3PAMA

Crystal structure of a domain of transmembrane protein of abc-type oligopeptide transport system from bartonella henselae str. houston-1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
256
structure length
256
Chain Sequence
DIMGFVFNTRRTLFKDKRVRQALSILFDFEWVNHHLFNNIYTRTEGYWDGSILSSIGKPASEEEKALLAPYPDAVLPEVMDGSWRISKTDGSGMDRLNAQKAWKLLQEAGFTKKNNRLIAPNGLPFQFEIMTQSLEEEKVALAFQSNLSRLGIHAEIRTVDDSQYQNRLGMFNYDMIIGKLKNSLSPGNEQINRWSSASRNLKGSFNFSGASDPAIDAMITAILDAHSQVDFIAAVRALDRILISGSYYIPLYHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transmembrane protein
publication title Crystal structure of a domain of transmembrane protein of ABC-type oligopeptide transport system from Bartonella henselae str. Houston-1"
rcsb
source organism Bartonella henselae
molecule tags Transport protein
total genus 74
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3pamA00
2NOOA 1UIUA 2WOPA 3RYAA 3MVWA 4OERA 3DRKA 4ZE8A 3RY3A 4PFYA 3MZBA 3PAMA 1B52A 5KZTA 4XKRA 1RKMA 4ONYA 2D5WA 4RA1A 4QFNA 3M8UA 3TCFA 2B4LA 4JSOA 4XKNA 4GL8A 4ZEBA 5ICQA 3DRJA 2RKMA 4DCXA 4PFTA 3TCGA 1B58A 4ZEKA 4ZEDA 1B46A 1ZTYA 1B6HA 3MVZA 1UQWA 1B3FA 4PFWA 1UIVA 1JETA 1OLCA 3O9PA 1B9JA 4QFPA 4GFRA 1DPEA 3MVXA 1B51A 4WEDA 1JEUA 1B5HA 4ZEIA 1B4ZA 3LVUA 1XOCA 2WOKA 4QFLA 4JSDA 4I9DA 3DRIA 4OFJA 3MZ9A 4QFOA 1VR5A 3RYBA 4PFUA 4OFOA 4OEUA 4FAJA 1JEVA 4XKPA 2GRVA 4ZECA 5F1QA 1B4HA 3T66A 1B5JA 3I5OA 3DRHA 1OLAA 1QKBA 4OESA 3MW0A 1B5IA 3ZS6A 3TCHA 5ISUA 1B05A 2WOLA 1B7HA 2OLBA 2B4MA 4QFKA 5L8DA 1B3GA 4OEVA 1B1HA 1B3HA 1B2HA 3FTOA 3MVYA 1DPPA 4OETA 3E3KA 3DRFA 4XKQA 2Z23A 1B3LA 3DRGA 3TPAA 1B0HA 4TOZA 4OFLA 1B40A 3O6PA 3CHGA 3QIMA 3RQTA 2O7IA 1QKAA 4DCYA 4GF8A 5HM4B 1ZLQA 1ZU0A 1B32A 4I8CA 4ZE9A 3DP8A
chains in the Genus database with same CATH superfamily
2NOOA 1UIUA 2WOPA 3RYAA 3MVWA 4OERA 3DRKA 4ZE8A 3RY3A 4PFYA 3MZBA 3PAMA 1B52A 5KZTA 4XKRA 1RKMA 4ONYA 2D5WA 4RA1A 4QFNA 3M8UA 3TCFA 2B4LA 4JSOA 4XKNA 4GL8A 4ZEBA 5ICQA 3DRJA 2RKMA 4DCXA 4PFTA 3TCGA 1B58A 4ZEKA 4ZEDA 1B46A 1ZTYA 1B6HA 3MVZA 1UQWA 1B3FA 4PFWA 1UIVA 1JETA 1OLCA 3O9PA 1B9JA 4QFPA 4GFRA 1DPEA 3MVXA 1B51A 4WEDA 1JEUA 1B5HA 4ZEIA 1B4ZA 3LVUA 1XOCA 2WOKA 4QFLA 4JSDA 4I9DA 3DRIA 4OFJA 3MZ9A 4QFOA 1VR5A 3RYBA 4PFUA 4OFOA 4OEUA 4FAJA 1JEVA 4XKPA 2GRVA 4ZECA 5F1QA 1B4HA 3T66A 1B5JA 3I5OA 3DRHA 1OLAA 1QKBA 4OESA 3MW0A 1B5IA 3ZS6A 3TCHA 5ISUA 1B05A 2WOLA 1B7HA 2OLBA 2B4MA 4QFKA 5L8DA 1B3GA 4OEVA 1B1HA 1B3HA 1B2HA 3FTOA 3MVYA 1DPPA 4OETA 3E3KA 3DRFA 4XKQA 2Z23A 1B3LA 3DRGA 3TPAA 1B0HA 4TOZA 4OFLA 1B40A 3O6PA 3CHGA 3QIMA 3RQTA 2O7IA 1QKAA 4DCYA 4GF8A 5HM4B 1ZLQA 1ZU0A 1B32A 4I8CA 4ZE9A 3DP8A
chains in the Genus database with same CATH topology
2NOOA 1UIUA 2WOPA 3RYAA 3MVWA 4OERA 3DRKA 4ZE8A 3RY3A 4PFYA 3MZBA 3PAMA 1B52A 5KZTA 4XKRA 1RKMA 4ONYA 2D5WA 4RA1A 4QFNA 3M8UA 3TCFA 2B4LA 4JSOA 4XKNA 4GL8A 4ZEBA 5ICQA 3DRJA 2RKMA 4DCXA 4PFTA 3TCGA 1B58A 4ZEKA 4ZEDA 1B46A 1ZTYA 1B6HA 3MVZA 1UQWA 1B3FA 4PFWA 1UIVA 1JETA 1OLCA 3O9PA 1B9JA 4QFPA 4GFRA 1DPEA 3MVXA 1B51A 4WEDA 1JEUA 1B5HA 4ZEIA 1B4ZA 3LVUA 1XOCA 2WOKA 4QFLA 4JSDA 4I9DA 3DRIA 4OFJA 3MZ9A 4QFOA 1VR5A 3RYBA 4PFUA 4OFOA 4OEUA 4FAJA 1JEVA 4XKPA 2GRVA 4ZECA 5F1QA 1B4HA 3T66A 1B5JA 3I5OA 3DRHA 1OLAA 1QKBA 4OESA 3MW0A 1B5IA 3ZS6A 3TCHA 5ISUA 1B05A 2WOLA 1B7HA 2OLBA 2B4MA 4QFKA 5L8DA 1B3GA 4OEVA 1B1HA 1B3HA 1B2HA 3FTOA 3MVYA 1DPPA 4OETA 3E3KA 3DRFA 4XKQA 2Z23A 1B3LA 3DRGA 3TPAA 1B0HA 4TOZA 4OFLA 1B40A 3O6PA 3CHGA 3QIMA 3RQTA 2O7IA 1QKAA 4DCYA 4GF8A 5HM4B 1ZLQA 1ZU0A 1B32A 4I8CA 4ZE9A 3DP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOO A;  1UIU A;  2WOP A;  3RYA A;  3MVW A;  4OER A;  3DRK A;  4ZE8 A;  3RY3 A;  4PFY A;  3MZB A;  3PAM A;  1B52 A;  5KZT A;  4XKR A;  1RKM A;  4ONY A;  2D5W A;  4RA1 A;  4QFN A;  3M8U A;  3TCF A;  2B4L A;  4JSO A;  4XKN A;  4GL8 A;  4ZEB A;  5ICQ A;  3DRJ A;  2RKM A;  4DCX A;  4PFT A;  3TCG A;  1B58 A;  4ZEK A;  4ZED A;  1B46 A;  1ZTY A;  1B6H A;  3MVZ A;  1UQW A;  1B3F A;  4PFW A;  1UIV A;  1JET A;  1OLC A;  3O9P A;  1B9J A;  4QFP A;  4GFR A;  1DPE A;  3MVX A;  1B51 A;  4WED A;  1JEU A;  1B5H A;  4ZEI A;  1B4Z A;  3LVU A;  1XOC A;  2WOK A;  4QFL A;  4JSD A;  4I9D A;  3DRI A;  4OFJ A;  3MZ9 A;  4QFO A;  1VR5 A;  3RYB A;  4PFU A;  4OFO A;  4OEU A;  4FAJ A;  1JEV A;  4XKP A;  2GRV A;  4ZEC A;  5F1Q A;  1B4H A;  3T66 A;  1B5J A;  3I5O A;  3DRH A;  1OLA A;  1QKB A;  4OES A;  3MW0 A;  1B5I A;  3ZS6 A;  3TCH A;  5ISU A;  1B05 A;  2WOL A;  1B7H A;  2OLB A;  2B4M A;  4QFK A;  5L8D A;  1B3G A;  4OEV A;  1B1H A;  1B3H A;  1B2H A;  3FTO A;  3MVY A;  1DPP A;  4OET A;  3E3K A;  3DRF A;  4XKQ A;  2Z23 A;  1B3L A;  3DRG A;  3TPA A;  1B0H A;  4TOZ A;  4OFL A;  1B40 A;  3O6P A;  3CHG A;  3QIM A;  3RQT A;  2O7I A;  1QKA A;  4DCY A;  4GF8 A;  5HM4 B;  1ZLQ A;  1ZU0 A;  1B32 A;  4I8C A;  4ZE9 A;  3DP8 A; 
#chains in the Genus database with same CATH topology
 2NOO A;  1UIU A;  2WOP A;  3RYA A;  3MVW A;  4OER A;  3DRK A;  4ZE8 A;  3RY3 A;  4PFY A;  3MZB A;  3PAM A;  1B52 A;  5KZT A;  4XKR A;  1RKM A;  4ONY A;  2D5W A;  4RA1 A;  4QFN A;  3M8U A;  3TCF A;  2B4L A;  4JSO A;  4XKN A;  4GL8 A;  4ZEB A;  5ICQ A;  3DRJ A;  2RKM A;  4DCX A;  4PFT A;  3TCG A;  1B58 A;  4ZEK A;  4ZED A;  1B46 A;  1ZTY A;  1B6H A;  3MVZ A;  1UQW A;  1B3F A;  4PFW A;  1UIV A;  1JET A;  1OLC A;  3O9P A;  1B9J A;  4QFP A;  4GFR A;  1DPE A;  3MVX A;  1B51 A;  4WED A;  1JEU A;  1B5H A;  4ZEI A;  1B4Z A;  3LVU A;  1XOC A;  2WOK A;  4QFL A;  4JSD A;  4I9D A;  3DRI A;  4OFJ A;  3MZ9 A;  4QFO A;  1VR5 A;  3RYB A;  4PFU A;  4OFO A;  4OEU A;  4FAJ A;  1JEV A;  4XKP A;  2GRV A;  4ZEC A;  5F1Q A;  1B4H A;  3T66 A;  1B5J A;  3I5O A;  3DRH A;  1OLA A;  1QKB A;  4OES A;  3MW0 A;  1B5I A;  3ZS6 A;  3TCH A;  5ISU A;  1B05 A;  2WOL A;  1B7H A;  2OLB A;  2B4M A;  4QFK A;  5L8D A;  1B3G A;  4OEV A;  1B1H A;  1B3H A;  1B2H A;  3FTO A;  3MVY A;  1DPP A;  4OET A;  3E3K A;  3DRF A;  4XKQ A;  2Z23 A;  1B3L A;  3DRG A;  3TPA A;  1B0H A;  4TOZ A;  4OFL A;  1B40 A;  3O6P A;  3CHG A;  3QIM A;  3RQT A;  2O7I A;  1QKA A;  4DCY A;  4GF8 A;  5HM4 B;  1ZLQ A;  1ZU0 A;  1B32 A;  4I8C A;  4ZE9 A;  3DP8 A; 
#chains in the Genus database with same CATH homology
 2NOO A;  1UIU A;  2WOP A;  3RYA A;  3MVW A;  4OER A;  3DRK A;  4ZE8 A;  3RY3 A;  4PFY A;  3MZB A;  3PAM A;  1B52 A;  5KZT A;  4XKR A;  1RKM A;  4ONY A;  2D5W A;  4RA1 A;  4QFN A;  3M8U A;  3TCF A;  2B4L A;  4JSO A;  4XKN A;  4GL8 A;  4ZEB A;  5ICQ A;  3DRJ A;  2RKM A;  4DCX A;  4PFT A;  3TCG A;  1B58 A;  4ZEK A;  4ZED A;  1B46 A;  1ZTY A;  1B6H A;  3MVZ A;  1UQW A;  1B3F A;  4PFW A;  1UIV A;  1JET A;  1OLC A;  3O9P A;  1B9J A;  4QFP A;  4GFR A;  1DPE A;  3MVX A;  1B51 A;  4WED A;  1JEU A;  1B5H A;  4ZEI A;  1B4Z A;  3LVU A;  1XOC A;  2WOK A;  4QFL A;  4JSD A;  4I9D A;  3DRI A;  4OFJ A;  3MZ9 A;  4QFO A;  1VR5 A;  3RYB A;  4PFU A;  4OFO A;  4OEU A;  4FAJ A;  1JEV A;  4XKP A;  2GRV A;  4ZEC A;  5F1Q A;  1B4H A;  3T66 A;  1B5J A;  3I5O A;  3DRH A;  1OLA A;  1QKB A;  4OES A;  3MW0 A;  1B5I A;  3ZS6 A;  3TCH A;  5ISU A;  1B05 A;  2WOL A;  1B7H A;  2OLB A;  2B4M A;  4QFK A;  5L8D A;  1B3G A;  4OEV A;  1B1H A;  1B3H A;  1B2H A;  3FTO A;  3MVY A;  1DPP A;  4OET A;  3E3K A;  3DRF A;  4XKQ A;  2Z23 A;  1B3L A;  3DRG A;  3TPA A;  1B0H A;  4TOZ A;  4OFL A;  1B40 A;  3O6P A;  3CHG A;  3QIM A;  3RQT A;  2O7I A;  1QKA A;  4DCY A;  4GF8 A;  5HM4 B;  1ZLQ A;  1ZU0 A;  1B32 A;  4I8C A;  4ZE9 A;  3DP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...