3M8UA

Crystal structure of glutathione-binding protein a (gbpa) from haemophilus parasuis sh0165 in complex with glutathione disulfide (gssg)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
508
structure length
508
Chain Sequence
DKTFINCVSRSPTGFSPALVMDGISYNASSQQVYNRLVEFKRGSTDIEPALAESWTVSDDGLTYTFNLRKGVKFHSNKEFTPSRDFNADDVVFSFQRQLDPNHPYHNVSKATYPYFKAMKFSTLLKSVEKVDMHTVKITLNRQDATFLASLGMDFISIYSAEYADKMLAAGKPETIDTTPIGTGPFLFAGYQVDQKSRYLAHKEYWKGKADIDRLIFEIVPDATARYAKLQAGACDLIDFPNAADLEKMKTDPKVNLHSQSGLNIAYIAFNTEKAPFDNVKVRQALNYAVDKNAIIDAVYRGAGVAAKNPLPPTIWGYNNEITGYEYSPEKAKQLLKEAGFENGFETDIWVQPVVRASNPNPRRMAELVQSDWEKVGVKSKLVSYEWGDYIKRTKAGELTAGTYGWSGDNGDPDNFLSPLFGSENVGNSNYARFKNPELDALLHKAVGLSDKAERAKIYEQAQVLLKEQAPWINVAHSINFAPTSKRVQDYKQSPFGYTYLYGTKLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Heme-binding protein A
publication title Glutathione import in Haemophilus influenzae Rd is primed by the periplasmic heme-binding protein HbpA
pubmed doi rcsb
source organism Haemophilus parasuis
total genus 158
structure length 508
sequence length 508
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3m8uA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3m8uA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3m8uA02
1B4ZA 5CMMA 4ZECA 3PUZE 5KDTA 2YLNA 1WODA 2RINA 5HPQA 1B05A 4F39A 1LAXA 2DXYA 3OXNA 4H1XA 1TWYA 3KBRA 1OQHA 2ONKE 3E13X 1B9JA 4GFRA 5KDTB 1O63A 4YZZA 3EHTA 2UVIA 3MC2A 4KFQA 5I56A 3TEPA 1PEBA 3K02A 2Y7PA 2Q89A 3OO8A 3MVYA 1B7ZA 1MY3A 4FATA 4IO7A 4RYAA 5FTHA 1HSLA 4ESWA 5I56B 4WEDA 2ZNTA 2QJEA 4O3AA 1SW1A 4THIA 3FD3A 4R72A 1QKAA 1MXYA 2Y7IA 3TAJA 2R9JA 4BDOA 2HXWA 4LVQA 4F3BA 3K1PA 4LZ8A 3O28A 4YMAA 3U92A 3HPIA 1B3LA 1B5IA 4Q30B 4GRKA 4C0RA 2O1MA 4KCDA 3LR1A 1Y3NA 4TOZA 1M5EA 3T22A 3IR1A 2DE4A 2Z8DA 4X48A 3SEWA 5CC2A 2V25A 3PU5A 4IY6A 4HW8A 1B4HA 2I58A 4HS7A 3FV1A 3Q26A 4F2QA 2XXQA 3QUJA 4EXLA 1B5JA 3JYRA 1GTKA 2QMXA 2ZYKA 2WOKA 4IO3A 2O68A 1LSTA 3W9WA 2P0SA 3LSFB 3S2VA 1USYE 4ISUA 5CM6A 3U8QA 1NKXA 5CI5A 4DZ1A 2ABHA 3MVXA 3RTFB 5AA3A 1H45A 3GBBA 2R71A 2B4LA 4PFTA 1H44A 3MP8A 3IOWA 5BWJA 3DRGA 4R9FA 1S7YA 3CSGA 4FECA 1CE2A 3MUQA 3C32A 1MQDA 3MZ9A 4ZEIA 3T9HB 1EU8A 1Q35A 4UACA 4NE4A 4Z7EA 2F36A 4ESXA 1MXUA 4R9GA 4F29A 4JXIA 1NNTA 2PT1A 2ZNUA 4ELOA 3D4CA 1QUKA 3K6VA 4O3CA 1NL5A 4R73A 2OWTA 4EQ7A 3PPOA 1B46A 1ZIUA 5AA2A 3HV1A 1SW5A 3P7IA 2CMOA 1UIUA 3H6WA 3FATA 1OLCA 2F35A 2F6PA 5AA2B 2DP8A 1ZU0A 2DYXA 4KQPA 1MPBA 2DVCA 4FEBA 1NFTA 4ZEBA 5HM4B 5KZTA 2G93A 3T9XB 4PFYA 4IY5A 2P1SA 1FW0A 3DP8A 4YKPA 1PC3A 3FVGA 3JZJA 4KHZE 1LCTA 3O66A 1WDNA 4LQ2A 3WAEA 4F1YA 2X7PA 3FIRA 3PUVE 4FJPA 5H8SA 1LAGE 4F19A 4EQBA 4WKMA 1H43A 1H76A 1A54A 3PMWA 3MQ9A 4OMBA 5B70A 2DWAA 3TYHA 1UIVA 3E4RA 4NF6A 2PMSA 4JB7A 2O84X 4I8CA 4ZEFA 5CMCA 1P1WA 5KCJA 4Q5TA 1POY1 4ZE9A 3M3LA 3RN8A 1PDAA 2R6GE 4NF6B 3CG1A 3OSRA 4ND9A 3MZ1A 3QAXA 3O2AA 3FVKA 5KCJB 4NTLA 1URDA 3S9LC 3LVUA 4LATA 3OSQA 4KPTA 4UA8A 4IO4A 2XXRA 2XHDA 3DRJA 4FORA 2XXVA 1ANFA 1MQJA 2QMWA 3FXUA 2ZYNA 4R2FA 4XKQA 4G68A 1DMBA 3OOAA 3RY3A 3FVOA 2DXRA 1XC1A 1NH7A 1B0HA 2CZLA 2NVUB 4OYVA 1Q1KA 5B7DA 4OFJA 4YMBA 1B7UA 1MRPA 3FUZA 3KJTA 4G68B 1M5DA 3KEIA 2AL5A 4EDPA 3C31A 1O7TA 3DP4A 3C34A 3PPRA 4RK9A 3UP9A 1XS5A 4MF3A 1LGBC 2H9BA 2NOOA 4U4XA 4FIMA 1N7XA 4IO2A 4KD5A 4DE8A 3LSXA 2D5WA 2FA7A 4RJZA 2NXOA 1P1OA 3T96B 1FQEA 1IQ7A 2ANJA 3IL1B 4BDQA 3PGFA 4R75A 1B3GA 3FASA 1DTGA 4QFKA 1JETA 3O6HA 1MG1A 4ZZAA 2DOJA 4OVJA 3VLUA 3SDFA 1MPCA 2OCUA 1B1HA 3HN0A 1YAEA 1H3DA 5I2KA 1VFEA 3S9MC 2I4BA 3IORA 3VDFA 5AE4A 3QYTA 3RGYA 4AQ4A 1NNFA 2V3QA 3KOSA 4U1ZA 4EUOA 1URGA 5I2KB 4R2BA 1PBPA 1SW4A 5FHOA 4QSDA 1VSOA 5TPAA 4G77A 4QFOA 1SDXA 2PYYA 1N3XA 4NWDA 2GFEA 4F3GA 3K01A 2FYIA 2V93A 5BUUA 3QIMA 1JW4A 2DSFA 2OZZA 2P2AA 1LAHE 5TPAB 1MXZA 5CBSA 1B3EA 5L9MA 3K1MA 4YU0A 2I3WA 4R6HA 2XX8A 4PE5B 1GV8A 4JSDA 3B6TA 1B0LA 4RXLA 1EZPA 1TXFA 4GL0A 1N84A 1PB9A 1XVXA 2BJJX 3O29A 3ONMA 1XOCA 3Q28A 2A5TA 2Q9TA 3OMBA 2Z8EA 2F8DA 4L17A 3QSLA 2X7QA 4XXUA 3KN7A 1S9TA 3OO6A 2W7YA 4GL8A 2XXYA 4G8MA 3VVEA 1EH3A 3UA8A 3ZKKA 2A5TB 1OVBA 4U4SA 2Z23A 5F7VA 4Z0IA 4KR5A 2D3IA 4HTGA 1IIWA 1ATGA 3OO9A 2OJTA 2Q8JA 3PMXA 5DT6A 3RTWB 2XD2A 5L8DA 4G68C 4GXSB 2UVHA 1FTMA 1QW0A 2DQVA 3UORA 1R1NA 1AMFA 3PUXE 1HSEA 5AA4A 3DRFA 1EZOA 2RC7A 3R26A 4NF4A 2F7CA 1OQGA 5ITPA 3G3GA 4LZ5A 4ELRA 1B3FA 3C4MA 3N6TA 3TZAA 3N5LA 3GBAA 2H99A 2WKYA 4U23A 4AB5A 5ELVA 3DELB 1B5HA 5AA4B 2V84A 3DRKA 3TCGA 1JW5A 1XT8A 4OESA 4NF4B 2Q2CA 4KCCA 3E9XA 1A99A 2V3UA 3ILTB 3TCHA 2B65A 4DIGA 5ICQA 3RNNA 4GLIA 1GGGA 5I84A 4RK2A 2ZMBA 2ZYMA 4U2RA 1M5CA 3WAFA 3IOTA 3K0VA 1P99A 3IK6B 3HCQA 4GXAA 2HZLA 4G8HA 3UIFA 2ZYOA 1PB8A 4POWA 3H6UA 5JEIA 4JSOA 1FQCA 4X9TA 2F7BA 4IGRA 3IOUA 3M8UA 4LUBA 4RPOA 3RPWA 3RT8A 1MY0A 1SYHA 4FAJA 1LFGA 4F22A 2XXHA 3SEYA 3V8XB 2HEUA 3OO7A 3G3HA 3MBPA 5I2NA 4U1OA 4R6YA 4PFUA 3TTRA 3D4GA 4U22A 4ZEKA 4IB2A 2I3VA 1MS7A 4H0WA 4F2OA 5I2NB 1YCJA 4NMYA 4TQUQ 4C1UA 3TQLA 2UVGA 3V89B 4I1DA 1SYIA 2F97A 3CRBA 3IB0A 3DP6A 3FJ7A 1NNKA 3H6VA 2REGA 3O9PA 3G3KA 5IAIA 1LFHA 4OTEA 4H67A 5JK4A 5M2VA 2QSXA 3K6WA 5DVJA 3B6WA 1IZ1A 1MQIA 4OFLA 5CRYA 4OEVA 4KYDA 3DLNA 2XD3A 2XXPA 1Y20A 4FE8A 2HAVA 3Q29A 1JEVA 3S4UA 4H8IA 3C35A 3SKPA 2H25A 3MP6A 3MAMA 2GRVA 2DE2A 4F18A 1DPPA 3VE1B 3HHFA 4PQJA 1BP5A 3GLBA 1D4NA 3TTNA 4NEDA 4EF2A 1MH4A 1Y9UA 4DDDA 4POXA 3RT6B 4H5FA 4IO6A 5I59A 2QS4A 4GVOA 4OENA 2VHAA 2Z8FA 1NNPA 4XTCQ 3BFTA 3USDA 4ELQA 4MLVA 4OZ9A 4E0XA 1ZMGA 5I59B 4JWYA 4R74A 3FVNA 1USYH 2NUVA 1BIYA 1SW2A 3TTMA 1B52A 3OEKA 3TQWA 1B40A 2RCAA 5JTYA 1N7WA 5TP9A 3PPNA 3A3UA 2B4MA 1IITA 2AIXA 1SBPA 4JWXA 5ISUA 2RF1A 4ZZEA 3BFUA 3VVDA 1YTVA 1FCKA 4G8NA 5L9OA 1Y3QA 1MXVA 3N94A 3VFJA 5JTYB 5TP9B 1AL3A 1PB7A 1SI0A 3UN6A 4QSCA 1XHYA 3RYAA 2ONSA 3G3FA 4LP2B 3LUYA 3W15C 5K2YA 4QFLA 1URSA 3AXFA 3IO6A 1LLSA 3A09A 1EZ9A 4AB6A 4H8JA 1ELJA 5ICTA 1SQYA 1IXGA 1N0TA 2QS2A 2RC8A 3IO4A 1JEUA 4PETA 3O6GA 4KI0E 2A5SA 1JNFA 3CFXA 3SESA 3C9HA 3T9VA 1SI1A 4LONB 1UTHA 3ZS6A 3MW0A 1R9LA 3RLFE 3BBRA 3MVZA 3TPAA 4HCWA 2GHBA 1LBBA 1GVCA 3FTOA 3RUMA 4M1VA 2PX1A 3KFMA 3JV9A 2WOPA 5DEXA 1UTHB 5H8QA 3SEUA 3PPPA 3PD8A 2B3BA 1RYOA 2XX7A 3FJGA 2ALUA 3SEVA 3K4UA 1F9BA 4DCYA 2I49A 1FQAA 3K00A 3FZVA 1VE4A 5DEXB 1BKAA 1B32A 5H8QB 5TU0A 2UYFA 3EN3A 3DRHA 1MQHA 4G4PA 1VFDA 3O97A 3IJOB 4ZS9A 1AH5A 4TLLB 1ZKBA 2Q2AA 2DE3A 4QSEA 1NMUA 2I4CA 4XIGQ 1LB9A 4ZDMA 2WOLA 5AA2D 3MZBA 1FTKA 1BLFA 3M3FA 1MH3A 3VLVA 4ELPA 4HCYA 3T66A 3PV0E 4OETA 4PP0A 2PVUA 2QS1A 1UTBA 1ZBMA 2F6GA 1QVSA 2O7UA 2Y7RA 2LAOA 2D21A 5DTBA 5H8FA 3PAMA 2VP1A 3HSTA 4GQOA 4GF8A 1UTBB 2V3TA 5EHSA 1Z7NE 1DSNA 3GZGA 1JQFA 2I48A 5I57A 2H5YA 1B6HA 1JW1A 5H8FB 3VVFA 3HHGA 3CVGA 4ZE8A 4JWOA 5J1DA 4YKJA 4F3SA 3E3KA 5EHMA 2UVJA 3L6GA 3S9EA 2DWJA 3IAZA 3H7MA 1I6AA 3CFZA 4LA9A 1DTZA 3CFLA 5I57B 3TELA 1TFDA 3ODBA 5A5XA 2I0BA 3EHUA 1IUDA 4IO5A 1DPEA 2XXXA 3CI8A 2O7IA 2OWSA 4NF5A 5A5XB 2X26A 3KGCA 4OERA 4RPNA 5FHNA 3VLWA 4GOTA 3T9UA 2VGQA 3MWBA 1US5A 3KZGA 1RKMA 4NF5B 1SD3A 1Z7ME 3IB1A 4JBZA 2RCBA 4FEDA 3VV5A 4BDLA 4DXBA 1FQBA 2THIA 2FNCA 5AA1A 4K3FA 4NWCA 3U93A 4P11A 1GR2A 3EQ1A 1B51A 2F34A 1FTJA 2E0SA 3EHSA 5I58A 3O6PA 2Y7KA 2HCAA 3I5OA 1D9VA 3G7WA 1Y4TA 2DS9A 1II5A 1FQFA 1J1NA 4BLAA 3SEXA 3R7XA 3LSWA 4U21A 2HQ0A 1D9YA 2DVZA 3KN3A 2M8CA 5I58B 3HO7A 4NF8A 2GH9A 5DYHA 3DRIA 3TTLA 4QHQA 1JVYA 4N13A 4LQ5A 3S9NC 4I9DA 3QK6A 2ESNA 3KOTA 4BDNA 2ZXTA 2E1SA 1MXXA 1T0KA 4NF8B 4XKNA 2KLFA 3A3CA 4EXKA 2Y7WA 5L9SA 3LBSA 2QRYA 1B1XA 3O6IA 4O3BA 5K2XA 3G3IA 4C1TA 3MJNA 4BDMA 3KG2A 4DLDA 1MY1A 1MM7A 3OEMA 1M5BA 1QUIA 3R6UA 1A55A 3CHGA 5IKBA 4F1UA 3L6HA 3KN8A 2DWIA 2XXTA 4M4GA 3THIA 5H8HA 3IOVA 3G3JA 3C36A 3FXQA 2IEEA 4E0WA 2GHAA 4GWOA 4QFNA 3PPQA 3FJMA 3KSXA 3H06B 5H8HB 3MPLA 5DVFA 3K6XA 3CG3A 4LZ7A 2O6AA 3LC8A 1AOVA 2AYSA 3M3KA 5CMBA 1RYXA 3Q25A 1NH8A 3ILUB 4OXVA 1TT1A 4X1BA 3V83A 4P0GA 1D3KA 4Q0CA 4QFPA 2ONRA 4N07A 3MP1A 3PUYE 1IXIA 1FTOA 1WVJA 4F31B 3OD7A 3T93B 4I62A 2QL3A 1OMPA 4PFWA 4N6PA 3N26A 4P0IA 4H5GA 2PT2A 2XXIA 1R9QA 3CR9A 3K2DA 1R6ZA 4YAHX 1N04A 3W9VA 1QJMA 1YPNA 2DWHA 3V5AA 3H3GA 3U94A 2O1LA 2ZNSA 4MH5A 2QPQA 2IA4A 3I3VA 4DXCA 3SETA 4ONYA 4GIZA 1US4A 3VXBA 3K6UA 1AIVA 2HFBA 4MFIA 2HZKA 4QF9A 2NWJA 4OFOA 2YJPA 1M5FA 3CIJA 2Z22A 4X1DA 1ZLQA 1P1QA 2REJA 3OENA 3OELA 1IXCA 2I0CA 3PD9A 4MLQA 4KYSA 3TCFA 3MPKA 1MDP1 1SVXB 1MPDA 4KYEA 3TODA 4QRZA 1IEJA 4EQ9A 4ZEDA 3GXAA 1N76A 3I6VA 4OWDA 1BTJA 4YICA 3TMGA 4MBPA 1DOTA 1FTLA 1LFIA 1A8EA 1N3WA 1MQGA 2O69A 1TFAA 1CB6A 1Y1MA 4DXUA 5F1QA 3IB2A 1P1NA 2AL4A 4G2ZA 3CSBA 4OQOA 3KSJA 3B7DA 3IJXB 1A8FA 4R6KA 4DCXA 4XKPA 5FHMA 3MVWA 3ZSFA 5FTIA 2B3FA 2RC9A 4H65A 3FV2A 2OBGA 1JVXA 1A40A 1HSJA 5CMKA 2G29A 1I6BA 3LSLA 1Y1ZA 1MM6A 3H4ZA 2F5XA 1P1UA 4XKRA 3TDJA 3UK4A 2HAUA 4WXJA 2VD3A 4OHNA 3SERA 3TKDA 3EPEA 1LB8A 5CBRA 1MXWA 2H98A 2PBWA 1B3HA 2RKMA 4YB7A 2YPNA 4RNSA 1ZJLA 1UQWA 1MDQA 2O51A 4EF1A 5H8NA 4WEPA 2XXUA 3H03A 3IX1A 3RYBA 1FQDA 1B2HA 3U1OA 3PUWE 3BKIB 4RA1A 2UYEA 3RQTA 3QXMA 5LOMA 5H8NB 3TUSA 1OIBA 5HBCA 3UGWA 1Y3PA 2I6EA 2F7AA 4H6DA 1L5TA 1LCFA 1MY4A 2Q88A 5DVIA 4OEUA 2QS3A 4TLMB 1O64A 3KJ7A 1PBQA 1LBCA 2XX9A 1MY2A 1Y4CA 3FGSA 5ITOA 4YKKA 3VXCA 1B7HA 1XVYA 1QUJA 1POTA 1S50A 1OVTA 1B58A 3C33A 4YB6A 4GD5A 3B6QA 4YKIA 3H6TA 4ECFA 3TFLA 3F11A 1QULA 1LAFE 2OK2A 1A7LA 1I69A 3QUFA 1VR5A 3TTKA 4YB5A 2Y84A 3FXRA 4Q8RA 3N6UA 3EF7A 4JDFA 3ZKLA 1KWHA 2F78A 3ECRA 2H4IA 4RY1A 4IGTA 2VOZA 4F3PA 3K1NA 1OLAA 2OLBA 1IXHA 1I6QA 4F1VA 4BDRA 1QKBA 2UXAA 3PMVA 2VD2A 3Q27A 3DM0A 1ZTYA 5EYFA 3U72A 2XXWA
chains in the Genus database with same CATH superfamily
1B4ZA 4PTKA 5CMMA 4ZECA 3PUZE 5KDTA 2YLNA 1WODA 4XEQA 2RINA 5HPQA 1B05A 4F39A 1LAXA 2DXYA 3OXNA 4H1XA 5FBPA 1D9QA 1TWYA 3KBRA 1OQHA 2ONKE 3E13X 1B9JA 4GFRA 5KDTB 1O63A 4YZZA 4NQ8A 3QMFA 3EHTA 2UVIA 3MC2A 4KFQA 5I56A 3TEPA 1PEBA 3K02A 1AWBA 2Y7PA 2Q89A 3OO8A 4O7IA 3MVYA 1B7ZA 1MY3A 4FATA 2F3BA 1NI9A 4IO7A 4RYAA 5FTHA 1HSLA 4OVTA 4ESWA 5I56B 4WEDA 2ZNTA 2QJEA 5DW8A 1IMBA 4O3AA 1SW1A 3EKIA 4THIA 3FD3A 3ISPA 4R72A 1QKAA 4DI4B 1MXYA 2Y7IA 3TAJA 2R9JA 4BDOA 4X04A 2HXWA 4LVQA 4F3BA 3K1PA 4LZ8A 3O28A 4YMAA 1JP4A 3U92A 3HPIA 1B3LA 3E79A 1B5IA 4Q30B 4GRKA 4C0RA 2O1MA 4KCDA 3LR1A 1Y3NA 4TOZA 1M5EA 3T22A 3IR1A 2DE4A 2Z8DA 4X48A 3SEWA 5CC2A 2V25A 3PU5A 4IY6A 4HW8A 1B4HA 2I58A 4HS7A 3FV1A 3Q26A 5EQ8A 4F2QA 2XXQA 3QUJA 4EXLA 1B5JA 3JYRA 4PDHA 1GTKA 4I3EA 2QMXA 2ZYKA 2WOKA 1FBDA 4IO3A 2O68A 1LSTA 3W9WA 2P0SA 3GYYA 2WYKA 3LSFB 3S2VA 2JJKA 1USYE 4ISUA 5CM6A 3U8QA 4PDDA 1NKXA 5CI5A 4DZ1A 2ABHA 4GWYA 3MVXA 3RTFB 5AA3A 1H45A 4PBHA 3GBBA 2R71A 2B4LA 4PFTA 1H44A 3MP8A 3IOWA 5BWJA 5IZZA 2XWVA 3DRGA 4R9FA 1S7YA 3CSGA 4FECA 1CE2A 3MUQA 3C32A 1MQDA 3MZ9A 4ZEIA 3T9HB 1EU8A 1Q35A 4UACA 3HFUA 4NE4A 4Z7EA 2F36A 2WBDA 4ESXA 1MXUA 4R9GA 4F29A 4JXIA 1NNTA 2PT1A 2ZNUA 4ELOA 3D4CA 1QUKA 3K6VA 1LBVA 4O3CA 1NL5A 1YZ0A 4R73A 2OWTA 4EQ7A 3PPOA 2Y5LA 1B46A 1ZIUA 5AA2A 3HV1A 1SW5A 4GWUA 3P7IA 3KBZA 2CMOA 1UIUA 1YXIA 3H6WA 3FATA 1OLCA 2F35A 2XA5A 2F6PA 5AA2B 2DP8A 1ZU0A 1VDWA 2DYXA 4KQPA 1MPBA 4QBAA 2DVCA 4FEBA 1NFTA 3IFAA 5EYGA 4ZEBA 5HM4B 5KZTA 2G93A 3T9XB 4PFYA 5T3JA 4IY5A 1FPIA 2P1SA 1FW0A 3DP8A 4YKPA 1FTAA 1PC3A 3FVGA 3JZJA 4I40A 2PFYA 4KHZE 2HXRA 1LCTA 3O66A 1WDNA 1NV7A 4LQ2A 3WAEA 4F1YA 1FBGA 2X7PA 2OWZA 3FIRA 3PUVE 4OVQA 4FJPA 3SZPA 1DBZA 5H8SA 1LAGE 4F19A 4EQBA 4WKMA 1H43A 4GWWA 1H76A 1A54A 3PMWA 3MQ9A 4OMBA 5B70A 4P1LA 2DWAA 3TYHA 4OVPA 1UIVA 3E4RA 4NF6A 2PMSA 4JB7A 2O84X 4I8CA 4ZEFA 5CMCA 1P1WA 5KCJA 4Q5TA 1POY1 4ZE9A 3M3LA 3RN8A 2QVUA 1PDAA 2R6GE 1LBYA 4NF6B 1G0HA 3CG1A 3OSRA 4ND9A 3MZ1A 1EYKA 3QAXA 3O2AA 3FVKA 5KCJB 2KR0A 4NTLA 1URDA 3S9LC 4QXDA 2XWKA 3LVUA 4LATA 3OSQA 4KPTA 4UA8A 5ET5A 4IO4A 2XXRA 2XHDA 3DRJA 4FORA 2XXVA 1ANFA 1MQJA 2QMWA 3FXUA 2ZYNA 4R2FA 4XKQA 4G68A 1NV4A 1DMBA 1FBCA 3OOAA 3RY3A 3FVOA 2DXRA 1XC1A 1NH7A 1B0HA 2CZLA 2NVUB 4NF0A 4OYVA 1Q1KA 5B7DA 4OFJA 4YMBA 1B7UA 1MRPA 3FUZA 3KJTA 4G68B 1M5DA 1LEVA 3KEIA 3B50A 2AL5A 4P9KA 4EDPA 3C31A 1O7TA 3DP4A 3C34A 3PPRA 4RK9A 3UP9A 4OVSA 3FBPA 4FBPA 1XS5A 4MF3A 1LGBC 2H9BA 2NOOA 4U4XA 4FIMA 1N7XA 4IO2A 3PTYA 4KD5A 4DE8A 3LSXA 2D5WA 4PF6A 5ET8A 2FA7A 4RJZA 2NXOA 1P1OA 3T96B 1FQEA 1IQ7A 2ANJA 3IL1B 4HXVA 4HE2A 4BDQA 3PGFA 4R75A 1B3GA 3FASA 1DTGA 4QFKA 1JETA 3O6HA 1MG1A 1NUZA 4ZZAA 2CZHA 2DOJA 4OVJA 3VLUA 3SDFA 1MPCA 2OCUA 4MNCA 1B1HA 3HN0A 1YAEA 1H3DA 5I2KA 1VFEA 3S9MC 2I4BA 3IORA 3VDFA 5AE4A 3QYTA 3RGYA 4AQ4A 1NNFA 2V3QA 1FPDA 3KOSA 4U1ZA 4EUOA 1URGA 5I2KB 4MJOA 4P47A 4R2BA 1PBPA 1SW4A 5FHOA 4UABA 4QSDA 1VSOA 5TPAA 4G77A 4QFOA 1SDXA 2PYYA 2VPNA 3MSTA 1N3XA 4NWDA 2GFEA 4F3GA 1FJ9A 3T0JA 3K01A 2FYIA 2V93A 5BUUA 3QIMA 1JW4A 2DSFA 2OZZA 2P2AA 1LAHE 5TPAB 1MXZA 5CBSA 1B3EA 5L9MA 3K1MA 4YU0A 2MKZA 2I3WA 4R6HA 2XX8A 4PE5B 1GV8A 4JSDA 3B6TA 1B0LA 2Q74A 2CZKA 4RXLA 1EZPA 4NGUA 1TXFA 4GL0A 1N84A 1PB9A 1XVXA 2BJJX 5IZ3A 3O29A 3ONMA 1XOCA 3Q28A 2A5TA 2Q9TA 3OMBA 2Z8EA 2F8DA 4L17A 3QSLA 2X7QA 4XXUA 3KN7A 1S9TA 3OO6A 1XI6A 2W7YA 4GL8A 1RDZA 2XXYA 4G8MA 3VVEA 1EH3A 5IZ3B 3UA8A 3ZKKA 2A5TB 1OVBA 4U4SA 2Z23A 4OA4A 5F7VA 2L5VA 4Z0IA 4KR5A 3BIGA 2D3IA 4HTGA 1IIWA 1ATGA 3OO9A 2OJTA 2Q8JA 3PMXA 5DT6A 3RTWB 2XD2A 5L8DA 4G68C 4GXSB 2UVHA 1FTMA 1QW0A 2DQVA 3UORA 1R1NA 1AMFA 3PUXE 1HSEA 2PCRA 5AA4A 4LN5A 3DRFA 1EZOA 2RC7A 3R26A 4NF4A 2F7CA 1OQGA 5ITPA 4PF8A 3G3GA 4LZ5A 4ELRA 1KZ8A 1B3FA 3C4MA 4AS5A 3N6TA 3TZAA 3N5LA 3GBAA 2H99A 2WKYA 4U23A 4AB5A 4PAKA 5ELVA 3DELB 1B5HA 5AA4B 2V84A 3DRKA 3TCGA 1JW5A 1XT8A 4OESA 4NF4B 2Q2CA 4MCOA 4KCCA 3E9XA 2R8TA 5IM2A 1A99A 2V3UA 3ILTB 4PGPA 3TCHA 2B65A 4DIGA 5ICQA 3RNNA 4N8YA 4GLIA 1GGGA 5I84A 4RK2A 2ZMBA 2ZYMA 3T1BA 4O8MA 4U2RA 1M5CA 4OVRA 3WAFA 3IOTA 3K0VA 1CNQA 1P99A 3IK6B 4NAPA 3HCQA 4GXAA 5EQAA 2HZLA 4G8HA 4N15A 3UIFA 2ZYOA 1PB8A 4POWA 3H6UA 1INPA 5JEIA 4JSOA 1FQCA 4X9TA 2F7BA 4IGRA 3IOUA 3M8UA 4LUBA 4RPOA 3RPWA 3RT8A 1MY0A 4NN3A 1SYHA 4GX4A 4FAJA 1LFGA 2FIEA 4F22A 2XWOA 2XXHA 3SEYA 1SPIA 3V8XB 2HEUA 3OO7A 3G3HA 3MBPA 5I2NA 4U1OA 4R6YA 4PFUA 3TTRA 4MX6A 3D4GA 4U22A 4ZEKA 3B8BA 4IB2A 1FBPA 2I3VA 1MS7A 4H0WA 4F2OA 5I2NB 1YCJA 4NMYA 3D1RA 4TQUQ 1FPJA 4C1UA 3TQLA 2UVGA 2FVZA 3V89B 1NV0A 3E78A 4I1DA 1FBFA 1SYIA 2F97A 3CRBA 3IB0A 3DP6A 3FJ7A 1NNKA 3H6VA 5ESYA 2REGA 3O9PA 3G3KA 5IAIA 1LFHA 4OTEA 4H67A 5JK4A 4P56A 5M2VA 4H45A 2QSXA 3K6WA 5DVJA 3B6WA 1IZ1A 3IFCA 1MQIA 4OFLA 1KA0A 5CRYA 4OEVA 4KYDA 3LUZA 3DLNA 2XD3A 2XXPA 1Y20A 1QGXA 4FE8A 4O94A 2HAVA 3Q29A 1JEVA 3S4UA 4H8IA 3C35A 3SKPA 1LBWA 2DDKA 2H25A 3MP6A 3MAMA 2GRVA 2DE2A 4F18A 4PFBA 1DPPA 4G61A 3VE1B 3HHFA 4PQJA 3FXBA 1BP5A 3GLBA 4N91A 2FHYA 1D4NA 3TTNA 4NEDA 4MNIA 4EF2A 1MH4A 1FBHA 1Y9UA 4DDDA 4P3LA 4POXA 3KC0A 3RT6B 4H5FA 4IO6A 5I59A 2QS4A 4GVOA 4OENA 2VHAA 2Z8FA 1NNPA 4XTCQ 3BFTA 3USDA 4ELQA 2WX9A 4MLVA 1DCUA 4OZ9A 4E0XA 1ZMGA 5I59B 4JWYA 4R74A 3FVNA 1USYH 2NUVA 5LDZA 1BIYA 1SW2A 3TTMA 4JVCA 1B52A 3OEKA 3TQWA 1B40A 2RCAA 5JTYA 1N7WA 5TP9A 3PPNA 3A3UA 2B4MA 1IITA 2AIXA 1SBPA 4JWXA 5ISUA 2RF1A 1RDXA 4ZZEA 3BFUA 3VVDA 1YTVA 1FCKA 4G8NA 5L9OA 1Y3QA 4MIJA 1MXVA 2GQ1A 3N94A 3VFJA 5JTYB 5TP9B 1AL3A 1PB7A 1SI0A 1LBZA 3UN6A 4QSCA 1XHYA 3RYAA 2ONSA 3G3FA 3MYUA 4LP2B 3LUYA 3W15C 5K2YA 4QFLA 4XFEA 1URSA 3AXFA 4I3YA 3IO6A 1LLSA 3A09A 1EZ9A 4AB6A 4H8JA 1ELJA 5ICTA 1SQYA 2P3NA 4MEVA 5I7IA 1IXGA 1N0TA 4PAIA 1Q9DA 4MHFA 2QS2A 2RC8A 3IO4A 1JEUA 4PETA 1FPGA 5ET7A 3O6GA 4KI0E 2A5SA 2XXKA 1JNFA 3CFXA 3SESA 3C9HA 3T9VA 1SI1A 2OX3A 2CEXA 3A29A 4LONB 1UTHA 3ZS6A 3MW0A 1R9LA 4DI3D 3RLFE 3BBRA 3MVZA 3TPAA 5I3SA 4HCWA 2WYPA 1FPBA 2GHBA 1LBBA 1GVCA 3FTOA 3RUMA 4M1VA 2PX1A 3KFMA 3JV9A 2WOPA 1G0IA 4P8BA 5DEXA 1UTHB 2CZIA 5H8QA 4PFRA 3SEUA 3PPPA 3PD8A 2B3BA 1RYOA 2XX7A 3FJGA 2ALUA 3SEVA 4OANA 3K4UA 1F9BA 5IZ1A 4DCYA 2I49A 1FQAA 3K00A 3FZVA 1VE4A 5DEXB 4JVDA 1BKAA 1B32A 5H8QB 5TU0A 2UYFA 3EN3A 3DRHA 1MQHA 4G4PA 1VFDA 3O97A 1NV6A 3IJOB 4ZS9A 1AH5A 4TLLB 1ZKBA 1FBEA 3RPLA 3NOHA 2Q2AA 2DE3A 4MMPA 4QSEA 1NMUA 3BIHA 2I4CA 4XIGQ 1LB9A 1DK4A 4X8RA 4ZDMA 2WOLA 3RPLB 5AA2D 3MZBA 2WEFA 5EQ7A 5EQ9A 1FTKA 1BLFA 3M3FA 1MH3A 3VLVA 4ELPA 4HCYA 5IGAA 3T66A 3PV0E 4OETA 4PP0A 2PVUA 2QS1A 4GWSA 1UTBA 3LV0A 1ZBMA 2F6GA 1QVSA 2O7UA 2Y7RA 2LAOA 2D21A 5LTCA 5DTBA 5H8FA 3PAMA 2VP1A 5I5PA 3HSTA 3U65A 4GQOA 4GF8A 1UTBB 2V3TA 5EHSA 1Z7NE 1DSNA 3GZGA 1JQFA 2I48A 5I57A 2H5YA 1B6HA 1JW1A 5H8FB 3VVFA 3HHGA 3CVGA 4ZE8A 4JWOA 5J1DA 4YKJA 4F3SA 3E3KA 5EHMA 2UVJA 3L6GA 3S9EA 2HPGA 2DWJA 3IAZA 3H7MA 1I6AA 3CFZA 4LA9A 1DTZA 3CFLA 5I57B 3TELA 1K9YA 1TFDA 3ODBA 5A5XA 2I0BA 3EHUA 1IUDA 4IO5A 1DPEA 2XXXA 3CI8A 2O7IA 2OWSA 4NF5A 5A5XB 2X26A 3KGCA 4OERA 4RPNA 5FHNA 3VLWA 4GOTA 5ET6A 3T9UA 2VGQA 3MWBA 1US5A 3KZGA 1RKMA 4NF5B 1SD3A 1Z7ME 3IB1A 4JBZA 2RCBA 4FEDA 3VV5A 4BDLA 4DXBA 1FQBA 2THIA 2FNCA 5AA1A 1BK4A 4K3FA 4NWCA 3U93A 4P11A 1GR2A 3EQ1A 4GX6A 4PAFA 5A5LA 1FJ6A 1B51A 2F34A 1FTJA 2E0SA 3EHSA 5I58A 3O6PA 2Y7KA 2HCAA 3I5OA 1D9VA 3G7WA 4GWXA 1Y4TA 2DS9A 1II5A 1FQFA 2XWIA 1J1NA 4BLAA 3SEXA 3R7XA 3LSWA 4U21A 3ROJA 4HE1A 2HQ0A 1D9YA 2DVZA 3KN3A 2M8CA 5I58B 3HO7A 4NF8A 2GH9A 5DYHA 3DRIA 3TTLA 4QHQA 1JVYA 4N13A 4LQ5A 3S9NC 4I9DA 3QK6A 2ESNA 3KOTA 4BDNA 2ZXTA 2E1SA 2ZZVA 1MXXA 1T0KA 4NF8B 4XKNA 2KLFA 3A3CA 4EXKA 4N6KA 2Y7WA 5L9SA 3LBSA 2QRYA 1B1XA 3O6IA 4O3BA 5K2XA 3G3IA 4C1TA 3MJNA 4BDMA 3KG2A 4DLDA 2VPOA 1MY1A 1MM7A 3OEMA 1M5BA 1QUIA 3R6UA 2CEYA 1A55A 2FIXA 4AS4A 3CHGA 5IKBA 4F1UA 3L6HA 3KN8A 2DWIA 2WBBA 2XXTA 4M4GA 3THIA 5H8HA 3IOVA 3G3JA 3C36A 3FXQA 2IEEA 2ZZWA 4E0WA 2GHAA 4GWOA 4QFNA 3PPQA 3FJMA 4JVIA 3KSXA 3H06B 5H8HB 5EYHA 4KXPA 3MPLA 5DVFA 3K6XA 3CG3A 4LZ7A 2O6AA 3LC8A 1AOVA 2AYSA 3M3KA 5CMBA 1RYXA 3Q25A 1NH8A 2P3VA 3ILUB 4OXVA 1TT1A 2BJIA 4X1BA 3V83A 4P0GA 1D3KA 4Q0CA 4QFPA 2ONRA 1K9ZA 4PE3A 4N07A 3MP1A 3PUYE 1IXIA 1FTOA 1WVJA 2Q8MA 2KQZA 4F31B 3OD7A 3RYDA 3T93B 4I62A 2QL3A 1OMPA 4PFWA 4PCDA 4N6PA 3N26A 4P0IA 4H5GA 1EYJA 2PT2A 1FSAA 2XXIA 1R9QA 3CR9A 3K2DA 1R6ZA 4YAHX 1N04A 3W9VA 1QJMA 1YPNA 2DWHA 3V5AA 3H3GA 3U94A 2O1LA 2ZNSA 4MH5A 2QPQA 2IA4A 3I3VA 5F24A 4DXCA 4N4UA 3SETA 4ONYA 4GIZA 1US4A 2VT5A 3VXBA 1IMCA 3K6UA 1AIVA 2ZZXA 2HFBA 4MFIA 2QFLA 2HZKA 4IR8A 1LBXA 4QF9A 4H46A 2NWJA 4OFOA 4N8GA 4MNPA 2YJPA 1M5FA 4GBVA 1FRPA 3CIJA 2Z22A 2Y5KA 1KA1A 4X1DA 4MAGA 1ZLQA 1P1QA 2REJA 3OENA 3OELA 1IXCA 2I0CA 4XF5A 1IMFA 3PD9A 4MLQA 4KYSA 3TCFA 3MPKA 4PC9A 1MDP1 1SVXB 1MPDA 4KYEA 3TODA 4QRZA 1IEJA 4EQ9A 4ZEDA 3GXAA 1N76A 3I6VA 4OWDA 1BTJA 4YICA 3TMGA 4MBPA 1DOTA 1FTLA 1LFIA 1A8EA 2HHMA 1N3WA 1MQGA 1FPEA 2O69A 1TFAA 4O7MA 1CB6A 4GBWA 1Y1MA 4DXUA 5F1QA 2V4CA 1P1NA 3IB2A 2AL4A 4G2ZA 3CSBA 4OQOA 3KSJA 3B7DA 3IJXB 1A8FA 4R6KA 4DCXA 4GX3A 4XKPA 5FHMA 3MVWA 4PGNA 3ZSFA 5FTIA 2B3FA 2RC9A 4H65A 3FV2A 2OBGA 1JVXA 4HE0A 1A40A 1NV1A 1HSJA 1NUYA 5CMKA 2G29A 1I6BA 3LSLA 1Y1ZA 1MM6A 3H4ZA 1FPKA 2F5XA 1P1UA 4XKRA 3TDJA 3UK4A 2HAUA 4WXJA 2VD3A 4OHNA 1NV5A 1NUWA 3SERA 3TKDA 3EPEA 4N17A 1LB8A 5CBRA 4NX1A 1MXWA 2H98A 2PBWA 1B3HA 2RKMA 4YB7A 1IMDA 2YPNA 4RNSA 1ZJLA 2QVVA 1UQWA 1MDQA 2O51A 4EF1A 1NV3A 5H8NA 4WEPA 2XXUA 3H03A 4N81A 3IX1A 3RYBA 1FQDA 1B2HA 3U1OA 3PUWE 3BKIB 5J16A 4RA1A 2UYEA 3RQTA 3QXMA 5LOMA 5H8NB 3TUSA 1OIBA 5HBCA 2PFZA 1RDYA 3UGWA 4NG7A 1Y3PA 1IMEA 1FPFA 2I6EA 2F7AA 4H6DA 4P1EA 1L5TA 1LCFA 1YYZA 1MY4A 2Q88A 5DVIA 4OEUA 2QS3A 4TLMB 1O64A 3KJ7A 4N6DA 1PBQA 1LBCA 2XX9A 1MY2A 1Y4CA 3FGSA 2QVRA 1EYIA 1NUXA 5ITOA 1IMAA 4YKKA 3VXCA 4NHBA 1B7HA 1XVYA 1QUJA 1POTA 1S50A 4PFIA 1OVTA 1B58A 3C33A 4YB6A 4GD5A 3B6QA 4YKIA 3H6TA 1FPLA 4ECFA 3TFLA 3F11A 1QULA 1LAFE 2OK2A 4GWZA 1A7LA 1I69A 3QUFA 1VR5A 4YB5A 2Y84A 3FXRA 3TTKA 4Q8RA 2FBPA 3N6UA 3EF7A 4JDFA 3ZKLA 1KWHA 4PBQA 2F3DA 2F78A 3ECRA 2H4IA 4RY1A 4IGTA 2VOZA 4F3PA 3K1NA 1OLAA 2OLBA 1IXHA 1I6QA 4F1VA 3KC1A 4BDRA 1QKBA 2UXAA 3PMVA 2VD2A 3Q27A 3DM0A 1ZTYA 5EYFA 1NV2A 3U72A 2XXWA
chains in the Genus database with same CATH topology
1B4ZA 5CMMA 4ZECA 3PUZE 5KDTA 2YLNA 1WODA 2RINA 5HPQA 1B05A 4F39A 1LAXA 2DXYA 3OXNA 4H1XA 1TWYA 3KBRA 1OQHA 2ONKE 3E13X 1B9JA 4GFRA 5KDTB 1O63A 4YZZA 3EHTA 2UVIA 3MC2A 4KFQA 5I56A 3TEPA 1PEBA 3K02A 2Y7PA 2Q89A 3OO8A 3MVYA 1B7ZA 1MY3A 4FATA 4IO7A 4RYAA 5FTHA 1HSLA 4ESWA 5I56B 4WEDA 2ZNTA 2QJEA 4O3AA 1SW1A 4THIA 3FD3A 4R72A 1QKAA 1MXYA 2Y7IA 3TAJA 2R9JA 4BDOA 2HXWA 4LVQA 4F3BA 3K1PA 4LZ8A 3O28A 4YMAA 3U92A 3HPIA 1B3LA 1B5IA 4Q30B 4GRKA 4C0RA 2O1MA 4KCDA 3LR1A 1Y3NA 4TOZA 1M5EA 3T22A 3IR1A 2DE4A 2Z8DA 4X48A 3SEWA 5CC2A 2V25A 3PU5A 4IY6A 4HW8A 1B4HA 2I58A 4HS7A 3FV1A 3Q26A 4F2QA 2XXQA 3QUJA 4EXLA 1B5JA 3JYRA 1GTKA 2QMXA 2ZYKA 2WOKA 4IO3A 2O68A 1LSTA 3W9WA 2P0SA 3LSFB 3S2VA 1USYE 4ISUA 5CM6A 3U8QA 1NKXA 5CI5A 4DZ1A 2ABHA 3MVXA 3RTFB 5AA3A 1H45A 3GBBA 2R71A 2B4LA 4PFTA 1H44A 3MP8A 3IOWA 5BWJA 3DRGA 4R9FA 1S7YA 3CSGA 4FECA 1CE2A 3MUQA 3C32A 1MQDA 3MZ9A 4ZEIA 3T9HB 1EU8A 1Q35A 4UACA 4NE4A 4Z7EA 2F36A 4ESXA 1MXUA 4R9GA 4F29A 4JXIA 1NNTA 2PT1A 2ZNUA 4ELOA 3D4CA 1QUKA 3K6VA 4O3CA 1NL5A 4R73A 2OWTA 4EQ7A 3PPOA 1B46A 1ZIUA 5AA2A 3HV1A 1SW5A 3P7IA 2CMOA 1UIUA 3H6WA 3FATA 1OLCA 2F35A 2F6PA 5AA2B 2DP8A 1ZU0A 2DYXA 4KQPA 1MPBA 2DVCA 4FEBA 1NFTA 4ZEBA 5HM4B 5KZTA 2G93A 3T9XB 4PFYA 4IY5A 2P1SA 1FW0A 3DP8A 4YKPA 1PC3A 3FVGA 3JZJA 4KHZE 1LCTA 3O66A 1WDNA 4LQ2A 3WAEA 4F1YA 2X7PA 3FIRA 3PUVE 4FJPA 5H8SA 1LAGE 4F19A 4EQBA 4WKMA 1H43A 1H76A 1A54A 3PMWA 3MQ9A 4OMBA 5B70A 2DWAA 3TYHA 1UIVA 3E4RA 4NF6A 2PMSA 4JB7A 2O84X 4I8CA 4ZEFA 5CMCA 1P1WA 5KCJA 4Q5TA 1POY1 4ZE9A 3M3LA 3RN8A 1PDAA 2R6GE 4NF6B 3CG1A 3OSRA 4ND9A 3MZ1A 3QAXA 3O2AA 3FVKA 5KCJB 4NTLA 1URDA 3S9LC 3LVUA 4LATA 3OSQA 4KPTA 4UA8A 4IO4A 2XXRA 2XHDA 3DRJA 4FORA 2XXVA 1ANFA 1MQJA 2QMWA 3FXUA 2ZYNA 4R2FA 4XKQA 4G68A 1DMBA 3OOAA 3RY3A 3FVOA 2DXRA 1XC1A 1NH7A 1B0HA 2CZLA 2NVUB 4OYVA 1Q1KA 5B7DA 4OFJA 4YMBA 1B7UA 1MRPA 3FUZA 3KJTA 4G68B 1M5DA 3KEIA 2AL5A 4EDPA 3C31A 1O7TA 3DP4A 3C34A 3PPRA 4RK9A 3UP9A 1XS5A 4MF3A 1LGBC 2H9BA 2NOOA 4U4XA 4FIMA 1N7XA 4IO2A 4KD5A 4DE8A 3LSXA 2D5WA 2FA7A 4RJZA 2NXOA 1P1OA 3T96B 1FQEA 1IQ7A 2ANJA 3IL1B 4BDQA 3PGFA 4R75A 1B3GA 3FASA 1DTGA 4QFKA 1JETA 3O6HA 1MG1A 4ZZAA 2DOJA 4OVJA 3VLUA 3SDFA 1MPCA 2OCUA 1B1HA 3HN0A 1YAEA 1H3DA 5I2KA 1VFEA 3S9MC 2I4BA 3IORA 3VDFA 5AE4A 3QYTA 3RGYA 4AQ4A 1NNFA 2V3QA 3KOSA 4U1ZA 4EUOA 1URGA 5I2KB 4R2BA 1PBPA 1SW4A 5FHOA 4QSDA 1VSOA 5TPAA 4G77A 4QFOA 1SDXA 2PYYA 1N3XA 4NWDA 2GFEA 4F3GA 3K01A 2FYIA 2V93A 5BUUA 3QIMA 1JW4A 2DSFA 2OZZA 2P2AA 1LAHE 5TPAB 1MXZA 5CBSA 1B3EA 5L9MA 3K1MA 4YU0A 2I3WA 4R6HA 2XX8A 4PE5B 1GV8A 4JSDA 3B6TA 1B0LA 4RXLA 1EZPA 1TXFA 4GL0A 1N84A 1PB9A 1XVXA 2BJJX 3O29A 3ONMA 1XOCA 3Q28A 2A5TA 2Q9TA 3OMBA 2Z8EA 2F8DA 4L17A 3QSLA 2X7QA 4XXUA 3KN7A 1S9TA 3OO6A 2W7YA 4GL8A 2XXYA 4G8MA 3VVEA 1EH3A 3UA8A 3ZKKA 2A5TB 1OVBA 4U4SA 2Z23A 5F7VA 4Z0IA 4KR5A 2D3IA 4HTGA 1IIWA 1ATGA 3OO9A 2OJTA 2Q8JA 3PMXA 5DT6A 3RTWB 2XD2A 5L8DA 4G68C 4GXSB 2UVHA 1FTMA 1QW0A 2DQVA 3UORA 1R1NA 1AMFA 3PUXE 1HSEA 5AA4A 3DRFA 1EZOA 2RC7A 3R26A 4NF4A 2F7CA 1OQGA 5ITPA 3G3GA 4LZ5A 4ELRA 1B3FA 3C4MA 3N6TA 3TZAA 3N5LA 3GBAA 2H99A 2WKYA 4U23A 4AB5A 5ELVA 3DELB 1B5HA 5AA4B 2V84A 3DRKA 3TCGA 1JW5A 1XT8A 4OESA 4NF4B 2Q2CA 4KCCA 3E9XA 1A99A 2V3UA 3ILTB 3TCHA 2B65A 4DIGA 5ICQA 3RNNA 4GLIA 1GGGA 5I84A 4RK2A 2ZMBA 2ZYMA 4U2RA 1M5CA 3WAFA 3IOTA 3K0VA 1P99A 3IK6B 3HCQA 4GXAA 2HZLA 4G8HA 3UIFA 2ZYOA 1PB8A 4POWA 3H6UA 5JEIA 4JSOA 1FQCA 4X9TA 2F7BA 4IGRA 3IOUA 3M8UA 4LUBA 4RPOA 3RPWA 3RT8A 1MY0A 1SYHA 4FAJA 1LFGA 4F22A 2XXHA 3SEYA 3V8XB 2HEUA 3OO7A 3G3HA 3MBPA 5I2NA 4U1OA 4R6YA 4PFUA 3TTRA 3D4GA 4U22A 4ZEKA 4IB2A 2I3VA 1MS7A 4H0WA 4F2OA 5I2NB 1YCJA 4NMYA 4TQUQ 4C1UA 3TQLA 2UVGA 3V89B 4I1DA 1SYIA 2F97A 3CRBA 3IB0A 3DP6A 3FJ7A 1NNKA 3H6VA 2REGA 3O9PA 3G3KA 5IAIA 1LFHA 4OTEA 4H67A 5JK4A 5M2VA 2QSXA 3K6WA 5DVJA 3B6WA 1IZ1A 1MQIA 4OFLA 5CRYA 4OEVA 4KYDA 3DLNA 2XD3A 2XXPA 1Y20A 4FE8A 2HAVA 3Q29A 1JEVA 3S4UA 4H8IA 3C35A 3SKPA 2H25A 3MP6A 3MAMA 2GRVA 2DE2A 4F18A 1DPPA 3VE1B 3HHFA 4PQJA 1BP5A 3GLBA 1D4NA 3TTNA 4NEDA 4EF2A 1MH4A 1Y9UA 4DDDA 4POXA 3RT6B 4H5FA 4IO6A 5I59A 2QS4A 4GVOA 4OENA 2VHAA 2Z8FA 1NNPA 4XTCQ 3BFTA 3USDA 4ELQA 4MLVA 4OZ9A 4E0XA 1ZMGA 5I59B 4JWYA 4R74A 3FVNA 1USYH 2NUVA 1BIYA 1SW2A 3TTMA 1B52A 3OEKA 3TQWA 1B40A 2RCAA 5JTYA 1N7WA 5TP9A 3PPNA 3A3UA 2B4MA 1IITA 2AIXA 1SBPA 4JWXA 5ISUA 2RF1A 4ZZEA 3BFUA 3VVDA 1YTVA 1FCKA 4G8NA 5L9OA 1Y3QA 1MXVA 3N94A 3VFJA 5JTYB 5TP9B 1AL3A 1PB7A 1SI0A 3UN6A 4QSCA 1XHYA 3RYAA 2ONSA 3G3FA 4LP2B 3LUYA 3W15C 5K2YA 4QFLA 1URSA 3AXFA 3IO6A 1LLSA 3A09A 1EZ9A 4AB6A 4H8JA 1ELJA 5ICTA 1SQYA 1IXGA 1N0TA 2QS2A 2RC8A 3IO4A 1JEUA 4PETA 3O6GA 4KI0E 2A5SA 1JNFA 3CFXA 3SESA 3C9HA 3T9VA 1SI1A 4LONB 1UTHA 3ZS6A 3MW0A 1R9LA 3RLFE 3BBRA 3MVZA 3TPAA 4HCWA 2GHBA 1LBBA 1GVCA 3FTOA 3RUMA 4M1VA 2PX1A 3KFMA 3JV9A 2WOPA 5DEXA 1UTHB 5H8QA 3SEUA 3PPPA 3PD8A 2B3BA 1RYOA 2XX7A 3FJGA 2ALUA 3SEVA 3K4UA 1F9BA 4DCYA 2I49A 1FQAA 3K00A 3FZVA 1VE4A 5DEXB 1BKAA 1B32A 5H8QB 5TU0A 2UYFA 3EN3A 3DRHA 1MQHA 4G4PA 1VFDA 3O97A 3IJOB 4ZS9A 1AH5A 4TLLB 1ZKBA 2Q2AA 2DE3A 4QSEA 1NMUA 2I4CA 4XIGQ 1LB9A 4ZDMA 2WOLA 5AA2D 3MZBA 1FTKA 1BLFA 3M3FA 1MH3A 3VLVA 4ELPA 4HCYA 3T66A 3PV0E 4OETA 4PP0A 2PVUA 2QS1A 1UTBA 1ZBMA 2F6GA 1QVSA 2O7UA 2Y7RA 2LAOA 2D21A 5DTBA 5H8FA 3PAMA 2VP1A 3HSTA 4GQOA 4GF8A 1UTBB 2V3TA 5EHSA 1Z7NE 1DSNA 3GZGA 1JQFA 2I48A 5I57A 2H5YA 1B6HA 1JW1A 5H8FB 3VVFA 3HHGA 3CVGA 4ZE8A 4JWOA 5J1DA 4YKJA 4F3SA 3E3KA 5EHMA 2UVJA 3L6GA 3S9EA 2DWJA 3IAZA 3H7MA 1I6AA 3CFZA 4LA9A 1DTZA 3CFLA 5I57B 3TELA 1TFDA 3ODBA 5A5XA 2I0BA 3EHUA 1IUDA 4IO5A 1DPEA 2XXXA 3CI8A 2O7IA 2OWSA 4NF5A 5A5XB 2X26A 3KGCA 4OERA 4RPNA 5FHNA 3VLWA 4GOTA 3T9UA 2VGQA 3MWBA 1US5A 3KZGA 1RKMA 4NF5B 1SD3A 1Z7ME 3IB1A 4JBZA 2RCBA 4FEDA 3VV5A 4BDLA 4DXBA 1FQBA 2THIA 2FNCA 5AA1A 4K3FA 4NWCA 3U93A 4P11A 1GR2A 3EQ1A 1B51A 2F34A 1FTJA 2E0SA 3EHSA 5I58A 3O6PA 2Y7KA 2HCAA 3I5OA 1D9VA 3G7WA 1Y4TA 2DS9A 1II5A 1FQFA 1J1NA 4BLAA 3SEXA 3R7XA 3LSWA 4U21A 2HQ0A 1D9YA 2DVZA 3KN3A 2M8CA 5I58B 3HO7A 4NF8A 2GH9A 5DYHA 3DRIA 3TTLA 4QHQA 1JVYA 4N13A 4LQ5A 3S9NC 4I9DA 3QK6A 2ESNA 3KOTA 4BDNA 2ZXTA 2E1SA 1MXXA 1T0KA 4NF8B 4XKNA 2KLFA 3A3CA 4EXKA 2Y7WA 5L9SA 3LBSA 2QRYA 1B1XA 3O6IA 4O3BA 5K2XA 3G3IA 4C1TA 3MJNA 4BDMA 3KG2A 4DLDA 1MY1A 1MM7A 3OEMA 1M5BA 1QUIA 3R6UA 1A55A 3CHGA 5IKBA 4F1UA 3L6HA 3KN8A 2DWIA 2XXTA 4M4GA 3THIA 5H8HA 3IOVA 3G3JA 3C36A 3FXQA 2IEEA 4E0WA 2GHAA 4GWOA 4QFNA 3PPQA 3FJMA 3KSXA 3H06B 5H8HB 3MPLA 5DVFA 3K6XA 3CG3A 4LZ7A 2O6AA 3LC8A 1AOVA 2AYSA 3M3KA 5CMBA 1RYXA 3Q25A 1NH8A 3ILUB 4OXVA 1TT1A 4X1BA 3V83A 4P0GA 1D3KA 4Q0CA 4QFPA 2ONRA 4N07A 3MP1A 3PUYE 1IXIA 1FTOA 1WVJA 4F31B 3OD7A 3T93B 4I62A 2QL3A 1OMPA 4PFWA 4N6PA 3N26A 4P0IA 4H5GA 2PT2A 2XXIA 1R9QA 3CR9A 3K2DA 1R6ZA 4YAHX 1N04A 3W9VA 1QJMA 1YPNA 2DWHA 3V5AA 3H3GA 3U94A 2O1LA 2ZNSA 4MH5A 2QPQA 2IA4A 3I3VA 4DXCA 3SETA 4ONYA 4GIZA 1US4A 3VXBA 3K6UA 1AIVA 2HFBA 4MFIA 2HZKA 4QF9A 2NWJA 4OFOA 2YJPA 1M5FA 3CIJA 2Z22A 4X1DA 1ZLQA 1P1QA 2REJA 3OENA 3OELA 1IXCA 2I0CA 3PD9A 4MLQA 4KYSA 3TCFA 3MPKA 1MDP1 1SVXB 1MPDA 4KYEA 3TODA 4QRZA 1IEJA 4EQ9A 4ZEDA 3GXAA 1N76A 3I6VA 4OWDA 1BTJA 4YICA 3TMGA 4MBPA 1DOTA 1FTLA 1LFIA 1A8EA 1N3WA 1MQGA 2O69A 1TFAA 1CB6A 1Y1MA 4DXUA 5F1QA 3IB2A 1P1NA 2AL4A 4G2ZA 3CSBA 4OQOA 3KSJA 3B7DA 3IJXB 1A8FA 4R6KA 4DCXA 4XKPA 5FHMA 3MVWA 3ZSFA 5FTIA 2B3FA 2RC9A 4H65A 3FV2A 2OBGA 1JVXA 1A40A 1HSJA 5CMKA 2G29A 1I6BA 3LSLA 1Y1ZA 1MM6A 3H4ZA 2F5XA 1P1UA 4XKRA 3TDJA 3UK4A 2HAUA 4WXJA 2VD3A 4OHNA 3SERA 3TKDA 3EPEA 1LB8A 5CBRA 1MXWA 2H98A 2PBWA 1B3HA 2RKMA 4YB7A 2YPNA 4RNSA 1ZJLA 1UQWA 1MDQA 2O51A 4EF1A 5H8NA 4WEPA 2XXUA 3H03A 3IX1A 3RYBA 1FQDA 1B2HA 3U1OA 3PUWE 3BKIB 4RA1A 2UYEA 3RQTA 3QXMA 5LOMA 5H8NB 3TUSA 1OIBA 5HBCA 3UGWA 1Y3PA 2I6EA 2F7AA 4H6DA 1L5TA 1LCFA 1MY4A 2Q88A 5DVIA 4OEUA 2QS3A 4TLMB 1O64A 3KJ7A 1PBQA 1LBCA 2XX9A 1MY2A 1Y4CA 3FGSA 5ITOA 4YKKA 3VXCA 1B7HA 1XVYA 1QUJA 1POTA 1S50A 1OVTA 1B58A 3C33A 4YB6A 4GD5A 3B6QA 4YKIA 3H6TA 4ECFA 3TFLA 3F11A 1QULA 1LAFE 2OK2A 1A7LA 1I69A 3QUFA 1VR5A 3TTKA 4YB5A 2Y84A 3FXRA 4Q8RA 3N6UA 3EF7A 4JDFA 3ZKLA 1KWHA 2F78A 3ECRA 2H4IA 4RY1A 4IGTA 2VOZA 4F3PA 3K1NA 1OLAA 2OLBA 1IXHA 1I6QA 4F1VA 4BDRA 1QKBA 2UXAA 3PMVA 2VD2A 3Q27A 3DM0A 1ZTYA 5EYFA 3U72A 2XXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4Z A;  5CMM A;  4ZEC A;  3PUZ E;  5KDT A;  2YLN A;  1WOD A;  2RIN A;  5HPQ A;  1B05 A;  4F39 A;  1LAX A;  2DXY A;  3OXN A;  4H1X A;  1TWY A;  3KBR A;  1OQH A;  2ONK E;  3E13 X;  1B9J A;  4GFR A;  5KDT B;  1O63 A;  4YZZ A;  3EHT A;  2UVI A;  3MC2 A;  4KFQ A;  5I56 A;  3TEP A;  1PEB A;  3K02 A;  2Y7P A;  2Q89 A;  3OO8 A;  3MVY A;  1B7Z A;  1MY3 A;  4FAT A;  4IO7 A;  4RYA A;  5FTH A;  1HSL A;  4ESW A;  5I56 B;  4WED A;  2ZNT A;  2QJE A;  4O3A A;  1SW1 A;  4THI A;  3FD3 A;  4R72 A;  1QKA A;  1MXY A;  2Y7I A;  3TAJ A;  2R9J A;  4BDO A;  2HXW A;  4LVQ A;  4F3B A;  3K1P A;  4LZ8 A;  3O28 A;  4YMA A;  3U92 A;  3HPI A;  1B3L A;  1B5I A;  4Q30 B;  4GRK A;  4C0R A;  2O1M A;  4KCD A;  3LR1 A;  1Y3N A;  4TOZ A;  1M5E A;  3T22 A;  3IR1 A;  2DE4 A;  2Z8D A;  4X48 A;  3SEW A;  5CC2 A;  2V25 A;  3PU5 A;  4IY6 A;  4HW8 A;  1B4H A;  2I58 A;  4HS7 A;  3FV1 A;  3Q26 A;  4F2Q A;  2XXQ A;  3QUJ A;  4EXL A;  1B5J A;  3JYR A;  1GTK A;  2QMX A;  2ZYK A;  2WOK A;  4IO3 A;  2O68 A;  1LST A;  3W9W A;  2P0S A;  3LSF B;  3S2V A;  1USY E;  4ISU A;  5CM6 A;  3U8Q A;  1NKX A;  5CI5 A;  4DZ1 A;  2ABH A;  3MVX A;  3RTF B;  5AA3 A;  1H45 A;  3GBB A;  2R71 A;  2B4L A;  4PFT A;  1H44 A;  3MP8 A;  3IOW A;  5BWJ A;  3DRG A;  4R9F A;  1S7Y A;  3CSG A;  4FEC A;  1CE2 A;  3MUQ A;  3C32 A;  1MQD A;  3MZ9 A;  4ZEI A;  3T9H B;  1EU8 A;  1Q35 A;  4UAC A;  4NE4 A;  4Z7E A;  2F36 A;  4ESX A;  1MXU A;  4R9G A;  4F29 A;  4JXI A;  1NNT A;  2PT1 A;  2ZNU A;  4ELO A;  3D4C A;  1QUK A;  3K6V A;  4O3C A;  1NL5 A;  4R73 A;  2OWT A;  4EQ7 A;  3PPO A;  1B46 A;  1ZIU A;  5AA2 A;  3HV1 A;  1SW5 A;  3P7I A;  2CMO A;  1UIU A;  3H6W A;  3FAT A;  1OLC A;  2F35 A;  2F6P A;  5AA2 B;  2DP8 A;  1ZU0 A;  2DYX A;  4KQP A;  1MPB A;  2DVC A;  4FEB A;  1NFT A;  4ZEB A;  5HM4 B;  5KZT A;  2G93 A;  3T9X B;  4PFY A;  4IY5 A;  2P1S A;  1FW0 A;  3DP8 A;  4YKP A;  1PC3 A;  3FVG A;  3JZJ A;  4KHZ E;  1LCT A;  3O66 A;  1WDN A;  4LQ2 A;  3WAE A;  4F1Y A;  2X7P A;  3FIR A;  3PUV E;  4FJP A;  5H8S A;  1LAG E;  4F19 A;  4EQB A;  4WKM A;  1H43 A;  1H76 A;  1A54 A;  3PMW A;  3MQ9 A;  4OMB A;  5B70 A;  2DWA A;  3TYH A;  1UIV A;  3E4R A;  4NF6 A;  2PMS A;  4JB7 A;  2O84 X;  4I8C A;  4ZEF A;  5CMC A;  1P1W A;  5KCJ A;  4Q5T A;  1POY 1;  4ZE9 A;  3M3L A;  3RN8 A;  1PDA A;  2R6G E;  4NF6 B;  3CG1 A;  3OSR A;  4ND9 A;  3MZ1 A;  3QAX A;  3O2A A;  3FVK A;  5KCJ B;  4NTL A;  1URD A;  3S9L C;  3LVU A;  4LAT A;  3OSQ A;  4KPT A;  4UA8 A;  4IO4 A;  2XXR A;  2XHD A;  3DRJ A;  4FOR A;  2XXV A;  1ANF A;  1MQJ A;  2QMW A;  3FXU A;  2ZYN A;  4R2F A;  4XKQ A;  4G68 A;  1DMB A;  3OOA A;  3RY3 A;  3FVO A;  2DXR A;  1XC1 A;  1NH7 A;  1B0H A;  2CZL A;  2NVU B;  4OYV A;  1Q1K A;  5B7D A;  4OFJ A;  4YMB A;  1B7U A;  1MRP A;  3FUZ A;  3KJT A;  4G68 B;  1M5D A;  3KEI A;  2AL5 A;  4EDP A;  3C31 A;  1O7T A;  3DP4 A;  3C34 A;  3PPR A;  4RK9 A;  3UP9 A;  1XS5 A;  4MF3 A;  1LGB C;  2H9B A;  2NOO A;  4U4X A;  4FIM A;  1N7X A;  4IO2 A;  4KD5 A;  4DE8 A;  3LSX A;  2D5W A;  2FA7 A;  4RJZ A;  2NXO A;  1P1O A;  3T96 B;  1FQE A;  1IQ7 A;  2ANJ A;  3IL1 B;  4BDQ A;  3PGF A;  4R75 A;  1B3G A;  3FAS A;  1DTG A;  4QFK A;  1JET A;  3O6H A;  1MG1 A;  4ZZA A;  2DOJ A;  4OVJ A;  3VLU A;  3SDF A;  1MPC A;  2OCU A;  1B1H A;  3HN0 A;  1YAE A;  1H3D A;  5I2K A;  1VFE A;  3S9M C;  2I4B A;  3IOR A;  3VDF A;  5AE4 A;  3QYT A;  3RGY A;  4AQ4 A;  1NNF A;  2V3Q A;  3KOS A;  4U1Z A;  4EUO A;  1URG A;  5I2K B;  4R2B A;  1PBP A;  1SW4 A;  5FHO A;  4QSD A;  1VSO A;  5TPA A;  4G77 A;  4QFO A;  1SDX A;  2PYY A;  1N3X A;  4NWD A;  2GFE A;  4F3G A;  3K01 A;  2FYI A;  2V93 A;  5BUU A;  3QIM A;  1JW4 A;  2DSF A;  2OZZ A;  2P2A A;  1LAH E;  5TPA B;  1MXZ A;  5CBS A;  1B3E A;  5L9M A;  3K1M A;  4YU0 A;  2I3W A;  4R6H A;  2XX8 A;  4PE5 B;  1GV8 A;  4JSD A;  3B6T A;  1B0L A;  4RXL A;  1EZP A;  1TXF A;  4GL0 A;  1N84 A;  1PB9 A;  1XVX A;  2BJJ X;  3O29 A;  3ONM A;  1XOC A;  3Q28 A;  2A5T A;  2Q9T A;  3OMB A;  2Z8E A;  2F8D A;  4L17 A;  3QSL A;  2X7Q A;  4XXU A;  3KN7 A;  1S9T A;  3OO6 A;  2W7Y A;  4GL8 A;  2XXY A;  4G8M A;  3VVE A;  1EH3 A;  3UA8 A;  3ZKK A;  2A5T B;  1OVB A;  4U4S A;  2Z23 A;  5F7V A;  4Z0I A;  4KR5 A;  2D3I A;  4HTG A;  1IIW A;  1ATG A;  3OO9 A;  2OJT A;  2Q8J A;  3PMX A;  5DT6 A;  3RTW B;  2XD2 A;  5L8D A;  4G68 C;  4GXS B;  2UVH A;  1FTM A;  1QW0 A;  2DQV A;  3UOR A;  1R1N A;  1AMF A;  3PUX E;  1HSE A;  5AA4 A;  3DRF A;  1EZO A;  2RC7 A;  3R26 A;  4NF4 A;  2F7C A;  1OQG A;  5ITP A;  3G3G A;  4LZ5 A;  4ELR A;  1B3F A;  3C4M A;  3N6T A;  3TZA A;  3N5L A;  3GBA A;  2H99 A;  2WKY A;  4U23 A;  4AB5 A;  5ELV A;  3DEL B;  1B5H A;  5AA4 B;  2V84 A;  3DRK A;  3TCG A;  1JW5 A;  1XT8 A;  4OES A;  4NF4 B;  2Q2C A;  4KCC A;  3E9X A;  1A99 A;  2V3U A;  3ILT B;  3TCH A;  2B65 A;  4DIG A;  5ICQ A;  3RNN A;  4GLI A;  1GGG A;  5I84 A;  4RK2 A;  2ZMB A;  2ZYM A;  4U2R A;  1M5C A;  3WAF A;  3IOT A;  3K0V A;  1P99 A;  3IK6 B;  3HCQ A;  4GXA A;  2HZL A;  4G8H A;  3UIF A;  2ZYO A;  1PB8 A;  4POW A;  3H6U A;  5JEI A;  4JSO A;  1FQC A;  4X9T A;  2F7B A;  4IGR A;  3IOU A;  3M8U A;  4LUB A;  4RPO A;  3RPW A;  3RT8 A;  1MY0 A;  1SYH A;  4FAJ A;  1LFG A;  4F22 A;  2XXH A;  3SEY A;  3V8X B;  2HEU A;  3OO7 A;  3G3H A;  3MBP A;  5I2N A;  4U1O A;  4R6Y A;  4PFU A;  3TTR A;  3D4G A;  4U22 A;  4ZEK A;  4IB2 A;  2I3V A;  1MS7 A;  4H0W A;  4F2O A;  5I2N B;  1YCJ A;  4NMY A;  4TQU Q;  4C1U A;  3TQL A;  2UVG A;  3V89 B;  4I1D A;  1SYI A;  2F97 A;  3CRB A;  3IB0 A;  3DP6 A;  3FJ7 A;  1NNK A;  3H6V A;  2REG A;  3O9P A;  3G3K A;  5IAI A;  1LFH A;  4OTE A;  4H67 A;  5JK4 A;  5M2V A;  2QSX A;  3K6W A;  5DVJ A;  3B6W A;  1IZ1 A;  1MQI A;  4OFL A;  5CRY A;  4OEV A;  4KYD A;  3DLN A;  2XD3 A;  2XXP A;  1Y20 A;  4FE8 A;  2HAV A;  3Q29 A;  1JEV A;  3S4U A;  4H8I A;  3C35 A;  3SKP A;  2H25 A;  3MP6 A;  3MAM A;  2GRV A;  2DE2 A;  4F18 A;  1DPP A;  3VE1 B;  3HHF A;  4PQJ A;  1BP5 A;  3GLB A;  1D4N A;  3TTN A;  4NED A;  4EF2 A;  1MH4 A;  1Y9U A;  4DDD A;  4POX A;  3RT6 B;  4H5F A;  4IO6 A;  5I59 A;  2QS4 A;  4GVO A;  4OEN A;  2VHA A;  2Z8F A;  1NNP A;  4XTC Q;  3BFT A;  3USD A;  4ELQ A;  4MLV A;  4OZ9 A;  4E0X A;  1ZMG A;  5I59 B;  4JWY A;  4R74 A;  3FVN A;  1USY H;  2NUV A;  1BIY A;  1SW2 A;  3TTM A;  1B52 A;  3OEK A;  3TQW A;  1B40 A;  2RCA A;  5JTY A;  1N7W A;  5TP9 A;  3PPN A;  3A3U A;  2B4M A;  1IIT A;  2AIX A;  1SBP A;  4JWX A;  5ISU A;  2RF1 A;  4ZZE A;  3BFU A;  3VVD A;  1YTV A;  1FCK A;  4G8N A;  5L9O A;  1Y3Q A;  1MXV A;  3N94 A;  3VFJ A;  5JTY B;  5TP9 B;  1AL3 A;  1PB7 A;  1SI0 A;  3UN6 A;  4QSC A;  1XHY A;  3RYA A;  2ONS A;  3G3F A;  4LP2 B;  3LUY A;  3W15 C;  5K2Y A;  4QFL A;  1URS A;  3AXF A;  3IO6 A;  1LLS A;  3A09 A;  1EZ9 A;  4AB6 A;  4H8J A;  1ELJ A;  5ICT A;  1SQY A;  1IXG A;  1N0T A;  2QS2 A;  2RC8 A;  3IO4 A;  1JEU A;  4PET A;  3O6G A;  4KI0 E;  2A5S A;  1JNF A;  3CFX A;  3SES A;  3C9H A;  3T9V A;  1SI1 A;  4LON B;  1UTH A;  3ZS6 A;  3MW0 A;  1R9L A;  3RLF E;  3BBR A;  3MVZ A;  3TPA A;  4HCW A;  2GHB A;  1LBB A;  1GVC A;  3FTO A;  3RUM A;  4M1V A;  2PX1 A;  3KFM A;  3JV9 A;  2WOP A;  5DEX A;  1UTH B;  5H8Q A;  3SEU A;  3PPP A;  3PD8 A;  2B3B A;  1RYO A;  2XX7 A;  3FJG A;  2ALU A;  3SEV A;  3K4U A;  1F9B A;  4DCY A;  2I49 A;  1FQA A;  3K00 A;  3FZV A;  1VE4 A;  5DEX B;  1BKA A;  1B32 A;  5H8Q B;  5TU0 A;  2UYF A;  3EN3 A;  3DRH A;  1MQH A;  4G4P A;  1VFD A;  3O97 A;  3IJO B;  4ZS9 A;  1AH5 A;  4TLL B;  1ZKB A;  2Q2A A;  2DE3 A;  4QSE A;  1NMU A;  2I4C A;  4XIG Q;  1LB9 A;  4ZDM A;  2WOL A;  5AA2 D;  3MZB A;  1FTK A;  1BLF A;  3M3F A;  1MH3 A;  3VLV A;  4ELP A;  4HCY A;  3T66 A;  3PV0 E;  4OET A;  4PP0 A;  2PVU A;  2QS1 A;  1UTB A;  1ZBM A;  2F6G A;  1QVS A;  2O7U A;  2Y7R A;  2LAO A;  2D21 A;  5DTB A;  5H8F A;  3PAM A;  2VP1 A;  3HST A;  4GQO A;  4GF8 A;  1UTB B;  2V3T A;  5EHS A;  1Z7N E;  1DSN A;  3GZG A;  1JQF A;  2I48 A;  5I57 A;  2H5Y A;  1B6H A;  1JW1 A;  5H8F B;  3VVF A;  3HHG A;  3CVG A;  4ZE8 A;  4JWO A;  5J1D A;  4YKJ A;  4F3S A;  3E3K A;  5EHM A;  2UVJ A;  3L6G A;  3S9E A;  2DWJ A;  3IAZ A;  3H7M A;  1I6A A;  3CFZ A;  4LA9 A;  1DTZ A;  3CFL A;  5I57 B;  3TEL A;  1TFD A;  3ODB A;  5A5X A;  2I0B A;  3EHU A;  1IUD A;  4IO5 A;  1DPE A;  2XXX A;  3CI8 A;  2O7I A;  2OWS A;  4NF5 A;  5A5X B;  2X26 A;  3KGC A;  4OER A;  4RPN A;  5FHN A;  3VLW A;  4GOT A;  3T9U A;  2VGQ A;  3MWB A;  1US5 A;  3KZG A;  1RKM A;  4NF5 B;  1SD3 A;  1Z7M E;  3IB1 A;  4JBZ A;  2RCB A;  4FED A;  3VV5 A;  4BDL A;  4DXB A;  1FQB A;  2THI A;  2FNC A;  5AA1 A;  4K3F A;  4NWC A;  3U93 A;  4P11 A;  1GR2 A;  3EQ1 A;  1B51 A;  2F34 A;  1FTJ A;  2E0S A;  3EHS A;  5I58 A;  3O6P A;  2Y7K A;  2HCA A;  3I5O A;  1D9V A;  3G7W A;  1Y4T A;  2DS9 A;  1II5 A;  1FQF A;  1J1N A;  4BLA A;  3SEX A;  3R7X A;  3LSW A;  4U21 A;  2HQ0 A;  1D9Y A;  2DVZ A;  3KN3 A;  2M8C A;  5I58 B;  3HO7 A;  4NF8 A;  2GH9 A;  5DYH A;  3DRI A;  3TTL A;  4QHQ A;  1JVY A;  4N13 A;  4LQ5 A;  3S9N C;  4I9D A;  3QK6 A;  2ESN A;  3KOT A;  4BDN A;  2ZXT A;  2E1S A;  1MXX A;  1T0K A;  4NF8 B;  4XKN A;  2KLF A;  3A3C A;  4EXK A;  2Y7W A;  5L9S A;  3LBS A;  2QRY A;  1B1X A;  3O6I A;  4O3B A;  5K2X A;  3G3I A;  4C1T A;  3MJN A;  4BDM A;  3KG2 A;  4DLD A;  1MY1 A;  1MM7 A;  3OEM A;  1M5B A;  1QUI A;  3R6U A;  1A55 A;  3CHG A;  5IKB A;  4F1U A;  3L6H A;  3KN8 A;  2DWI A;  2XXT A;  4M4G A;  3THI A;  5H8H A;  3IOV A;  3G3J A;  3C36 A;  3FXQ A;  2IEE A;  4E0W A;  2GHA A;  4GWO A;  4QFN A;  3PPQ A;  3FJM A;  3KSX A;  3H06 B;  5H8H B;  3MPL A;  5DVF A;  3K6X A;  3CG3 A;  4LZ7 A;  2O6A A;  3LC8 A;  1AOV A;  2AYS A;  3M3K A;  5CMB A;  1RYX A;  3Q25 A;  1NH8 A;  3ILU B;  4OXV A;  1TT1 A;  4X1B A;  3V83 A;  4P0G A;  1D3K A;  4Q0C A;  4QFP A;  2ONR A;  4N07 A;  3MP1 A;  3PUY E;  1IXI A;  1FTO A;  1WVJ A;  4F31 B;  3OD7 A;  3T93 B;  4I62 A;  2QL3 A;  1OMP A;  4PFW A;  4N6P A;  3N26 A;  4P0I A;  4H5G A;  2PT2 A;  2XXI A;  1R9Q A;  3CR9 A;  3K2D A;  1R6Z A;  4YAH X;  1N04 A;  3W9V A;  1QJM A;  1YPN A;  2DWH A;  3V5A A;  3H3G A;  3U94 A;  2O1L A;  2ZNS A;  4MH5 A;  2QPQ A;  2IA4 A;  3I3V A;  4DXC A;  3SET A;  4ONY A;  4GIZ A;  1US4 A;  3VXB A;  3K6U A;  1AIV A;  2HFB A;  4MFI A;  2HZK A;  4QF9 A;  2NWJ A;  4OFO A;  2YJP A;  1M5F A;  3CIJ A;  2Z22 A;  4X1D A;  1ZLQ A;  1P1Q A;  2REJ A;  3OEN A;  3OEL A;  1IXC A;  2I0C A;  3PD9 A;  4MLQ A;  4KYS A;  3TCF A;  3MPK A;  1MDP 1;  1SVX B;  1MPD A;  4KYE A;  3TOD A;  4QRZ A;  1IEJ A;  4EQ9 A;  4ZED A;  3GXA A;  1N76 A;  3I6V A;  4OWD A;  1BTJ A;  4YIC A;  3TMG A;  4MBP A;  1DOT A;  1FTL A;  1LFI A;  1A8E A;  1N3W A;  1MQG A;  2O69 A;  1TFA A;  1CB6 A;  1Y1M A;  4DXU A;  5F1Q A;  3IB2 A;  1P1N A;  2AL4 A;  4G2Z A;  3CSB A;  4OQO A;  3KSJ A;  3B7D A;  3IJX B;  1A8F A;  4R6K A;  4DCX A;  4XKP A;  5FHM A;  3MVW A;  3ZSF A;  5FTI A;  2B3F A;  2RC9 A;  4H65 A;  3FV2 A;  2OBG A;  1JVX A;  1A40 A;  1HSJ A;  5CMK A;  2G29 A;  1I6B A;  3LSL A;  1Y1Z A;  1MM6 A;  3H4Z A;  2F5X A;  1P1U A;  4XKR A;  3TDJ A;  3UK4 A;  2HAU A;  4WXJ A;  2VD3 A;  4OHN A;  3SER A;  3TKD A;  3EPE A;  1LB8 A;  5CBR A;  1MXW A;  2H98 A;  2PBW A;  1B3H A;  2RKM A;  4YB7 A;  2YPN A;  4RNS A;  1ZJL A;  1UQW A;  1MDQ A;  2O51 A;  4EF1 A;  5H8N A;  4WEP A;  2XXU A;  3H03 A;  3IX1 A;  3RYB A;  1FQD A;  1B2H A;  3U1O A;  3PUW E;  3BKI B;  4RA1 A;  2UYE A;  3RQT A;  3QXM A;  5LOM A;  5H8N B;  3TUS A;  1OIB A;  5HBC A;  3UGW A;  1Y3P A;  2I6E A;  2F7A A;  4H6D A;  1L5T A;  1LCF A;  1MY4 A;  2Q88 A;  5DVI A;  4OEU A;  2QS3 A;  4TLM B;  1O64 A;  3KJ7 A;  1PBQ A;  1LBC A;  2XX9 A;  1MY2 A;  1Y4C A;  3FGS A;  5ITO A;  4YKK A;  3VXC A;  1B7H A;  1XVY A;  1QUJ A;  1POT A;  1S50 A;  1OVT A;  1B58 A;  3C33 A;  4YB6 A;  4GD5 A;  3B6Q A;  4YKI A;  3H6T A;  4ECF A;  3TFL A;  3F11 A;  1QUL A;  1LAF E;  2OK2 A;  1A7L A;  1I69 A;  3QUF A;  1VR5 A;  3TTK A;  4YB5 A;  2Y84 A;  3FXR A;  4Q8R A;  3N6U A;  3EF7 A;  4JDF A;  3ZKL A;  1KWH A;  2F78 A;  3ECR A;  2H4I A;  4RY1 A;  4IGT A;  2VOZ A;  4F3P A;  3K1N A;  1OLA A;  2OLB A;  1IXH A;  1I6Q A;  4F1V A;  4BDR A;  1QKB A;  2UXA A;  3PMV A;  2VD2 A;  3Q27 A;  3DM0 A;  1ZTY A;  5EYF A;  3U72 A;  2XXW A; 
#chains in the Genus database with same CATH topology
 1B4Z A;  4PTK A;  5CMM A;  4ZEC A;  3PUZ E;  5KDT A;  2YLN A;  1WOD A;  4XEQ A;  2RIN A;  5HPQ A;  1B05 A;  4F39 A;  1LAX A;  2DXY A;  3OXN A;  4H1X A;  5FBP A;  1D9Q A;  1TWY A;  3KBR A;  1OQH A;  2ONK E;  3E13 X;  1B9J A;  4GFR A;  5KDT B;  1O63 A;  4YZZ A;  4NQ8 A;  3QMF A;  3EHT A;  2UVI A;  3MC2 A;  4KFQ A;  5I56 A;  3TEP A;  1PEB A;  3K02 A;  1AWB A;  2Y7P A;  2Q89 A;  3OO8 A;  4O7I A;  3MVY A;  1B7Z A;  1MY3 A;  4FAT A;  2F3B A;  1NI9 A;  4IO7 A;  4RYA A;  5FTH A;  1HSL A;  4OVT A;  4ESW A;  5I56 B;  4WED A;  2ZNT A;  2QJE A;  5DW8 A;  1IMB A;  4O3A A;  1SW1 A;  3EKI A;  4THI A;  3FD3 A;  3ISP A;  4R72 A;  1QKA A;  4DI4 B;  1MXY A;  2Y7I A;  3TAJ A;  2R9J A;  4BDO A;  4X04 A;  2HXW A;  4LVQ A;  4F3B A;  3K1P A;  4LZ8 A;  3O28 A;  4YMA A;  1JP4 A;  3U92 A;  3HPI A;  1B3L A;  3E79 A;  1B5I A;  4Q30 B;  4GRK A;  4C0R A;  2O1M A;  4KCD A;  3LR1 A;  1Y3N A;  4TOZ A;  1M5E A;  3T22 A;  3IR1 A;  2DE4 A;  2Z8D A;  4X48 A;  3SEW A;  5CC2 A;  2V25 A;  3PU5 A;  4IY6 A;  4HW8 A;  1B4H A;  2I58 A;  4HS7 A;  3FV1 A;  3Q26 A;  5EQ8 A;  4F2Q A;  2XXQ A;  3QUJ A;  4EXL A;  1B5J A;  3JYR A;  4PDH A;  1GTK A;  4I3E A;  2QMX A;  2ZYK A;  2WOK A;  1FBD A;  4IO3 A;  2O68 A;  1LST A;  3W9W A;  2P0S A;  3GYY A;  2WYK A;  3LSF B;  3S2V A;  2JJK A;  1USY E;  4ISU A;  5CM6 A;  3U8Q A;  4PDD A;  1NKX A;  5CI5 A;  4DZ1 A;  2ABH A;  4GWY A;  3MVX A;  3RTF B;  5AA3 A;  1H45 A;  4PBH A;  3GBB A;  2R71 A;  2B4L A;  4PFT A;  1H44 A;  3MP8 A;  3IOW A;  5BWJ A;  5IZZ A;  2XWV A;  3DRG A;  4R9F A;  1S7Y A;  3CSG A;  4FEC A;  1CE2 A;  3MUQ A;  3C32 A;  1MQD A;  3MZ9 A;  4ZEI A;  3T9H B;  1EU8 A;  1Q35 A;  4UAC A;  3HFU A;  4NE4 A;  4Z7E A;  2F36 A;  2WBD A;  4ESX A;  1MXU A;  4R9G A;  4F29 A;  4JXI A;  1NNT A;  2PT1 A;  2ZNU A;  4ELO A;  3D4C A;  1QUK A;  3K6V A;  1LBV A;  4O3C A;  1NL5 A;  1YZ0 A;  4R73 A;  2OWT A;  4EQ7 A;  3PPO A;  2Y5L A;  1B46 A;  1ZIU A;  5AA2 A;  3HV1 A;  1SW5 A;  4GWU A;  3P7I A;  3KBZ A;  2CMO A;  1UIU A;  1YXI A;  3H6W A;  3FAT A;  1OLC A;  2F35 A;  2XA5 A;  2F6P A;  5AA2 B;  2DP8 A;  1ZU0 A;  1VDW A;  2DYX A;  4KQP A;  1MPB A;  4QBA A;  2DVC A;  4FEB A;  1NFT A;  3IFA A;  5EYG A;  4ZEB A;  5HM4 B;  5KZT A;  2G93 A;  3T9X B;  4PFY A;  5T3J A;  4IY5 A;  1FPI A;  2P1S A;  1FW0 A;  3DP8 A;  4YKP A;  1FTA A;  1PC3 A;  3FVG A;  3JZJ A;  4I40 A;  2PFY A;  4KHZ E;  2HXR A;  1LCT A;  3O66 A;  1WDN A;  1NV7 A;  4LQ2 A;  3WAE A;  4F1Y A;  1FBG A;  2X7P A;  2OWZ A;  3FIR A;  3PUV E;  4OVQ A;  4FJP A;  3SZP A;  1DBZ A;  5H8S A;  1LAG E;  4F19 A;  4EQB A;  4WKM A;  1H43 A;  4GWW A;  1H76 A;  1A54 A;  3PMW A;  3MQ9 A;  4OMB A;  5B70 A;  4P1L A;  2DWA A;  3TYH A;  4OVP A;  1UIV A;  3E4R A;  4NF6 A;  2PMS A;  4JB7 A;  2O84 X;  4I8C A;  4ZEF A;  5CMC A;  1P1W A;  5KCJ A;  4Q5T A;  1POY 1;  4ZE9 A;  3M3L A;  3RN8 A;  2QVU A;  1PDA A;  2R6G E;  1LBY A;  4NF6 B;  1G0H A;  3CG1 A;  3OSR A;  4ND9 A;  3MZ1 A;  1EYK A;  3QAX A;  3O2A A;  3FVK A;  5KCJ B;  2KR0 A;  4NTL A;  1URD A;  3S9L C;  4QXD A;  2XWK A;  3LVU A;  4LAT A;  3OSQ A;  4KPT A;  4UA8 A;  5ET5 A;  4IO4 A;  2XXR A;  2XHD A;  3DRJ A;  4FOR A;  2XXV A;  1ANF A;  1MQJ A;  2QMW A;  3FXU A;  2ZYN A;  4R2F A;  4XKQ A;  4G68 A;  1NV4 A;  1DMB A;  1FBC A;  3OOA A;  3RY3 A;  3FVO A;  2DXR A;  1XC1 A;  1NH7 A;  1B0H A;  2CZL A;  2NVU B;  4NF0 A;  4OYV A;  1Q1K A;  5B7D A;  4OFJ A;  4YMB A;  1B7U A;  1MRP A;  3FUZ A;  3KJT A;  4G68 B;  1M5D A;  1LEV A;  3KEI A;  3B50 A;  2AL5 A;  4P9K A;  4EDP A;  3C31 A;  1O7T A;  3DP4 A;  3C34 A;  3PPR A;  4RK9 A;  3UP9 A;  4OVS A;  3FBP A;  4FBP A;  1XS5 A;  4MF3 A;  1LGB C;  2H9B A;  2NOO A;  4U4X A;  4FIM A;  1N7X A;  4IO2 A;  3PTY A;  4KD5 A;  4DE8 A;  3LSX A;  2D5W A;  4PF6 A;  5ET8 A;  2FA7 A;  4RJZ A;  2NXO A;  1P1O A;  3T96 B;  1FQE A;  1IQ7 A;  2ANJ A;  3IL1 B;  4HXV A;  4HE2 A;  4BDQ A;  3PGF A;  4R75 A;  1B3G A;  3FAS A;  1DTG A;  4QFK A;  1JET A;  3O6H A;  1MG1 A;  1NUZ A;  4ZZA A;  2CZH A;  2DOJ A;  4OVJ A;  3VLU A;  3SDF A;  1MPC A;  2OCU A;  4MNC A;  1B1H A;  3HN0 A;  1YAE A;  1H3D A;  5I2K A;  1VFE A;  3S9M C;  2I4B A;  3IOR A;  3VDF A;  5AE4 A;  3QYT A;  3RGY A;  4AQ4 A;  1NNF A;  2V3Q A;  1FPD A;  3KOS A;  4U1Z A;  4EUO A;  1URG A;  5I2K B;  4MJO A;  4P47 A;  4R2B A;  1PBP A;  1SW4 A;  5FHO A;  4UAB A;  4QSD A;  1VSO A;  5TPA A;  4G77 A;  4QFO A;  1SDX A;  2PYY A;  2VPN A;  3MST A;  1N3X A;  4NWD A;  2GFE A;  4F3G A;  1FJ9 A;  3T0J A;  3K01 A;  2FYI A;  2V93 A;  5BUU A;  3QIM A;  1JW4 A;  2DSF A;  2OZZ A;  2P2A A;  1LAH E;  5TPA B;  1MXZ A;  5CBS A;  1B3E A;  5L9M A;  3K1M A;  4YU0 A;  2MKZ A;  2I3W A;  4R6H A;  2XX8 A;  4PE5 B;  1GV8 A;  4JSD A;  3B6T A;  1B0L A;  2Q74 A;  2CZK A;  4RXL A;  1EZP A;  4NGU A;  1TXF A;  4GL0 A;  1N84 A;  1PB9 A;  1XVX A;  2BJJ X;  5IZ3 A;  3O29 A;  3ONM A;  1XOC A;  3Q28 A;  2A5T A;  2Q9T A;  3OMB A;  2Z8E A;  2F8D A;  4L17 A;  3QSL A;  2X7Q A;  4XXU A;  3KN7 A;  1S9T A;  3OO6 A;  1XI6 A;  2W7Y A;  4GL8 A;  1RDZ A;  2XXY A;  4G8M A;  3VVE A;  1EH3 A;  5IZ3 B;  3UA8 A;  3ZKK A;  2A5T B;  1OVB A;  4U4S A;  2Z23 A;  4OA4 A;  5F7V A;  2L5V A;  4Z0I A;  4KR5 A;  3BIG A;  2D3I A;  4HTG A;  1IIW A;  1ATG A;  3OO9 A;  2OJT A;  2Q8J A;  3PMX A;  5DT6 A;  3RTW B;  2XD2 A;  5L8D A;  4G68 C;  4GXS B;  2UVH A;  1FTM A;  1QW0 A;  2DQV A;  3UOR A;  1R1N A;  1AMF A;  3PUX E;  1HSE A;  2PCR A;  5AA4 A;  4LN5 A;  3DRF A;  1EZO A;  2RC7 A;  3R26 A;  4NF4 A;  2F7C A;  1OQG A;  5ITP A;  4PF8 A;  3G3G A;  4LZ5 A;  4ELR A;  1KZ8 A;  1B3F A;  3C4M A;  4AS5 A;  3N6T A;  3TZA A;  3N5L A;  3GBA A;  2H99 A;  2WKY A;  4U23 A;  4AB5 A;  4PAK A;  5ELV A;  3DEL B;  1B5H A;  5AA4 B;  2V84 A;  3DRK A;  3TCG A;  1JW5 A;  1XT8 A;  4OES A;  4NF4 B;  2Q2C A;  4MCO A;  4KCC A;  3E9X A;  2R8T A;  5IM2 A;  1A99 A;  2V3U A;  3ILT B;  4PGP A;  3TCH A;  2B65 A;  4DIG A;  5ICQ A;  3RNN A;  4N8Y A;  4GLI A;  1GGG A;  5I84 A;  4RK2 A;  2ZMB A;  2ZYM A;  3T1B A;  4O8M A;  4U2R A;  1M5C A;  4OVR A;  3WAF A;  3IOT A;  3K0V A;  1CNQ A;  1P99 A;  3IK6 B;  4NAP A;  3HCQ A;  4GXA A;  5EQA A;  2HZL A;  4G8H A;  4N15 A;  3UIF A;  2ZYO A;  1PB8 A;  4POW A;  3H6U A;  1INP A;  5JEI A;  4JSO A;  1FQC A;  4X9T A;  2F7B A;  4IGR A;  3IOU A;  3M8U A;  4LUB A;  4RPO A;  3RPW A;  3RT8 A;  1MY0 A;  4NN3 A;  1SYH A;  4GX4 A;  4FAJ A;  1LFG A;  2FIE A;  4F22 A;  2XWO A;  2XXH A;  3SEY A;  1SPI A;  3V8X B;  2HEU A;  3OO7 A;  3G3H A;  3MBP A;  5I2N A;  4U1O A;  4R6Y A;  4PFU A;  3TTR A;  4MX6 A;  3D4G A;  4U22 A;  4ZEK A;  3B8B A;  4IB2 A;  1FBP A;  2I3V A;  1MS7 A;  4H0W A;  4F2O A;  5I2N B;  1YCJ A;  4NMY A;  3D1R A;  4TQU Q;  1FPJ A;  4C1U A;  3TQL A;  2UVG A;  2FVZ A;  3V89 B;  1NV0 A;  3E78 A;  4I1D A;  1FBF A;  1SYI A;  2F97 A;  3CRB A;  3IB0 A;  3DP6 A;  3FJ7 A;  1NNK A;  3H6V A;  5ESY A;  2REG A;  3O9P A;  3G3K A;  5IAI A;  1LFH A;  4OTE A;  4H67 A;  5JK4 A;  4P56 A;  5M2V A;  4H45 A;  2QSX A;  3K6W A;  5DVJ A;  3B6W A;  1IZ1 A;  3IFC A;  1MQI A;  4OFL A;  1KA0 A;  5CRY A;  4OEV A;  4KYD A;  3LUZ A;  3DLN A;  2XD3 A;  2XXP A;  1Y20 A;  1QGX A;  4FE8 A;  4O94 A;  2HAV A;  3Q29 A;  1JEV A;  3S4U A;  4H8I A;  3C35 A;  3SKP A;  1LBW A;  2DDK A;  2H25 A;  3MP6 A;  3MAM A;  2GRV A;  2DE2 A;  4F18 A;  4PFB A;  1DPP A;  4G61 A;  3VE1 B;  3HHF A;  4PQJ A;  3FXB A;  1BP5 A;  3GLB A;  4N91 A;  2FHY A;  1D4N A;  3TTN A;  4NED A;  4MNI A;  4EF2 A;  1MH4 A;  1FBH A;  1Y9U A;  4DDD A;  4P3L A;  4POX A;  3KC0 A;  3RT6 B;  4H5F A;  4IO6 A;  5I59 A;  2QS4 A;  4GVO A;  4OEN A;  2VHA A;  2Z8F A;  1NNP A;  4XTC Q;  3BFT A;  3USD A;  4ELQ A;  2WX9 A;  4MLV A;  1DCU A;  4OZ9 A;  4E0X A;  1ZMG A;  5I59 B;  4JWY A;  4R74 A;  3FVN A;  1USY H;  2NUV A;  5LDZ A;  1BIY A;  1SW2 A;  3TTM A;  4JVC A;  1B52 A;  3OEK A;  3TQW A;  1B40 A;  2RCA A;  5JTY A;  1N7W A;  5TP9 A;  3PPN A;  3A3U A;  2B4M A;  1IIT A;  2AIX A;  1SBP A;  4JWX A;  5ISU A;  2RF1 A;  1RDX A;  4ZZE A;  3BFU A;  3VVD A;  1YTV A;  1FCK A;  4G8N A;  5L9O A;  1Y3Q A;  4MIJ A;  1MXV A;  2GQ1 A;  3N94 A;  3VFJ A;  5JTY B;  5TP9 B;  1AL3 A;  1PB7 A;  1SI0 A;  1LBZ A;  3UN6 A;  4QSC A;  1XHY A;  3RYA A;  2ONS A;  3G3F A;  3MYU A;  4LP2 B;  3LUY A;  3W15 C;  5K2Y A;  4QFL A;  4XFE A;  1URS A;  3AXF A;  4I3Y A;  3IO6 A;  1LLS A;  3A09 A;  1EZ9 A;  4AB6 A;  4H8J A;  1ELJ A;  5ICT A;  1SQY A;  2P3N A;  4MEV A;  5I7I A;  1IXG A;  1N0T A;  4PAI A;  1Q9D A;  4MHF A;  2QS2 A;  2RC8 A;  3IO4 A;  1JEU A;  4PET A;  1FPG A;  5ET7 A;  3O6G A;  4KI0 E;  2A5S A;  2XXK A;  1JNF A;  3CFX A;  3SES A;  3C9H A;  3T9V A;  1SI1 A;  2OX3 A;  2CEX A;  3A29 A;  4LON B;  1UTH A;  3ZS6 A;  3MW0 A;  1R9L A;  4DI3 D;  3RLF E;  3BBR A;  3MVZ A;  3TPA A;  5I3S A;  4HCW A;  2WYP A;  1FPB A;  2GHB A;  1LBB A;  1GVC A;  3FTO A;  3RUM A;  4M1V A;  2PX1 A;  3KFM A;  3JV9 A;  2WOP A;  1G0I A;  4P8B A;  5DEX A;  1UTH B;  2CZI A;  5H8Q A;  4PFR A;  3SEU A;  3PPP A;  3PD8 A;  2B3B A;  1RYO A;  2XX7 A;  3FJG A;  2ALU A;  3SEV A;  4OAN A;  3K4U A;  1F9B A;  5IZ1 A;  4DCY A;  2I49 A;  1FQA A;  3K00 A;  3FZV A;  1VE4 A;  5DEX B;  4JVD A;  1BKA A;  1B32 A;  5H8Q B;  5TU0 A;  2UYF A;  3EN3 A;  3DRH A;  1MQH A;  4G4P A;  1VFD A;  3O97 A;  1NV6 A;  3IJO B;  4ZS9 A;  1AH5 A;  4TLL B;  1ZKB A;  1FBE A;  3RPL A;  3NOH A;  2Q2A A;  2DE3 A;  4MMP A;  4QSE A;  1NMU A;  3BIH A;  2I4C A;  4XIG Q;  1LB9 A;  1DK4 A;  4X8R A;  4ZDM A;  2WOL A;  3RPL B;  5AA2 D;  3MZB A;  2WEF A;  5EQ7 A;  5EQ9 A;  1FTK A;  1BLF A;  3M3F A;  1MH3 A;  3VLV A;  4ELP A;  4HCY A;  5IGA A;  3T66 A;  3PV0 E;  4OET A;  4PP0 A;  2PVU A;  2QS1 A;  4GWS A;  1UTB A;  3LV0 A;  1ZBM A;  2F6G A;  1QVS A;  2O7U A;  2Y7R A;  2LAO A;  2D21 A;  5LTC A;  5DTB A;  5H8F A;  3PAM A;  2VP1 A;  5I5P A;  3HST A;  3U65 A;  4GQO A;  4GF8 A;  1UTB B;  2V3T A;  5EHS A;  1Z7N E;  1DSN A;  3GZG A;  1JQF A;  2I48 A;  5I57 A;  2H5Y A;  1B6H A;  1JW1 A;  5H8F B;  3VVF A;  3HHG A;  3CVG A;  4ZE8 A;  4JWO A;  5J1D A;  4YKJ A;  4F3S A;  3E3K A;  5EHM A;  2UVJ A;  3L6G A;  3S9E A;  2HPG A;  2DWJ A;  3IAZ A;  3H7M A;  1I6A A;  3CFZ A;  4LA9 A;  1DTZ A;  3CFL A;  5I57 B;  3TEL A;  1K9Y A;  1TFD A;  3ODB A;  5A5X A;  2I0B A;  3EHU A;  1IUD A;  4IO5 A;  1DPE A;  2XXX A;  3CI8 A;  2O7I A;  2OWS A;  4NF5 A;  5A5X B;  2X26 A;  3KGC A;  4OER A;  4RPN A;  5FHN A;  3VLW A;  4GOT A;  5ET6 A;  3T9U A;  2VGQ A;  3MWB A;  1US5 A;  3KZG A;  1RKM A;  4NF5 B;  1SD3 A;  1Z7M E;  3IB1 A;  4JBZ A;  2RCB A;  4FED A;  3VV5 A;  4BDL A;  4DXB A;  1FQB A;  2THI A;  2FNC A;  5AA1 A;  1BK4 A;  4K3F A;  4NWC A;  3U93 A;  4P11 A;  1GR2 A;  3EQ1 A;  4GX6 A;  4PAF A;  5A5L A;  1FJ6 A;  1B51 A;  2F34 A;  1FTJ A;  2E0S A;  3EHS A;  5I58 A;  3O6P A;  2Y7K A;  2HCA A;  3I5O A;  1D9V A;  3G7W A;  4GWX A;  1Y4T A;  2DS9 A;  1II5 A;  1FQF A;  2XWI A;  1J1N A;  4BLA A;  3SEX A;  3R7X A;  3LSW A;  4U21 A;  3ROJ A;  4HE1 A;  2HQ0 A;  1D9Y A;  2DVZ A;  3KN3 A;  2M8C A;  5I58 B;  3HO7 A;  4NF8 A;  2GH9 A;  5DYH A;  3DRI A;  3TTL A;  4QHQ A;  1JVY A;  4N13 A;  4LQ5 A;  3S9N C;  4I9D A;  3QK6 A;  2ESN A;  3KOT A;  4BDN A;  2ZXT A;  2E1S A;  2ZZV A;  1MXX A;  1T0K A;  4NF8 B;  4XKN A;  2KLF A;  3A3C A;  4EXK A;  4N6K A;  2Y7W A;  5L9S A;  3LBS A;  2QRY A;  1B1X A;  3O6I A;  4O3B A;  5K2X A;  3G3I A;  4C1T A;  3MJN A;  4BDM A;  3KG2 A;  4DLD A;  2VPO A;  1MY1 A;  1MM7 A;  3OEM A;  1M5B A;  1QUI A;  3R6U A;  2CEY A;  1A55 A;  2FIX A;  4AS4 A;  3CHG A;  5IKB A;  4F1U A;  3L6H A;  3KN8 A;  2DWI A;  2WBB A;  2XXT A;  4M4G A;  3THI A;  5H8H A;  3IOV A;  3G3J A;  3C36 A;  3FXQ A;  2IEE A;  2ZZW A;  4E0W A;  2GHA A;  4GWO A;  4QFN A;  3PPQ A;  3FJM A;  4JVI A;  3KSX A;  3H06 B;  5H8H B;  5EYH A;  4KXP A;  3MPL A;  5DVF A;  3K6X A;  3CG3 A;  4LZ7 A;  2O6A A;  3LC8 A;  1AOV A;  2AYS A;  3M3K A;  5CMB A;  1RYX A;  3Q25 A;  1NH8 A;  2P3V A;  3ILU B;  4OXV A;  1TT1 A;  2BJI A;  4X1B A;  3V83 A;  4P0G A;  1D3K A;  4Q0C A;  4QFP A;  2ONR A;  1K9Z A;  4PE3 A;  4N07 A;  3MP1 A;  3PUY E;  1IXI A;  1FTO A;  1WVJ A;  2Q8M A;  2KQZ A;  4F31 B;  3OD7 A;  3RYD A;  3T93 B;  4I62 A;  2QL3 A;  1OMP A;  4PFW A;  4PCD A;  4N6P A;  3N26 A;  4P0I A;  4H5G A;  1EYJ A;  2PT2 A;  1FSA A;  2XXI A;  1R9Q A;  3CR9 A;  3K2D A;  1R6Z A;  4YAH X;  1N04 A;  3W9V A;  1QJM A;  1YPN A;  2DWH A;  3V5A A;  3H3G A;  3U94 A;  2O1L A;  2ZNS A;  4MH5 A;  2QPQ A;  2IA4 A;  3I3V A;  5F24 A;  4DXC A;  4N4U A;  3SET A;  4ONY A;  4GIZ A;  1US4 A;  2VT5 A;  3VXB A;  1IMC A;  3K6U A;  1AIV A;  2ZZX A;  2HFB A;  4MFI A;  2QFL A;  2HZK A;  4IR8 A;  1LBX A;  4QF9 A;  4H46 A;  2NWJ A;  4OFO A;  4N8G A;  4MNP A;  2YJP A;  1M5F A;  4GBV A;  1FRP A;  3CIJ A;  2Z22 A;  2Y5K A;  1KA1 A;  4X1D A;  4MAG A;  1ZLQ A;  1P1Q A;  2REJ A;  3OEN A;  3OEL A;  1IXC A;  2I0C A;  4XF5 A;  1IMF A;  3PD9 A;  4MLQ A;  4KYS A;  3TCF A;  3MPK A;  4PC9 A;  1MDP 1;  1SVX B;  1MPD A;  4KYE A;  3TOD A;  4QRZ A;  1IEJ A;  4EQ9 A;  4ZED A;  3GXA A;  1N76 A;  3I6V A;  4OWD A;  1BTJ A;  4YIC A;  3TMG A;  4MBP A;  1DOT A;  1FTL A;  1LFI A;  1A8E A;  2HHM A;  1N3W A;  1MQG A;  1FPE A;  2O69 A;  1TFA A;  4O7M A;  1CB6 A;  4GBW A;  1Y1M A;  4DXU A;  5F1Q A;  2V4C A;  1P1N A;  3IB2 A;  2AL4 A;  4G2Z A;  3CSB A;  4OQO A;  3KSJ A;  3B7D A;  3IJX B;  1A8F A;  4R6K A;  4DCX A;  4GX3 A;  4XKP A;  5FHM A;  3MVW A;  4PGN A;  3ZSF A;  5FTI A;  2B3F A;  2RC9 A;  4H65 A;  3FV2 A;  2OBG A;  1JVX A;  4HE0 A;  1A40 A;  1NV1 A;  1HSJ A;  1NUY A;  5CMK A;  2G29 A;  1I6B A;  3LSL A;  1Y1Z A;  1MM6 A;  3H4Z A;  1FPK A;  2F5X A;  1P1U A;  4XKR A;  3TDJ A;  3UK4 A;  2HAU A;  4WXJ A;  2VD3 A;  4OHN A;  1NV5 A;  1NUW A;  3SER A;  3TKD A;  3EPE A;  4N17 A;  1LB8 A;  5CBR A;  4NX1 A;  1MXW A;  2H98 A;  2PBW A;  1B3H A;  2RKM A;  4YB7 A;  1IMD A;  2YPN A;  4RNS A;  1ZJL A;  2QVV A;  1UQW A;  1MDQ A;  2O51 A;  4EF1 A;  1NV3 A;  5H8N A;  4WEP A;  2XXU A;  3H03 A;  4N81 A;  3IX1 A;  3RYB A;  1FQD A;  1B2H A;  3U1O A;  3PUW E;  3BKI B;  5J16 A;  4RA1 A;  2UYE A;  3RQT A;  3QXM A;  5LOM A;  5H8N B;  3TUS A;  1OIB A;  5HBC A;  2PFZ A;  1RDY A;  3UGW A;  4NG7 A;  1Y3P A;  1IME A;  1FPF A;  2I6E A;  2F7A A;  4H6D A;  4P1E A;  1L5T A;  1LCF A;  1YYZ A;  1MY4 A;  2Q88 A;  5DVI A;  4OEU A;  2QS3 A;  4TLM B;  1O64 A;  3KJ7 A;  4N6D A;  1PBQ A;  1LBC A;  2XX9 A;  1MY2 A;  1Y4C A;  3FGS A;  2QVR A;  1EYI A;  1NUX A;  5ITO A;  1IMA A;  4YKK A;  3VXC A;  4NHB A;  1B7H A;  1XVY A;  1QUJ A;  1POT A;  1S50 A;  4PFI A;  1OVT A;  1B58 A;  3C33 A;  4YB6 A;  4GD5 A;  3B6Q A;  4YKI A;  3H6T A;  1FPL A;  4ECF A;  3TFL A;  3F11 A;  1QUL A;  1LAF E;  2OK2 A;  4GWZ A;  1A7L A;  1I69 A;  3QUF A;  1VR5 A;  4YB5 A;  2Y84 A;  3FXR A;  3TTK A;  4Q8R A;  2FBP A;  3N6U A;  3EF7 A;  4JDF A;  3ZKL A;  1KWH A;  4PBQ A;  2F3D A;  2F78 A;  3ECR A;  2H4I A;  4RY1 A;  4IGT A;  2VOZ A;  4F3P A;  3K1N A;  1OLA A;  2OLB A;  1IXH A;  1I6Q A;  4F1V A;  3KC1 A;  4BDR A;  1QKB A;  2UXA A;  3PMV A;  2VD2 A;  3Q27 A;  3DM0 A;  1ZTY A;  5EYF A;  1NV2 A;  3U72 A;  2XXW A; 
#chains in the Genus database with same CATH homology
 1B4Z A;  5CMM A;  4ZEC A;  3PUZ E;  5KDT A;  2YLN A;  1WOD A;  2RIN A;  5HPQ A;  1B05 A;  4F39 A;  1LAX A;  2DXY A;  3OXN A;  4H1X A;  1TWY A;  3KBR A;  1OQH A;  2ONK E;  3E13 X;  1B9J A;  4GFR A;  5KDT B;  1O63 A;  4YZZ A;  3EHT A;  2UVI A;  3MC2 A;  4KFQ A;  5I56 A;  3TEP A;  1PEB A;  3K02 A;  2Y7P A;  2Q89 A;  3OO8 A;  3MVY A;  1B7Z A;  1MY3 A;  4FAT A;  4IO7 A;  4RYA A;  5FTH A;  1HSL A;  4ESW A;  5I56 B;  4WED A;  2ZNT A;  2QJE A;  4O3A A;  1SW1 A;  4THI A;  3FD3 A;  4R72 A;  1QKA A;  1MXY A;  2Y7I A;  3TAJ A;  2R9J A;  4BDO A;  2HXW A;  4LVQ A;  4F3B A;  3K1P A;  4LZ8 A;  3O28 A;  4YMA A;  3U92 A;  3HPI A;  1B3L A;  1B5I A;  4Q30 B;  4GRK A;  4C0R A;  2O1M A;  4KCD A;  3LR1 A;  1Y3N A;  4TOZ A;  1M5E A;  3T22 A;  3IR1 A;  2DE4 A;  2Z8D A;  4X48 A;  3SEW A;  5CC2 A;  2V25 A;  3PU5 A;  4IY6 A;  4HW8 A;  1B4H A;  2I58 A;  4HS7 A;  3FV1 A;  3Q26 A;  4F2Q A;  2XXQ A;  3QUJ A;  4EXL A;  1B5J A;  3JYR A;  1GTK A;  2QMX A;  2ZYK A;  2WOK A;  4IO3 A;  2O68 A;  1LST A;  3W9W A;  2P0S A;  3LSF B;  3S2V A;  1USY E;  4ISU A;  5CM6 A;  3U8Q A;  1NKX A;  5CI5 A;  4DZ1 A;  2ABH A;  3MVX A;  3RTF B;  5AA3 A;  1H45 A;  3GBB A;  2R71 A;  2B4L A;  4PFT A;  1H44 A;  3MP8 A;  3IOW A;  5BWJ A;  3DRG A;  4R9F A;  1S7Y A;  3CSG A;  4FEC A;  1CE2 A;  3MUQ A;  3C32 A;  1MQD A;  3MZ9 A;  4ZEI A;  3T9H B;  1EU8 A;  1Q35 A;  4UAC A;  4NE4 A;  4Z7E A;  2F36 A;  4ESX A;  1MXU A;  4R9G A;  4F29 A;  4JXI A;  1NNT A;  2PT1 A;  2ZNU A;  4ELO A;  3D4C A;  1QUK A;  3K6V A;  4O3C A;  1NL5 A;  4R73 A;  2OWT A;  4EQ7 A;  3PPO A;  1B46 A;  1ZIU A;  5AA2 A;  3HV1 A;  1SW5 A;  3P7I A;  2CMO A;  1UIU A;  3H6W A;  3FAT A;  1OLC A;  2F35 A;  2F6P A;  5AA2 B;  2DP8 A;  1ZU0 A;  2DYX A;  4KQP A;  1MPB A;  2DVC A;  4FEB A;  1NFT A;  4ZEB A;  5HM4 B;  5KZT A;  2G93 A;  3T9X B;  4PFY A;  4IY5 A;  2P1S A;  1FW0 A;  3DP8 A;  4YKP A;  1PC3 A;  3FVG A;  3JZJ A;  4KHZ E;  1LCT A;  3O66 A;  1WDN A;  4LQ2 A;  3WAE A;  4F1Y A;  2X7P A;  3FIR A;  3PUV E;  4FJP A;  5H8S A;  1LAG E;  4F19 A;  4EQB A;  4WKM A;  1H43 A;  1H76 A;  1A54 A;  3PMW A;  3MQ9 A;  4OMB A;  5B70 A;  2DWA A;  3TYH A;  1UIV A;  3E4R A;  4NF6 A;  2PMS A;  4JB7 A;  2O84 X;  4I8C A;  4ZEF A;  5CMC A;  1P1W A;  5KCJ A;  4Q5T A;  1POY 1;  4ZE9 A;  3M3L A;  3RN8 A;  1PDA A;  2R6G E;  4NF6 B;  3CG1 A;  3OSR A;  4ND9 A;  3MZ1 A;  3QAX A;  3O2A A;  3FVK A;  5KCJ B;  4NTL A;  1URD A;  3S9L C;  3LVU A;  4LAT A;  3OSQ A;  4KPT A;  4UA8 A;  4IO4 A;  2XXR A;  2XHD A;  3DRJ A;  4FOR A;  2XXV A;  1ANF A;  1MQJ A;  2QMW A;  3FXU A;  2ZYN A;  4R2F A;  4XKQ A;  4G68 A;  1DMB A;  3OOA A;  3RY3 A;  3FVO A;  2DXR A;  1XC1 A;  1NH7 A;  1B0H A;  2CZL A;  2NVU B;  4OYV A;  1Q1K A;  5B7D A;  4OFJ A;  4YMB A;  1B7U A;  1MRP A;  3FUZ A;  3KJT A;  4G68 B;  1M5D A;  3KEI A;  2AL5 A;  4EDP A;  3C31 A;  1O7T A;  3DP4 A;  3C34 A;  3PPR A;  4RK9 A;  3UP9 A;  1XS5 A;  4MF3 A;  1LGB C;  2H9B A;  2NOO A;  4U4X A;  4FIM A;  1N7X A;  4IO2 A;  4KD5 A;  4DE8 A;  3LSX A;  2D5W A;  2FA7 A;  4RJZ A;  2NXO A;  1P1O A;  3T96 B;  1FQE A;  1IQ7 A;  2ANJ A;  3IL1 B;  4BDQ A;  3PGF A;  4R75 A;  1B3G A;  3FAS A;  1DTG A;  4QFK A;  1JET A;  3O6H A;  1MG1 A;  4ZZA A;  2DOJ A;  4OVJ A;  3VLU A;  3SDF A;  1MPC A;  2OCU A;  1B1H A;  3HN0 A;  1YAE A;  1H3D A;  5I2K A;  1VFE A;  3S9M C;  2I4B A;  3IOR A;  3VDF A;  5AE4 A;  3QYT A;  3RGY A;  4AQ4 A;  1NNF A;  2V3Q A;  3KOS A;  4U1Z A;  4EUO A;  1URG A;  5I2K B;  4R2B A;  1PBP A;  1SW4 A;  5FHO A;  4QSD A;  1VSO A;  5TPA A;  4G77 A;  4QFO A;  1SDX A;  2PYY A;  1N3X A;  4NWD A;  2GFE A;  4F3G A;  3K01 A;  2FYI A;  2V93 A;  5BUU A;  3QIM A;  1JW4 A;  2DSF A;  2OZZ A;  2P2A A;  1LAH E;  5TPA B;  1MXZ A;  5CBS A;  1B3E A;  5L9M A;  3K1M A;  4YU0 A;  2I3W A;  4R6H A;  2XX8 A;  4PE5 B;  1GV8 A;  4JSD A;  3B6T A;  1B0L A;  4RXL A;  1EZP A;  1TXF A;  4GL0 A;  1N84 A;  1PB9 A;  1XVX A;  2BJJ X;  3O29 A;  3ONM A;  1XOC A;  3Q28 A;  2A5T A;  2Q9T A;  3OMB A;  2Z8E A;  2F8D A;  4L17 A;  3QSL A;  2X7Q A;  4XXU A;  3KN7 A;  1S9T A;  3OO6 A;  2W7Y A;  4GL8 A;  2XXY A;  4G8M A;  3VVE A;  1EH3 A;  3UA8 A;  3ZKK A;  2A5T B;  1OVB A;  4U4S A;  2Z23 A;  5F7V A;  4Z0I A;  4KR5 A;  2D3I A;  4HTG A;  1IIW A;  1ATG A;  3OO9 A;  2OJT A;  2Q8J A;  3PMX A;  5DT6 A;  3RTW B;  2XD2 A;  5L8D A;  4G68 C;  4GXS B;  2UVH A;  1FTM A;  1QW0 A;  2DQV A;  3UOR A;  1R1N A;  1AMF A;  3PUX E;  1HSE A;  5AA4 A;  3DRF A;  1EZO A;  2RC7 A;  3R26 A;  4NF4 A;  2F7C A;  1OQG A;  5ITP A;  3G3G A;  4LZ5 A;  4ELR A;  1B3F A;  3C4M A;  3N6T A;  3TZA A;  3N5L A;  3GBA A;  2H99 A;  2WKY A;  4U23 A;  4AB5 A;  5ELV A;  3DEL B;  1B5H A;  5AA4 B;  2V84 A;  3DRK A;  3TCG A;  1JW5 A;  1XT8 A;  4OES A;  4NF4 B;  2Q2C A;  4KCC A;  3E9X A;  1A99 A;  2V3U A;  3ILT B;  3TCH A;  2B65 A;  4DIG A;  5ICQ A;  3RNN A;  4GLI A;  1GGG A;  5I84 A;  4RK2 A;  2ZMB A;  2ZYM A;  4U2R A;  1M5C A;  3WAF A;  3IOT A;  3K0V A;  1P99 A;  3IK6 B;  3HCQ A;  4GXA A;  2HZL A;  4G8H A;  3UIF A;  2ZYO A;  1PB8 A;  4POW A;  3H6U A;  5JEI A;  4JSO A;  1FQC A;  4X9T A;  2F7B A;  4IGR A;  3IOU A;  3M8U A;  4LUB A;  4RPO A;  3RPW A;  3RT8 A;  1MY0 A;  1SYH A;  4FAJ A;  1LFG A;  4F22 A;  2XXH A;  3SEY A;  3V8X B;  2HEU A;  3OO7 A;  3G3H A;  3MBP A;  5I2N A;  4U1O A;  4R6Y A;  4PFU A;  3TTR A;  3D4G A;  4U22 A;  4ZEK A;  4IB2 A;  2I3V A;  1MS7 A;  4H0W A;  4F2O A;  5I2N B;  1YCJ A;  4NMY A;  4TQU Q;  4C1U A;  3TQL A;  2UVG A;  3V89 B;  4I1D A;  1SYI A;  2F97 A;  3CRB A;  3IB0 A;  3DP6 A;  3FJ7 A;  1NNK A;  3H6V A;  2REG A;  3O9P A;  3G3K A;  5IAI A;  1LFH A;  4OTE A;  4H67 A;  5JK4 A;  5M2V A;  2QSX A;  3K6W A;  5DVJ A;  3B6W A;  1IZ1 A;  1MQI A;  4OFL A;  5CRY A;  4OEV A;  4KYD A;  3DLN A;  2XD3 A;  2XXP A;  1Y20 A;  4FE8 A;  2HAV A;  3Q29 A;  1JEV A;  3S4U A;  4H8I A;  3C35 A;  3SKP A;  2H25 A;  3MP6 A;  3MAM A;  2GRV A;  2DE2 A;  4F18 A;  1DPP A;  3VE1 B;  3HHF A;  4PQJ A;  1BP5 A;  3GLB A;  1D4N A;  3TTN A;  4NED A;  4EF2 A;  1MH4 A;  1Y9U A;  4DDD A;  4POX A;  3RT6 B;  4H5F A;  4IO6 A;  5I59 A;  2QS4 A;  4GVO A;  4OEN A;  2VHA A;  2Z8F A;  1NNP A;  4XTC Q;  3BFT A;  3USD A;  4ELQ A;  4MLV A;  4OZ9 A;  4E0X A;  1ZMG A;  5I59 B;  4JWY A;  4R74 A;  3FVN A;  1USY H;  2NUV A;  1BIY A;  1SW2 A;  3TTM A;  1B52 A;  3OEK A;  3TQW A;  1B40 A;  2RCA A;  5JTY A;  1N7W A;  5TP9 A;  3PPN A;  3A3U A;  2B4M A;  1IIT A;  2AIX A;  1SBP A;  4JWX A;  5ISU A;  2RF1 A;  4ZZE A;  3BFU A;  3VVD A;  1YTV A;  1FCK A;  4G8N A;  5L9O A;  1Y3Q A;  1MXV A;  3N94 A;  3VFJ A;  5JTY B;  5TP9 B;  1AL3 A;  1PB7 A;  1SI0 A;  3UN6 A;  4QSC A;  1XHY A;  3RYA A;  2ONS A;  3G3F A;  4LP2 B;  3LUY A;  3W15 C;  5K2Y A;  4QFL A;  1URS A;  3AXF A;  3IO6 A;  1LLS A;  3A09 A;  1EZ9 A;  4AB6 A;  4H8J A;  1ELJ A;  5ICT A;  1SQY A;  1IXG A;  1N0T A;  2QS2 A;  2RC8 A;  3IO4 A;  1JEU A;  4PET A;  3O6G A;  4KI0 E;  2A5S A;  1JNF A;  3CFX A;  3SES A;  3C9H A;  3T9V A;  1SI1 A;  4LON B;  1UTH A;  3ZS6 A;  3MW0 A;  1R9L A;  3RLF E;  3BBR A;  3MVZ A;  3TPA A;  4HCW A;  2GHB A;  1LBB A;  1GVC A;  3FTO A;  3RUM A;  4M1V A;  2PX1 A;  3KFM A;  3JV9 A;  2WOP A;  5DEX A;  1UTH B;  5H8Q A;  3SEU A;  3PPP A;  3PD8 A;  2B3B A;  1RYO A;  2XX7 A;  3FJG A;  2ALU A;  3SEV A;  3K4U A;  1F9B A;  4DCY A;  2I49 A;  1FQA A;  3K00 A;  3FZV A;  1VE4 A;  5DEX B;  1BKA A;  1B32 A;  5H8Q B;  5TU0 A;  2UYF A;  3EN3 A;  3DRH A;  1MQH A;  4G4P A;  1VFD A;  3O97 A;  3IJO B;  4ZS9 A;  1AH5 A;  4TLL B;  1ZKB A;  2Q2A A;  2DE3 A;  4QSE A;  1NMU A;  2I4C A;  4XIG Q;  1LB9 A;  4ZDM A;  2WOL A;  5AA2 D;  3MZB A;  1FTK A;  1BLF A;  3M3F A;  1MH3 A;  3VLV A;  4ELP A;  4HCY A;  3T66 A;  3PV0 E;  4OET A;  4PP0 A;  2PVU A;  2QS1 A;  1UTB A;  1ZBM A;  2F6G A;  1QVS A;  2O7U A;  2Y7R A;  2LAO A;  2D21 A;  5DTB A;  5H8F A;  3PAM A;  2VP1 A;  3HST A;  4GQO A;  4GF8 A;  1UTB B;  2V3T A;  5EHS A;  1Z7N E;  1DSN A;  3GZG A;  1JQF A;  2I48 A;  5I57 A;  2H5Y A;  1B6H A;  1JW1 A;  5H8F B;  3VVF A;  3HHG A;  3CVG A;  4ZE8 A;  4JWO A;  5J1D A;  4YKJ A;  4F3S A;  3E3K A;  5EHM A;  2UVJ A;  3L6G A;  3S9E A;  2DWJ A;  3IAZ A;  3H7M A;  1I6A A;  3CFZ A;  4LA9 A;  1DTZ A;  3CFL A;  5I57 B;  3TEL A;  1TFD A;  3ODB A;  5A5X A;  2I0B A;  3EHU A;  1IUD A;  4IO5 A;  1DPE A;  2XXX A;  3CI8 A;  2O7I A;  2OWS A;  4NF5 A;  5A5X B;  2X26 A;  3KGC A;  4OER A;  4RPN A;  5FHN A;  3VLW A;  4GOT A;  3T9U A;  2VGQ A;  3MWB A;  1US5 A;  3KZG A;  1RKM A;  4NF5 B;  1SD3 A;  1Z7M E;  3IB1 A;  4JBZ A;  2RCB A;  4FED A;  3VV5 A;  4BDL A;  4DXB A;  1FQB A;  2THI A;  2FNC A;  5AA1 A;  4K3F A;  4NWC A;  3U93 A;  4P11 A;  1GR2 A;  3EQ1 A;  1B51 A;  2F34 A;  1FTJ A;  2E0S A;  3EHS A;  5I58 A;  3O6P A;  2Y7K A;  2HCA A;  3I5O A;  1D9V A;  3G7W A;  1Y4T A;  2DS9 A;  1II5 A;  1FQF A;  1J1N A;  4BLA A;  3SEX A;  3R7X A;  3LSW A;  4U21 A;  2HQ0 A;  1D9Y A;  2DVZ A;  3KN3 A;  2M8C A;  5I58 B;  3HO7 A;  4NF8 A;  2GH9 A;  5DYH A;  3DRI A;  3TTL A;  4QHQ A;  1JVY A;  4N13 A;  4LQ5 A;  3S9N C;  4I9D A;  3QK6 A;  2ESN A;  3KOT A;  4BDN A;  2ZXT A;  2E1S A;  1MXX A;  1T0K A;  4NF8 B;  4XKN A;  2KLF A;  3A3C A;  4EXK A;  2Y7W A;  5L9S A;  3LBS A;  2QRY A;  1B1X A;  3O6I A;  4O3B A;  5K2X A;  3G3I A;  4C1T A;  3MJN A;  4BDM A;  3KG2 A;  4DLD A;  1MY1 A;  1MM7 A;  3OEM A;  1M5B A;  1QUI A;  3R6U A;  1A55 A;  3CHG A;  5IKB A;  4F1U A;  3L6H A;  3KN8 A;  2DWI A;  2XXT A;  4M4G A;  3THI A;  5H8H A;  3IOV A;  3G3J A;  3C36 A;  3FXQ A;  2IEE A;  4E0W A;  2GHA A;  4GWO A;  4QFN A;  3PPQ A;  3FJM A;  3KSX A;  3H06 B;  5H8H B;  3MPL A;  5DVF A;  3K6X A;  3CG3 A;  4LZ7 A;  2O6A A;  3LC8 A;  1AOV A;  2AYS A;  3M3K A;  5CMB A;  1RYX A;  3Q25 A;  1NH8 A;  3ILU B;  4OXV A;  1TT1 A;  4X1B A;  3V83 A;  4P0G A;  1D3K A;  4Q0C A;  4QFP A;  2ONR A;  4N07 A;  3MP1 A;  3PUY E;  1IXI A;  1FTO A;  1WVJ A;  4F31 B;  3OD7 A;  3T93 B;  4I62 A;  2QL3 A;  1OMP A;  4PFW A;  4N6P A;  3N26 A;  4P0I A;  4H5G A;  2PT2 A;  2XXI A;  1R9Q A;  3CR9 A;  3K2D A;  1R6Z A;  4YAH X;  1N04 A;  3W9V A;  1QJM A;  1YPN A;  2DWH A;  3V5A A;  3H3G A;  3U94 A;  2O1L A;  2ZNS A;  4MH5 A;  2QPQ A;  2IA4 A;  3I3V A;  4DXC A;  3SET A;  4ONY A;  4GIZ A;  1US4 A;  3VXB A;  3K6U A;  1AIV A;  2HFB A;  4MFI A;  2HZK A;  4QF9 A;  2NWJ A;  4OFO A;  2YJP A;  1M5F A;  3CIJ A;  2Z22 A;  4X1D A;  1ZLQ A;  1P1Q A;  2REJ A;  3OEN A;  3OEL A;  1IXC A;  2I0C A;  3PD9 A;  4MLQ A;  4KYS A;  3TCF A;  3MPK A;  1MDP 1;  1SVX B;  1MPD A;  4KYE A;  3TOD A;  4QRZ A;  1IEJ A;  4EQ9 A;  4ZED A;  3GXA A;  1N76 A;  3I6V A;  4OWD A;  1BTJ A;  4YIC A;  3TMG A;  4MBP A;  1DOT A;  1FTL A;  1LFI A;  1A8E A;  1N3W A;  1MQG A;  2O69 A;  1TFA A;  1CB6 A;  1Y1M A;  4DXU A;  5F1Q A;  3IB2 A;  1P1N A;  2AL4 A;  4G2Z A;  3CSB A;  4OQO A;  3KSJ A;  3B7D A;  3IJX B;  1A8F A;  4R6K A;  4DCX A;  4XKP A;  5FHM A;  3MVW A;  3ZSF A;  5FTI A;  2B3F A;  2RC9 A;  4H65 A;  3FV2 A;  2OBG A;  1JVX A;  1A40 A;  1HSJ A;  5CMK A;  2G29 A;  1I6B A;  3LSL A;  1Y1Z A;  1MM6 A;  3H4Z A;  2F5X A;  1P1U A;  4XKR A;  3TDJ A;  3UK4 A;  2HAU A;  4WXJ A;  2VD3 A;  4OHN A;  3SER A;  3TKD A;  3EPE A;  1LB8 A;  5CBR A;  1MXW A;  2H98 A;  2PBW A;  1B3H A;  2RKM A;  4YB7 A;  2YPN A;  4RNS A;  1ZJL A;  1UQW A;  1MDQ A;  2O51 A;  4EF1 A;  5H8N A;  4WEP A;  2XXU A;  3H03 A;  3IX1 A;  3RYB A;  1FQD A;  1B2H A;  3U1O A;  3PUW E;  3BKI B;  4RA1 A;  2UYE A;  3RQT A;  3QXM A;  5LOM A;  5H8N B;  3TUS A;  1OIB A;  5HBC A;  3UGW A;  1Y3P A;  2I6E A;  2F7A A;  4H6D A;  1L5T A;  1LCF A;  1MY4 A;  2Q88 A;  5DVI A;  4OEU A;  2QS3 A;  4TLM B;  1O64 A;  3KJ7 A;  1PBQ A;  1LBC A;  2XX9 A;  1MY2 A;  1Y4C A;  3FGS A;  5ITO A;  4YKK A;  3VXC A;  1B7H A;  1XVY A;  1QUJ A;  1POT A;  1S50 A;  1OVT A;  1B58 A;  3C33 A;  4YB6 A;  4GD5 A;  3B6Q A;  4YKI A;  3H6T A;  4ECF A;  3TFL A;  3F11 A;  1QUL A;  1LAF E;  2OK2 A;  1A7L A;  1I69 A;  3QUF A;  1VR5 A;  3TTK A;  4YB5 A;  2Y84 A;  3FXR A;  4Q8R A;  3N6U A;  3EF7 A;  4JDF A;  3ZKL A;  1KWH A;  2F78 A;  3ECR A;  2H4I A;  4RY1 A;  4IGT A;  2VOZ A;  4F3P A;  3K1N A;  1OLA A;  2OLB A;  1IXH A;  1I6Q A;  4F1V A;  4BDR A;  1QKB A;  2UXA A;  3PMV A;  2VD2 A;  3Q27 A;  3DM0 A;  1ZTY A;  5EYF A;  3U72 A;  2XXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...