3GXAA 4DZ1A 4F22A 2ZZVA 2G93A 4U23A 5FHNA 5H8NB 4UA8A 1FQDA 4BDMA 4RK9A 2GHAA 2WX9A 4LZ7A 2WEFA 3FXBA 3M3FA 3TQWA 3O66A 1UIVA 3HCQA 4JBZA 1LEVA 4FAJA 4I3EA 1OVTA 3KFMA 1SBPA 4LZ8A 3MZBA 1A8FA 2OJTA 2XWOA 4XEQA 5L8DA 3FGSA 4EUOA 3FASA 2A5TB 3K6WA 1JW1A 4GWOA 4YZZA 3MC2A 4ZZAA 2JJKA 1B7HA 1R9QA 2O7IA 3CFXA 1IMBA 3K1MA 4P0IA 4MBPA 1Z7ME 2I3VA 3SETA 5TPAB 5B70A 4DCYA 3FXUA 4E0XA 2ABHA 3HPIA 3USDA 1MPCA 3I3VA 3FXRA 3C35A 4F2QA 3KC1A 1EYIA 4YKJA 3FD3A 2VOZA 1M5EA 3KN8A 3UN6A 4IR8A 4C0RA 2DWHA 5JTYB 1SI1A 4IO4A 1YTVA 1LBZA 2VT5A 5FHOA 1P1NA 4U4SA 2BJJX 2ZNUA 1B4ZA 2H9BA 4R2FA 3B6WA 4N13A 2OWZA 3O6IA 3QIMA 2O69A 4I1DA 2X7PA 2DE3A 2F6PA 3N6TA 4LATA 3K6XA 4KYEA 2QS4A 2REJA 4FE8A
chains in the Genus database with same CATH topology
4M4GA 4F29A 3S4UA 3OEKA 4JXIA 1MRPA 3TDJA 1OVBA 1XC1A 4KFQA 5L9OA 3KOSA 5H8QA 1M5BA 5H8SA 5TPAA 5BUUA 4X1DA 5I57A 1MY4A 3ZS6A 3ILUB 1N0TA 3K2DA 4PP0A 3OXNA 5L9MA 4BDOA 4OESA 3BKIB 4Q0CA 3M3LA 5KDTA 4IO5A 5TU0A 2XXVA 3GBBA 4F18A 3B7DA 3MZ1A 4R9GA 1MDQA 3VVFA 4FIMA 5I59B 3IX1A 4MLVA 4U21A 2OWTA 2OCUA 1BIYA 4U2RA 3DM0A 1D3KA 4R2BA 4BDQA 4KCCA 2RCBA 3LR1A 2XHDA 3SKPA 3V5AA 3G3JA 3RNNA 3TODA 3EQ1A 3T9VA 4BLAA 1VE4A 3IJXB 3PPRA 4G8NA 2Y7IA 1NL5A 3IOWA 3H6TA 5CBSA 1RKMA 3LSXA 3SEUA 4R75A 4ELQA 4OFJA 1QVSA 4F1VA 2V3QA 5DYHA 1N3XA 4ZEFA 5CMKA 1EZ9A 2F78A 3CVGA 2ZYOA 1MQHA 4HCYA 4O3AA 1RYXA 4NF8B 1PC3A 4P0GA 2X7QA 3MBPA 1UTBA 3Q29A 4IGRA 3ODBA 1MS7A 1GTKA 2UYEA 2B4LA 1MXVA 3U1OA 4DE8A 4ZEIA 3G3IA 4LUBA 1DMBA 4TOZA 2PYYA 1MH4A 1RYOA 4IO6A 2QRYA 4YKKA 1MH3A 4XKQA 1QW0A 2F6GA 2V3UA 2Z8DA 2ZXTA 3ILTB 2DSFA 3HN0A 5IKBA 3H7MA 3T66A 3MVXA 3T9HB 4U4XA 3G3HA 3SEYA 4NF6A 3MPKA 3KG2A 1AL3A 5AA2A 1O64A 1QUKA 4IGTA 2LAOA 3H3GA 3UIFA 5AE4A 1MY1A 3IO6A 3F11A 4NF8A 1N84A 3TUSA 1MQIA 4OYVA 1MY3A 3K0VA 4MF3A 1LLSA 2DVZA 4F2OA 4PFYA 1OQGA 3RY3A 4F3GA 1XOCA 2H25A 3CSBA 4EQBA 3MQ9A 4RYAA 2QS1A 1B9JA 2ANJA 4F31B 4O3CA 5TP9A 4OFOA 1POY1 3TAJA 2HAVA 2DQVA 2HXWA 2Z22A 3QSLA 3DRFA 1TWYA 1Y4TA 3IL1B 1JW5A 1B1HA 4NWCA 4H65A 1A40A 4H0WA 4BDRA 2DE2A 2HCAA 3MWBA 1QUIA 2PVUA 2P1SA 3PPQA 3IB2A 3KBRA 3TTRA 2ZMBA 3LSWA 2R6GE 4KD5A 5CBRA 5EHMA 3FXQA 3GBAA 2B3FA 3SESA 2AYSA 1FTLA 2HAUA 5CMCA 1SW5A 3Q25A 3L6HA 2XXUA 2XXIA 1H43A 1N04A 3O6HA 3A3CA 4EQ7A 2GH9A 2WOKA 1CB6A 1PB7A 3ZKKA 4QFKA 4GLIA 3K6VA 3OD7A 3TTKA 3CFZA 4DDDA 1GVCA 5A5XA 3KJ7A 3PPOA 2PX1A 4PFUA 3KJTA 1B4HA 3IO4A 3O9PA 2GRVA 4ISUA 4OEVA 1TXFA 3D4CA 3OSQA 3CRBA 3R26A 1XS5A 4Q8RA 3PV0E 2D5WA 2UVGA 3CG1A 3SEVA 1DPPA 3EHUA 4I62A 4KI0E 5I56B 1O7TA 3GLBA 3SEXA 1B7ZA 3U8QA 3IK6B 4YU0A 1IQ7A 3H4ZA 4POXA 4X1BA 3RTFB 2I4CA 4O3BA 1YAEA 2OBGA 4WKMA 4YMBA 1US4A 2UVJA 4JWOA 4KPTA 2RKMA 1H3DA 4QSCA 1SYIA 3VE1B 3MW0A 3DP8A 3WAFA 1VFEA 1LB8A 1VFDA 3TPAA 4L17A 4PQJA 4LQ5A 4OVJA 1IXIA 1POTA 4H67A 3MP8A 1LB9A 3PD8A 3VV5A 3RYBA 4G68B 4ELOA 2XXPA 3C33A 2XX9A 1PBPA 3K1NA 4MH5A 1MPBA 4ZEKA 1A55A 2X26A 1NKXA 1XT8A 3DRGA 3UK4A 4EQ9A 5I56A 4NF4A 4Q30B 3G3FA 2RC8A 3I6VA 3TQLA 2HFBA 3N26A 3PUXE 1LAFE 4OXVA 5I2KB 1SW1A 3T93B 3C36A 3RYAA 1Q1KA 5BWJA 2OZZA 1FQBA 5HM4B 4EXLA 3I5OA 5H8HA 3TFLA 1MPDA 3LBSA 3TTNA 4LZ5A 4U1ZA 4HW8A 2WOPA 2F7AA 1H45A 1EZOA 4GVOA 1LCTA 2XX7A 1B6HA 1FTMA 2YJPA 5HBCA 2M8CA 2DXYA 3FJMA 2E0SA 5H8NA 4MLQA 2NXOA 1B3FA 2KLFA 3OMBA 4XKNA 1OLAA 1URDA 3MP6A 2ESNA 4Q5TA 1S7YA 3EPEA 5DTBA 3WAEA 4AB5A 3TMGA 5EHSA 1PEBA 2I49A 4TLMB 2HQ0A 3E9XA 2A5TA 5CM6A 3S9LC 4ZEDA 1ZBMA 4JWYA 3C32A 3IOUA 3TCHA 1B51A 3MJNA 2AL4A 4EDPA 2QL3A 3PPNA 2XXYA 5F1QA 4ONYA 4IO7A 3SERA 4F3SA 1B5IA 4R73A 1BKAA 1T0KA 1YCJA 4NE4A 1I6BA 3S9NC 2RC9A 1F9BA 2F8DA 3K6UA 1PB8A 3FV1A 2ZNTA 1MG1A 3PD9A 1S50A 3OSRA 2Z23A 1MM7A 5JTYA 2V84A 1QULA 3EF7A 3KN3A 4H1XA 3S2VA 1Y20A 3UORA 3VFJA 4R6KA 4XIGQ 4QRZA 4OENA 1WODA 5AA4B 3THIA 4GFRA 2XXWA 4XKRA 2V3TA 4WXJA 1ATGA 3DP6A 3T96B 3VLVA 2Q2AA 2QJEA 3ZKLA 5DT6A 4RNSA 1LSTA 3VLUA 4XTCQ 2VD2A 3KSXA 3FIRA 3G3GA 5I58B 2HZLA 1CE2A 2B65A 4YKIA 2A5SA 3V83A 4GXAA 1SYHA 3FV2A 2H98A 3G3KA 4R9FA 3M8UA 4R74A 3EHTA 2FA7A 4F3PA 1SW2A 4XKPA 4JWXA 5ITOA 3RLFE 1Y1ZA 2HZKA 4R6YA 3TTLA 1EU8A 4I9DA 5I59A 1TFDA 4DCXA 3RQTA 3OO7A 2D3IA 1MXWA 4RPOA 1SVXB 2VP1A 1FQEA 4NF5B 4OERA 3U93A 3PUZE 3IORA 3Q26A 3QK6A 4GXSB 4POWA 3N94A 1B2HA 1USYH 5I58A 4ZE9A 1ELJA 1Z7NE 5KCJB 5AA2D 4OHNA 1GR2A 1URGA 3FZVA 1IIWA 1SD3A 3UGWA 4G77A 1PDAA 4DXCA 3Q28A 2WOLA 4M1VA 1ANFA 3L6GA 3UP9A 1IEJA 4KCDA 4F1UA 1GGGA 1A54A 2QSXA 3RUMA 3MVYA 3BFTA 3A3UA 3OELA 2ALUA 4IO2A 3IB0A 4NTLA 5F7VA 3IB1A 1P1OA 4F3BA 2IEEA 1B46A 1JNFA 3PUVE 3RGYA 3BFUA 5K2XA 4H8JA 2RCAA 4YB7A 2YPNA 3TYHA 3GZGA 2H4IA 4KHZE 3U94A 2VHAA 1LFHA 3RN8A 4Z0IA 2G29A 3LVUA 4I8CA 3ZSFA 2F5XA 1P1WA 5ELVA 3JYRA 2Q2CA 1SW4A 1B0LA 3ONMA 3C9HA 2PBWA 1S9TA 3MPLA 1SQYA 4KYSA 3B6QA 1BTJA 1JVYA 5H8FB 4YMAA 5DVJA 2DVCA 2V25A 3V89B 3AXFA 1LBBA 3QXMA 4OMBA 3TCGA 1Y3PA 4OTEA 3JZJA 4U22A 3DLNA 4H6DA 3OO6A 3DRJA 1I6AA 5K2YA 3MUQA 4GF8A 4FEDA 1ZTYA 1IXCA 1D9VA 1M5CA 4JSDA 1D9YA 3DP4A 4YICA 1ZIUA 1XVYA 4G4PA 4QSEA 5I2NB 4F1YA 1LBCA 3UA8A 4JDFA 4THIA 1R1NA 3O28A 4IY5A 3MP1A 1L5TA 3IOTA 1JW4A 3VDFA 5AA1A 4BDLA 2QMXA 2GFEA 3CG3A 2ZNSA 1P99A 4WEDA 3O6PA 3DRHA 4KQPA 1WVJA 1YPNA 1OLCA 2NWJA 3G7WA 1AOVA 1N7WA 1LFIA 4E0WA 3KZGA 3DRKA 1FTJA 3RT6B 4KR5A 2O68A 4ECFA 3K1PA 2H99A 1FW0A 3B6TA 4G8MA 3KSJA 4GRKA 4RY1A 4YB6A 4QSDA 4DXBA 5DVIA 2DYXA 2I58A 3FJ7A 3TTMA 2ZYNA 3IOVA 2O51A 3FUZA 1BP5A 4QFLA 2DP8A 3CFLA 1B3EA 3RT8A 2I0CA 3IJOB 4PE5B 3O29A 4QFPA 3PUWE 1Y3NA 1ZU0A 2Q8JA 3A09A 3PGFA 4YAHX 3C4MA 1FTOA 3P7IA 2DWJA 4ZDMA 2UYFA 4EF2A 1OMPA 2ONKE 3LSLA 4JSOA 5IAIA 3VXCA 3RPWA 1JQFA 3VLWA 2NVUB 3H6WA 2ZYMA 3CR9A 3HHGA 4OZ9A 4H5GA 3FJGA 3OO9A 2Z8FA 1B5JA 3PMXA 2Y7PA 4XXUA 1MY2A 5B7DA 1B40A 1UTHB 1MDP1 3TELA 3FTOA 5L9SA 2VD3A 4QFNA 5AA3A 4R72A 3TKDA 1OIBA 3QUJA 2O1LA 3QAXA 3LC8A 4G68A 4YB5A 1URSA 5H8QB 3CSGA 4ESXA 3C34A 5CMMA 5I57B 4LP2B 2XD2A 1Q35A 2F36A 3Q27A 4AB6A 5KDTB 5J1DA 4RPNA 4H8IA 3D4GA 3MVWA 3QUFA 4HCWA 2OWSA 3JV9A 2P0SA 3OO8A 1QJMA 4HTGA 1O63A 4K3FA 5I2KA 2RF1A 4DIGA 3FATA 3E4RA 2O84X 3LUYA 4FECA 2THIA 5I84A 3K02A 5CRYA 1UTHA 5JK4A 1MQJA 4QHQA 1MM6A 1Y4CA 2QMWA 4ZEBA 5JEIA 1DTGA 4DXUA 3SDFA 4RA1A 3R7XA 1Y3QA 3K4UA 4C1TA 4WEPA 3LSFB 1B3LA 2CMOA 4TQUQ 4UACA 3CIJA 4BDNA 4GD5A 2XX8A 2UXAA 1FQAA 3OENA 1FTKA 3T9XB 4LVQA 1IXHA 1A99A 3PMWA 4KYDA 1R6ZA 1MXZA 2PT2A 4FORA 2B4MA 4ELRA 3VVDA 2UVHA 1DPEA 2XXXA 2V93A 1JEVA 4QFOA 1NH7A 3H6UA 1UTBB 1UIUA 3N5LA 2ONRA 2F35A 4FATA 2PT1A 3TCFA 1IUDA 1B7UA 1NNKA 1LGBC 3SEWA 3KEIA 1VSOA 4NWDA 2I48A 4EXKA 3C31A 4OFLA 3RTWB 2O1MA 1QKBA 1HSEA 2Y7RA 2D21A 4OETA 2NOOA 4X9TA 3K00A 1DTZA 2DWIA 4LONB 1EZPA 2GHBA 1OQHA 2DE4A 1JVXA 4NF6B 3PMVA 1UQWA 5AA2B 4X48A 3HHFA 3R6UA 2F34A 1MY0A 5CMBA 4ZECA 5FTIA 4F19A 1A8EA 4IY6A 1KWHA 2XXTA 5AA4A 5CI5A 4FEBA 1P1QA 1B32A 1LAGE 1B58A 3O2AA 2IA4A 3O97A 3KGCA 4PFWA 1IXGA 2QS3A 2DS9A 3H03A 2I3WA 3VXBA 4OEUA 1B1XA 1WDNA 3V8XB 1ZMGA 1AH5A 2Y84A 1FQCA 4U1OA 3HO7A 1ZLQA 2I0BA 4NMYA 3E13X 1FQFA 4Z7EA 1I6QA 1XHYA 4P11A 1NNPA 3W15C 2Q9TA 1TFAA 1B0HA 4ESWA 1M5DA 5CC2A 2DXRA 1MXYA 1QKAA 5TP9B 1JEUA 5DVFA 1HSLA 1P1UA 3QYTA 3IR1A 1VR5A 2R9JA 3VVEA 3T9UA 3FVGA 3OEMA 3S9MC 2XXQA 1AMFA 5ICTA 1Y1MA 4GQOA 2Z8EA 4N07A 2H5YA 3IAZA 2B3BA 2ONSA 1B05A 4NF5A 1FCKA 1NFTA 1SI0A 1TT1A 1GV8A 5ISUA 3PAMA 1ZJLA 2AIXA 1B3HA 2I6EA 1LFGA 4N6PA 4YKPA 3E3KA 5KCJA 1N76A 4RK2A 4HS7A 1LAHE 3FVNA 4ND9A 3EN3A 4R6HA 1BLFA 4ELPA 4QF9A 1I69A 4G68C 4LQ2A 2FNCA 2ZYKA 3OOAA 2CZLA 3M3KA 2R71A 3TZAA 1QUJA 3N6UA 4G2ZA 1MXXA 5A5XB 2QPQA 1PB9A 3K01A 1D4NA 1M5FA 2RINA 4NEDA 2F7BA 1R9LA 4IO3A 1USYE 2OK2A 1B5HA 3FVOA 1J1NA 4G8HA 3DRIA 1LAXA 4PETA 2DWAA 2W7YA 4JB7A 4TLLB 3PPPA 4PFTA 4GL0A 2Y7WA 1MQDA 3U92A 4AQ4A 4C1UA 1HSJA 4FJPA 2Q88A 1H76A 3S9EA 3HSTA 5ICQA 2VGQA 1IITA 4F39A 2YLNA 4OWDA 1NMUA 2F7CA 3FVKA 3MAMA 3MVZA 1JETA 5DEXB 5HPQA 4ZE8A 4MFIA 4OQOA 1II5A 2REGA 4RJZA 5LOMA 2XXRA 5H8FA 2UVIA 2XXHA 2AL5A 3KN7A 4DLDA 2O7UA 1MQGA 4IB2A 1B52A 5FTHA 2Q89A 4GL8A 1N3WA 1EH3A 3T22A 3O6GA 5EYFA 1PBQA 1MXUA 3TEPA 4LA9A 2WKYA 5KZTA 3KOTA 2QS2A 2NUVA 3W9WA 1IZ1A 2I4BA 4H5FA 4NF4B 2DOJA 3U72A 1US5A 3HV1A 2RC7A 1SDXA 4RXLA 2F97A 3CHGA 2Y7KA 2HEUA 5I2NA 1A7LA 2FYIA 4ZS9A 3PU5A 3H6VA 3W9VA 2O6AA 1LCFA 3MZ9A 1NNFA 3H06B 2OLBA 4GIZA 5DEXA 4GOTA 1Y9UA 2E1SA 5ITPA 3PUYE 1AIVA 5FHMA 5H8HB 1NNTA 3EHSA 5M2VA 1ZKBA 3ECRA 4ZZEA 1N7XA 1XVXA 4EF1A 2PMSA 2XD3A 1NH8A 1DOTA 1B3GA 3BBRA 1DSNA 3DELB 1H44A 3CI8A 2P2AA 3GXAA 4DZ1A 4F22A 5H8NB 2G93A 4U23A 5FHNA 4UA8A 1FQDA 4BDMA 4RK9A 2GHAA 4LZ7A 3M3FA 3TQWA 3O66A 1UIVA 3HCQA 4JBZA 4FAJA 1OVTA 3KFMA 1SBPA 4LZ8A 3MZBA 1A8FA 2OJTA 5L8DA 3FGSA 4EUOA 3FASA 2A5TB 3K6WA 1JW1A 4GWOA 4YZZA 3MC2A 4ZZAA 1B7HA 1R9QA 2O7IA 3CFXA 4P0IA 3K1MA 4MBPA 1Z7ME 2I3VA 3SETA 5TPAB 5B70A 4DCYA 3FXUA 4E0XA 2ABHA 3HPIA 3USDA 1MPCA 3I3VA 3FXRA 3C35A 4F2QA 4YKJA 3FD3A 2VOZA 1M5EA 3KN8A 3UN6A 4C0RA 2DWHA 5JTYB 1SI1A 4IO4A 1YTVA 5FHOA 1P1NA 4U4SA 2BJJX 2ZNUA 1B4ZA 2H9BA 4R2FA 3B6WA 4N13A 3O6IA 3QIMA 2O69A 4I1DA 2X7PA 2DE3A 2F6PA 3N6TA 4LATA 3K6XA 4KYEA 2QS4A 2REJA 4FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4G A;  4F29 A;  3S4U A;  3OEK A;  4JXI A;  1MRP A;  3TDJ A;  1OVB A;  1XC1 A;  4KFQ A;  5L9O A;  3KOS A;  5H8Q A;  1M5B A;  5H8S A;  5TPA A;  5BUU A;  4X1D A;  5I57 A;  1MY4 A;  3ZS6 A;  3ILU B;  1N0T A;  3K2D A;  4PP0 A;  3OXN A;  5L9M A;  4BDO A;  4OES A;  3BKI B;  4Q0C A;  3M3L A;  5KDT A;  4IO5 A;  5TU0 A;  2XXV A;  3GBB A;  4F18 A;  3B7D A;  3MZ1 A;  4R9G A;  1MDQ A;  3VVF A;  4FIM A;  5I59 B;  3IX1 A;  4MLV A;  4U21 A;  2OWT A;  2OCU A;  1BIY A;  4U2R A;  3DM0 A;  1D3K A;  4R2B A;  4BDQ A;  4KCC A;  2RCB A;  3LR1 A;  2XHD A;  3SKP A;  3V5A A;  3G3J A;  3RNN A;  3TOD A;  3EQ1 A;  3T9V A;  4BLA A;  1VE4 A;  3IJX B;  3PPR A;  4G8N A;  2Y7I A;  1NL5 A;  3IOW A;  3H6T A;  5CBS A;  1RKM A;  3LSX A;  3SEU A;  4R75 A;  4ELQ A;  4OFJ A;  1QVS A;  4F1V A;  2V3Q A;  5DYH A;  1N3X A;  4ZEF A;  5CMK A;  1EZ9 A;  2F78 A;  3CVG A;  2ZYO A;  1MQH A;  4HCY A;  4O3A A;  1RYX A;  4NF8 B;  1PC3 A;  4P0G A;  2X7Q A;  3MBP A;  1UTB A;  3Q29 A;  4IGR A;  3ODB A;  1MS7 A;  1GTK A;  2UYE A;  2B4L A;  1MXV A;  3U1O A;  4DE8 A;  4ZEI A;  3G3I A;  4LUB A;  1DMB A;  4TOZ A;  2PYY A;  1MH4 A;  1RYO A;  4IO6 A;  2QRY A;  4YKK A;  1MH3 A;  4XKQ A;  1QW0 A;  2F6G A;  2V3U A;  2Z8D A;  2ZXT A;  3ILT B;  2DSF A;  3HN0 A;  5IKB A;  3H7M A;  3T66 A;  3MVX A;  3T9H B;  4U4X A;  3G3H A;  3SEY A;  4NF6 A;  3MPK A;  3KG2 A;  1AL3 A;  5AA2 A;  1O64 A;  1QUK A;  4IGT A;  2LAO A;  3H3G A;  3UIF A;  5AE4 A;  1MY1 A;  3IO6 A;  3F11 A;  4NF8 A;  1N84 A;  3TUS A;  1MQI A;  4OYV A;  1MY3 A;  3K0V A;  4MF3 A;  1LLS A;  2DVZ A;  4F2O A;  4PFY A;  1OQG A;  3RY3 A;  4F3G A;  1XOC A;  2H25 A;  3CSB A;  4EQB A;  3MQ9 A;  4RYA A;  2QS1 A;  1B9J A;  2ANJ A;  4F31 B;  4O3C A;  5TP9 A;  4OFO A;  1POY 1;  3TAJ A;  2HAV A;  2DQV A;  2HXW A;  2Z22 A;  3QSL A;  3DRF A;  1TWY A;  1Y4T A;  3IL1 B;  1JW5 A;  1B1H A;  4NWC A;  4H65 A;  1A40 A;  4H0W A;  4BDR A;  2DE2 A;  2HCA A;  3MWB A;  1QUI A;  2PVU A;  2P1S A;  3PPQ A;  3IB2 A;  3KBR A;  3TTR A;  2ZMB A;  3LSW A;  2R6G E;  4KD5 A;  5CBR A;  5EHM A;  3FXQ A;  3GBA A;  2B3F A;  3SES A;  2AYS A;  1FTL A;  2HAU A;  5CMC A;  1SW5 A;  3Q25 A;  3L6H A;  2XXU A;  2XXI A;  1H43 A;  1N04 A;  3O6H A;  3A3C A;  4EQ7 A;  2GH9 A;  2WOK A;  1CB6 A;  1PB7 A;  3ZKK A;  4QFK A;  4GLI A;  3K6V A;  3OD7 A;  3TTK A;  3CFZ A;  4DDD A;  1GVC A;  5A5X A;  3KJ7 A;  3PPO A;  2PX1 A;  4PFU A;  3KJT A;  1B4H A;  3IO4 A;  3O9P A;  2GRV A;  4ISU A;  4OEV A;  1TXF A;  3D4C A;  3OSQ A;  3CRB A;  3R26 A;  1XS5 A;  4Q8R A;  3PV0 E;  2D5W A;  2UVG A;  3CG1 A;  3SEV A;  1DPP A;  3EHU A;  4I62 A;  4KI0 E;  5I56 B;  1O7T A;  3GLB A;  3SEX A;  1B7Z A;  3U8Q A;  3IK6 B;  4YU0 A;  1IQ7 A;  3H4Z A;  4POX A;  4X1B A;  3RTF B;  2I4C A;  4O3B A;  1YAE A;  2OBG A;  4WKM A;  4YMB A;  1US4 A;  2UVJ A;  4JWO A;  4KPT A;  2RKM A;  1H3D A;  4QSC A;  1SYI A;  3VE1 B;  3MW0 A;  3DP8 A;  3WAF A;  1VFE A;  1LB8 A;  1VFD A;  3TPA A;  4L17 A;  4PQJ A;  4LQ5 A;  4OVJ A;  1IXI A;  1POT A;  4H67 A;  3MP8 A;  1LB9 A;  3PD8 A;  3VV5 A;  3RYB A;  4G68 B;  4ELO A;  2XXP A;  3C33 A;  2XX9 A;  1PBP A;  3K1N A;  4MH5 A;  1MPB A;  4ZEK A;  1A55 A;  2X26 A;  1NKX A;  1XT8 A;  3DRG A;  3UK4 A;  4EQ9 A;  5I56 A;  4NF4 A;  4Q30 B;  3G3F A;  2RC8 A;  3I6V A;  3TQL A;  2HFB A;  3N26 A;  3PUX E;  1LAF E;  4OXV A;  5I2K B;  1SW1 A;  3T93 B;  3C36 A;  3RYA A;  1Q1K A;  5BWJ A;  2OZZ A;  1FQB A;  5HM4 B;  4EXL A;  3I5O A;  5H8H A;  3TFL A;  1MPD A;  3LBS A;  3TTN A;  4LZ5 A;  4U1Z A;  4HW8 A;  2WOP A;  2F7A A;  1H45 A;  1EZO A;  4GVO A;  1LCT A;  2XX7 A;  1B6H A;  1FTM A;  2YJP A;  5HBC A;  2M8C A;  2DXY A;  3FJM A;  2E0S A;  5H8N A;  4MLQ A;  2NXO A;  1B3F A;  2KLF A;  3OMB A;  4XKN A;  1OLA A;  1URD A;  3MP6 A;  2ESN A;  4Q5T A;  1S7Y A;  3EPE A;  5DTB A;  3WAE A;  4AB5 A;  3TMG A;  5EHS A;  1PEB A;  2I49 A;  4TLM B;  2HQ0 A;  3E9X A;  2A5T A;  5CM6 A;  3S9L C;  4ZED A;  1ZBM A;  4JWY A;  3C32 A;  3IOU A;  3TCH A;  1B51 A;  3MJN A;  2AL4 A;  4EDP A;  2QL3 A;  3PPN A;  2XXY A;  5F1Q A;  4ONY A;  4IO7 A;  3SER A;  4F3S A;  1B5I A;  4R73 A;  1BKA A;  1T0K A;  1YCJ A;  4NE4 A;  1I6B A;  3S9N C;  2RC9 A;  1F9B A;  2F8D A;  3K6U A;  1PB8 A;  3FV1 A;  2ZNT A;  1MG1 A;  3PD9 A;  1S50 A;  3OSR A;  2Z23 A;  1MM7 A;  5JTY A;  2V84 A;  1QUL A;  3EF7 A;  3KN3 A;  4H1X A;  3S2V A;  1Y20 A;  3UOR A;  3VFJ A;  4R6K A;  4XIG Q;  4QRZ A;  4OEN A;  1WOD A;  5AA4 B;  3THI A;  4GFR A;  2XXW A;  4XKR A;  2V3T A;  4WXJ A;  1ATG A;  3DP6 A;  3T96 B;  3VLV A;  2Q2A A;  2QJE A;  3ZKL A;  5DT6 A;  4RNS A;  1LST A;  3VLU A;  4XTC Q;  2VD2 A;  3KSX A;  3FIR A;  3G3G A;  5I58 B;  2HZL A;  1CE2 A;  2B65 A;  4YKI A;  2A5S A;  3V83 A;  4GXA A;  1SYH A;  3FV2 A;  2H98 A;  3G3K A;  4R9F A;  3M8U A;  4R74 A;  3EHT A;  2FA7 A;  4F3P A;  1SW2 A;  4XKP A;  4JWX A;  5ITO A;  3RLF E;  1Y1Z A;  2HZK A;  4R6Y A;  3TTL A;  1EU8 A;  4I9D A;  5I59 A;  1TFD A;  4DCX A;  3RQT A;  3OO7 A;  2D3I A;  1MXW A;  4RPO A;  1SVX B;  2VP1 A;  1FQE A;  4NF5 B;  4OER A;  3U93 A;  3PUZ E;  3IOR A;  3Q26 A;  3QK6 A;  4GXS B;  4POW A;  3N94 A;  1B2H A;  1USY H;  5I58 A;  4ZE9 A;  1ELJ A;  1Z7N E;  5KCJ B;  5AA2 D;  4OHN A;  1GR2 A;  1URG A;  3FZV A;  1IIW A;  1SD3 A;  3UGW A;  4G77 A;  1PDA A;  4DXC A;  3Q28 A;  2WOL A;  4M1V A;  1ANF A;  3L6G A;  3UP9 A;  1IEJ A;  4KCD A;  4F1U A;  1GGG A;  1A54 A;  2QSX A;  3RUM A;  3MVY A;  3BFT A;  3A3U A;  3OEL A;  2ALU A;  4IO2 A;  3IB0 A;  4NTL A;  5F7V A;  3IB1 A;  1P1O A;  4F3B A;  2IEE A;  1B46 A;  1JNF A;  3PUV E;  3RGY A;  3BFU A;  5K2X A;  4H8J A;  2RCA A;  4YB7 A;  2YPN A;  3TYH A;  3GZG A;  2H4I A;  4KHZ E;  3U94 A;  2VHA A;  1LFH A;  3RN8 A;  4Z0I A;  2G29 A;  3LVU A;  4I8C A;  3ZSF A;  2F5X A;  1P1W A;  5ELV A;  3JYR A;  2Q2C A;  1SW4 A;  1B0L A;  3ONM A;  3C9H A;  2PBW A;  1S9T A;  3MPL A;  1SQY A;  4KYS A;  3B6Q A;  1BTJ A;  1JVY A;  5H8F B;  4YMA A;  5DVJ A;  2DVC A;  2V25 A;  3V89 B;  3AXF A;  1LBB A;  3QXM A;  4OMB A;  3TCG A;  1Y3P A;  4OTE A;  3JZJ A;  4U22 A;  3DLN A;  4H6D A;  3OO6 A;  3DRJ A;  1I6A A;  5K2Y A;  3MUQ A;  4GF8 A;  4FED A;  1ZTY A;  1IXC A;  1D9V A;  1M5C A;  4JSD A;  1D9Y A;  3DP4 A;  4YIC A;  1ZIU A;  1XVY A;  4G4P A;  4QSE A;  5I2N B;  4F1Y A;  1LBC A;  3UA8 A;  4JDF A;  4THI A;  1R1N A;  3O28 A;  4IY5 A;  3MP1 A;  1L5T A;  3IOT A;  1JW4 A;  3VDF A;  5AA1 A;  4BDL A;  2QMX A;  2GFE A;  3CG3 A;  2ZNS A;  1P99 A;  4WED A;  3O6P A;  3DRH A;  4KQP A;  1WVJ A;  1YPN A;  1OLC A;  2NWJ A;  3G7W A;  1AOV A;  1N7W A;  1LFI A;  4E0W A;  3KZG A;  3DRK A;  1FTJ A;  3RT6 B;  4KR5 A;  2O68 A;  4ECF A;  3K1P A;  2H99 A;  1FW0 A;  3B6T A;  4G8M A;  3KSJ A;  4GRK A;  4RY1 A;  4YB6 A;  4QSD A;  4DXB A;  5DVI A;  2DYX A;  2I58 A;  3FJ7 A;  3TTM A;  2ZYN A;  3IOV A;  2O51 A;  3FUZ A;  1BP5 A;  4QFL A;  2DP8 A;  3CFL A;  1B3E A;  3RT8 A;  2I0C A;  3IJO B;  4PE5 B;  3O29 A;  4QFP A;  3PUW E;  1Y3N A;  1ZU0 A;  2Q8J A;  3A09 A;  3PGF A;  4YAH X;  3C4M A;  1FTO A;  3P7I A;  2DWJ A;  4ZDM A;  2UYF A;  4EF2 A;  1OMP A;  2ONK E;  3LSL A;  4JSO A;  5IAI A;  3VXC A;  3RPW A;  1JQF A;  3VLW A;  2NVU B;  3H6W A;  2ZYM A;  3CR9 A;  3HHG A;  4OZ9 A;  4H5G A;  3FJG A;  3OO9 A;  2Z8F A;  1B5J A;  3PMX A;  2Y7P A;  4XXU A;  1MY2 A;  5B7D A;  1B40 A;  1UTH B;  1MDP 1;  3TEL A;  3FTO A;  5L9S A;  2VD3 A;  4QFN A;  5AA3 A;  4R72 A;  3TKD A;  1OIB A;  3QUJ A;  2O1L A;  3QAX A;  3LC8 A;  4G68 A;  4YB5 A;  1URS A;  5H8Q B;  3CSG A;  4ESX A;  3C34 A;  5CMM A;  5I57 B;  4LP2 B;  2XD2 A;  1Q35 A;  2F36 A;  3Q27 A;  4AB6 A;  5KDT B;  5J1D A;  4RPN A;  4H8I A;  3D4G A;  3MVW A;  3QUF A;  4HCW A;  2OWS A;  3JV9 A;  2P0S A;  3OO8 A;  1QJM A;  4HTG A;  1O63 A;  4K3F A;  5I2K A;  2RF1 A;  4DIG A;  3FAT A;  3E4R A;  2O84 X;  3LUY A;  4FEC A;  2THI A;  5I84 A;  3K02 A;  5CRY A;  1UTH A;  5JK4 A;  1MQJ A;  4QHQ A;  1MM6 A;  1Y4C A;  2QMW A;  4ZEB A;  5JEI A;  1DTG A;  4DXU A;  3SDF A;  4RA1 A;  3R7X A;  1Y3Q A;  3K4U A;  4C1T A;  4WEP A;  3LSF B;  1B3L A;  2CMO A;  4TQU Q;  4UAC A;  3CIJ A;  4BDN A;  4GD5 A;  2XX8 A;  2UXA A;  1FQA A;  3OEN A;  1FTK A;  3T9X B;  4LVQ A;  1IXH A;  1A99 A;  3PMW A;  4KYD A;  1R6Z A;  1MXZ A;  2PT2 A;  4FOR A;  2B4M A;  4ELR A;  3VVD A;  2UVH A;  1DPE A;  2XXX A;  2V93 A;  1JEV A;  4QFO A;  1NH7 A;  3H6U A;  1UTB B;  1UIU A;  3N5L A;  2ONR A;  2F35 A;  4FAT A;  2PT1 A;  3TCF A;  1IUD A;  1B7U A;  1NNK A;  1LGB C;  3SEW A;  3KEI A;  1VSO A;  4NWD A;  2I48 A;  4EXK A;  3C31 A;  4OFL A;  3RTW B;  2O1M A;  1QKB A;  1HSE A;  2Y7R A;  2D21 A;  4OET A;  2NOO A;  4X9T A;  3K00 A;  1DTZ A;  2DWI A;  4LON B;  1EZP A;  2GHB A;  1OQH A;  2DE4 A;  1JVX A;  4NF6 B;  3PMV A;  1UQW A;  5AA2 B;  4X48 A;  3HHF A;  3R6U A;  2F34 A;  1MY0 A;  5CMB A;  4ZEC A;  5FTI A;  4F19 A;  1A8E A;  4IY6 A;  1KWH A;  2XXT A;  5AA4 A;  5CI5 A;  4FEB A;  1P1Q A;  1B32 A;  1LAG E;  1B58 A;  3O2A A;  2IA4 A;  3O97 A;  3KGC A;  4PFW A;  1IXG A;  2QS3 A;  2DS9 A;  3H03 A;  2I3W A;  3VXB A;  4OEU A;  1B1X A;  1WDN A;  3V8X B;  1ZMG A;  1AH5 A;  2Y84 A;  1FQC A;  4U1O A;  3HO7 A;  1ZLQ A;  2I0B A;  4NMY A;  3E13 X;  1FQF A;  4Z7E A;  1I6Q A;  1XHY A;  4P11 A;  1NNP A;  3W15 C;  2Q9T A;  1TFA A;  1B0H A;  4ESW A;  1M5D A;  5CC2 A;  2DXR A;  1MXY A;  1QKA A;  5TP9 B;  1JEU A;  5DVF A;  1HSL A;  1P1U A;  3QYT A;  3IR1 A;  1VR5 A;  2R9J A;  3VVE A;  3T9U A;  3FVG A;  3OEM A;  3S9M C;  2XXQ A;  1AMF A;  5ICT A;  1Y1M A;  4GQO A;  2Z8E A;  4N07 A;  2H5Y A;  3IAZ A;  2B3B A;  2ONS A;  1B05 A;  4NF5 A;  1FCK A;  1NFT A;  1SI0 A;  1TT1 A;  1GV8 A;  5ISU A;  3PAM A;  1ZJL A;  2AIX A;  1B3H A;  2I6E A;  1LFG A;  4N6P A;  4YKP A;  3E3K A;  5KCJ A;  1N76 A;  4RK2 A;  4HS7 A;  1LAH E;  3FVN A;  4ND9 A;  3EN3 A;  4R6H A;  1BLF A;  4ELP A;  4QF9 A;  1I69 A;  4G68 C;  4LQ2 A;  2FNC A;  2ZYK A;  3OOA A;  2CZL A;  3M3K A;  2R71 A;  3TZA A;  1QUJ A;  3N6U A;  4G2Z A;  1MXX A;  5A5X B;  2QPQ A;  1PB9 A;  3K01 A;  1D4N A;  1M5F A;  2RIN A;  4NED A;  2F7B A;  1R9L A;  4IO3 A;  1USY E;  2OK2 A;  1B5H A;  3FVO A;  1J1N A;  4G8H A;  3DRI A;  1LAX A;  4PET A;  2DWA A;  2W7Y A;  4JB7 A;  4TLL B;  3PPP A;  4PFT A;  4GL0 A;  2Y7W A;  1MQD A;  3U92 A;  4AQ4 A;  4C1U A;  1HSJ A;  4FJP A;  2Q88 A;  1H76 A;  3S9E A;  3HST A;  5ICQ A;  2VGQ A;  1IIT A;  4F39 A;  2YLN A;  4OWD A;  1NMU A;  2F7C A;  3FVK A;  3MAM A;  3MVZ A;  1JET A;  5DEX B;  5HPQ A;  4ZE8 A;  4MFI A;  4OQO A;  1II5 A;  2REG A;  4RJZ A;  5LOM A;  2XXR A;  5H8F A;  2UVI A;  2XXH A;  2AL5 A;  3KN7 A;  4DLD A;  2O7U A;  1MQG A;  4IB2 A;  1B52 A;  5FTH A;  2Q89 A;  4GL8 A;  1N3W A;  1EH3 A;  3T22 A;  3O6G A;  5EYF A;  1PBQ A;  1MXU A;  3TEP A;  4LA9 A;  2WKY A;  5KZT A;  3KOT A;  2QS2 A;  2NUV A;  3W9W A;  1IZ1 A;  2I4B A;  4H5F A;  4NF4 B;  2DOJ A;  3U72 A;  1US5 A;  3HV1 A;  2RC7 A;  1SDX A;  4RXL A;  2F97 A;  3CHG A;  2Y7K A;  2HEU A;  5I2N A;  1A7L A;  2FYI A;  4ZS9 A;  3PU5 A;  3H6V A;  3W9V A;  2O6A A;  1LCF A;  3MZ9 A;  1NNF A;  3H06 B;  2OLB A;  4GIZ A;  5DEX A;  4GOT A;  1Y9U A;  2E1S A;  5ITP A;  3PUY E;  1AIV A;  5FHM A;  5H8H B;  1NNT A;  3EHS A;  5M2V A;  1ZKB A;  3ECR A;  4ZZE A;  1N7X A;  1XVX A;  4EF1 A;  2PMS A;  2XD3 A;  1NH8 A;  1DOT A;  1B3G A;  3BBR A;  1DSN A;  3DEL B;  1H44 A;  3CI8 A;  2P2A A;  3GXA A;  4DZ1 A;  4F22 A;  5H8N B;  2G93 A;  4U23 A;  5FHN A;  4UA8 A;  1FQD A;  4BDM A;  4RK9 A;  2GHA A;  4LZ7 A;  3M3F A;  3TQW A;  3O66 A;  1UIV A;  3HCQ A;  4JBZ A;  4FAJ A;  1OVT A;  3KFM A;  1SBP A;  4LZ8 A;  3MZB A;  1A8F A;  2OJT A;  5L8D A;  3FGS A;  4EUO A;  3FAS A;  2A5T B;  3K6W A;  1JW1 A;  4GWO A;  4YZZ A;  3MC2 A;  4ZZA A;  1B7H A;  1R9Q A;  2O7I A;  3CFX A;  4P0I A;  3K1M A;  4MBP A;  1Z7M E;  2I3V A;  3SET A;  5TPA B;  5B70 A;  4DCY A;  3FXU A;  4E0X A;  2ABH A;  3HPI A;  3USD A;  1MPC A;  3I3V A;  3FXR A;  3C35 A;  4F2Q A;  4YKJ A;  3FD3 A;  2VOZ A;  1M5E A;  3KN8 A;  3UN6 A;  4C0R A;  2DWH A;  5JTY B;  1SI1 A;  4IO4 A;  1YTV A;  5FHO A;  1P1N A;  4U4S A;  2BJJ X;  2ZNU A;  1B4Z A;  2H9B A;  4R2F A;  3B6W A;  4N13 A;  3O6I A;  3QIM A;  2O69 A;  4I1D A;  2X7P A;  2DE3 A;  2F6P A;  3N6T A;  4LAT A;  3K6X A;  4KYE A;  2QS4 A;  2REJ A;  4FE8 A; 
#chains in the Genus database with same CATH topology
 4M4G A;  4F29 A;  3S4U A;  3OEK A;  4JXI A;  4N6D A;  1MRP A;  1FSA A;  3TDJ A;  1OVB A;  1XC1 A;  4KFQ A;  3RPL B;  5L9O A;  4HXV A;  3KOS A;  5EYG A;  1M5B A;  5H8Q A;  5H8S A;  5TPA A;  5BUU A;  5EQ8 A;  4X1D A;  4H46 A;  1MY4 A;  5I57 A;  3ZS6 A;  3ILU B;  1N0T A;  3K2D A;  4PP0 A;  4N6K A;  3OXN A;  5L9M A;  4BDO A;  4OES A;  3BKI B;  4Q0C A;  3M3L A;  5KDT A;  4IO5 A;  5TU0 A;  2XXV A;  3GBB A;  4F18 A;  3B7D A;  3MZ1 A;  4R9G A;  1MDQ A;  3VVF A;  4FIM A;  5I59 B;  3IX1 A;  4MLV A;  1INP A;  4U21 A;  2OWT A;  2OCU A;  1BIY A;  4U2R A;  3DM0 A;  1D3K A;  4N15 A;  4R2B A;  4BDQ A;  4KCC A;  1LBX A;  2RCB A;  3LR1 A;  2XHD A;  3SKP A;  3V5A A;  3G3J A;  3RNN A;  1K9Y A;  3TOD A;  3EQ1 A;  3T9V A;  4BLA A;  1VE4 A;  3IJX B;  3PPR A;  4G8N A;  2Y7I A;  1NL5 A;  3IOW A;  3H6T A;  5CBS A;  1RKM A;  3LSX A;  3SEU A;  1JP4 A;  4R75 A;  4ELQ A;  4OFJ A;  1QVS A;  4F1V A;  2V3Q A;  5DYH A;  2P3N A;  1N3X A;  4ZEF A;  5CMK A;  1EZ9 A;  2F78 A;  3CVG A;  2ZYO A;  1MQH A;  2QVV A;  4HCY A;  4H45 A;  4O3A A;  2HPG A;  1RYX A;  4NF8 B;  1PC3 A;  3D1R A;  4OVP A;  4P0G A;  2X7Q A;  3MBP A;  2WBB A;  1UTB A;  3Q29 A;  4IGR A;  3ODB A;  1MS7 A;  1GTK A;  2UYE A;  3LV0 A;  2B4L A;  1MXV A;  3U1O A;  4DE8 A;  2BJI A;  4ZEI A;  3G3I A;  4LUB A;  1DMB A;  4TOZ A;  2PYY A;  1MH4 A;  1RYO A;  4IO6 A;  2QRY A;  4YKK A;  1MH3 A;  4XKQ A;  1QW0 A;  2F6G A;  2V3U A;  2Z8D A;  2ZXT A;  3ILT B;  1FPK A;  2DSF A;  3HN0 A;  5IKB A;  3H7M A;  3T66 A;  3MVX A;  3T9H B;  4MJO A;  4U4X A;  1NV4 A;  4GX3 A;  3G3H A;  3SEY A;  1G0I A;  4NF6 A;  3MPK A;  3KG2 A;  1AL3 A;  1K9Z A;  5AA2 A;  1FPI A;  1O64 A;  1QUK A;  4IGT A;  2LAO A;  2VPO A;  3H3G A;  3UIF A;  4O8M A;  5AE4 A;  1MY1 A;  3IO6 A;  3F11 A;  4NF8 A;  1N84 A;  3TUS A;  1MQI A;  4OYV A;  4JVD A;  1MY3 A;  3K0V A;  4MF3 A;  4OVT A;  1LLS A;  4O94 A;  2DVZ A;  3QMF A;  5I5P A;  4F2O A;  4PFY A;  1OQG A;  3RY3 A;  4F3G A;  2HHM A;  1XOC A;  2H25 A;  1NV0 A;  3CSB A;  4EQB A;  3MQ9 A;  5T3J A;  1DCU A;  4RYA A;  2QS1 A;  1B9J A;  2ANJ A;  4F31 B;  4O3C A;  1NV7 A;  5TP9 A;  2L5V A;  4OFO A;  1POY 1;  3TAJ A;  2HAV A;  2DQV A;  2HXW A;  2Z22 A;  3QSL A;  3DRF A;  1TWY A;  1Y4T A;  3IL1 B;  4P1L A;  1NV1 A;  1JW5 A;  1IMA A;  1B1H A;  4NWC A;  4H65 A;  1A40 A;  4H0W A;  4BDR A;  2DE2 A;  2HCA A;  3MWB A;  1QUI A;  2PVU A;  4NGU A;  2P1S A;  3PPQ A;  3IB2 A;  3KBR A;  3TTR A;  2ZMB A;  3LSW A;  2R6G E;  4KD5 A;  5CBR A;  5EHM A;  3FXQ A;  3GBA A;  2B3F A;  3SES A;  2AYS A;  1FTL A;  2HAU A;  5CMC A;  1SW5 A;  3Q25 A;  3L6H A;  2XXU A;  2XXI A;  4GX6 A;  1H43 A;  1N04 A;  3O6H A;  3A3C A;  4EQ7 A;  1FBC A;  1RDX A;  2GH9 A;  2WOK A;  1CB6 A;  1PB7 A;  3ZKK A;  2CEX A;  4QFK A;  4GLI A;  3K6V A;  3OD7 A;  3TTK A;  3CFZ A;  4DDD A;  4PAI A;  1GVC A;  5A5X A;  3KJ7 A;  4P1E A;  3PPO A;  2ZZX A;  2PX1 A;  4PFU A;  3KJT A;  1B4H A;  3IO4 A;  3O9P A;  4MCO A;  2GRV A;  4ISU A;  4PGP A;  4OEV A;  1TXF A;  3D4C A;  3OSQ A;  1FBH A;  3CRB A;  3R26 A;  4GWY A;  4G61 A;  1XS5 A;  1QGX A;  4Q8R A;  5ET5 A;  3PV0 E;  2D5W A;  2UVG A;  3CG1 A;  3SEV A;  1FPL A;  1DPP A;  3EHU A;  4I62 A;  4KI0 E;  4X8R A;  1O7T A;  5I56 B;  3GLB A;  3SEX A;  1B7Z A;  3U8Q A;  1VDW A;  3IK6 B;  1XI6 A;  4YU0 A;  3A29 A;  1IQ7 A;  3H4Z A;  4POX A;  4X1B A;  3RTF B;  2I4C A;  4O3B A;  4NG7 A;  1YAE A;  2OBG A;  4WKM A;  4YMB A;  1US4 A;  2UVJ A;  4JWO A;  4KPT A;  2RKM A;  1H3D A;  2PFZ A;  1DK4 A;  4QSC A;  4PE3 A;  1SYI A;  3VE1 B;  3MW0 A;  3DP8 A;  3WAF A;  1VFE A;  1LB8 A;  1VFD A;  3TPA A;  4L17 A;  4PQJ A;  4HE0 A;  4LQ5 A;  4OVJ A;  1IXI A;  1POT A;  3BIG A;  4H67 A;  3MP8 A;  1LB9 A;  3PD8 A;  3U65 A;  3VV5 A;  3RYB A;  4G68 B;  4ELO A;  2XXP A;  3C33 A;  2XX9 A;  1PBP A;  3K1N A;  4MH5 A;  1MPB A;  4P47 A;  4ZEK A;  1A55 A;  2X26 A;  1NKX A;  1XT8 A;  3DRG A;  3UK4 A;  4EQ9 A;  5I56 A;  4NF4 A;  4Q30 B;  3G3F A;  2RC8 A;  3I6V A;  3TQL A;  2HFB A;  3N26 A;  3PUX E;  1LAF E;  4OXV A;  1NV5 A;  5I2K B;  1SW1 A;  3T93 B;  3C36 A;  3RYA A;  2XXK A;  1Q1K A;  5BWJ A;  2OZZ A;  1FQB A;  4PDD A;  5HM4 B;  4EXL A;  3I5O A;  5H8H A;  3TFL A;  1MPD A;  3LBS A;  3TTN A;  4LZ5 A;  2WBD A;  4U1Z A;  4PFB A;  4HW8 A;  2WOP A;  2F7A A;  1H45 A;  1EZO A;  4GVO A;  1LCT A;  2XX7 A;  1YXI A;  1B6H A;  1FTM A;  2YJP A;  5HBC A;  2M8C A;  2DXY A;  1NUW A;  1KA0 A;  3FJM A;  2E0S A;  2R8T A;  1NUY A;  5H8N A;  4MLQ A;  4AS4 A;  2NXO A;  1B3F A;  2KLF A;  3OMB A;  4XKN A;  1OLA A;  1URD A;  3MP6 A;  2ESN A;  1EYJ A;  4PFR A;  5FBP A;  4Q5T A;  1YYZ A;  1S7Y A;  3EPE A;  5DTB A;  3WAE A;  4AB5 A;  3TMG A;  5LTC A;  5EHS A;  1PEB A;  2I49 A;  4TLM B;  2HQ0 A;  3E9X A;  2A5T A;  5CM6 A;  3S9L C;  4ZED A;  1ZBM A;  4JWY A;  1LBY A;  3C32 A;  3IOU A;  4MX6 A;  3TCH A;  4UAB A;  1B51 A;  3MJN A;  2AL4 A;  3SZP A;  4EDP A;  2QL3 A;  3PPN A;  2XXY A;  5F1Q A;  4ONY A;  4IO7 A;  2F3D A;  3SER A;  1B5I A;  4R73 A;  4F3S A;  1BKA A;  1T0K A;  1YCJ A;  1NI9 A;  4NE4 A;  1I6B A;  3S9N C;  2RC9 A;  1F9B A;  2F8D A;  3K6U A;  1PB8 A;  3FV1 A;  2XWI A;  2ZNT A;  1MG1 A;  3PD9 A;  1S50 A;  3OSR A;  2Z23 A;  1MM7 A;  5JTY A;  2V84 A;  1QUL A;  3EF7 A;  3KN3 A;  4H1X A;  3S2V A;  1Y20 A;  3EKI A;  3UOR A;  3VFJ A;  5LDZ A;  4R6K A;  4XIG Q;  1FRP A;  4QRZ A;  4OEN A;  1WOD A;  5AA4 B;  3T0J A;  3B8B A;  3THI A;  4GFR A;  2XXW A;  4XKR A;  4PTK A;  2V3T A;  4WXJ A;  1ATG A;  3DP6 A;  3T96 B;  3VLV A;  2PFY A;  2Q2A A;  4PBQ A;  2QJE A;  3ZKL A;  5DT6 A;  4RNS A;  1LBW A;  1LST A;  3VLU A;  2VD2 A;  3KSX A;  4XTC Q;  3FIR A;  3G3G A;  5I58 B;  2HZL A;  1CE2 A;  2B65 A;  4YKI A;  2A5S A;  5F24 A;  3RPL A;  3V83 A;  4GXA A;  1SYH A;  3FV2 A;  4N81 A;  2H98 A;  3G3K A;  4R9F A;  3M8U A;  4R74 A;  3EHT A;  2FA7 A;  4F3P A;  1SW2 A;  4I40 A;  2OX3 A;  4XKP A;  4JWX A;  4PCD A;  4N8Y A;  5ITO A;  3RLF E;  1Y1Z A;  2HZK A;  4XFE A;  4MNC A;  4R6Y A;  3TTL A;  1EU8 A;  4I9D A;  5I59 A;  1TFD A;  4OAN A;  4DCX A;  3RQT A;  3OO7 A;  2D3I A;  1MXW A;  4RPO A;  1SVX B;  2VP1 A;  1FQE A;  4NF5 B;  4OER A;  3U93 A;  3PUZ E;  4NX1 A;  3IOR A;  3Q26 A;  3QK6 A;  2Q74 A;  4GXS B;  4POW A;  3N94 A;  2CEY A;  1B2H A;  1USY H;  5I58 A;  4ZE9 A;  2XWK A;  1ELJ A;  1Z7N E;  1BK4 A;  5KCJ B;  4OVS A;  3ISP A;  5AA2 D;  4OHN A;  1GR2 A;  1URG A;  3FZV A;  1IIW A;  1SD3 A;  3GYY A;  3UGW A;  4G77 A;  1PDA A;  2KR0 A;  4DXC A;  3Q28 A;  2WOL A;  1FTA A;  4M1V A;  1ANF A;  3L6G A;  3UP9 A;  1IEJ A;  2ZZW A;  4KCD A;  4N91 A;  1FBG A;  4OVQ A;  4LN5 A;  4F1U A;  1GGG A;  1A54 A;  2QSX A;  3RUM A;  3MVY A;  4N17 A;  3BFT A;  3A3U A;  2Y5L A;  3OEL A;  2ALU A;  2QVR A;  1IMF A;  3BIH A;  4IO2 A;  3IB0 A;  4NTL A;  5F7V A;  3IB1 A;  4PAF A;  3E78 A;  1P1O A;  4F3B A;  1AWB A;  2IEE A;  1B46 A;  1JNF A;  3PUV E;  3RGY A;  3BFU A;  5K2X A;  4H8J A;  2RCA A;  4PFI A;  4YB7 A;  4GX4 A;  2YPN A;  3TYH A;  3GZG A;  2H4I A;  4KHZ E;  3NOH A;  3U94 A;  2VHA A;  5IZ3 B;  1LFH A;  3RN8 A;  4Z0I A;  4XF5 A;  4O7M A;  2G29 A;  3LVU A;  4I8C A;  3ZSF A;  2F5X A;  1P1W A;  1NUX A;  5ELV A;  3JYR A;  2Q2C A;  1SW4 A;  1B0L A;  3ONM A;  3C9H A;  2PBW A;  1S9T A;  3MPL A;  1SQY A;  3IFA A;  4KYS A;  3B6Q A;  1BTJ A;  3HFU A;  1JVY A;  5H8F B;  4YMA A;  5DVJ A;  2DVC A;  3KC0 A;  2V25 A;  3V89 B;  4GBW A;  4PF6 A;  3E79 A;  2QFL A;  3AXF A;  1LBB A;  3QXM A;  4OMB A;  3TCG A;  1Y3P A;  4OTE A;  2FBP A;  3JZJ A;  1RDZ A;  4U22 A;  3DLN A;  4H6D A;  3OO6 A;  3DRJ A;  1I6A A;  5K2Y A;  3MUQ A;  4GF8 A;  4FED A;  1ZTY A;  1IXC A;  1D9V A;  4DI4 B;  1M5C A;  4JSD A;  4JVC A;  1D9Y A;  3DP4 A;  4YIC A;  1ZIU A;  1XVY A;  4G4P A;  4QSE A;  1FBP A;  5I2N B;  3B50 A;  4F1Y A;  1LBC A;  2CZK A;  3UA8 A;  4JDF A;  4THI A;  1R1N A;  3O28 A;  4IY5 A;  5ET7 A;  3MP1 A;  1L5T A;  3IOT A;  1JW4 A;  3VDF A;  5AA1 A;  4OA4 A;  4BDL A;  2QMX A;  4HE2 A;  3RYD A;  2GFE A;  3CG3 A;  2ZNS A;  4GWZ A;  2HXR A;  1P99 A;  4WED A;  3O6P A;  3DRH A;  1FBD A;  4KQP A;  4PDH A;  1WVJ A;  5EQ7 A;  1YPN A;  1OLC A;  2NWJ A;  3G7W A;  5J16 A;  1AOV A;  1N7W A;  1LFI A;  4E0W A;  3KZG A;  3DRK A;  1FTJ A;  3RT6 B;  1DBZ A;  4KR5 A;  2O68 A;  4ECF A;  3K1P A;  2H99 A;  1FW0 A;  3B6T A;  4G8M A;  3KSJ A;  5A5L A;  4GRK A;  4RY1 A;  4YB6 A;  4QSD A;  4DXB A;  5DVI A;  1IME A;  4P3L A;  2DYX A;  2I58 A;  1YZ0 A;  3FJ7 A;  3TTM A;  2ZYN A;  3IOV A;  2O51 A;  3FUZ A;  1BP5 A;  4QFL A;  2WYP A;  2DP8 A;  3CFL A;  1B3E A;  3RT8 A;  2I0C A;  1NUZ A;  2PCR A;  3IJO B;  4PE5 B;  3O29 A;  4QFP A;  3PUW E;  1Y3N A;  5IZZ A;  1ZU0 A;  2Q8J A;  3A09 A;  3PGF A;  4YAH X;  3C4M A;  1FTO A;  1EYK A;  3P7I A;  2DWJ A;  4PC9 A;  4ZDM A;  2UYF A;  5EQA A;  4EF2 A;  1OMP A;  2ONK E;  3LSL A;  4JSO A;  2FHY A;  3LUZ A;  5IAI A;  3VXC A;  3FBP A;  3RPW A;  1JQF A;  3VLW A;  2NVU B;  5I7I A;  3H6W A;  2ZYM A;  3CR9 A;  3HHG A;  4OZ9 A;  4H5G A;  3FJG A;  2CZH A;  3OO9 A;  2Z8F A;  4NF0 A;  1B5J A;  3IFC A;  3PMX A;  2Y7P A;  4XXU A;  3T1B A;  1MY2 A;  5B7D A;  1B40 A;  1UTH B;  1MDP 1;  3TEL A;  3FTO A;  5L9S A;  2VD3 A;  4QFN A;  5AA3 A;  4R72 A;  4PAK A;  4PF8 A;  3TKD A;  1OIB A;  3QUJ A;  2FIX A;  2O1L A;  3QAX A;  3LC8 A;  4GBV A;  4G68 A;  4YB5 A;  1URS A;  4JVI A;  5H8Q B;  3CSG A;  4ESX A;  3C34 A;  5CMM A;  5I57 B;  4LP2 B;  2XD2 A;  1Q35 A;  2F36 A;  5I3S A;  3Q27 A;  4AB6 A;  5KDT B;  5J1D A;  4RPN A;  4H8I A;  3D4G A;  3MVW A;  3QUF A;  4HCW A;  2OWS A;  3KBZ A;  3JV9 A;  2P0S A;  4N4U A;  3OO8 A;  1QJM A;  4HTG A;  1O63 A;  4K3F A;  5I2K A;  2RF1 A;  4P56 A;  4DIG A;  3FAT A;  3E4R A;  2O84 X;  3LUY A;  4FEC A;  2THI A;  5I84 A;  3K02 A;  5CRY A;  1UTH A;  5EYH A;  4HE1 A;  4GWW A;  5JK4 A;  1MQJ A;  4QHQ A;  1MM6 A;  1Y4C A;  2QMW A;  4ZEB A;  5JEI A;  1DTG A;  4DXU A;  3SDF A;  4RA1 A;  1KA1 A;  4P9K A;  3R7X A;  1Y3Q A;  3K4U A;  4C1T A;  4NHB A;  4WEP A;  3LSF B;  1B3L A;  2CMO A;  4TQU Q;  4UAC A;  3CIJ A;  4BDN A;  4GD5 A;  2XX8 A;  2UXA A;  1FQA A;  3OEN A;  1FTK A;  3T9X B;  4LVQ A;  1IXH A;  1A99 A;  3PMW A;  4KYD A;  1R6Z A;  1MXZ A;  4PBH A;  2PT2 A;  4FOR A;  2B4M A;  4ELR A;  3VVD A;  2UVH A;  1DPE A;  2XXX A;  2V93 A;  1JEV A;  4QFO A;  5IM2 A;  1NH7 A;  3H6U A;  4KXP A;  1UTB B;  1UIU A;  3N5L A;  2ONR A;  2F35 A;  4FAT A;  2PT1 A;  3TCF A;  4O7I A;  1IUD A;  1B7U A;  1NNK A;  1LGB C;  3SEW A;  3KEI A;  1VSO A;  4NWD A;  2I48 A;  2FIE A;  4EXK A;  3C31 A;  4PGN A;  4OFL A;  3RTW B;  2O1M A;  1QKB A;  1FBE A;  1HSE A;  2Y7R A;  4X04 A;  1FPG A;  2D21 A;  4OET A;  2NOO A;  4X9T A;  3K00 A;  1DTZ A;  2P3V A;  2DWI A;  4LON B;  1EZP A;  2GHB A;  1OQH A;  3ROJ A;  2DE4 A;  1JVX A;  4NF6 B;  3PMV A;  1UQW A;  5AA2 B;  1CNQ A;  4GWS A;  4X48 A;  3HHF A;  3R6U A;  2F34 A;  4MNP A;  1MY0 A;  5CMB A;  4ZEC A;  4P8B A;  5FTI A;  4F19 A;  1A8E A;  2Y5K A;  1Q9D A;  4IY6 A;  4FBP A;  2DDK A;  1KWH A;  2XXT A;  5AA4 A;  1D9Q A;  4FEB A;  5CI5 A;  1P1Q A;  1B32 A;  1FPF A;  1LAG E;  1B58 A;  3O2A A;  2IA4 A;  3O97 A;  3KGC A;  4PFW A;  1IXG A;  2QS3 A;  2DS9 A;  3H03 A;  2I3W A;  3V8X B;  4OEU A;  1B1X A;  1WDN A;  3VXB A;  1ZMG A;  1AH5 A;  1IMD A;  5ET8 A;  2Y84 A;  1FQC A;  4U1O A;  3HO7 A;  1ZLQ A;  2I0B A;  4NMY A;  4DI3 D;  3E13 X;  1RDY A;  5ET6 A;  1FQF A;  4Z7E A;  1I6Q A;  1XHY A;  5IZ1 A;  4P11 A;  1NNP A;  3W15 C;  2Q9T A;  1TFA A;  1B0H A;  4ESW A;  1M5D A;  5CC2 A;  2DXR A;  1MXY A;  1QKA A;  5TP9 B;  1JEU A;  2XWV A;  5DVF A;  1HSL A;  1P1U A;  3QYT A;  1FPD A;  3IR1 A;  4I3Y A;  1VR5 A;  5EQ9 A;  2R9J A;  3VVE A;  3T9U A;  3FVG A;  2VPN A;  3OEM A;  3MST A;  3S9M C;  2XXQ A;  1AMF A;  4NN3 A;  5ICT A;  1IMC A;  1Y1M A;  4GQO A;  2Z8E A;  4N07 A;  2H5Y A;  3IAZ A;  2B3B A;  2ONS A;  1B05 A;  4NF5 A;  1FCK A;  1NFT A;  1SI0 A;  1TT1 A;  4QBA A;  1GV8 A;  1KZ8 A;  2WYK A;  5ISU A;  3PAM A;  1ZJL A;  2AIX A;  1B3H A;  2I6E A;  1LFG A;  4N6P A;  4YKP A;  3E3K A;  1FPB A;  5KCJ A;  1N76 A;  4RK2 A;  4HS7 A;  1LAH E;  3FVN A;  4ND9 A;  3EN3 A;  4R6H A;  4GWU A;  1BLF A;  4ELP A;  4QF9 A;  1I69 A;  4G68 C;  2V4C A;  5ESY A;  4LQ2 A;  2FNC A;  2ZYK A;  3OOA A;  2CZL A;  3M3K A;  1FJ9 A;  2R71 A;  3TZA A;  1QUJ A;  3N6U A;  4G2Z A;  1MXX A;  5A5X B;  2QPQ A;  1PB9 A;  3K01 A;  1D4N A;  1M5F A;  2RIN A;  4NED A;  2F7B A;  1R9L A;  4IO3 A;  1USY E;  2OK2 A;  1B5H A;  3FVO A;  1J1N A;  2FVZ A;  4G8H A;  3DRI A;  1LAX A;  4PET A;  2DWA A;  2W7Y A;  4JB7 A;  4TLL B;  3PPP A;  4NAP A;  4PFT A;  4GL0 A;  2Y7W A;  1MQD A;  3U92 A;  4AQ4 A;  4C1U A;  1FPE A;  1HSJ A;  4FJP A;  2Q88 A;  5DW8 A;  1H76 A;  3S9E A;  1FJ6 A;  3HST A;  5ICQ A;  2VGQ A;  4N8G A;  1IIT A;  5IZ3 A;  4F39 A;  2YLN A;  2F3B A;  1FBF A;  4OVR A;  2GQ1 A;  4OWD A;  1NMU A;  2F7C A;  3FVK A;  3MAM A;  3MVZ A;  1JET A;  4AS5 A;  2CZI A;  5DEX B;  5HPQ A;  4MIJ A;  4ZE8 A;  4MFI A;  4OQO A;  4GWX A;  1II5 A;  2REG A;  4RJZ A;  5LOM A;  2XXR A;  5H8F A;  2UVI A;  2XXH A;  2AL5 A;  1LBV A;  3KN7 A;  4DLD A;  4MEV A;  2O7U A;  1MQG A;  4IB2 A;  1B52 A;  5FTH A;  2Q89 A;  4GL8 A;  1N3W A;  1EH3 A;  3T22 A;  2MKZ A;  3O6G A;  1FPJ A;  5EYF A;  1PBQ A;  4MMP A;  2QVU A;  1MXU A;  3TEP A;  3MYU A;  4LA9 A;  1NV3 A;  2WKY A;  5KZT A;  3KOT A;  2QS2 A;  2NUV A;  3W9W A;  1IZ1 A;  2I4B A;  4H5F A;  1SPI A;  4NF4 B;  2DOJ A;  3U72 A;  1US5 A;  3HV1 A;  2RC7 A;  1SDX A;  4RXL A;  4QXD A;  2F97 A;  3CHG A;  2Y7K A;  2HEU A;  5IGA A;  2XA5 A;  5I2N A;  1A7L A;  2FYI A;  4ZS9 A;  3PU5 A;  3H6V A;  3W9V A;  2O6A A;  1LCF A;  3MZ9 A;  1NNF A;  4MNI A;  3H06 B;  2Q8M A;  2OLB A;  4GIZ A;  1NV2 A;  3PTY A;  5DEX A;  4GOT A;  1Y9U A;  2E1S A;  5ITP A;  2KQZ A;  3PUY E;  1AIV A;  1NV6 A;  5FHM A;  5H8H B;  4MHF A;  1NNT A;  4NQ8 A;  3EHS A;  5M2V A;  1ZKB A;  3ECR A;  4ZZE A;  1N7X A;  1XVX A;  4EF1 A;  1G0H A;  2PMS A;  2XD3 A;  4MAG A;  1NH8 A;  1DOT A;  1B3G A;  3BBR A;  1DSN A;  3DEL B;  1H44 A;  3CI8 A;  2P2A A;  3GXA A;  4DZ1 A;  4F22 A;  2ZZV A;  2G93 A;  4U23 A;  5FHN A;  5H8N B;  4UA8 A;  1FQD A;  4BDM A;  4RK9 A;  2GHA A;  2WX9 A;  4LZ7 A;  2WEF A;  3FXB A;  3M3F A;  3TQW A;  3O66 A;  1UIV A;  3HCQ A;  4JBZ A;  1LEV A;  4FAJ A;  4I3E A;  1OVT A;  3KFM A;  1SBP A;  4LZ8 A;  3MZB A;  1A8F A;  2OJT A;  2XWO A;  4XEQ A;  5L8D A;  3FGS A;  4EUO A;  3FAS A;  2A5T B;  3K6W A;  1JW1 A;  4GWO A;  4YZZ A;  3MC2 A;  4ZZA A;  2JJK A;  1B7H A;  1R9Q A;  2O7I A;  3CFX A;  1IMB A;  3K1M A;  4P0I A;  4MBP A;  1Z7M E;  2I3V A;  3SET A;  5TPA B;  5B70 A;  4DCY A;  3FXU A;  4E0X A;  2ABH A;  3HPI A;  3USD A;  1MPC A;  3I3V A;  3FXR A;  3C35 A;  4F2Q A;  3KC1 A;  1EYI A;  4YKJ A;  3FD3 A;  2VOZ A;  1M5E A;  3KN8 A;  3UN6 A;  4IR8 A;  4C0R A;  2DWH A;  5JTY B;  1SI1 A;  4IO4 A;  1YTV A;  1LBZ A;  2VT5 A;  5FHO A;  1P1N A;  4U4S A;  2BJJ X;  2ZNU A;  1B4Z A;  2H9B A;  4R2F A;  3B6W A;  4N13 A;  2OWZ A;  3O6I A;  3QIM A;  2O69 A;  4I1D A;  2X7P A;  2DE3 A;  2F6P A;  3N6T A;  4LAT A;  3K6X A;  4KYE A;  2QS4 A;  2REJ A;  4FE8 A; 
#chains in the Genus database with same CATH homology
 4M4G A;  4F29 A;  3S4U A;  3OEK A;  4JXI A;  1MRP A;  3TDJ A;  1OVB A;  1XC1 A;  4KFQ A;  5L9O A;  3KOS A;  5H8Q A;  1M5B A;  5H8S A;  5TPA A;  5BUU A;  4X1D A;  5I57 A;  1MY4 A;  3ZS6 A;  3ILU B;  1N0T A;  3K2D A;  4PP0 A;  3OXN A;  5L9M A;  4BDO A;  4OES A;  3BKI B;  4Q0C A;  3M3L A;  5KDT A;  4IO5 A;  5TU0 A;  2XXV A;  3GBB A;  4F18 A;  3B7D A;  3MZ1 A;  4R9G A;  1MDQ A;  3VVF A;  4FIM A;  5I59 B;  3IX1 A;  4MLV A;  4U21 A;  2OWT A;  2OCU A;  1BIY A;  4U2R A;  3DM0 A;  1D3K A;  4R2B A;  4BDQ A;  4KCC A;  2RCB A;  3LR1 A;  2XHD A;  3SKP A;  3V5A A;  3G3J A;  3RNN A;  3TOD A;  3EQ1 A;  3T9V A;  4BLA A;  1VE4 A;  3IJX B;  3PPR A;  4G8N A;  2Y7I A;  1NL5 A;  3IOW A;  3H6T A;  5CBS A;  1RKM A;  3LSX A;  3SEU A;  4R75 A;  4ELQ A;  4OFJ A;  1QVS A;  4F1V A;  2V3Q A;  5DYH A;  1N3X A;  4ZEF A;  5CMK A;  1EZ9 A;  2F78 A;  3CVG A;  2ZYO A;  1MQH A;  4HCY A;  4O3A A;  1RYX A;  4NF8 B;  1PC3 A;  4P0G A;  2X7Q A;  3MBP A;  1UTB A;  3Q29 A;  4IGR A;  3ODB A;  1MS7 A;  1GTK A;  2UYE A;  2B4L A;  1MXV A;  3U1O A;  4DE8 A;  4ZEI A;  3G3I A;  4LUB A;  1DMB A;  4TOZ A;  2PYY A;  1MH4 A;  1RYO A;  4IO6 A;  2QRY A;  4YKK A;  1MH3 A;  4XKQ A;  1QW0 A;  2F6G A;  2V3U A;  2Z8D A;  2ZXT A;  3ILT B;  2DSF A;  3HN0 A;  5IKB A;  3H7M A;  3T66 A;  3MVX A;  3T9H B;  4U4X A;  3G3H A;  3SEY A;  4NF6 A;  3MPK A;  3KG2 A;  1AL3 A;  5AA2 A;  1O64 A;  1QUK A;  4IGT A;  2LAO A;  3H3G A;  3UIF A;  5AE4 A;  1MY1 A;  3IO6 A;  3F11 A;  4NF8 A;  1N84 A;  3TUS A;  1MQI A;  4OYV A;  1MY3 A;  3K0V A;  4MF3 A;  1LLS A;  2DVZ A;  4F2O A;  4PFY A;  1OQG A;  3RY3 A;  4F3G A;  1XOC A;  2H25 A;  3CSB A;  4EQB A;  3MQ9 A;  4RYA A;  2QS1 A;  1B9J A;  2ANJ A;  4F31 B;  4O3C A;  5TP9 A;  4OFO A;  1POY 1;  3TAJ A;  2HAV A;  2DQV A;  2HXW A;  2Z22 A;  3QSL A;  3DRF A;  1TWY A;  1Y4T A;  3IL1 B;  1JW5 A;  1B1H A;  4NWC A;  4H65 A;  1A40 A;  4H0W A;  4BDR A;  2DE2 A;  2HCA A;  3MWB A;  1QUI A;  2PVU A;  2P1S A;  3PPQ A;  3IB2 A;  3KBR A;  3TTR A;  2ZMB A;  3LSW A;  2R6G E;  4KD5 A;  5CBR A;  5EHM A;  3FXQ A;  3GBA A;  2B3F A;  3SES A;  2AYS A;  1FTL A;  2HAU A;  5CMC A;  1SW5 A;  3Q25 A;  3L6H A;  2XXU A;  2XXI A;  1H43 A;  1N04 A;  3O6H A;  3A3C A;  4EQ7 A;  2GH9 A;  2WOK A;  1CB6 A;  1PB7 A;  3ZKK A;  4QFK A;  4GLI A;  3K6V A;  3OD7 A;  3TTK A;  3CFZ A;  4DDD A;  1GVC A;  5A5X A;  3KJ7 A;  3PPO A;  2PX1 A;  4PFU A;  3KJT A;  1B4H A;  3IO4 A;  3O9P A;  2GRV A;  4ISU A;  4OEV A;  1TXF A;  3D4C A;  3OSQ A;  3CRB A;  3R26 A;  1XS5 A;  4Q8R A;  3PV0 E;  2D5W A;  2UVG A;  3CG1 A;  3SEV A;  1DPP A;  3EHU A;  4I62 A;  4KI0 E;  5I56 B;  1O7T A;  3GLB A;  3SEX A;  1B7Z A;  3U8Q A;  3IK6 B;  4YU0 A;  1IQ7 A;  3H4Z A;  4POX A;  4X1B A;  3RTF B;  2I4C A;  4O3B A;  1YAE A;  2OBG A;  4WKM A;  4YMB A;  1US4 A;  2UVJ A;  4JWO A;  4KPT A;  2RKM A;  1H3D A;  4QSC A;  1SYI A;  3VE1 B;  3MW0 A;  3DP8 A;  3WAF A;  1VFE A;  1LB8 A;  1VFD A;  3TPA A;  4L17 A;  4PQJ A;  4LQ5 A;  4OVJ A;  1IXI A;  1POT A;  4H67 A;  3MP8 A;  1LB9 A;  3PD8 A;  3VV5 A;  3RYB A;  4G68 B;  4ELO A;  2XXP A;  3C33 A;  2XX9 A;  1PBP A;  3K1N A;  4MH5 A;  1MPB A;  4ZEK A;  1A55 A;  2X26 A;  1NKX A;  1XT8 A;  3DRG A;  3UK4 A;  4EQ9 A;  5I56 A;  4NF4 A;  4Q30 B;  3G3F A;  2RC8 A;  3I6V A;  3TQL A;  2HFB A;  3N26 A;  3PUX E;  1LAF E;  4OXV A;  5I2K B;  1SW1 A;  3T93 B;  3C36 A;  3RYA A;  1Q1K A;  5BWJ A;  2OZZ A;  1FQB A;  5HM4 B;  4EXL A;  3I5O A;  5H8H A;  3TFL A;  1MPD A;  3LBS A;  3TTN A;  4LZ5 A;  4U1Z A;  4HW8 A;  2WOP A;  2F7A A;  1H45 A;  1EZO A;  4GVO A;  1LCT A;  2XX7 A;  1B6H A;  1FTM A;  2YJP A;  5HBC A;  2M8C A;  2DXY A;  3FJM A;  2E0S A;  5H8N A;  4MLQ A;  2NXO A;  1B3F A;  2KLF A;  3OMB A;  4XKN A;  1OLA A;  1URD A;  3MP6 A;  2ESN A;  4Q5T A;  1S7Y A;  3EPE A;  5DTB A;  3WAE A;  4AB5 A;  3TMG A;  5EHS A;  1PEB A;  2I49 A;  4TLM B;  2HQ0 A;  3E9X A;  2A5T A;  5CM6 A;  3S9L C;  4ZED A;  1ZBM A;  4JWY A;  3C32 A;  3IOU A;  3TCH A;  1B51 A;  3MJN A;  2AL4 A;  4EDP A;  2QL3 A;  3PPN A;  2XXY A;  5F1Q A;  4ONY A;  4IO7 A;  3SER A;  4F3S A;  1B5I A;  4R73 A;  1BKA A;  1T0K A;  1YCJ A;  4NE4 A;  1I6B A;  3S9N C;  2RC9 A;  1F9B A;  2F8D A;  3K6U A;  1PB8 A;  3FV1 A;  2ZNT A;  1MG1 A;  3PD9 A;  1S50 A;  3OSR A;  2Z23 A;  1MM7 A;  5JTY A;  2V84 A;  1QUL A;  3EF7 A;  3KN3 A;  4H1X A;  3S2V A;  1Y20 A;  3UOR A;  3VFJ A;  4R6K A;  4XIG Q;  4QRZ A;  4OEN A;  1WOD A;  5AA4 B;  3THI A;  4GFR A;  2XXW A;  4XKR A;  2V3T A;  4WXJ A;  1ATG A;  3DP6 A;  3T96 B;  3VLV A;  2Q2A A;  2QJE A;  3ZKL A;  5DT6 A;  4RNS A;  1LST A;  3VLU A;  4XTC Q;  2VD2 A;  3KSX A;  3FIR A;  3G3G A;  5I58 B;  2HZL A;  1CE2 A;  2B65 A;  4YKI A;  2A5S A;  3V83 A;  4GXA A;  1SYH A;  3FV2 A;  2H98 A;  3G3K A;  4R9F A;  3M8U A;  4R74 A;  3EHT A;  2FA7 A;  4F3P A;  1SW2 A;  4XKP A;  4JWX A;  5ITO A;  3RLF E;  1Y1Z A;  2HZK A;  4R6Y A;  3TTL A;  1EU8 A;  4I9D A;  5I59 A;  1TFD A;  4DCX A;  3RQT A;  3OO7 A;  2D3I A;  1MXW A;  4RPO A;  1SVX B;  2VP1 A;  1FQE A;  4NF5 B;  4OER A;  3U93 A;  3PUZ E;  3IOR A;  3Q26 A;  3QK6 A;  4GXS B;  4POW A;  3N94 A;  1B2H A;  1USY H;  5I58 A;  4ZE9 A;  1ELJ A;  1Z7N E;  5KCJ B;  5AA2 D;  4OHN A;  1GR2 A;  1URG A;  3FZV A;  1IIW A;  1SD3 A;  3UGW A;  4G77 A;  1PDA A;  4DXC A;  3Q28 A;  2WOL A;  4M1V A;  1ANF A;  3L6G A;  3UP9 A;  1IEJ A;  4KCD A;  4F1U A;  1GGG A;  1A54 A;  2QSX A;  3RUM A;  3MVY A;  3BFT A;  3A3U A;  3OEL A;  2ALU A;  4IO2 A;  3IB0 A;  4NTL A;  5F7V A;  3IB1 A;  1P1O A;  4F3B A;  2IEE A;  1B46 A;  1JNF A;  3PUV E;  3RGY A;  3BFU A;  5K2X A;  4H8J A;  2RCA A;  4YB7 A;  2YPN A;  3TYH A;  3GZG A;  2H4I A;  4KHZ E;  3U94 A;  2VHA A;  1LFH A;  3RN8 A;  4Z0I A;  2G29 A;  3LVU A;  4I8C A;  3ZSF A;  2F5X A;  1P1W A;  5ELV A;  3JYR A;  2Q2C A;  1SW4 A;  1B0L A;  3ONM A;  3C9H A;  2PBW A;  1S9T A;  3MPL A;  1SQY A;  4KYS A;  3B6Q A;  1BTJ A;  1JVY A;  5H8F B;  4YMA A;  5DVJ A;  2DVC A;  2V25 A;  3V89 B;  3AXF A;  1LBB A;  3QXM A;  4OMB A;  3TCG A;  1Y3P A;  4OTE A;  3JZJ A;  4U22 A;  3DLN A;  4H6D A;  3OO6 A;  3DRJ A;  1I6A A;  5K2Y A;  3MUQ A;  4GF8 A;  4FED A;  1ZTY A;  1IXC A;  1D9V A;  1M5C A;  4JSD A;  1D9Y A;  3DP4 A;  4YIC A;  1ZIU A;  1XVY A;  4G4P A;  4QSE A;  5I2N B;  4F1Y A;  1LBC A;  3UA8 A;  4JDF A;  4THI A;  1R1N A;  3O28 A;  4IY5 A;  3MP1 A;  1L5T A;  3IOT A;  1JW4 A;  3VDF A;  5AA1 A;  4BDL A;  2QMX A;  2GFE A;  3CG3 A;  2ZNS A;  1P99 A;  4WED A;  3O6P A;  3DRH A;  4KQP A;  1WVJ A;  1YPN A;  1OLC A;  2NWJ A;  3G7W A;  1AOV A;  1N7W A;  1LFI A;  4E0W A;  3KZG A;  3DRK A;  1FTJ A;  3RT6 B;  4KR5 A;  2O68 A;  4ECF A;  3K1P A;  2H99 A;  1FW0 A;  3B6T A;  4G8M A;  3KSJ A;  4GRK A;  4RY1 A;  4YB6 A;  4QSD A;  4DXB A;  5DVI A;  2DYX A;  2I58 A;  3FJ7 A;  3TTM A;  2ZYN A;  3IOV A;  2O51 A;  3FUZ A;  1BP5 A;  4QFL A;  2DP8 A;  3CFL A;  1B3E A;  3RT8 A;  2I0C A;  3IJO B;  4PE5 B;  3O29 A;  4QFP A;  3PUW E;  1Y3N A;  1ZU0 A;  2Q8J A;  3A09 A;  3PGF A;  4YAH X;  3C4M A;  1FTO A;  3P7I A;  2DWJ A;  4ZDM A;  2UYF A;  4EF2 A;  1OMP A;  2ONK E;  3LSL A;  4JSO A;  5IAI A;  3VXC A;  3RPW A;  1JQF A;  3VLW A;  2NVU B;  3H6W A;  2ZYM A;  3CR9 A;  3HHG A;  4OZ9 A;  4H5G A;  3FJG A;  3OO9 A;  2Z8F A;  1B5J A;  3PMX A;  2Y7P A;  4XXU A;  1MY2 A;  5B7D A;  1B40 A;  1UTH B;  1MDP 1;  3TEL A;  3FTO A;  5L9S A;  2VD3 A;  4QFN A;  5AA3 A;  4R72 A;  3TKD A;  1OIB A;  3QUJ A;  2O1L A;  3QAX A;  3LC8 A;  4G68 A;  4YB5 A;  1URS A;  5H8Q B;  3CSG A;  4ESX A;  3C34 A;  5CMM A;  5I57 B;  4LP2 B;  2XD2 A;  1Q35 A;  2F36 A;  3Q27 A;  4AB6 A;  5KDT B;  5J1D A;  4RPN A;  4H8I A;  3D4G A;  3MVW A;  3QUF A;  4HCW A;  2OWS A;  3JV9 A;  2P0S A;  3OO8 A;  1QJM A;  4HTG A;  1O63 A;  4K3F A;  5I2K A;  2RF1 A;  4DIG A;  3FAT A;  3E4R A;  2O84 X;  3LUY A;  4FEC A;  2THI A;  5I84 A;  3K02 A;  5CRY A;  1UTH A;  5JK4 A;  1MQJ A;  4QHQ A;  1MM6 A;  1Y4C A;  2QMW A;  4ZEB A;  5JEI A;  1DTG A;  4DXU A;  3SDF A;  4RA1 A;  3R7X A;  1Y3Q A;  3K4U A;  4C1T A;  4WEP A;  3LSF B;  1B3L A;  2CMO A;  4TQU Q;  4UAC A;  3CIJ A;  4BDN A;  4GD5 A;  2XX8 A;  2UXA A;  1FQA A;  3OEN A;  1FTK A;  3T9X B;  4LVQ A;  1IXH A;  1A99 A;  3PMW A;  4KYD A;  1R6Z A;  1MXZ A;  2PT2 A;  4FOR A;  2B4M A;  4ELR A;  3VVD A;  2UVH A;  1DPE A;  2XXX A;  2V93 A;  1JEV A;  4QFO A;  1NH7 A;  3H6U A;  1UTB B;  1UIU A;  3N5L A;  2ONR A;  2F35 A;  4FAT A;  2PT1 A;  3TCF A;  1IUD A;  1B7U A;  1NNK A;  1LGB C;  3SEW A;  3KEI A;  1VSO A;  4NWD A;  2I48 A;  4EXK A;  3C31 A;  4OFL A;  3RTW B;  2O1M A;  1QKB A;  1HSE A;  2Y7R A;  2D21 A;  4OET A;  2NOO A;  4X9T A;  3K00 A;  1DTZ A;  2DWI A;  4LON B;  1EZP A;  2GHB A;  1OQH A;  2DE4 A;  1JVX A;  4NF6 B;  3PMV A;  1UQW A;  5AA2 B;  4X48 A;  3HHF A;  3R6U A;  2F34 A;  1MY0 A;  5CMB A;  4ZEC A;  5FTI A;  4F19 A;  1A8E A;  4IY6 A;  1KWH A;  2XXT A;  5AA4 A;  5CI5 A;  4FEB A;  1P1Q A;  1B32 A;  1LAG E;  1B58 A;  3O2A A;  2IA4 A;  3O97 A;  3KGC A;  4PFW A;  1IXG A;  2QS3 A;  2DS9 A;  3H03 A;  2I3W A;  3VXB A;  4OEU A;  1B1X A;  1WDN A;  3V8X B;  1ZMG A;  1AH5 A;  2Y84 A;  1FQC A;  4U1O A;  3HO7 A;  1ZLQ A;  2I0B A;  4NMY A;  3E13 X;  1FQF A;  4Z7E A;  1I6Q A;  1XHY A;  4P11 A;  1NNP A;  3W15 C;  2Q9T A;  1TFA A;  1B0H A;  4ESW A;  1M5D A;  5CC2 A;  2DXR A;  1MXY A;  1QKA A;  5TP9 B;  1JEU A;  5DVF A;  1HSL A;  1P1U A;  3QYT A;  3IR1 A;  1VR5 A;  2R9J A;  3VVE A;  3T9U A;  3FVG A;  3OEM A;  3S9M C;  2XXQ A;  1AMF A;  5ICT A;  1Y1M A;  4GQO A;  2Z8E A;  4N07 A;  2H5Y A;  3IAZ A;  2B3B A;  2ONS A;  1B05 A;  4NF5 A;  1FCK A;  1NFT A;  1SI0 A;  1TT1 A;  1GV8 A;  5ISU A;  3PAM A;  1ZJL A;  2AIX A;  1B3H A;  2I6E A;  1LFG A;  4N6P A;  4YKP A;  3E3K A;  5KCJ A;  1N76 A;  4RK2 A;  4HS7 A;  1LAH E;  3FVN A;  4ND9 A;  3EN3 A;  4R6H A;  1BLF A;  4ELP A;  4QF9 A;  1I69 A;  4G68 C;  4LQ2 A;  2FNC A;  2ZYK A;  3OOA A;  2CZL A;  3M3K A;  2R71 A;  3TZA A;  1QUJ A;  3N6U A;  4G2Z A;  1MXX A;  5A5X B;  2QPQ A;  1PB9 A;  3K01 A;  1D4N A;  1M5F A;  2RIN A;  4NED A;  2F7B A;  1R9L A;  4IO3 A;  1USY E;  2OK2 A;  1B5H A;  3FVO A;  1J1N A;  4G8H A;  3DRI A;  1LAX A;  4PET A;  2DWA A;  2W7Y A;  4JB7 A;  4TLL B;  3PPP A;  4PFT A;  4GL0 A;  2Y7W A;  1MQD A;  3U92 A;  4AQ4 A;  4C1U A;  1HSJ A;  4FJP A;  2Q88 A;  1H76 A;  3S9E A;  3HST A;  5ICQ A;  2VGQ A;  1IIT A;  4F39 A;  2YLN A;  4OWD A;  1NMU A;  2F7C A;  3FVK A;  3MAM A;  3MVZ A;  1JET A;  5DEX B;  5HPQ A;  4ZE8 A;  4MFI A;  4OQO A;  1II5 A;  2REG A;  4RJZ A;  5LOM A;  2XXR A;  5H8F A;  2UVI A;  2XXH A;  2AL5 A;  3KN7 A;  4DLD A;  2O7U A;  1MQG A;  4IB2 A;  1B52 A;  5FTH A;  2Q89 A;  4GL8 A;  1N3W A;  1EH3 A;  3T22 A;  3O6G A;  5EYF A;  1PBQ A;  1MXU A;  3TEP A;  4LA9 A;  2WKY A;  5KZT A;  3KOT A;  2QS2 A;  2NUV A;  3W9W A;  1IZ1 A;  2I4B A;  4H5F A;  4NF4 B;  2DOJ A;  3U72 A;  1US5 A;  3HV1 A;  2RC7 A;  1SDX A;  4RXL A;  2F97 A;  3CHG A;  2Y7K A;  2HEU A;  5I2N A;  1A7L A;  2FYI A;  4ZS9 A;  3PU5 A;  3H6V A;  3W9V A;  2O6A A;  1LCF A;  3MZ9 A;  1NNF A;  3H06 B;  2OLB A;  4GIZ A;  5DEX A;  4GOT A;  1Y9U A;  2E1S A;  5ITP A;  3PUY E;  1AIV A;  5FHM A;  5H8H B;  1NNT A;  3EHS A;  5M2V A;  1ZKB A;  3ECR A;  4ZZE A;  1N7X A;  1XVX A;  4EF1 A;  2PMS A;  2XD3 A;  1NH8 A;  1DOT A;  1B3G A;  3BBR A;  1DSN A;  3DEL B;  1H44 A;  3CI8 A;  2P2A A;  3GXA A;  4DZ1 A;  4F22 A;  5H8N B;  2G93 A;  4U23 A;  5FHN A;  4UA8 A;  1FQD A;  4BDM A;  4RK9 A;  2GHA A;  4LZ7 A;  3M3F A;  3TQW A;  3O66 A;  1UIV A;  3HCQ A;  4JBZ A;  4FAJ A;  1OVT A;  3KFM A;  1SBP A;  4LZ8 A;  3MZB A;  1A8F A;  2OJT A;  5L8D A;  3FGS A;  4EUO A;  3FAS A;  2A5T B;  3K6W A;  1JW1 A;  4GWO A;  4YZZ A;  3MC2 A;  4ZZA A;  1B7H A;  1R9Q A;  2O7I A;  3CFX A;  4P0I A;  3K1M A;  4MBP A;  1Z7M E;  2I3V A;  3SET A;  5TPA B;  5B70 A;  4DCY A;  3FXU A;  4E0X A;  2ABH A;  3HPI A;  3USD A;  1MPC A;  3I3V A;  3FXR A;  3C35 A;  4F2Q A;  4YKJ A;  3FD3 A;  2VOZ A;  1M5E A;  3KN8 A;  3UN6 A;  4C0R A;  2DWH A;  5JTY B;  1SI1 A;  4IO4 A;  1YTV A;  5FHO A;  1P1N A;  4U4S A;  2BJJ X;  2ZNU A;  1B4Z A;  2H9B A;  4R2F A;  3B6W A;  4N13 A;  3O6I A;  3QIM A;  2O69 A;  4I1D A;  2X7P A;  2DE3 A;  2F6P A;  3N6T A;  4LAT A;  3K6X A;  4KYE A;  2QS4 A;  2REJ A;  4FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...