1ZU0A

Crystal structure of the liganded chitin oligasaccharide binding protein
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
529
structure length
529
Chain Sequence
RSELTIVPDFYPTMVRNFNPYLATNLRTTTDFIYEPLVVFNEMKGNTPVFRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRFRLSEANSNVPYEISLIPIVAEHVWKDVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQLLGKIVNSELDWTSSFVPDIDRTYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKKEALDNVDFRRAFSMALDRQTIIDIAFYGSGTVNDFASGLGYAFEAWSDEATHKKYKGFNTYDVEGSKKLLAKAGFKDVNGDGFVETPSGKSFELLIQSPNGWTDFNNTVQLAVEQLQEVGIKAKARTPEFAVYNQAMLEGTYDVAYTNYFHGADPFTYWNSGYNSALQSGDGMPRFAMHYFTDKKLDGLLDSFYKTADKNEQLAIAHGIQKIIAENQVTIPVMSGAWMYQYNTTRFTGWWSEENPKGRPSVWAGIPERLLHVLDLKPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the liganded and unliganded periplasmic chitin oligosaccharide binding protein
rcsb
source organism Vibrio cholerae
molecule tags Sugar binding protein, signaling protein
molecule keywords Chitin Oligosaccharide Binding Protein
total genus 168
structure length 529
sequence length 529
ec nomenclature
pdb deposition date 2005-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1zu0A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1zu0A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1zu0A02
1USYE 3S2VA 5AA3A 2XX8A 4R6KA 3WAEA 1LBBA 1QW0A 3TEPA 3LSLA 4DZ1A 1QUIA 3E4RA 3QSLA 3G7WA 5H8SA 2O69A 2Q9TA 3S9LC 5I59B 1VFEA 1ZU0A 4NF8B 3TFLA 2QS4A 3HHFA 5KZTA 2P1SA 2REJA 3LBSA 4KCDA 4OMBA 2I0CA 4QSDA 3MBPA 4M1VA 1BKAA 4G77A 4OTEA 3FTOA 4XKRA 4G68B 3O9PA 3IOTA 2D21A 4GIZA 4U4XA 4Z7EA 5I56B 4GD5A 1AL3A 2ZMBA 4LZ5A 3C34A 2RINA 2A5SA 3ZSFA 1B2HA 2DOJA 1ZBMA 5JTYB 5K2YA 3TAJA 4HTGA 4BDRA 4N07A 1SW1A 1FTMA 2AIXA 4XXUA 2VHAA 4PQJA 1ZLQA 5DVIA 1N3WA 1US4A 1VSOA 3VLWA 5DEXB 2NVUB 1B3LA 4NF5B 2E1SA 1HSLA 3TTNA 2F35A 1B58A 4OXVA 2D5WA 1MPBA 1IXHA 5TPAB 1A8EA 1UTBA 5TPAA 3VFJA 2HAVA 2GRVA 2XD2A 2XXQA 4GL8A 1IXGA 1LAXA 1SI0A 3M3FA 3K4UA 4IB2A 1A99A 2Z23A 4IGTA 3I6VA 2XXRA 4ECFA 4PFWA 3FASA 3TQLA 1QUJA 2I3WA 2XXIA 3B6QA 1ATGA 3KGCA 4IO6A 3VVEA 5CC2A 4FEDA 4IO2A 1M5BA 3VVDA 2H9BA 4Q8RA 1IXCA 1N7XA 2F7BA 1XVXA 1B46A 3EHSA 1LLSA 3MZ9A 2CMOA 2RCAA 1GR2A 2X26A 5K2XA 2Q8JA 1MRPA 2AYSA 4DXUA 1B0LA 4OQOA 2UYFA 1L5TA 3RT8A 5I58A 3DLNA 3QIMA 1BIYA 1GGGA 1ZKBA 3RUMA 4XIGQ 1ELJA 2Z8DA 2Q88A 1JVYA 4AB5A 1IITA 2Q89A 5I59A 4LZ8A 1CB6A 3C4MA 3MVWA 1ANFA 1DTZA 1NH8A 4XKPA 5IKBA 1FQEA 4KYSA 2VGQA 1AIVA 1YPNA 3TTMA 3H06B 2ALUA 1R1NA 3MP1A 3K02A 4JDFA 2QJEA 3TKDA 4KFQA 3KG2A 4OFLA 5AA2B 2OBGA 1H45A 3Q27A 1EU8A 4GXAA 2Q2CA 3KJ7A 1JW5A 4FATA 2I4BA 4HCYA 3IB1A 4KR5A 4N6PA 2I58A 3PUYE 2ONKE 3M8UA 3I3VA 4U4SA 4X1DA 4YAHX 3T96B 4LUBA 4YB5A 1XOCA 2DE2A 4C0RA 3MVYA 1PB7A 3FGSA 4G8HA 3VE1B 4ZE9A 2OCUA 3PPOA 3R6UA 4UACA 2XXPA 3EQ1A 3PD8A 1UQWA 3KBRA 3KSJA 3K1MA 1JQFA 4NEDA 4I62A 4KCCA 4PP0A 1N0TA 3PD9A 3U92A 1FCKA 4EF2A 1URDA 1MQDA 1USYH 4NF4B 2WOPA 1M5CA 1MY4A 2X7PA 3CFZA 2F34A 3K6VA 4JBZA 3C36A 3OO8A 1M5EA 3C9HA 3C32A 2G29A 3OSQA 1YCJA 1MY0A 4OETA 4ELPA 1Y1MA 4GWOA 1UIVA 3WAFA 5KCJB 1EZPA 3KFMA 3LVUA 2H5YA 2VOZA 3OO9A 1P99A 3PGFA 4QHQA 3IO4A 4IO4A 1YAEA 3MAMA 4PE5B 4QFKA 1MS7A 2ZYNA 3GXAA 3PU5A 3MW0A 3HV1A 1DSNA 4Q30B 4YKKA 1JEVA 4OZ9A 1HSJA 1Z7ME 4G8NA 1I6AA 4ZS9A 5FHNA 3LC8A 3SKPA 3S9EA 5BWJA 3BFUA 1OVTA 1B3EA 2O1LA 1VR5A 4GFRA 1M5FA 3ILUB 1JEUA 3RY3A 2IA4A 4NWCA 4U21A 2R6GE 5ELVA 3TTLA 4ND9A 1EZ9A 2B3FA 2GH9A 3O66A 5HBCA 2QMWA 4E0XA 4ZECA 2FYIA 1Y3PA 2DWJA 4GVOA 4KI0E 4P11A 4ZZEA 3W15C 3O2AA 5AA4A 5LOMA 3G3GA 1B40A 1B4HA 1LCFA 2V93A 2F8DA 3G3FA 3K6WA 3LUYA 4QSCA 4RPNA 3SEYA 4F39A 5CMCA 4YB6A 1IUDA 5I2NA 1MXUA 1FTOA 3UK4A 1P1NA 2DE3A 1SW5A 3IL1B 5KDTA 2XXUA 3MZBA 3CFXA 1H76A 1SW2A 3V89B 1NMUA 2UVHA 1PBQA 2I49A 1SQYA 4G4PA 5DTBA 4F3PA 5AE4A 1H43A 1FQFA 4MH5A 5AA1A 3GLBA 3MC2A 3FXRA 3E9XA 5H8NA 1GVCA 5IAIA 2O7UA 3B7DA 3RYAA 4ZEKA 2G93A 1PEBA 3QAXA 3IJXB 4G68A 4RJZA 3IOVA 2NXOA 1B3GA 1JW4A 3FZVA 4JXIA 4YZZA 5DEXA 4U2RA 3FJ7A 3TELA 3RTFB 1B1HA 2UYEA 3G3KA 5I84A 2H4IA 2OLBA 5L8DA 4DDDA 4QFNA 4R6HA 3FV2A 1LFIA 5A5XA 1OIBA 5HPQA 2UVJA 3O6IA 1XS5A 4IY5A 5I2KB 3SETA 3O6GA 5L9OA 4G8MA 1P1QA 1QULA 4UA8A 1AMFA 1UTHA 4ZEIA 3CG3A 4DLDA 1OVBA 4DIGA 1MXXA 1Y3QA 2PYYA 1JETA 3N6UA 1B9JA 3OSRA 3TDJA 1IQ7A 3K1NA 4X9TA 2LAOA 2VP1A 1B5HA 1MPDA 3BBRA 3U93A 2ANJA 1LCTA 1MQIA 3IO6A 1MG1A 5CMBA 3TQWA 1QJMA 5FTIA 1MY3A 3VLVA 3OEMA 1O64A 3SEVA 1EH3A 1SD3A 5CMKA 4QFPA 3MVXA 1MQJA 5H8QB 3RGYA 4JWYA 2ZXTA 1URGA 1Z7NE 4PETA 2PMSA 4Z0IA 3RLFE 4ESXA 3GBAA 1ZTYA 1FQDA 3GBBA 1M5DA 4GLIA 4NF6A 3S4UA 1BTJA 3PUWE 1SYIA 5AA2A 3H3GA 4BDMA 2PT1A 3FVKA 4BDLA 3AXFA 3RYBA 2THIA 2HZKA 3C33A 3IB0A 4XTCQ 1OQHA 4EQ7A 2O51A 3MP6A 3CVGA 2ZYMA 1NNTA 2FNCA 3HSTA 4MLVA 1MY1A 2PVUA 1LSTA 4YKJA 4DCYA 4TOZA 3PUXE 4X48A 3UORA 3S9NC 3IOUA 3KOSA 3KOTA 1D4NA 1HSEA 2QS3A 3CSGA 2HXWA 3K2DA 1QUKA 4ZDMA 3EHTA 1MDQA 2ESNA 1SYHA 2UVIA 4OESA 1A40A 3UN6A 4XKNA 1NNFA 3H6VA 1NKXA 1XVYA 2HQ0A 3FD3A 2ZYKA 3FJGA 1US5A 2DWHA 3U94A 4X1BA 3ZKLA 2OZZA 3IB2A 1N3XA 3IAZA 4WXJA 4H0WA 3FUZA 3TPAA 4OEVA 2HEUA 3K6UA 3MUQA 4TQUQ 2P0SA 2OWTA 2ZNUA 3H6UA 2F7AA 3DP8A 2DSFA 2ONRA 3JV9A 3KN3A 1B6HA 3O6HA 5H8HB 3RNNA 3O6PA 3TZAA 2QMXA 4Q0CA 3QYTA 1UTHB 3IX1A 3D4CA 3PV0E 4RA1A 4R6YA 4IGRA 5DT6A 3W9VA 1XHYA 1A55A 1RYOA 2H99A 1OMPA 1DMBA 2H98A 4R9FA 4GQOA 1FQAA 3DELB 3EN3A 3P7IA 4YICA 3T9XB 2I48A 4EXKA 5A5XB 4GF8A 4OERA 3A3UA 3LSWA 3DP6A 3T66A 3U1OA 1IEJA 2Z8FA 3H7MA 3HPIA 4GOTA 1IZ1A 5ICQA 1SW4A 4KQPA 5H8FB 3I5OA 1SDXA 4EQBA 3CR9A 2I3VA 3V83A 1Q1KA 3MVZA 1PB9A 2E0SA 4R73A 3T9HB 5H8NB 1LAGE 2PX1A 2V3QA 1QKAA 4U1OA 4WEPA 5B7DA 4H67A 1MXVA 4Q5TA 4EF1A 4EXLA 2QS1A 3PPQA 4OWDA 1SBPA 3RTWB 1PB8A 1P1WA 4IY6A 4YMAA 1A54A 3TCGA 5KDTB 3PMXA 2F6GA 1POY1 2V3UA 5BUUA 2RC7A 1PDAA 4O3CA 4FORA 4F22A 1H44A 3MZ1A 4IO7A 4BDNA 4QRZA 2HFBA 2F78A 3K6XA 4FECA 1EZOA 2O6AA 3MWBA 2O1MA 3UA8A 4F29A 3TTKA 3R7XA 2B65A 2DVCA 1MXYA 2FA7A 4K3FA 4AB6A 5I2NB 1JNFA 3QXMA 1MDP1 1R9QA 3PMVA 1VE4A 3PPPA 5DVFA 1A7LA 1FQBA 4F1VA 3FATA 4E0WA 5L9SA 4EUOA 3Q28A 3MP8A 2F7CA 3ONMA 3UP9A 3Q26A 3SEUA 3F11A 1NNPA 5FHMA 1P1UA 1WVJA 2HCAA 1YTVA 2CZLA 3ZS6A 2NUVA 2XX7A 4TLLB 4LATA 4XKQA 1TFAA 4YMBA 1FTKA 1POTA 3IORA 4O3BA 3UGWA 1MH4A 1SI1A 1WODA 1QVSA 1ZJLA 4H5FA 2RF1A 1VFDA 1WDNA 4OEUA 5I57B 3DRHA 3IR1A 1MQGA 2XXWA 1Q35A 4QFOA 4I1DA 4KHZE 2I0BA 5F7VA 2F36A 1S50A 5AA2D 1OQGA 1DOTA 1IIWA 3CG1A 2WOKA 4LZ7A 1XC1A 2O68A 2GFEA 4NF4A 5FTHA 4F2OA 5TP9A 2Q2AA 4IO3A 1IXIA 2UVGA 4R72A 4WKMA 5EHMA 1LB8A 1NH7A 3W9WA 4ESWA 1T0KA 4GRKA 3M3KA 3V8XB 1B52A 2P2AA 3VVFA 2UXAA 2Z8EA 2NWJA 4I9DA 5ITPA 3DRJA 3KEIA 2RCBA 4N13A 2REGA 3OO7A 3TMGA 4ELQA 4OFJA 1B51A 3OENA 3VDFA 1AH5A 3CFLA 4U1ZA 5TU0A 2DWAA 2F97A 1LFHA 1FTLA 2XXYA 4HW8A 3ODBA 3N94A 4ZEDA 2Y84A 3N26A 4LVQA 2QPQA 5I2KA 4NWDA 5ISUA 3RPWA 3H6WA 4NTLA 4TLMB 1GV8A 2XD3A 3C31A 4ISUA 4PFYA 4QF9A 4FAJA 4F31B 4H8JA 4F3BA 1Y4CA 3PMWA 3LR1A 4ELOA 2XHDA 3QUFA 1B05A 5CI5A 4ZEBA 3MQ9A 2XX9A 3FV1A 4BLAA 4FJPA 1JW1A 1LGBC 4YU0A 3OELA 1B4ZA 4P0IA 3FXUA 3EPEA 1O63A 1PC3A 4RXLA 5HM4B 4R2BA 1RYXA 1BP5A 2HZLA 2Y7IA 4R74A 5L9MA 3H4ZA 4IO5A 4C1TA 2O84X 4OENA 4YKIA 1I6QA 3CHGA 4RNSA 4DE8A 4F2QA 2WKYA 4F1YA 2B3BA 3LSXA 3DRGA 3PUVE 1B3FA 1NL5A 4RK9A 4F1UA 1URSA 1N76A 3SEWA 3O28A 3IOWA 1TT1A 1B3HA 4OFOA 1UTBB 1Y3NA 3CIJA 5H8HA 1Y4TA 4M4GA 1MXWA 2H25A 3DP4A 3PPNA 1Y20A 3OD7A 1SVXB 4MBPA 3N6TA 2DVZA 2QRYA 5ITOA 2YLNA 4ELRA 2ZNSA 2V3TA 1B1XA 3LSFB 5H8FA 3SEXA 4P0GA 4R9GA 3OXNA 2DWIA 4GXSB 1KWHA 5F1QA 5I57A 5KCJA 5JTYA 2XXTA 3BKIB 4U23A 3ILTB 3KN8A 4H8IA 3MPKA 2A5TB 2QSXA 3QUJA 2DE4A 3M3LA 2DS9A 5TP9B 3USDA 3VV5A 2DP8A 1MXZA 2W7YA 3HN0A 3VXCA 5I56A 2A5TA 4HS7A 3JZJA 2XXXA 3DRFA 3TODA 3KJTA 4O3AA 4H6DA 3JYRA 3DRIA 1B7HA 1DPPA 2F6PA 4FEBA 4NF8A 4RYAA 4YKPA 1B7ZA 1LB9A 1TFDA 3KSXA 3MJNA 3OO6A 3RT6B 2KLFA 3B6WA 1MM7A 3ZKKA 2BJJX 2V84A 4I8CA 3CI8A 4ZEFA 3PPRA 2HAUA 4GL0A 3T22A 4BDQA 2I4CA 5EHSA 4QSEA 5DVJA 1F9BA 1LFGA 4HCWA 1TXFA 2M8CA 4KYDA 2WOLA 1LAFE 2ABHA 3K0VA 3QK6A 3R26A 4LQ5A 4YB7A 1R6ZA 3GZGA 3RN8A 4F19A 2NOOA 5CM6A 1O7TA 4JWXA 1I6BA 1B5JA 3UIFA 2F5XA 4F3SA 4H5GA 3O29A 3KZGA 1D9YA 3TUSA 1UIUA 3K1PA 2VD3A 2ONSA 3E3KA 2OJTA 3A3CA 3K01A 3L6HA 4WEDA 4JB7A 3DM0A 4U22A 1H3DA 4EQ9A 1AOVA 5JK4A 4JWOA 3DRKA 1FQCA 3FJMA 2D3IA 1N7WA 1FTJA 5CMMA 2R71A 3HCQA 5DYHA 2B4MA 4LP2B 4EDPA 1B0HA 4POXA 3FVOA 1II5A 2Y7PA 2ZNTA 4THIA 2QL3A 3FXQA 4R2FA 3RQTA 4QFLA 4RK2A 3SERA 5CBSA 4KPTA 4JSOA 2GHAA 5EYFA 1OLCA 3MPLA 4BDOA 3BFTA 2AL4A 2OWSA 5CRYA 1TWYA 1BLFA 3E13X 4FIMA 4RPOA 3V5AA 5B70A 3VLUA 3OOAA 1RKMA 2ZYOA 1MM6A 4DCXA 2X7QA 2OK2A 2XXHA 3OEKA 5AA4B 1N04A 2IEEA 1JVXA 3G3IA 3Q29A 1P1OA 4RY1A 5M2VA 5I58B 3EF7A 4OHNA 4MF3A 4OVJA 3T93B 2O7IA 3KN7A 3ECRA 2DYXA 1NNKA 3TYHA 3K00A 5JEIA 1LAHE 2GHBA 2Y7WA 4H65A 4DXCA 1MY2A 2V25A 2RC8A 4AQ4A 3U72A 4F18A 1QKBA 4C1UA 2RC9A 4DXBA 4PFUA 4ONYA 3TCHA 1OLAA 4NE4A 5ICTA 3TTRA 4OYVA 1Y1ZA 2R9JA 4F3GA 1B32A 2VD2A 4KYEA 2DQVA 2DXRA 3H6TA 3PAMA 3TCFA 1N84A 2AL5A 2XXVA 4G68C 5CBRA 3OMBA 1DPEA 4LA9A 5FHOA 4JSDA 3THIA 2I6EA 3CSBA 1J1NA 3CRBA 3IK6B 4MLQA 3Q25A 2B4LA 1B7UA 2Z22A 3N5LA 3FIRA 3C35A 4ZZAA 4NMYA 2RKMA 2Y7KA 1DTGA 1D9VA 4KD5A 3A09A 1PBPA 4NF5A 3EHUA 1B5IA 2YJPA 1GTKA 3G3HA 3H03A 2QS2A 2Y7RA 1I69A 3FVGA 4ZE8A 3SDFA 3PUZE 1A8FA 1FW0A 4LQ2A 1D3KA 1ZIUA 4L17A 1XT8A 3VXBA 5H8QA 3T9VA 1MPCA 3D4GA 3L6GA 4H1XA 2PBWA 3SESA 2YPNA 3O97A 1MQHA 3FVNA 4POWA 1LBCA 3B6TA 3G3JA 1CE2A 3HHGA 3IJOB 4R75A 5J1DA 2PT2A 4MFIA 4PFTA 3HO7A 4LONB 4NF6B 3T9UA 3S9MC 4FE8A 1S7YA 1MH3A 3U8QA 1R9LA 1Y9UA 1ZMGA 2DXYA 4G2ZA 1S9TA 1NFTA
chains in the Genus database with same CATH superfamily
1USYE 4O8MA 5AA3A 5ET5A 1LBBA 1QW0A 3LSLA 5I59B 1ZU0A 4NF8B 3U65A 2P1SA 4QSDA 4XKRA 3O9PA 4U4XA 2D21A 2VPOA 5K2YA 4XXUA 1ZLQA 1US4A 2XA5A 3VLWA 2F35A 5AA2D 3VFJA 5TPAA 1UTBA 3PTYA 2Z23A 3FASA 3MSTA 3VVDA 2H9BA 2F7BA 4AB5A 2CMOA 3MZ9A 2X26A 5K2XA 3RT8A 3RUMA 4OANA 1ELJA 1Q9DA 1JVYA 1FBEA 3B50A 3MVWA 1ANFA 1DTZA 5IKBA 4OA4A 2QJEA 3NOHA 2VPNA 5AA2B 3Q27A 2Q2CA 3KJ7A 1JW5A 2I4BA 4N6PA 2I58A 2ONKE 3I3VA 4YB5A 2DE2A 2QFLA 4UACA 3A29A 1UQWA 3KBRA 1JQFA 4I62A 4KCCA 3PD9A 1FCKA 2WEFA 4EF2A 2ZZVA 4R6YA 3C36A 1M5EA 3OSQA 4ELPA 3WAFA 5KCJB 4QHQA 3IO4A 4HE0A 1AWBA 3MAMA 4QFKA 3GXAA 1DSNA 4G8NA 3LC8A 5BWJA 3BFUA 2O1LA 1B3EA 1VR5A 1M5FA 3RY3A 2GH9A 1Y3PA 2DWJA 3G3GA 4QSCA 1SW5A 3MZBA 1H76A 3D1RA 1PBQA 5AE4A 5H8NA 2O7UA 3RYAA 4YZZA 1EYIA 3RTFB 1B1HA 2UYEA 2H4IA 4QFNA 1LFIA 4IY5A 2FIEA 3O6GA 5L9OA 1P1QA 1QULA 1UTHA 3CG3A 1OVBA 1MXXA 1JETA 4X9TA 2LAOA 1B5HA 4JVDA 3TQWA 1MG1A 5CMBA 3VLVA 2Y5LA 1O64A 5CMKA 2ZXTA 1Z7NE 4PETA 3RLFE 1ZTYA 1SYIA 4P1EA 2MKZA 1NNTA 1MY1A 2PVUA 3S9NC 3KOSA 1HSEA 2HXWA 2ESNA 3H6VA 1NKXA 3FD3A 2ZYKA 3U94A 2DWHA 4O7IA 4ESXA 3MUQA 2P0SA 5F24A 3IFAA 2F7AA 3DP8A 2ONRA 3JV9A 5H8HB 3O6HA 3O6PA 2QMXA 3IX1A 4IGRA 3W9VA 5EYFA 1OMPA 2H98A 4GQOA 3EN3A 2I48A 3A3UA 2Z8FA 2GQ1A 4KQPA 1SDXA 3CR9A 1FBFA 1LAGE 2PX1A 4WEPA 1MXVA 4YMAA 5LTCA 2V3UA 5BUUA 2RC7A 4FORA 3MZ1A 4FECA 1FTAA 4F29A 1MXYA 4K3FA 5DW8A 4AB6A 1JNFA 1MDP1 3PPPA 1VE4A 2Q74A 4F1VA 3Q26A 3SEUA 5IZ1A 1P1UA 4LATA 1FTKA 1MQGA 3HFUA 4I1DA 4P8BA 4GWXA 1FPEA 2O68A 4LZ7A 4N17A 2QVUA 5ITPA 1FBCA 2RCBA 3OO7A 4N6DA 3ODBA 4NHBA 4ZEDA 3N26A 4LVQA 4OVSA 4HXVA 4NWDA 4NTLA 3C31A 4ISUA 1IMDA 3LR1A 2XHDA 1YXIA 3FV1A 3OELA 4MNPA 1BP5A 4R74A 4OENA 4DE8A 3CHGA 4F1YA 4MCOA 2QVVA 3PUVE 1B3FA 5EYHA 4GWYA 5IGAA 4NGUA 1B3HA 4OFOA 4N8GA 1MXWA 3DP4A 1Y20A 4MBPA 4ELRA 2ZNSA 2V3TA 5A5LA 5I57A 4H46A 5F1QA 5KCJA 1EYKA 3ILTB 2A5TB 3M3LA 3VXCA 5I56A 1MXZA 2W7YA 3HN0A 2XXXA 5ESYA 1INPA 3JYRA 3DRIA 1DPPA 4FBPA 3B6WA 2V84A 3T22A 4I8CA 3PPRA 4MNCA 5DVJA 1TXFA 4KYDA 1LAFE 3K0VA 3GZGA 1DBZA 1B5JA 3TUSA 3O29A 3KZGA 1D9YA 2ONSA 4JB7A 1CNQA 2OJTA 5JK4A 4JWOA 1N7WA 1FPIA 4POXA 2Y7PA 4THIA 2QL3A 4JSOA 3MPLA 4BDOA 1LBZA 2AL4A 4PAKA 1TWYA 4FIMA 3V5AA 2OK2A 5AA4B 3OEKA 1N04A 4RY1A 1FPDA 4OHNA 2HPGA 4MF3A 1RDYA 4XEQA 3T93B 3ECRA 2GHBA 4PTKA 2Y7WA 5EQAA 4NE4A 4ONYA 2VD2A 2DXRA 3PAMA 5CBRA 2AL5A 3OMBA 1DPEA 4LA9A 5FHOA 3THIA 3C35A 4ZZAA 5IZ3A 1PBPA 3EHUA 1FSAA 3T1BA 4ZE8A 1FW0A 4LQ2A 1ZIUA 3L6GA 2PBWA 3SESA 3O97A 4PFTA 3S9MC 1MH3A 1R9LA 1ZMGA 4I3EA 1AH5A 1FPJA 4R6KA 3WAEA 2O69A 5T3JA 1VFEA 2QS4A 3HHFA 4KCDA 4OTEA 1AL3A 3C34A 2RINA 2A5SA 1B2HA 5JTYB 1SW1A 4PQJA 1N3WA 2E1SA 1HSLA 2WYPA 4OXVA 2D5WA 2HAVA 2XD2A 2P3VA 3M3FA 1A99A 4ECFA 4PGNA 3B6QA 3VVEA 1XVXA 1B46A 1LLSA 2AYSA 1L5TA 3DLNA 3QIMA 1BIYA 2Z8DA 4LZ8A 4XKPA 2FIXA 2VGQA 2BJIA 3H06B 1R1NA 4JDFA 4XF5A 1NV4A 3IB1A 3PUYE 4H45A 5IM2A 1PB7A 3VE1B 2OCUA 3R6UA 1KA1A 3K1MA 2CZKA 4NEDA 4PP0A 1N0TA 1EYJA 4NF4B 1MY4A 3K6VA 3OO8A 3C9HA 4OETA 4GWOA 1P99A 1YAEA 3PU5A 3MW0A 4Q30B 1YZ0A 4ZS9A 5FHNA 1OVTA 4GFRA 2HHMA 4N91A 4ND9A 1EZ9A 3O66A 1XI6A 2FYIA 4GVOA 4KI0E 4P11A 3O2AA 5LOMA 1B40A 1B4HA 3SEYA 2F8DA 3LUYA 4F39A 5CMCA 4YB6A 2WBBA 3UK4A 1KA0A 3IL1B 4JVIA 3CFXA 1SW2A 4F3PA 2UVHA 5DTBA 3FXBA 4MH5A 3B7DA 4ZEKA 3QAXA 4G68A 4RJZA 4U2RA 3G3KA 2OLBA 5L8DA 4DDDA 5A5XA 5HPQA 3O6IA 4G8MA 4DLDA 4ZEIA 4LN5A 3TDJA 3OSRA 3K1NA 1MPDA 3MYUA 2ANJA 1LCTA 1QJMA 3OEMA 3SEVA 1MQJA 4O7MA 4JWYA 1URGA 2PMSA 4GLIA 1BTJA 2KR0A 4XTCQ 2PFYA 2ZYMA 1LSTA 1D4NA 2QS3A 3EHTA 3UN6A 4XKNA 5LDZA 3FJGA 3ZKLA 1N3XA 4WXJA 3K6UA 3TPAA 4OEVA 4TQUQ 2OWTA 2DSFA 3TZAA 1B6HA 4Q0CA 3D4CA 1A55A 2H99A 1DMBA 4EXKA 1FQAA 1FJ6A 4I3YA 5A5XB 4OERA 3U1OA 1IEJA 5H8FB 3I5OA 2E0SA 2V3QA 1QKAA 4PBQA 3PPQA 4OWDA 3RTWB 1PB8A 1P1WA 1A54A 1BK4A 1NV0A 1IMAA 2F6GA 4IO7A 4BDNA 2HFBA 2F78A 2KQZA 2PCRA 2O1MA 3TTKA 2CEYA 3R7XA 1D9QA 5I2NB 2FA7A 1R9QA 5DVFA 1A7LA 3UP9A 5FHMA 2HCAA 1YTVA 5I3SA 4YMBA 4XKQA 4O3BA 1MH4A 4JVCA 4OEUA 3DRHA 3IR1A 2XXWA 1Q35A 5F7VA 1OQGA 3CG1A 5TP9A 4WKMA 1IXIA 3W9WA 1NH7A 4GRKA 3VVFA 2UXAA 4PAFA 4IR8A 4N13A 4ELQA 3VDFA 3CFLA 1FTLA 3N94A 2Y84A 5I2KA 1G0IA 3RPWA 3H6WA 1GV8A 4PFYA 4H8JA 4F3BA 4ELOA 2XX9A 4I40A 4YU0A 1B4ZA 3FXUA 1O63A 2HZLA 3H4ZA 4IO5A 2O84X 2B3BA 1NL5A 1N76A 3SEWA 3O28A 1TT1A 1Y3NA 3CIJA 3QMFA 5H8HA 1Y4TA 4M4GA 2H25A 1SVXB 3N6TA 2QRYA 5ITOA 4P56A 1NV5A 4DI3D 3SEXA 3OXNA 4GXSB 1KWHA 3BKIB 2V4CA 3KN8A 4H8IA 3MPKA 2QSXA 3USDA 3VV5A 2ZZXA 2A5TA 4HS7A 3KJTA 1B7HA 4FEBA 2F6PA 4YKPA 1TFDA 3KSXA 5I2NA 4FATA 4ZEFA 4QSEA 1LFGA 4HCWA 2M8CA 2WOLA 2ABHA 4YB7A 1R6ZA 1I6BA 3UIFA 2F5XA 4F3SA 5DVIA 1H3DA 1FQCA 1DCUA 5CMMA 5DYHA 3HCQA 1B0HA 2WX9A 3FXQA 3SERA 4QFLA 2XWOA 3BFTA 5CRYA 3G3IA 3EF7A 2O7IA 3KN7A 5JEIA 3K00A 4H65A 4DXCA 4AQ4A 3U72A 1QKBA 4DXBA 2DDKA 3TCHA 5ICTA 4OVRA 3TTRA 3LUZA 4OYVA 3B8BA 2R9JA 4KYEA 2XXVA 2PFZA 2I6EA 4GWZA 4MLQA 3Q25A 2B4LA 3N5LA 2RKMA 4KD5A 1NV3A 1B5IA 3G3HA 2FBPA 3PUZE 3VXBA 4L17A 1XT8A 5ET7A 5J16A 4POWA 3HHGA 1CE2A 3IJOB 5J1DA 4NF6B 1S7YA 3U8QA 2ZMBA 1Y9UA 4G2ZA 1NFTA 4GWWA 2XWIA 1QUIA 3QSLA 3G7WA 2Q9TA 3LBSA 4OMBA 2I0CA 3MBPA 4M1VA 1BKAA 4G68B 3IOTA 5EQ8A 4LZ5A 3ZSFA 2DOJA 1ZBMA 3TAJA 2XWVA 1FPKA 1FTMA 1VSOA 5DEXB 2NVUB 1B3LA 3TTNA 1B58A 1MPBA 1IXHA 3FBPA 2FHYA 2GRVA 2VT5A 4IGTA 4PFWA 3TQLA 1QUJA 2XXIA 4FEDA 4IO2A 1M5BA 4Q8RA 1IXCA 1GR2A 4DXUA 1MRPA 1B0LA 4OQOA 2UYFA 5I58A 1ZKBA 1LBXA 2Q88A 5IZZA 5I59A 1LBWA 3C4MA 1NH8A 1FQEA 4GBWA 1FBGA 1NV7A 1AIVA 2ALUA 3MP1A 3K02A 3KG2A 2OBGA 1H45A 4GXAA 1EU8A 1IMCA 4KR5A 4U4SA 4X1DA 4C0RA 1XOCA 3FGSA 4G8HA 4ZE9A 2XXPA 4MJOA 3U92A 1URDA 1MQDA 1M5CA 3CFZA 2X7PA 2F34A 1IMFA 4JBZA 3C32A 1YCJA 1MY0A 1EZPA 3KFMA 3LVUA 2H5YA 2VOZA 3OO9A 1NI9A 3ROJA 3HV1A 1JEVA 4OZ9A 1Z7ME 1QGXA 5IZ3B 1FRPA 1JEUA 2IA4A 4NWCA 4UABA 4U21A 2R6GE 4PFIA 4N8YA 5ELVA 3TTLA 5HBCA 2B3FA 4E0XA 5AA4A 2V93A 3G3FA 4OVQA 1MXUA 1FTOA 2I49A 1SQYA 1H43A 1FQFA 3FXRA 3E9XA 4N4UA 5IAIA 2G93A 1PEBA 3IJXB 3IOVA 4JXIA 3TELA 2OX3A 3FV2A 2UVJA 1XS5A 3SETA 1NV1A 4DI4B 4UA8A 4DIGA 1B9JA 2VP1A 4N81A 3BBRA 1K9YA 3MVXA 4PFRA 1NUXA 4Z0IA 1FQDA 5AA2A 1M5DA 3S4UA 3PUWE 3H3GA 4BDMA 4BDLA 3FVKA 3C33A 2THIA 4EQ7A 2HZKA 1OQHA 4PC9A 3HSTA 4YKJA 3UORA 3IOUA 3CSGA 4ZDMA 2UVIA 4OESA 3ISPA 1US5A 1NUZA 4OVPA 2OZZA 3IAZA 5CM6A 4H0WA 3FUZA 2HEUA 2ZNUA 1FBDA 3QYTA 1LBYA 5DT6A 2F3BA 4R9FA 4YICA 3T9XB 3DELB 4AS5A 4GF8A 3BIGA 3DP6A 3H7MA 4MEVA 1IZ1A 1SW4A 2WYKA 4EQBA 1Q1KA 3MVZA 5H8NB 4U1OA 5B7DA 3RPLB 4EXLA 2QS1A 4MIJA 1SBPA 4IY6A 3PMXA 1PDAA 4F22A 4NF0A 1EZOA 2O6AA 3MWBA 2B65A 2DVCA 1FPGA 3PMVA 4PCDA 3FATA 4E0WA 3Q28A 3MP8A 1LEVA 1JP4A 2HXRA 3F11A 1NNPA 2CZLA 3ZS6A 2NUVA 4TLLB 1TFAA 3IORA 1POTA 3UGWA 1SI1A 1WODA 1ZJLA 1WDNA 5I57B 1S50A 2WOKA 4NF4A 5FTHA 4F2OA 2Q2AA 4R72A 2UVGA 1LB8A 3V8XB 1B52A 2P2AA 4PAIA 2Z8EA 2NWJA 4I9DA 1FPBA 2XXKA 3TMGA 4OFJA 4U1ZA 5TU0A 2DWAA 2F97A 1LFHA 4NN3A 1VDWA 5FBPA 4QF9A 4F31B 1Y4CA 3MQ9A 4P9KA 4FJPA 1LGBC 3EPEA 1PC3A 4PF6A 5HM4B 4PE3A 1RYXA 5L9MA 4F2QA 3LSXA 1FPLA 3DRGA 3E78A 4RK9A 4F1UA 1URSA 3IOWA 1UTBB 4R9GA 5JTYA 4P1LA 5TP9B 2DE4A 4HE1A 2DP8A 4HE2A 3JZJA 4PDDA 3TODA 4H6DA 4MNIA 4RYAA 1LB9A 3OO6A 3SZPA 3MJNA 3RT6B 2KLFA 1MM7A 3ZKKA 3CI8A 2HAUA 4GL0A 4BDQA 1F9BA 3RN8A 4F19A 1K9ZA 4JWXA 4H5GA 4N15A 3E3KA 3L6HA 5CC2A 3DM0A 1AOVA 3DRKA 2R71A 4LP2B 1II5A 3RQTA 4RK2A 4KPTA 2GHAA 1OLCA 2OWSA 1BLFA 4RPOA 3OOAA 1RKMA 1MM6A 4DCXA 5H8FA 1JVXA 3E79A 4OVJA 2DYXA 3TYHA 1LAHE 1MY2A 2V25A 2RC8A 4F18A 4C1UA 2RC9A 4PBHA 4P3LA 4F3GA 1B32A 3H6TA 1DK4A 2OWZA 1N84A 4G68C 3CSBA 3IK6B 2Z22A 3FIRA 4NX1A 2Y7KA 1D9VA 4NF5A 5I7IA 1GTKA 4MMPA 1I69A 1KZ8A 1D3KA 1NV6A 3D4GA 1LBCA 2PT2A 4MFIA 4LONB 3T9UA 4AS4A 2DXYA 4U22A 1NV2A 1S9TA 3S2VA 2XX8A 4GX4A 3TEPA 4DZ1A 3E4RA 5H8SA 3RPLA 3S9LC 3TFLA 5KZTA 2REJA 4GBVA 4G77A 3FTOA 4GIZA 4Z7EA 5I56B 4GD5A 4X8RA 4BDRA 4HTGA 4N07A 2AIXA 2FVZA 2VHAA 4X04A 5TPAB 1A8EA 2XXQA 4GL8A 1IXGA 1LAXA 1SI0A 3K4UA 4IB2A 3I6VA 2XXRA 3KGCA 2I3WA 1ATGA 4IO6A 1N7XA 3EHSA 2RCAA 2Q8JA 4P47A 1GGGA 4G61A 4XIGQ 1IITA 2Q89A 1CB6A 2QVRA 3KBZA 5EQ9A 4KYSA 2JJKA 4GWUA 1YPNA 3TTMA 3TKDA 4KFQA 4OFLA 4HCYA 4NG7A 3M8UA 4YAHX 3T96B 4LUBA 3MVYA 3PPOA 3EQ1A 3PD8A 4KXPA 3KSJA 2XWKA 1USYH 2WOPA 4NF5B 5ET8A 4XFEA 2G29A 1FBHA 1Y1MA 1UIVA 3PGFA 1FBPA 2WBDA 3IFCA 4IO4A 4PE5B 1MS7A 2ZYNA 4YKKA 1HSJA 3SKPA 3S9EA 1I6AA 3ILUB 2P3NA 2QMWA 4ZECA 4PFBA 4ZZEA 3W15C 1IMEA 1LCFA 3K6WA 4RPNA 4MAGA 1IUDA 1P1NA 2DE3A 5ET6A 5KDTA 2XXUA 3V89B 1NMUA 4G4PA 2CZHA 3GLBA 3MC2A 1GVCA 4GX3A 2NXOA 1B3GA 1JW4A 3FZVA 5DEXA 3FJ7A 5I84A 4R6HA 1OIBA 5I2KB 2R8TA 1AMFA 1NUWA 2PYYA 1Y3QA 3N6UA 4QXDA 1IQ7A 3U93A 1MQIA 3IO6A 5FTIA 1MY3A 1EH3A 1SD3A 4QFPA 5H8QB 3RGYA 3T0JA 3GBAA 3GBBA 4NF6A 4PGPA 2PT1A 3AXFA 3RYBA 3IB0A 2O51A 3MP6A 3CVGA 2FNCA 4MLVA 4DCYA 4TOZA 3PUXE 4X48A 3KOTA 3K2DA 1QUKA 1MDQA 1SYHA 1A40A 1NNFA 1XVYA 2HQ0A 4X1BA 3IB2A 3H6UA 1FPFA 3KN3A 3RNNA 4O94A 3LV0A 1UTHB 3PV0E 4RA1A 1XHYA 1RYOA 1YYZA 3P7IA 4NAPA 3LSWA 3T66A 3HPIA 4GOTA 3KC1A 5ICQA 3V83A 2I3VA 1PB9A 4R73A 3T9HB 4QBAA 4H67A 4Q5TA 4EF1A 5KDTB 3EKIA 3TCGA 1POY1 4O3CA 4GWSA 1H44A 4QRZA 3K6XA 1NUYA 3UA8A 3QXMA 1FQBA 5L9SA 4EUOA 2F7CA 1SPIA 3ONMA 2Y5KA 1LBVA 4N6KA 1WVJA 1G0HA 3BIHA 2XX7A 4H5FA 1QVSA 2RF1A 1VFDA 4QFOA 4KHZE 2I0BA 2F36A 1DOTA 1IIWA 1XC1A 2GFEA 4IO3A 5EHMA 4ESWA 1T0KA 3M3KA 3DRJA 3KEIA 2REGA 1B51A 3OENA 2XXYA 4OVTA 4HW8A 2QPQA 5ISUA 1FJ9A 4TLMB 2XD3A 4FAJA 4MX6A 3PMWA 3QUFA 1B05A 5CI5A 4ZEBA 5I5PA 4BLAA 1JW1A 2L5VA 4P0IA 5EQ7A 4RXLA 3KC0A 4R2BA 2Y7IA 4C1TA 4YKIA 1I6QA 4RNSA 2WKYA 3PPNA 5AA1A 3OD7A 2DVZA 2YLNA 1IMBA 1B1XA 3LSFB 4PF8A 4P0GA 2DWIA 4GX6A 2XXTA 4U23A 2F3DA 3QUJA 2DS9A 3DRFA 4O3AA 4NF8A 4PDHA 1B7ZA 2BJJX 2I4CA 3GYYA 5EHSA 4LQ5A 3QK6A 3R26A 4NQ8A 2NOOA 1O7TA 1UIUA 3K1PA 2VD3A 3K01A 3A3CA 2ZZWA 4EQ9A 4WEDA 5EYGA 4MHFA 3FJMA 2D3IA 1FTJA 4EDPA 2B4MA 3FVOA 2ZNTA 4R2FA 5CBSA 3RYDA 3E13X 5B70A 1RDXA 3VLUA 2ZYOA 2X7QA 2XXHA 2CZIA 2IEEA 5M2VA 3Q29A 5I58B 1P1OA 1NNKA 1RDZA 4PFUA 1OLAA 2Q8MA 1Y1ZA 2DQVA 3TCFA 4JSDA 3CRBA 1J1NA 1B7UA 4NMYA 1DTGA 2CEXA 3A09A 2YJPA 3H03A 2QS2A 2Y7RA 3FVGA 3SDFA 1A8FA 5H8QA 3T9VA 1MPCA 4H1XA 2YPNA 1MQHA 3FVNA 3B6TA 3G3JA 4R75A 3HO7A 4FE8A
chains in the Genus database with same CATH topology
1USYE 3S2VA 5AA3A 2XX8A 4R6KA 3WAEA 1LBBA 1QW0A 3TEPA 3LSLA 4DZ1A 1QUIA 3E4RA 3QSLA 3G7WA 5H8SA 2O69A 2Q9TA 3S9LC 5I59B 1VFEA 1ZU0A 4NF8B 3TFLA 2QS4A 3HHFA 5KZTA 2P1SA 2REJA 3LBSA 4KCDA 4OMBA 2I0CA 4QSDA 3MBPA 4M1VA 1BKAA 4G77A 4OTEA 3FTOA 4XKRA 4G68B 3O9PA 3IOTA 2D21A 4GIZA 4U4XA 4Z7EA 5I56B 4GD5A 1AL3A 2ZMBA 4LZ5A 3C34A 2RINA 2A5SA 3ZSFA 1B2HA 2DOJA 1ZBMA 5JTYB 5K2YA 3TAJA 4HTGA 4BDRA 4N07A 1SW1A 1FTMA 2AIXA 4XXUA 2VHAA 4PQJA 1ZLQA 5DVIA 1N3WA 1US4A 1VSOA 3VLWA 5DEXB 2NVUB 1B3LA 4NF5B 2E1SA 1HSLA 3TTNA 2F35A 1B58A 4OXVA 2D5WA 1MPBA 1IXHA 5TPAB 1A8EA 1UTBA 5TPAA 3VFJA 2HAVA 2GRVA 2XD2A 2XXQA 4GL8A 1IXGA 1LAXA 1SI0A 3M3FA 3K4UA 4IB2A 1A99A 2Z23A 4IGTA 3I6VA 2XXRA 4ECFA 4PFWA 3FASA 3TQLA 1QUJA 2I3WA 2XXIA 3B6QA 1ATGA 3KGCA 4IO6A 3VVEA 5CC2A 4FEDA 4IO2A 1M5BA 3VVDA 2H9BA 4Q8RA 1IXCA 1N7XA 2F7BA 1XVXA 1B46A 3EHSA 1LLSA 3MZ9A 2CMOA 2RCAA 1GR2A 2X26A 5K2XA 2Q8JA 1MRPA 2AYSA 4DXUA 1B0LA 4OQOA 2UYFA 1L5TA 3RT8A 5I58A 3DLNA 3QIMA 1BIYA 1GGGA 1ZKBA 3RUMA 4XIGQ 1ELJA 2Z8DA 2Q88A 1JVYA 4AB5A 1IITA 2Q89A 5I59A 4LZ8A 1CB6A 3C4MA 3MVWA 1ANFA 1DTZA 1NH8A 4XKPA 5IKBA 1FQEA 4KYSA 2VGQA 1AIVA 1YPNA 3TTMA 3H06B 2ALUA 1R1NA 3MP1A 3K02A 4JDFA 2QJEA 3TKDA 4KFQA 3KG2A 4OFLA 5AA2B 2OBGA 1H45A 3Q27A 1EU8A 4GXAA 2Q2CA 3KJ7A 1JW5A 4FATA 2I4BA 4HCYA 3IB1A 4KR5A 4N6PA 2I58A 3PUYE 2ONKE 3M8UA 3I3VA 4U4SA 4X1DA 4YAHX 3T96B 4LUBA 4YB5A 1XOCA 2DE2A 4C0RA 3MVYA 1PB7A 3FGSA 4G8HA 3VE1B 4ZE9A 2OCUA 3PPOA 3R6UA 4UACA 2XXPA 3EQ1A 3PD8A 1UQWA 3KBRA 3KSJA 3K1MA 1JQFA 4NEDA 4I62A 4KCCA 4PP0A 1N0TA 3PD9A 3U92A 1FCKA 4EF2A 1URDA 1MQDA 1USYH 4NF4B 2WOPA 1M5CA 1MY4A 2X7PA 3CFZA 2F34A 3K6VA 4JBZA 3C36A 3OO8A 1M5EA 3C9HA 3C32A 2G29A 3OSQA 1YCJA 1MY0A 4OETA 4ELPA 1Y1MA 4GWOA 1UIVA 3WAFA 5KCJB 1EZPA 3KFMA 3LVUA 2H5YA 2VOZA 3OO9A 1P99A 3PGFA 4QHQA 3IO4A 4IO4A 1YAEA 3MAMA 4PE5B 4QFKA 1MS7A 2ZYNA 3GXAA 3PU5A 3MW0A 3HV1A 1DSNA 4Q30B 4YKKA 1JEVA 4OZ9A 1HSJA 1Z7ME 4G8NA 1I6AA 4ZS9A 5FHNA 3LC8A 3SKPA 3S9EA 5BWJA 3BFUA 1OVTA 1B3EA 2O1LA 1VR5A 4GFRA 1M5FA 3ILUB 1JEUA 3RY3A 2IA4A 4NWCA 4U21A 2R6GE 5ELVA 3TTLA 4ND9A 1EZ9A 2B3FA 2GH9A 3O66A 5HBCA 2QMWA 4E0XA 4ZECA 2FYIA 1Y3PA 2DWJA 4GVOA 4KI0E 4P11A 4ZZEA 3W15C 3O2AA 5AA4A 5LOMA 3G3GA 1B40A 1B4HA 1LCFA 2V93A 2F8DA 3G3FA 3K6WA 3LUYA 4QSCA 4RPNA 3SEYA 4F39A 5CMCA 4YB6A 1IUDA 5I2NA 1MXUA 1FTOA 3UK4A 1P1NA 2DE3A 1SW5A 3IL1B 5KDTA 2XXUA 3MZBA 3CFXA 1H76A 1SW2A 3V89B 1NMUA 2UVHA 1PBQA 2I49A 1SQYA 4G4PA 5DTBA 4F3PA 5AE4A 1H43A 1FQFA 4MH5A 5AA1A 3GLBA 3MC2A 3FXRA 3E9XA 5H8NA 1GVCA 5IAIA 2O7UA 3B7DA 3RYAA 4ZEKA 2G93A 1PEBA 3QAXA 3IJXB 4G68A 4RJZA 3IOVA 2NXOA 1B3GA 1JW4A 3FZVA 4JXIA 4YZZA 5DEXA 4U2RA 3FJ7A 3TELA 3RTFB 1B1HA 2UYEA 3G3KA 5I84A 2H4IA 2OLBA 5L8DA 4DDDA 4QFNA 4R6HA 3FV2A 1LFIA 5A5XA 1OIBA 5HPQA 2UVJA 3O6IA 1XS5A 4IY5A 5I2KB 3SETA 3O6GA 5L9OA 4G8MA 1P1QA 1QULA 4UA8A 1AMFA 1UTHA 4ZEIA 3CG3A 4DLDA 1OVBA 4DIGA 1MXXA 1Y3QA 2PYYA 1JETA 3N6UA 1B9JA 3OSRA 3TDJA 1IQ7A 3K1NA 4X9TA 2LAOA 2VP1A 1B5HA 1MPDA 3BBRA 3U93A 2ANJA 1LCTA 1MQIA 3IO6A 1MG1A 5CMBA 3TQWA 1QJMA 5FTIA 1MY3A 3VLVA 3OEMA 1O64A 3SEVA 1EH3A 1SD3A 5CMKA 4QFPA 3MVXA 1MQJA 5H8QB 3RGYA 4JWYA 2ZXTA 1URGA 1Z7NE 4PETA 2PMSA 4Z0IA 3RLFE 4ESXA 3GBAA 1ZTYA 1FQDA 3GBBA 1M5DA 4GLIA 4NF6A 3S4UA 1BTJA 3PUWE 1SYIA 5AA2A 3H3GA 4BDMA 2PT1A 3FVKA 4BDLA 3AXFA 3RYBA 2THIA 2HZKA 3C33A 3IB0A 4XTCQ 1OQHA 4EQ7A 2O51A 3MP6A 3CVGA 2ZYMA 1NNTA 2FNCA 3HSTA 4MLVA 1MY1A 2PVUA 1LSTA 4YKJA 4DCYA 4TOZA 3PUXE 4X48A 3UORA 3S9NC 3IOUA 3KOSA 3KOTA 1D4NA 1HSEA 2QS3A 3CSGA 2HXWA 3K2DA 1QUKA 4ZDMA 3EHTA 1MDQA 2ESNA 1SYHA 2UVIA 4OESA 1A40A 3UN6A 4XKNA 1NNFA 3H6VA 1NKXA 1XVYA 2HQ0A 3FD3A 2ZYKA 3FJGA 1US5A 2DWHA 3U94A 4X1BA 3ZKLA 2OZZA 3IB2A 1N3XA 3IAZA 4WXJA 4H0WA 3FUZA 3TPAA 4OEVA 2HEUA 3K6UA 3MUQA 4TQUQ 2P0SA 2OWTA 2ZNUA 3H6UA 2F7AA 3DP8A 2DSFA 2ONRA 3JV9A 3KN3A 1B6HA 3O6HA 5H8HB 3RNNA 3O6PA 3TZAA 2QMXA 4Q0CA 3QYTA 1UTHB 3IX1A 3D4CA 3PV0E 4RA1A 4R6YA 4IGRA 5DT6A 3W9VA 1XHYA 1A55A 1RYOA 2H99A 1OMPA 1DMBA 2H98A 4R9FA 4GQOA 1FQAA 3DELB 3EN3A 3P7IA 4YICA 3T9XB 2I48A 4EXKA 5A5XB 4GF8A 4OERA 3A3UA 3LSWA 3DP6A 3T66A 3U1OA 1IEJA 2Z8FA 3H7MA 3HPIA 4GOTA 1IZ1A 5ICQA 1SW4A 4KQPA 5H8FB 3I5OA 1SDXA 4EQBA 3CR9A 2I3VA 3V83A 1Q1KA 3MVZA 1PB9A 2E0SA 4R73A 3T9HB 5H8NB 1LAGE 2PX1A 2V3QA 1QKAA 4U1OA 4WEPA 5B7DA 4H67A 1MXVA 4Q5TA 4EF1A 4EXLA 2QS1A 3PPQA 4OWDA 1SBPA 3RTWB 1PB8A 1P1WA 4IY6A 4YMAA 1A54A 3TCGA 5KDTB 3PMXA 2F6GA 1POY1 2V3UA 5BUUA 2RC7A 1PDAA 4O3CA 4FORA 4F22A 1H44A 3MZ1A 4IO7A 4BDNA 4QRZA 2HFBA 2F78A 3K6XA 4FECA 1EZOA 2O6AA 3MWBA 2O1MA 3UA8A 4F29A 3TTKA 3R7XA 2B65A 2DVCA 1MXYA 2FA7A 4K3FA 4AB6A 5I2NB 1JNFA 3QXMA 1MDP1 1R9QA 3PMVA 1VE4A 3PPPA 5DVFA 1A7LA 1FQBA 4F1VA 3FATA 4E0WA 5L9SA 4EUOA 3Q28A 3MP8A 2F7CA 3ONMA 3UP9A 3Q26A 3SEUA 3F11A 1NNPA 5FHMA 1P1UA 1WVJA 2HCAA 1YTVA 2CZLA 3ZS6A 2NUVA 2XX7A 4TLLB 4LATA 4XKQA 1TFAA 4YMBA 1FTKA 1POTA 3IORA 4O3BA 3UGWA 1MH4A 1SI1A 1WODA 1QVSA 1ZJLA 4H5FA 2RF1A 1VFDA 1WDNA 4OEUA 5I57B 3DRHA 3IR1A 1MQGA 2XXWA 1Q35A 4QFOA 4I1DA 4KHZE 2I0BA 5F7VA 2F36A 1S50A 5AA2D 1OQGA 1DOTA 1IIWA 3CG1A 2WOKA 4LZ7A 1XC1A 2O68A 2GFEA 4NF4A 5FTHA 4F2OA 5TP9A 2Q2AA 4IO3A 1IXIA 2UVGA 4R72A 4WKMA 5EHMA 1LB8A 1NH7A 3W9WA 4ESWA 1T0KA 4GRKA 3M3KA 3V8XB 1B52A 2P2AA 3VVFA 2UXAA 2Z8EA 2NWJA 4I9DA 5ITPA 3DRJA 3KEIA 2RCBA 4N13A 2REGA 3OO7A 3TMGA 4ELQA 4OFJA 1B51A 3OENA 3VDFA 1AH5A 3CFLA 4U1ZA 5TU0A 2DWAA 2F97A 1LFHA 1FTLA 2XXYA 4HW8A 3ODBA 3N94A 4ZEDA 2Y84A 3N26A 4LVQA 2QPQA 5I2KA 4NWDA 5ISUA 3RPWA 3H6WA 4NTLA 4TLMB 1GV8A 2XD3A 3C31A 4ISUA 4PFYA 4QF9A 4FAJA 4F31B 4H8JA 4F3BA 1Y4CA 3PMWA 3LR1A 4ELOA 2XHDA 3QUFA 1B05A 5CI5A 4ZEBA 3MQ9A 2XX9A 3FV1A 4BLAA 4FJPA 1JW1A 1LGBC 4YU0A 3OELA 1B4ZA 4P0IA 3FXUA 3EPEA 1O63A 1PC3A 4RXLA 5HM4B 4R2BA 1RYXA 1BP5A 2HZLA 2Y7IA 4R74A 5L9MA 3H4ZA 4IO5A 4C1TA 2O84X 4OENA 4YKIA 1I6QA 3CHGA 4RNSA 4DE8A 4F2QA 2WKYA 4F1YA 2B3BA 3LSXA 3DRGA 3PUVE 1B3FA 1NL5A 4RK9A 4F1UA 1URSA 1N76A 3SEWA 3O28A 3IOWA 1TT1A 1B3HA 4OFOA 1UTBB 1Y3NA 3CIJA 5H8HA 1Y4TA 4M4GA 1MXWA 2H25A 3DP4A 3PPNA 1Y20A 3OD7A 1SVXB 4MBPA 3N6TA 2DVZA 2QRYA 5ITOA 2YLNA 4ELRA 2ZNSA 2V3TA 1B1XA 3LSFB 5H8FA 3SEXA 4P0GA 4R9GA 3OXNA 2DWIA 4GXSB 1KWHA 5F1QA 5I57A 5KCJA 5JTYA 2XXTA 3BKIB 4U23A 3ILTB 3KN8A 4H8IA 3MPKA 2A5TB 2QSXA 3QUJA 2DE4A 3M3LA 2DS9A 5TP9B 3USDA 3VV5A 2DP8A 1MXZA 2W7YA 3HN0A 3VXCA 5I56A 2A5TA 4HS7A 3JZJA 2XXXA 3DRFA 3TODA 3KJTA 4O3AA 4H6DA 3JYRA 3DRIA 1B7HA 1DPPA 2F6PA 4FEBA 4NF8A 4RYAA 4YKPA 1B7ZA 1LB9A 1TFDA 3KSXA 3MJNA 3OO6A 3RT6B 2KLFA 3B6WA 1MM7A 3ZKKA 2BJJX 2V84A 4I8CA 3CI8A 4ZEFA 3PPRA 2HAUA 4GL0A 3T22A 4BDQA 2I4CA 5EHSA 4QSEA 5DVJA 1F9BA 1LFGA 4HCWA 1TXFA 2M8CA 4KYDA 2WOLA 1LAFE 2ABHA 3K0VA 3QK6A 3R26A 4LQ5A 4YB7A 1R6ZA 3GZGA 3RN8A 4F19A 2NOOA 5CM6A 1O7TA 4JWXA 1I6BA 1B5JA 3UIFA 2F5XA 4F3SA 4H5GA 3O29A 3KZGA 1D9YA 3TUSA 1UIUA 3K1PA 2VD3A 2ONSA 3E3KA 2OJTA 3A3CA 3K01A 3L6HA 4WEDA 4JB7A 3DM0A 4U22A 1H3DA 4EQ9A 1AOVA 5JK4A 4JWOA 3DRKA 1FQCA 3FJMA 2D3IA 1N7WA 1FTJA 5CMMA 2R71A 3HCQA 5DYHA 2B4MA 4LP2B 4EDPA 1B0HA 4POXA 3FVOA 1II5A 2Y7PA 2ZNTA 4THIA 2QL3A 3FXQA 4R2FA 3RQTA 4QFLA 4RK2A 3SERA 5CBSA 4KPTA 4JSOA 2GHAA 5EYFA 1OLCA 3MPLA 4BDOA 3BFTA 2AL4A 2OWSA 5CRYA 1TWYA 1BLFA 3E13X 4FIMA 4RPOA 3V5AA 5B70A 3VLUA 3OOAA 1RKMA 2ZYOA 1MM6A 4DCXA 2X7QA 2OK2A 2XXHA 3OEKA 5AA4B 1N04A 2IEEA 1JVXA 3G3IA 3Q29A 1P1OA 4RY1A 5M2VA 5I58B 3EF7A 4OHNA 4MF3A 4OVJA 3T93B 2O7IA 3KN7A 3ECRA 2DYXA 1NNKA 3TYHA 3K00A 5JEIA 1LAHE 2GHBA 2Y7WA 4H65A 4DXCA 1MY2A 2V25A 2RC8A 4AQ4A 3U72A 4F18A 1QKBA 4C1UA 2RC9A 4DXBA 4PFUA 4ONYA 3TCHA 1OLAA 4NE4A 5ICTA 3TTRA 4OYVA 1Y1ZA 2R9JA 4F3GA 1B32A 2VD2A 4KYEA 2DQVA 2DXRA 3H6TA 3PAMA 3TCFA 1N84A 2AL5A 2XXVA 4G68C 5CBRA 3OMBA 1DPEA 4LA9A 5FHOA 4JSDA 3THIA 2I6EA 3CSBA 1J1NA 3CRBA 3IK6B 4MLQA 3Q25A 2B4LA 1B7UA 2Z22A 3N5LA 3FIRA 3C35A 4ZZAA 4NMYA 2RKMA 2Y7KA 1DTGA 1D9VA 4KD5A 3A09A 1PBPA 4NF5A 3EHUA 1B5IA 2YJPA 1GTKA 3G3HA 3H03A 2QS2A 2Y7RA 1I69A 3FVGA 4ZE8A 3SDFA 3PUZE 1A8FA 1FW0A 4LQ2A 1D3KA 1ZIUA 4L17A 1XT8A 3VXBA 5H8QA 3T9VA 1MPCA 3D4GA 3L6GA 4H1XA 2PBWA 3SESA 2YPNA 3O97A 1MQHA 3FVNA 4POWA 1LBCA 3B6TA 3G3JA 1CE2A 3HHGA 3IJOB 4R75A 5J1DA 2PT2A 4MFIA 4PFTA 3HO7A 4LONB 4NF6B 3T9UA 3S9MC 4FE8A 1S7YA 1MH3A 3U8QA 1R9LA 1Y9UA 1ZMGA 2DXYA 4G2ZA 1S9TA 1NFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USY E;  3S2V A;  5AA3 A;  2XX8 A;  4R6K A;  3WAE A;  1LBB A;  1QW0 A;  3TEP A;  3LSL A;  4DZ1 A;  1QUI A;  3E4R A;  3QSL A;  3G7W A;  5H8S A;  2O69 A;  2Q9T A;  3S9L C;  5I59 B;  1VFE A;  1ZU0 A;  4NF8 B;  3TFL A;  2QS4 A;  3HHF A;  5KZT A;  2P1S A;  2REJ A;  3LBS A;  4KCD A;  4OMB A;  2I0C A;  4QSD A;  3MBP A;  4M1V A;  1BKA A;  4G77 A;  4OTE A;  3FTO A;  4XKR A;  4G68 B;  3O9P A;  3IOT A;  2D21 A;  4GIZ A;  4U4X A;  4Z7E A;  5I56 B;  4GD5 A;  1AL3 A;  2ZMB A;  4LZ5 A;  3C34 A;  2RIN A;  2A5S A;  3ZSF A;  1B2H A;  2DOJ A;  1ZBM A;  5JTY B;  5K2Y A;  3TAJ A;  4HTG A;  4BDR A;  4N07 A;  1SW1 A;  1FTM A;  2AIX A;  4XXU A;  2VHA A;  4PQJ A;  1ZLQ A;  5DVI A;  1N3W A;  1US4 A;  1VSO A;  3VLW A;  5DEX B;  2NVU B;  1B3L A;  4NF5 B;  2E1S A;  1HSL A;  3TTN A;  2F35 A;  1B58 A;  4OXV A;  2D5W A;  1MPB A;  1IXH A;  5TPA B;  1A8E A;  1UTB A;  5TPA A;  3VFJ A;  2HAV A;  2GRV A;  2XD2 A;  2XXQ A;  4GL8 A;  1IXG A;  1LAX A;  1SI0 A;  3M3F A;  3K4U A;  4IB2 A;  1A99 A;  2Z23 A;  4IGT A;  3I6V A;  2XXR A;  4ECF A;  4PFW A;  3FAS A;  3TQL A;  1QUJ A;  2I3W A;  2XXI A;  3B6Q A;  1ATG A;  3KGC A;  4IO6 A;  3VVE A;  5CC2 A;  4FED A;  4IO2 A;  1M5B A;  3VVD A;  2H9B A;  4Q8R A;  1IXC A;  1N7X A;  2F7B A;  1XVX A;  1B46 A;  3EHS A;  1LLS A;  3MZ9 A;  2CMO A;  2RCA A;  1GR2 A;  2X26 A;  5K2X A;  2Q8J A;  1MRP A;  2AYS A;  4DXU A;  1B0L A;  4OQO A;  2UYF A;  1L5T A;  3RT8 A;  5I58 A;  3DLN A;  3QIM A;  1BIY A;  1GGG A;  1ZKB A;  3RUM A;  4XIG Q;  1ELJ A;  2Z8D A;  2Q88 A;  1JVY A;  4AB5 A;  1IIT A;  2Q89 A;  5I59 A;  4LZ8 A;  1CB6 A;  3C4M A;  3MVW A;  1ANF A;  1DTZ A;  1NH8 A;  4XKP A;  5IKB A;  1FQE A;  4KYS A;  2VGQ A;  1AIV A;  1YPN A;  3TTM A;  3H06 B;  2ALU A;  1R1N A;  3MP1 A;  3K02 A;  4JDF A;  2QJE A;  3TKD A;  4KFQ A;  3KG2 A;  4OFL A;  5AA2 B;  2OBG A;  1H45 A;  3Q27 A;  1EU8 A;  4GXA A;  2Q2C A;  3KJ7 A;  1JW5 A;  4FAT A;  2I4B A;  4HCY A;  3IB1 A;  4KR5 A;  4N6P A;  2I58 A;  3PUY E;  2ONK E;  3M8U A;  3I3V A;  4U4S A;  4X1D A;  4YAH X;  3T96 B;  4LUB A;  4YB5 A;  1XOC A;  2DE2 A;  4C0R A;  3MVY A;  1PB7 A;  3FGS A;  4G8H A;  3VE1 B;  4ZE9 A;  2OCU A;  3PPO A;  3R6U A;  4UAC A;  2XXP A;  3EQ1 A;  3PD8 A;  1UQW A;  3KBR A;  3KSJ A;  3K1M A;  1JQF A;  4NED A;  4I62 A;  4KCC A;  4PP0 A;  1N0T A;  3PD9 A;  3U92 A;  1FCK A;  4EF2 A;  1URD A;  1MQD A;  1USY H;  4NF4 B;  2WOP A;  1M5C A;  1MY4 A;  2X7P A;  3CFZ A;  2F34 A;  3K6V A;  4JBZ A;  3C36 A;  3OO8 A;  1M5E A;  3C9H A;  3C32 A;  2G29 A;  3OSQ A;  1YCJ A;  1MY0 A;  4OET A;  4ELP A;  1Y1M A;  4GWO A;  1UIV A;  3WAF A;  5KCJ B;  1EZP A;  3KFM A;  3LVU A;  2H5Y A;  2VOZ A;  3OO9 A;  1P99 A;  3PGF A;  4QHQ A;  3IO4 A;  4IO4 A;  1YAE A;  3MAM A;  4PE5 B;  4QFK A;  1MS7 A;  2ZYN A;  3GXA A;  3PU5 A;  3MW0 A;  3HV1 A;  1DSN A;  4Q30 B;  4YKK A;  1JEV A;  4OZ9 A;  1HSJ A;  1Z7M E;  4G8N A;  1I6A A;  4ZS9 A;  5FHN A;  3LC8 A;  3SKP A;  3S9E A;  5BWJ A;  3BFU A;  1OVT A;  1B3E A;  2O1L A;  1VR5 A;  4GFR A;  1M5F A;  3ILU B;  1JEU A;  3RY3 A;  2IA4 A;  4NWC A;  4U21 A;  2R6G E;  5ELV A;  3TTL A;  4ND9 A;  1EZ9 A;  2B3F A;  2GH9 A;  3O66 A;  5HBC A;  2QMW A;  4E0X A;  4ZEC A;  2FYI A;  1Y3P A;  2DWJ A;  4GVO A;  4KI0 E;  4P11 A;  4ZZE A;  3W15 C;  3O2A A;  5AA4 A;  5LOM A;  3G3G A;  1B40 A;  1B4H A;  1LCF A;  2V93 A;  2F8D A;  3G3F A;  3K6W A;  3LUY A;  4QSC A;  4RPN A;  3SEY A;  4F39 A;  5CMC A;  4YB6 A;  1IUD A;  5I2N A;  1MXU A;  1FTO A;  3UK4 A;  1P1N A;  2DE3 A;  1SW5 A;  3IL1 B;  5KDT A;  2XXU A;  3MZB A;  3CFX A;  1H76 A;  1SW2 A;  3V89 B;  1NMU A;  2UVH A;  1PBQ A;  2I49 A;  1SQY A;  4G4P A;  5DTB A;  4F3P A;  5AE4 A;  1H43 A;  1FQF A;  4MH5 A;  5AA1 A;  3GLB A;  3MC2 A;  3FXR A;  3E9X A;  5H8N A;  1GVC A;  5IAI A;  2O7U A;  3B7D A;  3RYA A;  4ZEK A;  2G93 A;  1PEB A;  3QAX A;  3IJX B;  4G68 A;  4RJZ A;  3IOV A;  2NXO A;  1B3G A;  1JW4 A;  3FZV A;  4JXI A;  4YZZ A;  5DEX A;  4U2R A;  3FJ7 A;  3TEL A;  3RTF B;  1B1H A;  2UYE A;  3G3K A;  5I84 A;  2H4I A;  2OLB A;  5L8D A;  4DDD A;  4QFN A;  4R6H A;  3FV2 A;  1LFI A;  5A5X A;  1OIB A;  5HPQ A;  2UVJ A;  3O6I A;  1XS5 A;  4IY5 A;  5I2K B;  3SET A;  3O6G A;  5L9O A;  4G8M A;  1P1Q A;  1QUL A;  4UA8 A;  1AMF A;  1UTH A;  4ZEI A;  3CG3 A;  4DLD A;  1OVB A;  4DIG A;  1MXX A;  1Y3Q A;  2PYY A;  1JET A;  3N6U A;  1B9J A;  3OSR A;  3TDJ A;  1IQ7 A;  3K1N A;  4X9T A;  2LAO A;  2VP1 A;  1B5H A;  1MPD A;  3BBR A;  3U93 A;  2ANJ A;  1LCT A;  1MQI A;  3IO6 A;  1MG1 A;  5CMB A;  3TQW A;  1QJM A;  5FTI A;  1MY3 A;  3VLV A;  3OEM A;  1O64 A;  3SEV A;  1EH3 A;  1SD3 A;  5CMK A;  4QFP A;  3MVX A;  1MQJ A;  5H8Q B;  3RGY A;  4JWY A;  2ZXT A;  1URG A;  1Z7N E;  4PET A;  2PMS A;  4Z0I A;  3RLF E;  4ESX A;  3GBA A;  1ZTY A;  1FQD A;  3GBB A;  1M5D A;  4GLI A;  4NF6 A;  3S4U A;  1BTJ A;  3PUW E;  1SYI A;  5AA2 A;  3H3G A;  4BDM A;  2PT1 A;  3FVK A;  4BDL A;  3AXF A;  3RYB A;  2THI A;  2HZK A;  3C33 A;  3IB0 A;  4XTC Q;  1OQH A;  4EQ7 A;  2O51 A;  3MP6 A;  3CVG A;  2ZYM A;  1NNT A;  2FNC A;  3HST A;  4MLV A;  1MY1 A;  2PVU A;  1LST A;  4YKJ A;  4DCY A;  4TOZ A;  3PUX E;  4X48 A;  3UOR A;  3S9N C;  3IOU A;  3KOS A;  3KOT A;  1D4N A;  1HSE A;  2QS3 A;  3CSG A;  2HXW A;  3K2D A;  1QUK A;  4ZDM A;  3EHT A;  1MDQ A;  2ESN A;  1SYH A;  2UVI A;  4OES A;  1A40 A;  3UN6 A;  4XKN A;  1NNF A;  3H6V A;  1NKX A;  1XVY A;  2HQ0 A;  3FD3 A;  2ZYK A;  3FJG A;  1US5 A;  2DWH A;  3U94 A;  4X1B A;  3ZKL A;  2OZZ A;  3IB2 A;  1N3X A;  3IAZ A;  4WXJ A;  4H0W A;  3FUZ A;  3TPA A;  4OEV A;  2HEU A;  3K6U A;  3MUQ A;  4TQU Q;  2P0S A;  2OWT A;  2ZNU A;  3H6U A;  2F7A A;  3DP8 A;  2DSF A;  2ONR A;  3JV9 A;  3KN3 A;  1B6H A;  3O6H A;  5H8H B;  3RNN A;  3O6P A;  3TZA A;  2QMX A;  4Q0C A;  3QYT A;  1UTH B;  3IX1 A;  3D4C A;  3PV0 E;  4RA1 A;  4R6Y A;  4IGR A;  5DT6 A;  3W9V A;  1XHY A;  1A55 A;  1RYO A;  2H99 A;  1OMP A;  1DMB A;  2H98 A;  4R9F A;  4GQO A;  1FQA A;  3DEL B;  3EN3 A;  3P7I A;  4YIC A;  3T9X B;  2I48 A;  4EXK A;  5A5X B;  4GF8 A;  4OER A;  3A3U A;  3LSW A;  3DP6 A;  3T66 A;  3U1O A;  1IEJ A;  2Z8F A;  3H7M A;  3HPI A;  4GOT A;  1IZ1 A;  5ICQ A;  1SW4 A;  4KQP A;  5H8F B;  3I5O A;  1SDX A;  4EQB A;  3CR9 A;  2I3V A;  3V83 A;  1Q1K A;  3MVZ A;  1PB9 A;  2E0S A;  4R73 A;  3T9H B;  5H8N B;  1LAG E;  2PX1 A;  2V3Q A;  1QKA A;  4U1O A;  4WEP A;  5B7D A;  4H67 A;  1MXV A;  4Q5T A;  4EF1 A;  4EXL A;  2QS1 A;  3PPQ A;  4OWD A;  1SBP A;  3RTW B;  1PB8 A;  1P1W A;  4IY6 A;  4YMA A;  1A54 A;  3TCG A;  5KDT B;  3PMX A;  2F6G A;  1POY 1;  2V3U A;  5BUU A;  2RC7 A;  1PDA A;  4O3C A;  4FOR A;  4F22 A;  1H44 A;  3MZ1 A;  4IO7 A;  4BDN A;  4QRZ A;  2HFB A;  2F78 A;  3K6X A;  4FEC A;  1EZO A;  2O6A A;  3MWB A;  2O1M A;  3UA8 A;  4F29 A;  3TTK A;  3R7X A;  2B65 A;  2DVC A;  1MXY A;  2FA7 A;  4K3F A;  4AB6 A;  5I2N B;  1JNF A;  3QXM A;  1MDP 1;  1R9Q A;  3PMV A;  1VE4 A;  3PPP A;  5DVF A;  1A7L A;  1FQB A;  4F1V A;  3FAT A;  4E0W A;  5L9S A;  4EUO A;  3Q28 A;  3MP8 A;  2F7C A;  3ONM A;  3UP9 A;  3Q26 A;  3SEU A;  3F11 A;  1NNP A;  5FHM A;  1P1U A;  1WVJ A;  2HCA A;  1YTV A;  2CZL A;  3ZS6 A;  2NUV A;  2XX7 A;  4TLL B;  4LAT A;  4XKQ A;  1TFA A;  4YMB A;  1FTK A;  1POT A;  3IOR A;  4O3B A;  3UGW A;  1MH4 A;  1SI1 A;  1WOD A;  1QVS A;  1ZJL A;  4H5F A;  2RF1 A;  1VFD A;  1WDN A;  4OEU A;  5I57 B;  3DRH A;  3IR1 A;  1MQG A;  2XXW A;  1Q35 A;  4QFO A;  4I1D A;  4KHZ E;  2I0B A;  5F7V A;  2F36 A;  1S50 A;  5AA2 D;  1OQG A;  1DOT A;  1IIW A;  3CG1 A;  2WOK A;  4LZ7 A;  1XC1 A;  2O68 A;  2GFE A;  4NF4 A;  5FTH A;  4F2O A;  5TP9 A;  2Q2A A;  4IO3 A;  1IXI A;  2UVG A;  4R72 A;  4WKM A;  5EHM A;  1LB8 A;  1NH7 A;  3W9W A;  4ESW A;  1T0K A;  4GRK A;  3M3K A;  3V8X B;  1B52 A;  2P2A A;  3VVF A;  2UXA A;  2Z8E A;  2NWJ A;  4I9D A;  5ITP A;  3DRJ A;  3KEI A;  2RCB A;  4N13 A;  2REG A;  3OO7 A;  3TMG A;  4ELQ A;  4OFJ A;  1B51 A;  3OEN A;  3VDF A;  1AH5 A;  3CFL A;  4U1Z A;  5TU0 A;  2DWA A;  2F97 A;  1LFH A;  1FTL A;  2XXY A;  4HW8 A;  3ODB A;  3N94 A;  4ZED A;  2Y84 A;  3N26 A;  4LVQ A;  2QPQ A;  5I2K A;  4NWD A;  5ISU A;  3RPW A;  3H6W A;  4NTL A;  4TLM B;  1GV8 A;  2XD3 A;  3C31 A;  4ISU A;  4PFY A;  4QF9 A;  4FAJ A;  4F31 B;  4H8J A;  4F3B A;  1Y4C A;  3PMW A;  3LR1 A;  4ELO A;  2XHD A;  3QUF A;  1B05 A;  5CI5 A;  4ZEB A;  3MQ9 A;  2XX9 A;  3FV1 A;  4BLA A;  4FJP A;  1JW1 A;  1LGB C;  4YU0 A;  3OEL A;  1B4Z A;  4P0I A;  3FXU A;  3EPE A;  1O63 A;  1PC3 A;  4RXL A;  5HM4 B;  4R2B A;  1RYX A;  1BP5 A;  2HZL A;  2Y7I A;  4R74 A;  5L9M A;  3H4Z A;  4IO5 A;  4C1T A;  2O84 X;  4OEN A;  4YKI A;  1I6Q A;  3CHG A;  4RNS A;  4DE8 A;  4F2Q A;  2WKY A;  4F1Y A;  2B3B A;  3LSX A;  3DRG A;  3PUV E;  1B3F A;  1NL5 A;  4RK9 A;  4F1U A;  1URS A;  1N76 A;  3SEW A;  3O28 A;  3IOW A;  1TT1 A;  1B3H A;  4OFO A;  1UTB B;  1Y3N A;  3CIJ A;  5H8H A;  1Y4T A;  4M4G A;  1MXW A;  2H25 A;  3DP4 A;  3PPN A;  1Y20 A;  3OD7 A;  1SVX B;  4MBP A;  3N6T A;  2DVZ A;  2QRY A;  5ITO A;  2YLN A;  4ELR A;  2ZNS A;  2V3T A;  1B1X A;  3LSF B;  5H8F A;  3SEX A;  4P0G A;  4R9G A;  3OXN A;  2DWI A;  4GXS B;  1KWH A;  5F1Q A;  5I57 A;  5KCJ A;  5JTY A;  2XXT A;  3BKI B;  4U23 A;  3ILT B;  3KN8 A;  4H8I A;  3MPK A;  2A5T B;  2QSX A;  3QUJ A;  2DE4 A;  3M3L A;  2DS9 A;  5TP9 B;  3USD A;  3VV5 A;  2DP8 A;  1MXZ A;  2W7Y A;  3HN0 A;  3VXC A;  5I56 A;  2A5T A;  4HS7 A;  3JZJ A;  2XXX A;  3DRF A;  3TOD A;  3KJT A;  4O3A A;  4H6D A;  3JYR A;  3DRI A;  1B7H A;  1DPP A;  2F6P A;  4FEB A;  4NF8 A;  4RYA A;  4YKP A;  1B7Z A;  1LB9 A;  1TFD A;  3KSX A;  3MJN A;  3OO6 A;  3RT6 B;  2KLF A;  3B6W A;  1MM7 A;  3ZKK A;  2BJJ X;  2V84 A;  4I8C A;  3CI8 A;  4ZEF A;  3PPR A;  2HAU A;  4GL0 A;  3T22 A;  4BDQ A;  2I4C A;  5EHS A;  4QSE A;  5DVJ A;  1F9B A;  1LFG A;  4HCW A;  1TXF A;  2M8C A;  4KYD A;  2WOL A;  1LAF E;  2ABH A;  3K0V A;  3QK6 A;  3R26 A;  4LQ5 A;  4YB7 A;  1R6Z A;  3GZG A;  3RN8 A;  4F19 A;  2NOO A;  5CM6 A;  1O7T A;  4JWX A;  1I6B A;  1B5J A;  3UIF A;  2F5X A;  4F3S A;  4H5G A;  3O29 A;  3KZG A;  1D9Y A;  3TUS A;  1UIU A;  3K1P A;  2VD3 A;  2ONS A;  3E3K A;  2OJT A;  3A3C A;  3K01 A;  3L6H A;  4WED A;  4JB7 A;  3DM0 A;  4U22 A;  1H3D A;  4EQ9 A;  1AOV A;  5JK4 A;  4JWO A;  3DRK A;  1FQC A;  3FJM A;  2D3I A;  1N7W A;  1FTJ A;  5CMM A;  2R71 A;  3HCQ A;  5DYH A;  2B4M A;  4LP2 B;  4EDP A;  1B0H A;  4POX A;  3FVO A;  1II5 A;  2Y7P A;  2ZNT A;  4THI A;  2QL3 A;  3FXQ A;  4R2F A;  3RQT A;  4QFL A;  4RK2 A;  3SER A;  5CBS A;  4KPT A;  4JSO A;  2GHA A;  5EYF A;  1OLC A;  3MPL A;  4BDO A;  3BFT A;  2AL4 A;  2OWS A;  5CRY A;  1TWY A;  1BLF A;  3E13 X;  4FIM A;  4RPO A;  3V5A A;  5B70 A;  3VLU A;  3OOA A;  1RKM A;  2ZYO A;  1MM6 A;  4DCX A;  2X7Q A;  2OK2 A;  2XXH A;  3OEK A;  5AA4 B;  1N04 A;  2IEE A;  1JVX A;  3G3I A;  3Q29 A;  1P1O A;  4RY1 A;  5M2V A;  5I58 B;  3EF7 A;  4OHN A;  4MF3 A;  4OVJ A;  3T93 B;  2O7I A;  3KN7 A;  3ECR A;  2DYX A;  1NNK A;  3TYH A;  3K00 A;  5JEI A;  1LAH E;  2GHB A;  2Y7W A;  4H65 A;  4DXC A;  1MY2 A;  2V25 A;  2RC8 A;  4AQ4 A;  3U72 A;  4F18 A;  1QKB A;  4C1U A;  2RC9 A;  4DXB A;  4PFU A;  4ONY A;  3TCH A;  1OLA A;  4NE4 A;  5ICT A;  3TTR A;  4OYV A;  1Y1Z A;  2R9J A;  4F3G A;  1B32 A;  2VD2 A;  4KYE A;  2DQV A;  2DXR A;  3H6T A;  3PAM A;  3TCF A;  1N84 A;  2AL5 A;  2XXV A;  4G68 C;  5CBR A;  3OMB A;  1DPE A;  4LA9 A;  5FHO A;  4JSD A;  3THI A;  2I6E A;  3CSB A;  1J1N A;  3CRB A;  3IK6 B;  4MLQ A;  3Q25 A;  2B4L A;  1B7U A;  2Z22 A;  3N5L A;  3FIR A;  3C35 A;  4ZZA A;  4NMY A;  2RKM A;  2Y7K A;  1DTG A;  1D9V A;  4KD5 A;  3A09 A;  1PBP A;  4NF5 A;  3EHU A;  1B5I A;  2YJP A;  1GTK A;  3G3H A;  3H03 A;  2QS2 A;  2Y7R A;  1I69 A;  3FVG A;  4ZE8 A;  3SDF A;  3PUZ E;  1A8F A;  1FW0 A;  4LQ2 A;  1D3K A;  1ZIU A;  4L17 A;  1XT8 A;  3VXB A;  5H8Q A;  3T9V A;  1MPC A;  3D4G A;  3L6G A;  4H1X A;  2PBW A;  3SES A;  2YPN A;  3O97 A;  1MQH A;  3FVN A;  4POW A;  1LBC A;  3B6T A;  3G3J A;  1CE2 A;  3HHG A;  3IJO B;  4R75 A;  5J1D A;  2PT2 A;  4MFI A;  4PFT A;  3HO7 A;  4LON B;  4NF6 B;  3T9U A;  3S9M C;  4FE8 A;  1S7Y A;  1MH3 A;  3U8Q A;  1R9L A;  1Y9U A;  1ZMG A;  2DXY A;  4G2Z A;  1S9T A;  1NFT A; 
#chains in the Genus database with same CATH topology
 1USY E;  4O8M A;  5AA3 A;  5ET5 A;  1LBB A;  1QW0 A;  3LSL A;  5I59 B;  1ZU0 A;  4NF8 B;  3U65 A;  2P1S A;  4QSD A;  4XKR A;  3O9P A;  4U4X A;  2D21 A;  2VPO A;  5K2Y A;  4XXU A;  1ZLQ A;  1US4 A;  2XA5 A;  3VLW A;  2F35 A;  5AA2 D;  3VFJ A;  5TPA A;  1UTB A;  3PTY A;  2Z23 A;  3FAS A;  3MST A;  3VVD A;  2H9B A;  2F7B A;  4AB5 A;  2CMO A;  3MZ9 A;  2X26 A;  5K2X A;  3RT8 A;  3RUM A;  4OAN A;  1ELJ A;  1Q9D A;  1JVY A;  1FBE A;  3B50 A;  3MVW A;  1ANF A;  1DTZ A;  5IKB A;  4OA4 A;  2QJE A;  3NOH A;  2VPN A;  5AA2 B;  3Q27 A;  2Q2C A;  3KJ7 A;  1JW5 A;  2I4B A;  4N6P A;  2I58 A;  2ONK E;  3I3V A;  4YB5 A;  2DE2 A;  2QFL A;  4UAC A;  3A29 A;  1UQW A;  3KBR A;  1JQF A;  4I62 A;  4KCC A;  3PD9 A;  1FCK A;  2WEF A;  4EF2 A;  2ZZV A;  4R6Y A;  3C36 A;  1M5E A;  3OSQ A;  4ELP A;  3WAF A;  5KCJ B;  4QHQ A;  3IO4 A;  4HE0 A;  1AWB A;  3MAM A;  4QFK A;  3GXA A;  1DSN A;  4G8N A;  3LC8 A;  5BWJ A;  3BFU A;  2O1L A;  1B3E A;  1VR5 A;  1M5F A;  3RY3 A;  2GH9 A;  1Y3P A;  2DWJ A;  3G3G A;  4QSC A;  1SW5 A;  3MZB A;  1H76 A;  3D1R A;  1PBQ A;  5AE4 A;  5H8N A;  2O7U A;  3RYA A;  4YZZ A;  1EYI A;  3RTF B;  1B1H A;  2UYE A;  2H4I A;  4QFN A;  1LFI A;  4IY5 A;  2FIE A;  3O6G A;  5L9O A;  1P1Q A;  1QUL A;  1UTH A;  3CG3 A;  1OVB A;  1MXX A;  1JET A;  4X9T A;  2LAO A;  1B5H A;  4JVD A;  3TQW A;  1MG1 A;  5CMB A;  3VLV A;  2Y5L A;  1O64 A;  5CMK A;  2ZXT A;  1Z7N E;  4PET A;  3RLF E;  1ZTY A;  1SYI A;  4P1E A;  2MKZ A;  1NNT A;  1MY1 A;  2PVU A;  3S9N C;  3KOS A;  1HSE A;  2HXW A;  2ESN A;  3H6V A;  1NKX A;  3FD3 A;  2ZYK A;  3U94 A;  2DWH A;  4O7I A;  4ESX A;  3MUQ A;  2P0S A;  5F24 A;  3IFA A;  2F7A A;  3DP8 A;  2ONR A;  3JV9 A;  5H8H B;  3O6H A;  3O6P A;  2QMX A;  3IX1 A;  4IGR A;  3W9V A;  5EYF A;  1OMP A;  2H98 A;  4GQO A;  3EN3 A;  2I48 A;  3A3U A;  2Z8F A;  2GQ1 A;  4KQP A;  1SDX A;  3CR9 A;  1FBF A;  1LAG E;  2PX1 A;  4WEP A;  1MXV A;  4YMA A;  5LTC A;  2V3U A;  5BUU A;  2RC7 A;  4FOR A;  3MZ1 A;  4FEC A;  1FTA A;  4F29 A;  1MXY A;  4K3F A;  5DW8 A;  4AB6 A;  1JNF A;  1MDP 1;  3PPP A;  1VE4 A;  2Q74 A;  4F1V A;  3Q26 A;  3SEU A;  5IZ1 A;  1P1U A;  4LAT A;  1FTK A;  1MQG A;  3HFU A;  4I1D A;  4P8B A;  4GWX A;  1FPE A;  2O68 A;  4LZ7 A;  4N17 A;  2QVU A;  5ITP A;  1FBC A;  2RCB A;  3OO7 A;  4N6D A;  3ODB A;  4NHB A;  4ZED A;  3N26 A;  4LVQ A;  4OVS A;  4HXV A;  4NWD A;  4NTL A;  3C31 A;  4ISU A;  1IMD A;  3LR1 A;  2XHD A;  1YXI A;  3FV1 A;  3OEL A;  4MNP A;  1BP5 A;  4R74 A;  4OEN A;  4DE8 A;  3CHG A;  4F1Y A;  4MCO A;  2QVV A;  3PUV E;  1B3F A;  5EYH A;  4GWY A;  5IGA A;  4NGU A;  1B3H A;  4OFO A;  4N8G A;  1MXW A;  3DP4 A;  1Y20 A;  4MBP A;  4ELR A;  2ZNS A;  2V3T A;  5A5L A;  5I57 A;  4H46 A;  5F1Q A;  5KCJ A;  1EYK A;  3ILT B;  2A5T B;  3M3L A;  3VXC A;  5I56 A;  1MXZ A;  2W7Y A;  3HN0 A;  2XXX A;  5ESY A;  1INP A;  3JYR A;  3DRI A;  1DPP A;  4FBP A;  3B6W A;  2V84 A;  3T22 A;  4I8C A;  3PPR A;  4MNC A;  5DVJ A;  1TXF A;  4KYD A;  1LAF E;  3K0V A;  3GZG A;  1DBZ A;  1B5J A;  3TUS A;  3O29 A;  3KZG A;  1D9Y A;  2ONS A;  4JB7 A;  1CNQ A;  2OJT A;  5JK4 A;  4JWO A;  1N7W A;  1FPI A;  4POX A;  2Y7P A;  4THI A;  2QL3 A;  4JSO A;  3MPL A;  4BDO A;  1LBZ A;  2AL4 A;  4PAK A;  1TWY A;  4FIM A;  3V5A A;  2OK2 A;  5AA4 B;  3OEK A;  1N04 A;  4RY1 A;  1FPD A;  4OHN A;  2HPG A;  4MF3 A;  1RDY A;  4XEQ A;  3T93 B;  3ECR A;  2GHB A;  4PTK A;  2Y7W A;  5EQA A;  4NE4 A;  4ONY A;  2VD2 A;  2DXR A;  3PAM A;  5CBR A;  2AL5 A;  3OMB A;  1DPE A;  4LA9 A;  5FHO A;  3THI A;  3C35 A;  4ZZA A;  5IZ3 A;  1PBP A;  3EHU A;  1FSA A;  3T1B A;  4ZE8 A;  1FW0 A;  4LQ2 A;  1ZIU A;  3L6G A;  2PBW A;  3SES A;  3O97 A;  4PFT A;  3S9M C;  1MH3 A;  1R9L A;  1ZMG A;  4I3E A;  1AH5 A;  1FPJ A;  4R6K A;  3WAE A;  2O69 A;  5T3J A;  1VFE A;  2QS4 A;  3HHF A;  4KCD A;  4OTE A;  1AL3 A;  3C34 A;  2RIN A;  2A5S A;  1B2H A;  5JTY B;  1SW1 A;  4PQJ A;  1N3W A;  2E1S A;  1HSL A;  2WYP A;  4OXV A;  2D5W A;  2HAV A;  2XD2 A;  2P3V A;  3M3F A;  1A99 A;  4ECF A;  4PGN A;  3B6Q A;  3VVE A;  1XVX A;  1B46 A;  1LLS A;  2AYS A;  1L5T A;  3DLN A;  3QIM A;  1BIY A;  2Z8D A;  4LZ8 A;  4XKP A;  2FIX A;  2VGQ A;  2BJI A;  3H06 B;  1R1N A;  4JDF A;  4XF5 A;  1NV4 A;  3IB1 A;  3PUY E;  4H45 A;  5IM2 A;  1PB7 A;  3VE1 B;  2OCU A;  3R6U A;  1KA1 A;  3K1M A;  2CZK A;  4NED A;  4PP0 A;  1N0T A;  1EYJ A;  4NF4 B;  1MY4 A;  3K6V A;  3OO8 A;  3C9H A;  4OET A;  4GWO A;  1P99 A;  1YAE A;  3PU5 A;  3MW0 A;  4Q30 B;  1YZ0 A;  4ZS9 A;  5FHN A;  1OVT A;  4GFR A;  2HHM A;  4N91 A;  4ND9 A;  1EZ9 A;  3O66 A;  1XI6 A;  2FYI A;  4GVO A;  4KI0 E;  4P11 A;  3O2A A;  5LOM A;  1B40 A;  1B4H A;  3SEY A;  2F8D A;  3LUY A;  4F39 A;  5CMC A;  4YB6 A;  2WBB A;  3UK4 A;  1KA0 A;  3IL1 B;  4JVI A;  3CFX A;  1SW2 A;  4F3P A;  2UVH A;  5DTB A;  3FXB A;  4MH5 A;  3B7D A;  4ZEK A;  3QAX A;  4G68 A;  4RJZ A;  4U2R A;  3G3K A;  2OLB A;  5L8D A;  4DDD A;  5A5X A;  5HPQ A;  3O6I A;  4G8M A;  4DLD A;  4ZEI A;  4LN5 A;  3TDJ A;  3OSR A;  3K1N A;  1MPD A;  3MYU A;  2ANJ A;  1LCT A;  1QJM A;  3OEM A;  3SEV A;  1MQJ A;  4O7M A;  4JWY A;  1URG A;  2PMS A;  4GLI A;  1BTJ A;  2KR0 A;  4XTC Q;  2PFY A;  2ZYM A;  1LST A;  1D4N A;  2QS3 A;  3EHT A;  3UN6 A;  4XKN A;  5LDZ A;  3FJG A;  3ZKL A;  1N3X A;  4WXJ A;  3K6U A;  3TPA A;  4OEV A;  4TQU Q;  2OWT A;  2DSF A;  3TZA A;  1B6H A;  4Q0C A;  3D4C A;  1A55 A;  2H99 A;  1DMB A;  4EXK A;  1FQA A;  1FJ6 A;  4I3Y A;  5A5X B;  4OER A;  3U1O A;  1IEJ A;  5H8F B;  3I5O A;  2E0S A;  2V3Q A;  1QKA A;  4PBQ A;  3PPQ A;  4OWD A;  3RTW B;  1PB8 A;  1P1W A;  1A54 A;  1BK4 A;  1NV0 A;  1IMA A;  2F6G A;  4IO7 A;  4BDN A;  2HFB A;  2F78 A;  2KQZ A;  2PCR A;  2O1M A;  3TTK A;  2CEY A;  3R7X A;  1D9Q A;  5I2N B;  2FA7 A;  1R9Q A;  5DVF A;  1A7L A;  3UP9 A;  5FHM A;  2HCA A;  1YTV A;  5I3S A;  4YMB A;  4XKQ A;  4O3B A;  1MH4 A;  4JVC A;  4OEU A;  3DRH A;  3IR1 A;  2XXW A;  1Q35 A;  5F7V A;  1OQG A;  3CG1 A;  5TP9 A;  4WKM A;  1IXI A;  3W9W A;  1NH7 A;  4GRK A;  3VVF A;  2UXA A;  4PAF A;  4IR8 A;  4N13 A;  4ELQ A;  3VDF A;  3CFL A;  1FTL A;  3N94 A;  2Y84 A;  5I2K A;  1G0I A;  3RPW A;  3H6W A;  1GV8 A;  4PFY A;  4H8J A;  4F3B A;  4ELO A;  2XX9 A;  4I40 A;  4YU0 A;  1B4Z A;  3FXU A;  1O63 A;  2HZL A;  3H4Z A;  4IO5 A;  2O84 X;  2B3B A;  1NL5 A;  1N76 A;  3SEW A;  3O28 A;  1TT1 A;  1Y3N A;  3CIJ A;  3QMF A;  5H8H A;  1Y4T A;  4M4G A;  2H25 A;  1SVX B;  3N6T A;  2QRY A;  5ITO A;  4P56 A;  1NV5 A;  4DI3 D;  3SEX A;  3OXN A;  4GXS B;  1KWH A;  3BKI B;  2V4C A;  3KN8 A;  4H8I A;  3MPK A;  2QSX A;  3USD A;  3VV5 A;  2ZZX A;  2A5T A;  4HS7 A;  3KJT A;  1B7H A;  4FEB A;  2F6P A;  4YKP A;  1TFD A;  3KSX A;  5I2N A;  4FAT A;  4ZEF A;  4QSE A;  1LFG A;  4HCW A;  2M8C A;  2WOL A;  2ABH A;  4YB7 A;  1R6Z A;  1I6B A;  3UIF A;  2F5X A;  4F3S A;  5DVI A;  1H3D A;  1FQC A;  1DCU A;  5CMM A;  5DYH A;  3HCQ A;  1B0H A;  2WX9 A;  3FXQ A;  3SER A;  4QFL A;  2XWO A;  3BFT A;  5CRY A;  3G3I A;  3EF7 A;  2O7I A;  3KN7 A;  5JEI A;  3K00 A;  4H65 A;  4DXC A;  4AQ4 A;  3U72 A;  1QKB A;  4DXB A;  2DDK A;  3TCH A;  5ICT A;  4OVR A;  3TTR A;  3LUZ A;  4OYV A;  3B8B A;  2R9J A;  4KYE A;  2XXV A;  2PFZ A;  2I6E A;  4GWZ A;  4MLQ A;  3Q25 A;  2B4L A;  3N5L A;  2RKM A;  4KD5 A;  1NV3 A;  1B5I A;  3G3H A;  2FBP A;  3PUZ E;  3VXB A;  4L17 A;  1XT8 A;  5ET7 A;  5J16 A;  4POW A;  3HHG A;  1CE2 A;  3IJO B;  5J1D A;  4NF6 B;  1S7Y A;  3U8Q A;  2ZMB A;  1Y9U A;  4G2Z A;  1NFT A;  4GWW A;  2XWI A;  1QUI A;  3QSL A;  3G7W A;  2Q9T A;  3LBS A;  4OMB A;  2I0C A;  3MBP A;  4M1V A;  1BKA A;  4G68 B;  3IOT A;  5EQ8 A;  4LZ5 A;  3ZSF A;  2DOJ A;  1ZBM A;  3TAJ A;  2XWV A;  1FPK A;  1FTM A;  1VSO A;  5DEX B;  2NVU B;  1B3L A;  3TTN A;  1B58 A;  1MPB A;  1IXH A;  3FBP A;  2FHY A;  2GRV A;  2VT5 A;  4IGT A;  4PFW A;  3TQL A;  1QUJ A;  2XXI A;  4FED A;  4IO2 A;  1M5B A;  4Q8R A;  1IXC A;  1GR2 A;  4DXU A;  1MRP A;  1B0L A;  4OQO A;  2UYF A;  5I58 A;  1ZKB A;  1LBX A;  2Q88 A;  5IZZ A;  5I59 A;  1LBW A;  3C4M A;  1NH8 A;  1FQE A;  4GBW A;  1FBG A;  1NV7 A;  1AIV A;  2ALU A;  3MP1 A;  3K02 A;  3KG2 A;  2OBG A;  1H45 A;  4GXA A;  1EU8 A;  1IMC A;  4KR5 A;  4U4S A;  4X1D A;  4C0R A;  1XOC A;  3FGS A;  4G8H A;  4ZE9 A;  2XXP A;  4MJO A;  3U92 A;  1URD A;  1MQD A;  1M5C A;  3CFZ A;  2X7P A;  2F34 A;  1IMF A;  4JBZ A;  3C32 A;  1YCJ A;  1MY0 A;  1EZP A;  3KFM A;  3LVU A;  2H5Y A;  2VOZ A;  3OO9 A;  1NI9 A;  3ROJ A;  3HV1 A;  1JEV A;  4OZ9 A;  1Z7M E;  1QGX A;  5IZ3 B;  1FRP A;  1JEU A;  2IA4 A;  4NWC A;  4UAB A;  4U21 A;  2R6G E;  4PFI A;  4N8Y A;  5ELV A;  3TTL A;  5HBC A;  2B3F A;  4E0X A;  5AA4 A;  2V93 A;  3G3F A;  4OVQ A;  1MXU A;  1FTO A;  2I49 A;  1SQY A;  1H43 A;  1FQF A;  3FXR A;  3E9X A;  4N4U A;  5IAI A;  2G93 A;  1PEB A;  3IJX B;  3IOV A;  4JXI A;  3TEL A;  2OX3 A;  3FV2 A;  2UVJ A;  1XS5 A;  3SET A;  1NV1 A;  4DI4 B;  4UA8 A;  4DIG A;  1B9J A;  2VP1 A;  4N81 A;  3BBR A;  1K9Y A;  3MVX A;  4PFR A;  1NUX A;  4Z0I A;  1FQD A;  5AA2 A;  1M5D A;  3S4U A;  3PUW E;  3H3G A;  4BDM A;  4BDL A;  3FVK A;  3C33 A;  2THI A;  4EQ7 A;  2HZK A;  1OQH A;  4PC9 A;  3HST A;  4YKJ A;  3UOR A;  3IOU A;  3CSG A;  4ZDM A;  2UVI A;  4OES A;  3ISP A;  1US5 A;  1NUZ A;  4OVP A;  2OZZ A;  3IAZ A;  5CM6 A;  4H0W A;  3FUZ A;  2HEU A;  2ZNU A;  1FBD A;  3QYT A;  1LBY A;  5DT6 A;  2F3B A;  4R9F A;  4YIC A;  3T9X B;  3DEL B;  4AS5 A;  4GF8 A;  3BIG A;  3DP6 A;  3H7M A;  4MEV A;  1IZ1 A;  1SW4 A;  2WYK A;  4EQB A;  1Q1K A;  3MVZ A;  5H8N B;  4U1O A;  5B7D A;  3RPL B;  4EXL A;  2QS1 A;  4MIJ A;  1SBP A;  4IY6 A;  3PMX A;  1PDA A;  4F22 A;  4NF0 A;  1EZO A;  2O6A A;  3MWB A;  2B65 A;  2DVC A;  1FPG A;  3PMV A;  4PCD A;  3FAT A;  4E0W A;  3Q28 A;  3MP8 A;  1LEV A;  1JP4 A;  2HXR A;  3F11 A;  1NNP A;  2CZL A;  3ZS6 A;  2NUV A;  4TLL B;  1TFA A;  3IOR A;  1POT A;  3UGW A;  1SI1 A;  1WOD A;  1ZJL A;  1WDN A;  5I57 B;  1S50 A;  2WOK A;  4NF4 A;  5FTH A;  4F2O A;  2Q2A A;  4R72 A;  2UVG A;  1LB8 A;  3V8X B;  1B52 A;  2P2A A;  4PAI A;  2Z8E A;  2NWJ A;  4I9D A;  1FPB A;  2XXK A;  3TMG A;  4OFJ A;  4U1Z A;  5TU0 A;  2DWA A;  2F97 A;  1LFH A;  4NN3 A;  1VDW A;  5FBP A;  4QF9 A;  4F31 B;  1Y4C A;  3MQ9 A;  4P9K A;  4FJP A;  1LGB C;  3EPE A;  1PC3 A;  4PF6 A;  5HM4 B;  4PE3 A;  1RYX A;  5L9M A;  4F2Q A;  3LSX A;  1FPL A;  3DRG A;  3E78 A;  4RK9 A;  4F1U A;  1URS A;  3IOW A;  1UTB B;  4R9G A;  5JTY A;  4P1L A;  5TP9 B;  2DE4 A;  4HE1 A;  2DP8 A;  4HE2 A;  3JZJ A;  4PDD A;  3TOD A;  4H6D A;  4MNI A;  4RYA A;  1LB9 A;  3OO6 A;  3SZP A;  3MJN A;  3RT6 B;  2KLF A;  1MM7 A;  3ZKK A;  3CI8 A;  2HAU A;  4GL0 A;  4BDQ A;  1F9B A;  3RN8 A;  4F19 A;  1K9Z A;  4JWX A;  4H5G A;  4N15 A;  3E3K A;  3L6H A;  5CC2 A;  3DM0 A;  1AOV A;  3DRK A;  2R71 A;  4LP2 B;  1II5 A;  3RQT A;  4RK2 A;  4KPT A;  2GHA A;  1OLC A;  2OWS A;  1BLF A;  4RPO A;  3OOA A;  1RKM A;  1MM6 A;  4DCX A;  5H8F A;  1JVX A;  3E79 A;  4OVJ A;  2DYX A;  3TYH A;  1LAH E;  1MY2 A;  2V25 A;  2RC8 A;  4F18 A;  4C1U A;  2RC9 A;  4PBH A;  4P3L A;  4F3G A;  1B32 A;  3H6T A;  1DK4 A;  2OWZ A;  1N84 A;  4G68 C;  3CSB A;  3IK6 B;  2Z22 A;  3FIR A;  4NX1 A;  2Y7K A;  1D9V A;  4NF5 A;  5I7I A;  1GTK A;  4MMP A;  1I69 A;  1KZ8 A;  1D3K A;  1NV6 A;  3D4G A;  1LBC A;  2PT2 A;  4MFI A;  4LON B;  3T9U A;  4AS4 A;  2DXY A;  4U22 A;  1NV2 A;  1S9T A;  3S2V A;  2XX8 A;  4GX4 A;  3TEP A;  4DZ1 A;  3E4R A;  5H8S A;  3RPL A;  3S9L C;  3TFL A;  5KZT A;  2REJ A;  4GBV A;  4G77 A;  3FTO A;  4GIZ A;  4Z7E A;  5I56 B;  4GD5 A;  4X8R A;  4BDR A;  4HTG A;  4N07 A;  2AIX A;  2FVZ A;  2VHA A;  4X04 A;  5TPA B;  1A8E A;  2XXQ A;  4GL8 A;  1IXG A;  1LAX A;  1SI0 A;  3K4U A;  4IB2 A;  3I6V A;  2XXR A;  3KGC A;  2I3W A;  1ATG A;  4IO6 A;  1N7X A;  3EHS A;  2RCA A;  2Q8J A;  4P47 A;  1GGG A;  4G61 A;  4XIG Q;  1IIT A;  2Q89 A;  1CB6 A;  2QVR A;  3KBZ A;  5EQ9 A;  4KYS A;  2JJK A;  4GWU A;  1YPN A;  3TTM A;  3TKD A;  4KFQ A;  4OFL A;  4HCY A;  4NG7 A;  3M8U A;  4YAH X;  3T96 B;  4LUB A;  3MVY A;  3PPO A;  3EQ1 A;  3PD8 A;  4KXP A;  3KSJ A;  2XWK A;  1USY H;  2WOP A;  4NF5 B;  5ET8 A;  4XFE A;  2G29 A;  1FBH A;  1Y1M A;  1UIV A;  3PGF A;  1FBP A;  2WBD A;  3IFC A;  4IO4 A;  4PE5 B;  1MS7 A;  2ZYN A;  4YKK A;  1HSJ A;  3SKP A;  3S9E A;  1I6A A;  3ILU B;  2P3N A;  2QMW A;  4ZEC A;  4PFB A;  4ZZE A;  3W15 C;  1IME A;  1LCF A;  3K6W A;  4RPN A;  4MAG A;  1IUD A;  1P1N A;  2DE3 A;  5ET6 A;  5KDT A;  2XXU A;  3V89 B;  1NMU A;  4G4P A;  2CZH A;  3GLB A;  3MC2 A;  1GVC A;  4GX3 A;  2NXO A;  1B3G A;  1JW4 A;  3FZV A;  5DEX A;  3FJ7 A;  5I84 A;  4R6H A;  1OIB A;  5I2K B;  2R8T A;  1AMF A;  1NUW A;  2PYY A;  1Y3Q A;  3N6U A;  4QXD A;  1IQ7 A;  3U93 A;  1MQI A;  3IO6 A;  5FTI A;  1MY3 A;  1EH3 A;  1SD3 A;  4QFP A;  5H8Q B;  3RGY A;  3T0J A;  3GBA A;  3GBB A;  4NF6 A;  4PGP A;  2PT1 A;  3AXF A;  3RYB A;  3IB0 A;  2O51 A;  3MP6 A;  3CVG A;  2FNC A;  4MLV A;  4DCY A;  4TOZ A;  3PUX E;  4X48 A;  3KOT A;  3K2D A;  1QUK A;  1MDQ A;  1SYH A;  1A40 A;  1NNF A;  1XVY A;  2HQ0 A;  4X1B A;  3IB2 A;  3H6U A;  1FPF A;  3KN3 A;  3RNN A;  4O94 A;  3LV0 A;  1UTH B;  3PV0 E;  4RA1 A;  1XHY A;  1RYO A;  1YYZ A;  3P7I A;  4NAP A;  3LSW A;  3T66 A;  3HPI A;  4GOT A;  3KC1 A;  5ICQ A;  3V83 A;  2I3V A;  1PB9 A;  4R73 A;  3T9H B;  4QBA A;  4H67 A;  4Q5T A;  4EF1 A;  5KDT B;  3EKI A;  3TCG A;  1POY 1;  4O3C A;  4GWS A;  1H44 A;  4QRZ A;  3K6X A;  1NUY A;  3UA8 A;  3QXM A;  1FQB A;  5L9S A;  4EUO A;  2F7C A;  1SPI A;  3ONM A;  2Y5K A;  1LBV A;  4N6K A;  1WVJ A;  1G0H A;  3BIH A;  2XX7 A;  4H5F A;  1QVS A;  2RF1 A;  1VFD A;  4QFO A;  4KHZ E;  2I0B A;  2F36 A;  1DOT A;  1IIW A;  1XC1 A;  2GFE A;  4IO3 A;  5EHM A;  4ESW A;  1T0K A;  3M3K A;  3DRJ A;  3KEI A;  2REG A;  1B51 A;  3OEN A;  2XXY A;  4OVT A;  4HW8 A;  2QPQ A;  5ISU A;  1FJ9 A;  4TLM B;  2XD3 A;  4FAJ A;  4MX6 A;  3PMW A;  3QUF A;  1B05 A;  5CI5 A;  4ZEB A;  5I5P A;  4BLA A;  1JW1 A;  2L5V A;  4P0I A;  5EQ7 A;  4RXL A;  3KC0 A;  4R2B A;  2Y7I A;  4C1T A;  4YKI A;  1I6Q A;  4RNS A;  2WKY A;  3PPN A;  5AA1 A;  3OD7 A;  2DVZ A;  2YLN A;  1IMB A;  1B1X A;  3LSF B;  4PF8 A;  4P0G A;  2DWI A;  4GX6 A;  2XXT A;  4U23 A;  2F3D A;  3QUJ A;  2DS9 A;  3DRF A;  4O3A A;  4NF8 A;  4PDH A;  1B7Z A;  2BJJ X;  2I4C A;  3GYY A;  5EHS A;  4LQ5 A;  3QK6 A;  3R26 A;  4NQ8 A;  2NOO A;  1O7T A;  1UIU A;  3K1P A;  2VD3 A;  3K01 A;  3A3C A;  2ZZW A;  4EQ9 A;  4WED A;  5EYG A;  4MHF A;  3FJM A;  2D3I A;  1FTJ A;  4EDP A;  2B4M A;  3FVO A;  2ZNT A;  4R2F A;  5CBS A;  3RYD A;  3E13 X;  5B70 A;  1RDX A;  3VLU A;  2ZYO A;  2X7Q A;  2XXH A;  2CZI A;  2IEE A;  5M2V A;  3Q29 A;  5I58 B;  1P1O A;  1NNK A;  1RDZ A;  4PFU A;  1OLA A;  2Q8M A;  1Y1Z A;  2DQV A;  3TCF A;  4JSD A;  3CRB A;  1J1N A;  1B7U A;  4NMY A;  1DTG A;  2CEX A;  3A09 A;  2YJP A;  3H03 A;  2QS2 A;  2Y7R A;  3FVG A;  3SDF A;  1A8F A;  5H8Q A;  3T9V A;  1MPC A;  4H1X A;  2YPN A;  1MQH A;  3FVN A;  3B6T A;  3G3J A;  4R75 A;  3HO7 A;  4FE8 A; 
#chains in the Genus database with same CATH homology
 1USY E;  3S2V A;  5AA3 A;  2XX8 A;  4R6K A;  3WAE A;  1LBB A;  1QW0 A;  3TEP A;  3LSL A;  4DZ1 A;  1QUI A;  3E4R A;  3QSL A;  3G7W A;  5H8S A;  2O69 A;  2Q9T A;  3S9L C;  5I59 B;  1VFE A;  1ZU0 A;  4NF8 B;  3TFL A;  2QS4 A;  3HHF A;  5KZT A;  2P1S A;  2REJ A;  3LBS A;  4KCD A;  4OMB A;  2I0C A;  4QSD A;  3MBP A;  4M1V A;  1BKA A;  4G77 A;  4OTE A;  3FTO A;  4XKR A;  4G68 B;  3O9P A;  3IOT A;  2D21 A;  4GIZ A;  4U4X A;  4Z7E A;  5I56 B;  4GD5 A;  1AL3 A;  2ZMB A;  4LZ5 A;  3C34 A;  2RIN A;  2A5S A;  3ZSF A;  1B2H A;  2DOJ A;  1ZBM A;  5JTY B;  5K2Y A;  3TAJ A;  4HTG A;  4BDR A;  4N07 A;  1SW1 A;  1FTM A;  2AIX A;  4XXU A;  2VHA A;  4PQJ A;  1ZLQ A;  5DVI A;  1N3W A;  1US4 A;  1VSO A;  3VLW A;  5DEX B;  2NVU B;  1B3L A;  4NF5 B;  2E1S A;  1HSL A;  3TTN A;  2F35 A;  1B58 A;  4OXV A;  2D5W A;  1MPB A;  1IXH A;  5TPA B;  1A8E A;  1UTB A;  5TPA A;  3VFJ A;  2HAV A;  2GRV A;  2XD2 A;  2XXQ A;  4GL8 A;  1IXG A;  1LAX A;  1SI0 A;  3M3F A;  3K4U A;  4IB2 A;  1A99 A;  2Z23 A;  4IGT A;  3I6V A;  2XXR A;  4ECF A;  4PFW A;  3FAS A;  3TQL A;  1QUJ A;  2I3W A;  2XXI A;  3B6Q A;  1ATG A;  3KGC A;  4IO6 A;  3VVE A;  5CC2 A;  4FED A;  4IO2 A;  1M5B A;  3VVD A;  2H9B A;  4Q8R A;  1IXC A;  1N7X A;  2F7B A;  1XVX A;  1B46 A;  3EHS A;  1LLS A;  3MZ9 A;  2CMO A;  2RCA A;  1GR2 A;  2X26 A;  5K2X A;  2Q8J A;  1MRP A;  2AYS A;  4DXU A;  1B0L A;  4OQO A;  2UYF A;  1L5T A;  3RT8 A;  5I58 A;  3DLN A;  3QIM A;  1BIY A;  1GGG A;  1ZKB A;  3RUM A;  4XIG Q;  1ELJ A;  2Z8D A;  2Q88 A;  1JVY A;  4AB5 A;  1IIT A;  2Q89 A;  5I59 A;  4LZ8 A;  1CB6 A;  3C4M A;  3MVW A;  1ANF A;  1DTZ A;  1NH8 A;  4XKP A;  5IKB A;  1FQE A;  4KYS A;  2VGQ A;  1AIV A;  1YPN A;  3TTM A;  3H06 B;  2ALU A;  1R1N A;  3MP1 A;  3K02 A;  4JDF A;  2QJE A;  3TKD A;  4KFQ A;  3KG2 A;  4OFL A;  5AA2 B;  2OBG A;  1H45 A;  3Q27 A;  1EU8 A;  4GXA A;  2Q2C A;  3KJ7 A;  1JW5 A;  4FAT A;  2I4B A;  4HCY A;  3IB1 A;  4KR5 A;  4N6P A;  2I58 A;  3PUY E;  2ONK E;  3M8U A;  3I3V A;  4U4S A;  4X1D A;  4YAH X;  3T96 B;  4LUB A;  4YB5 A;  1XOC A;  2DE2 A;  4C0R A;  3MVY A;  1PB7 A;  3FGS A;  4G8H A;  3VE1 B;  4ZE9 A;  2OCU A;  3PPO A;  3R6U A;  4UAC A;  2XXP A;  3EQ1 A;  3PD8 A;  1UQW A;  3KBR A;  3KSJ A;  3K1M A;  1JQF A;  4NED A;  4I62 A;  4KCC A;  4PP0 A;  1N0T A;  3PD9 A;  3U92 A;  1FCK A;  4EF2 A;  1URD A;  1MQD A;  1USY H;  4NF4 B;  2WOP A;  1M5C A;  1MY4 A;  2X7P A;  3CFZ A;  2F34 A;  3K6V A;  4JBZ A;  3C36 A;  3OO8 A;  1M5E A;  3C9H A;  3C32 A;  2G29 A;  3OSQ A;  1YCJ A;  1MY0 A;  4OET A;  4ELP A;  1Y1M A;  4GWO A;  1UIV A;  3WAF A;  5KCJ B;  1EZP A;  3KFM A;  3LVU A;  2H5Y A;  2VOZ A;  3OO9 A;  1P99 A;  3PGF A;  4QHQ A;  3IO4 A;  4IO4 A;  1YAE A;  3MAM A;  4PE5 B;  4QFK A;  1MS7 A;  2ZYN A;  3GXA A;  3PU5 A;  3MW0 A;  3HV1 A;  1DSN A;  4Q30 B;  4YKK A;  1JEV A;  4OZ9 A;  1HSJ A;  1Z7M E;  4G8N A;  1I6A A;  4ZS9 A;  5FHN A;  3LC8 A;  3SKP A;  3S9E A;  5BWJ A;  3BFU A;  1OVT A;  1B3E A;  2O1L A;  1VR5 A;  4GFR A;  1M5F A;  3ILU B;  1JEU A;  3RY3 A;  2IA4 A;  4NWC A;  4U21 A;  2R6G E;  5ELV A;  3TTL A;  4ND9 A;  1EZ9 A;  2B3F A;  2GH9 A;  3O66 A;  5HBC A;  2QMW A;  4E0X A;  4ZEC A;  2FYI A;  1Y3P A;  2DWJ A;  4GVO A;  4KI0 E;  4P11 A;  4ZZE A;  3W15 C;  3O2A A;  5AA4 A;  5LOM A;  3G3G A;  1B40 A;  1B4H A;  1LCF A;  2V93 A;  2F8D A;  3G3F A;  3K6W A;  3LUY A;  4QSC A;  4RPN A;  3SEY A;  4F39 A;  5CMC A;  4YB6 A;  1IUD A;  5I2N A;  1MXU A;  1FTO A;  3UK4 A;  1P1N A;  2DE3 A;  1SW5 A;  3IL1 B;  5KDT A;  2XXU A;  3MZB A;  3CFX A;  1H76 A;  1SW2 A;  3V89 B;  1NMU A;  2UVH A;  1PBQ A;  2I49 A;  1SQY A;  4G4P A;  5DTB A;  4F3P A;  5AE4 A;  1H43 A;  1FQF A;  4MH5 A;  5AA1 A;  3GLB A;  3MC2 A;  3FXR A;  3E9X A;  5H8N A;  1GVC A;  5IAI A;  2O7U A;  3B7D A;  3RYA A;  4ZEK A;  2G93 A;  1PEB A;  3QAX A;  3IJX B;  4G68 A;  4RJZ A;  3IOV A;  2NXO A;  1B3G A;  1JW4 A;  3FZV A;  4JXI A;  4YZZ A;  5DEX A;  4U2R A;  3FJ7 A;  3TEL A;  3RTF B;  1B1H A;  2UYE A;  3G3K A;  5I84 A;  2H4I A;  2OLB A;  5L8D A;  4DDD A;  4QFN A;  4R6H A;  3FV2 A;  1LFI A;  5A5X A;  1OIB A;  5HPQ A;  2UVJ A;  3O6I A;  1XS5 A;  4IY5 A;  5I2K B;  3SET A;  3O6G A;  5L9O A;  4G8M A;  1P1Q A;  1QUL A;  4UA8 A;  1AMF A;  1UTH A;  4ZEI A;  3CG3 A;  4DLD A;  1OVB A;  4DIG A;  1MXX A;  1Y3Q A;  2PYY A;  1JET A;  3N6U A;  1B9J A;  3OSR A;  3TDJ A;  1IQ7 A;  3K1N A;  4X9T A;  2LAO A;  2VP1 A;  1B5H A;  1MPD A;  3BBR A;  3U93 A;  2ANJ A;  1LCT A;  1MQI A;  3IO6 A;  1MG1 A;  5CMB A;  3TQW A;  1QJM A;  5FTI A;  1MY3 A;  3VLV A;  3OEM A;  1O64 A;  3SEV A;  1EH3 A;  1SD3 A;  5CMK A;  4QFP A;  3MVX A;  1MQJ A;  5H8Q B;  3RGY A;  4JWY A;  2ZXT A;  1URG A;  1Z7N E;  4PET A;  2PMS A;  4Z0I A;  3RLF E;  4ESX A;  3GBA A;  1ZTY A;  1FQD A;  3GBB A;  1M5D A;  4GLI A;  4NF6 A;  3S4U A;  1BTJ A;  3PUW E;  1SYI A;  5AA2 A;  3H3G A;  4BDM A;  2PT1 A;  3FVK A;  4BDL A;  3AXF A;  3RYB A;  2THI A;  2HZK A;  3C33 A;  3IB0 A;  4XTC Q;  1OQH A;  4EQ7 A;  2O51 A;  3MP6 A;  3CVG A;  2ZYM A;  1NNT A;  2FNC A;  3HST A;  4MLV A;  1MY1 A;  2PVU A;  1LST A;  4YKJ A;  4DCY A;  4TOZ A;  3PUX E;  4X48 A;  3UOR A;  3S9N C;  3IOU A;  3KOS A;  3KOT A;  1D4N A;  1HSE A;  2QS3 A;  3CSG A;  2HXW A;  3K2D A;  1QUK A;  4ZDM A;  3EHT A;  1MDQ A;  2ESN A;  1SYH A;  2UVI A;  4OES A;  1A40 A;  3UN6 A;  4XKN A;  1NNF A;  3H6V A;  1NKX A;  1XVY A;  2HQ0 A;  3FD3 A;  2ZYK A;  3FJG A;  1US5 A;  2DWH A;  3U94 A;  4X1B A;  3ZKL A;  2OZZ A;  3IB2 A;  1N3X A;  3IAZ A;  4WXJ A;  4H0W A;  3FUZ A;  3TPA A;  4OEV A;  2HEU A;  3K6U A;  3MUQ A;  4TQU Q;  2P0S A;  2OWT A;  2ZNU A;  3H6U A;  2F7A A;  3DP8 A;  2DSF A;  2ONR A;  3JV9 A;  3KN3 A;  1B6H A;  3O6H A;  5H8H B;  3RNN A;  3O6P A;  3TZA A;  2QMX A;  4Q0C A;  3QYT A;  1UTH B;  3IX1 A;  3D4C A;  3PV0 E;  4RA1 A;  4R6Y A;  4IGR A;  5DT6 A;  3W9V A;  1XHY A;  1A55 A;  1RYO A;  2H99 A;  1OMP A;  1DMB A;  2H98 A;  4R9F A;  4GQO A;  1FQA A;  3DEL B;  3EN3 A;  3P7I A;  4YIC A;  3T9X B;  2I48 A;  4EXK A;  5A5X B;  4GF8 A;  4OER A;  3A3U A;  3LSW A;  3DP6 A;  3T66 A;  3U1O A;  1IEJ A;  2Z8F A;  3H7M A;  3HPI A;  4GOT A;  1IZ1 A;  5ICQ A;  1SW4 A;  4KQP A;  5H8F B;  3I5O A;  1SDX A;  4EQB A;  3CR9 A;  2I3V A;  3V83 A;  1Q1K A;  3MVZ A;  1PB9 A;  2E0S A;  4R73 A;  3T9H B;  5H8N B;  1LAG E;  2PX1 A;  2V3Q A;  1QKA A;  4U1O A;  4WEP A;  5B7D A;  4H67 A;  1MXV A;  4Q5T A;  4EF1 A;  4EXL A;  2QS1 A;  3PPQ A;  4OWD A;  1SBP A;  3RTW B;  1PB8 A;  1P1W A;  4IY6 A;  4YMA A;  1A54 A;  3TCG A;  5KDT B;  3PMX A;  2F6G A;  1POY 1;  2V3U A;  5BUU A;  2RC7 A;  1PDA A;  4O3C A;  4FOR A;  4F22 A;  1H44 A;  3MZ1 A;  4IO7 A;  4BDN A;  4QRZ A;  2HFB A;  2F78 A;  3K6X A;  4FEC A;  1EZO A;  2O6A A;  3MWB A;  2O1M A;  3UA8 A;  4F29 A;  3TTK A;  3R7X A;  2B65 A;  2DVC A;  1MXY A;  2FA7 A;  4K3F A;  4AB6 A;  5I2N B;  1JNF A;  3QXM A;  1MDP 1;  1R9Q A;  3PMV A;  1VE4 A;  3PPP A;  5DVF A;  1A7L A;  1FQB A;  4F1V A;  3FAT A;  4E0W A;  5L9S A;  4EUO A;  3Q28 A;  3MP8 A;  2F7C A;  3ONM A;  3UP9 A;  3Q26 A;  3SEU A;  3F11 A;  1NNP A;  5FHM A;  1P1U A;  1WVJ A;  2HCA A;  1YTV A;  2CZL A;  3ZS6 A;  2NUV A;  2XX7 A;  4TLL B;  4LAT A;  4XKQ A;  1TFA A;  4YMB A;  1FTK A;  1POT A;  3IOR A;  4O3B A;  3UGW A;  1MH4 A;  1SI1 A;  1WOD A;  1QVS A;  1ZJL A;  4H5F A;  2RF1 A;  1VFD A;  1WDN A;  4OEU A;  5I57 B;  3DRH A;  3IR1 A;  1MQG A;  2XXW A;  1Q35 A;  4QFO A;  4I1D A;  4KHZ E;  2I0B A;  5F7V A;  2F36 A;  1S50 A;  5AA2 D;  1OQG A;  1DOT A;  1IIW A;  3CG1 A;  2WOK A;  4LZ7 A;  1XC1 A;  2O68 A;  2GFE A;  4NF4 A;  5FTH A;  4F2O A;  5TP9 A;  2Q2A A;  4IO3 A;  1IXI A;  2UVG A;  4R72 A;  4WKM A;  5EHM A;  1LB8 A;  1NH7 A;  3W9W A;  4ESW A;  1T0K A;  4GRK A;  3M3K A;  3V8X B;  1B52 A;  2P2A A;  3VVF A;  2UXA A;  2Z8E A;  2NWJ A;  4I9D A;  5ITP A;  3DRJ A;  3KEI A;  2RCB A;  4N13 A;  2REG A;  3OO7 A;  3TMG A;  4ELQ A;  4OFJ A;  1B51 A;  3OEN A;  3VDF A;  1AH5 A;  3CFL A;  4U1Z A;  5TU0 A;  2DWA A;  2F97 A;  1LFH A;  1FTL A;  2XXY A;  4HW8 A;  3ODB A;  3N94 A;  4ZED A;  2Y84 A;  3N26 A;  4LVQ A;  2QPQ A;  5I2K A;  4NWD A;  5ISU A;  3RPW A;  3H6W A;  4NTL A;  4TLM B;  1GV8 A;  2XD3 A;  3C31 A;  4ISU A;  4PFY A;  4QF9 A;  4FAJ A;  4F31 B;  4H8J A;  4F3B A;  1Y4C A;  3PMW A;  3LR1 A;  4ELO A;  2XHD A;  3QUF A;  1B05 A;  5CI5 A;  4ZEB A;  3MQ9 A;  2XX9 A;  3FV1 A;  4BLA A;  4FJP A;  1JW1 A;  1LGB C;  4YU0 A;  3OEL A;  1B4Z A;  4P0I A;  3FXU A;  3EPE A;  1O63 A;  1PC3 A;  4RXL A;  5HM4 B;  4R2B A;  1RYX A;  1BP5 A;  2HZL A;  2Y7I A;  4R74 A;  5L9M A;  3H4Z A;  4IO5 A;  4C1T A;  2O84 X;  4OEN A;  4YKI A;  1I6Q A;  3CHG A;  4RNS A;  4DE8 A;  4F2Q A;  2WKY A;  4F1Y A;  2B3B A;  3LSX A;  3DRG A;  3PUV E;  1B3F A;  1NL5 A;  4RK9 A;  4F1U A;  1URS A;  1N76 A;  3SEW A;  3O28 A;  3IOW A;  1TT1 A;  1B3H A;  4OFO A;  1UTB B;  1Y3N A;  3CIJ A;  5H8H A;  1Y4T A;  4M4G A;  1MXW A;  2H25 A;  3DP4 A;  3PPN A;  1Y20 A;  3OD7 A;  1SVX B;  4MBP A;  3N6T A;  2DVZ A;  2QRY A;  5ITO A;  2YLN A;  4ELR A;  2ZNS A;  2V3T A;  1B1X A;  3LSF B;  5H8F A;  3SEX A;  4P0G A;  4R9G A;  3OXN A;  2DWI A;  4GXS B;  1KWH A;  5F1Q A;  5I57 A;  5KCJ A;  5JTY A;  2XXT A;  3BKI B;  4U23 A;  3ILT B;  3KN8 A;  4H8I A;  3MPK A;  2A5T B;  2QSX A;  3QUJ A;  2DE4 A;  3M3L A;  2DS9 A;  5TP9 B;  3USD A;  3VV5 A;  2DP8 A;  1MXZ A;  2W7Y A;  3HN0 A;  3VXC A;  5I56 A;  2A5T A;  4HS7 A;  3JZJ A;  2XXX A;  3DRF A;  3TOD A;  3KJT A;  4O3A A;  4H6D A;  3JYR A;  3DRI A;  1B7H A;  1DPP A;  2F6P A;  4FEB A;  4NF8 A;  4RYA A;  4YKP A;  1B7Z A;  1LB9 A;  1TFD A;  3KSX A;  3MJN A;  3OO6 A;  3RT6 B;  2KLF A;  3B6W A;  1MM7 A;  3ZKK A;  2BJJ X;  2V84 A;  4I8C A;  3CI8 A;  4ZEF A;  3PPR A;  2HAU A;  4GL0 A;  3T22 A;  4BDQ A;  2I4C A;  5EHS A;  4QSE A;  5DVJ A;  1F9B A;  1LFG A;  4HCW A;  1TXF A;  2M8C A;  4KYD A;  2WOL A;  1LAF E;  2ABH A;  3K0V A;  3QK6 A;  3R26 A;  4LQ5 A;  4YB7 A;  1R6Z A;  3GZG A;  3RN8 A;  4F19 A;  2NOO A;  5CM6 A;  1O7T A;  4JWX A;  1I6B A;  1B5J A;  3UIF A;  2F5X A;  4F3S A;  4H5G A;  3O29 A;  3KZG A;  1D9Y A;  3TUS A;  1UIU A;  3K1P A;  2VD3 A;  2ONS A;  3E3K A;  2OJT A;  3A3C A;  3K01 A;  3L6H A;  4WED A;  4JB7 A;  3DM0 A;  4U22 A;  1H3D A;  4EQ9 A;  1AOV A;  5JK4 A;  4JWO A;  3DRK A;  1FQC A;  3FJM A;  2D3I A;  1N7W A;  1FTJ A;  5CMM A;  2R71 A;  3HCQ A;  5DYH A;  2B4M A;  4LP2 B;  4EDP A;  1B0H A;  4POX A;  3FVO A;  1II5 A;  2Y7P A;  2ZNT A;  4THI A;  2QL3 A;  3FXQ A;  4R2F A;  3RQT A;  4QFL A;  4RK2 A;  3SER A;  5CBS A;  4KPT A;  4JSO A;  2GHA A;  5EYF A;  1OLC A;  3MPL A;  4BDO A;  3BFT A;  2AL4 A;  2OWS A;  5CRY A;  1TWY A;  1BLF A;  3E13 X;  4FIM A;  4RPO A;  3V5A A;  5B70 A;  3VLU A;  3OOA A;  1RKM A;  2ZYO A;  1MM6 A;  4DCX A;  2X7Q A;  2OK2 A;  2XXH A;  3OEK A;  5AA4 B;  1N04 A;  2IEE A;  1JVX A;  3G3I A;  3Q29 A;  1P1O A;  4RY1 A;  5M2V A;  5I58 B;  3EF7 A;  4OHN A;  4MF3 A;  4OVJ A;  3T93 B;  2O7I A;  3KN7 A;  3ECR A;  2DYX A;  1NNK A;  3TYH A;  3K00 A;  5JEI A;  1LAH E;  2GHB A;  2Y7W A;  4H65 A;  4DXC A;  1MY2 A;  2V25 A;  2RC8 A;  4AQ4 A;  3U72 A;  4F18 A;  1QKB A;  4C1U A;  2RC9 A;  4DXB A;  4PFU A;  4ONY A;  3TCH A;  1OLA A;  4NE4 A;  5ICT A;  3TTR A;  4OYV A;  1Y1Z A;  2R9J A;  4F3G A;  1B32 A;  2VD2 A;  4KYE A;  2DQV A;  2DXR A;  3H6T A;  3PAM A;  3TCF A;  1N84 A;  2AL5 A;  2XXV A;  4G68 C;  5CBR A;  3OMB A;  1DPE A;  4LA9 A;  5FHO A;  4JSD A;  3THI A;  2I6E A;  3CSB A;  1J1N A;  3CRB A;  3IK6 B;  4MLQ A;  3Q25 A;  2B4L A;  1B7U A;  2Z22 A;  3N5L A;  3FIR A;  3C35 A;  4ZZA A;  4NMY A;  2RKM A;  2Y7K A;  1DTG A;  1D9V A;  4KD5 A;  3A09 A;  1PBP A;  4NF5 A;  3EHU A;  1B5I A;  2YJP A;  1GTK A;  3G3H A;  3H03 A;  2QS2 A;  2Y7R A;  1I69 A;  3FVG A;  4ZE8 A;  3SDF A;  3PUZ E;  1A8F A;  1FW0 A;  4LQ2 A;  1D3K A;  1ZIU A;  4L17 A;  1XT8 A;  3VXB A;  5H8Q A;  3T9V A;  1MPC A;  3D4G A;  3L6G A;  4H1X A;  2PBW A;  3SES A;  2YPN A;  3O97 A;  1MQH A;  3FVN A;  4POW A;  1LBC A;  3B6T A;  3G3J A;  1CE2 A;  3HHG A;  3IJO B;  4R75 A;  5J1D A;  2PT2 A;  4MFI A;  4PFT A;  3HO7 A;  4LON B;  4NF6 B;  3T9U A;  3S9M C;  4FE8 A;  1S7Y A;  1MH3 A;  3U8Q A;  1R9L A;  1Y9U A;  1ZMG A;  2DXY A;  4G2Z A;  1S9T A;  1NFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...