1ZU0A

Crystal structure of the liganded chitin oligasaccharide binding protein
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
529
structure length
529
Chain Sequence
RSELTIVPDFYPTMVRNFNPYLATNLRTTTDFIYEPLVVFNEMKGNTPVFRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRFRLSEANSNVPYEISLIPIVAEHVWKDVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQLLGKIVNSELDWTSSFVPDIDRTYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKKEALDNVDFRRAFSMALDRQTIIDIAFYGSGTVNDFASGLGYAFEAWSDEATHKKYKGFNTYDVEGSKKLLAKAGFKDVNGDGFVETPSGKSFELLIQSPNGWTDFNNTVQLAVEQLQEVGIKAKARTPEFAVYNQAMLEGTYDVAYTNYFHGADPFTYWNSGYNSALQSGDGMPRFAMHYFTDKKLDGLLDSFYKTADKNEQLAIAHGIQKIIAENQVTIPVMSGAWMYQYNTTRFTGWWSEENPKGRPSVWAGIPERLLHVLDLKPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein, signaling protein
molecule keywords Chitin Oligosaccharide Binding Protein
publication title Crystal structure of the liganded and unliganded periplasmic chitin oligosaccharide binding protein
rcsb
source organism Vibrio cholerae
total genus 168
structure length 529
sequence length 529
ec nomenclature
pdb deposition date 2005-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1zu0A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1zu0A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1zu0A02
4DIGA 1TWYA 5DEXB 1JW4A 1JQFA 4EF2A 3RN8A 2HAUA 3FIRA 2O6AA 1AH5A 4GWOA 4MFIA 1KWHA 2HQ0A 3FV2A 3Q25A 1URGA 3IX1A 5H8FB 2I3VA 5B70A 5KDTB 4G77A 4LQ2A 2QS1A 2IEEA 3H4ZA 1GV8A 4KD5A 5ISUA 2OBGA 2P1SA 2UVGA 4HCYA 4JWYA 2WOKA 3E9XA 4Q0CA 1P1QA 3CFZA 3SESA 4BDQA 3JYRA 2WKYA 3TODA 1DPPA 2PBWA 4GIZA 3OEMA 2DWIA 3O97A 5TPAB 3KJTA 1JVXA 1FCKA 3ILTB 3T9VA 2QS3A 3RY3A 3VDFA 4GD5A 2DOJA 2R6GE 3HPIA 2ZMBA 4H5GA 3SDFA 4F3PA 5I2KA 2HZKA 4X9TA 5AA2A 4LONB 2VOZA 3M8UA 3FVKA 4PETA 4R75A 4IO6A 5IKBA 3JZJA 5FTIA 3WAEA 2Z8DA 3OD7A 2XXTA 5BWJA 1P1NA 3V83A 5IAIA 3S2VA 2ZYOA 2GFEA 5JTYA 1PB8A 4G2ZA 3DRHA 4NMYA 4AB6A 3USDA 5I58A 4Z7EA 1MXZA 3TELA 1POY1 2RKMA 2O84X 1P99A 1JETA 1UQWA 3U1OA 3U8QA 2VD2A 3U92A 2B3FA 4ZS9A 1Y20A 3DP4A 2DQVA 1LFHA 3PMXA 3OO8A 2HFBA 2LAOA 3Q28A 4GXAA 1Q1KA 1YCJA 3C36A 1Y4CA 1IUDA 1A7LA 2XXRA 1JEUA 1IQ7A 3H06B 4WEPA 2XXQA 3IORA 4YMBA 3PD8A 1B0HA 3ZKKA 1MXYA 3EPEA 2I4BA 3ILUB 1LFGA 3OSRA 4U4XA 3KSXA 5A5XA 4YMAA 5TP9A 1MQDA 4QRZA 1Y3NA 2OWSA 1UTHB 1Y1MA 3K1MA 1OIBA 1AMFA 3O9PA 5I59B 2B4LA 1N7XA 1NNTA 4YICA 2A5SA 1US4A 1FTJA 3O66A 1DSNA 5FHOA 2VHAA 2A5TB 5CM6A 3T93B 4H6DA 3V5AA 3KBRA 1R9LA 1S9TA 3LSWA 1DPEA 2H25A 2DWHA 1O64A 4BDMA 3PGFA 1XVXA 3H03A 4NEDA 1II5A 3CG1A 5JEIA 2FA7A 4QSCA 3QUJA 1MPDA 4I9DA 2ZNTA 4ZEDA 1LBCA 2V3TA 2DXYA 1B1HA 1EZOA 2UVJA 4QFKA 3T22A 2DE3A 4EQ7A 3QYTA 1B5IA 3FATA 1O7TA 1XT8A 5AA3A 4AB5A 3CFLA 4JSOA 3QXMA 4ONYA 2O69A 4UACA 3TCGA 4DXUA 3LSFB 4FE8A 4L17A 2ONKE 1LB8A 2ONRA 4C0RA 2PMSA 4RJZA 3C9HA 1RKMA 3CFXA 4F18A 3IOWA 2OZZA 4KYSA 3TTKA 3DP8A 3KFMA 3KG2A 4BDOA 3IB2A 4NTLA 3CI8A 3SEXA 3BFUA 2XX9A 3FVGA 4IO2A 4OEVA 4GOTA 1B2HA 3R7XA 2THIA 1MQHA 4POWA 3P7IA 1IZ1A 4ZZAA 5H8HB 4ZEFA 5HPQA 3CSBA 4F19A 1SYHA 1N0TA 4QFNA 3F11A 3RTFB 4IO5A 1SW1A 3IOUA 1B3EA 4ECFA 1LCFA 1YTVA 1LSTA 4IGTA 4XTCQ 3I6VA 5AA1A 4X1BA 5H8QB 4R6KA 3GZGA 1MY0A 4NF4B 4E0WA 1DTGA 3H6TA 2FYIA 2ZXTA 4G8HA 3V8XB 2GH9A 5AA4A 3N94A 2ONSA 2HZLA 4DZ1A 2XX8A 4LZ8A 2NVUB 4F22A 4R74A 4IO3A 4RK9A 1WODA 3K00A 4OETA 1Y3QA 3LR1A 3OO9A 4H8IA 5CI5A 3S4UA 3QAXA 3PPQA 4RA1A 5ITPA 3THIA 1QJMA 4JSDA 2RCBA 1EH3A 4I1DA 3RGYA 4JWXA 3G7WA 1S50A 3RT8A 3MC2A 1I6AA 4F2QA 3DM0A 3TQLA 4ESXA 5KCJB 3UP9A 4IY6A 4XIGQ 4O3CA 2ZYMA 1B4HA 2X7QA 4TLLB 3VVEA 3VVDA 4RXLA 4PQJA 2F78A 1Q35A 1B9JA 4ZDMA 4ELRA 3TPAA 2O1LA 3E3KA 3AXFA 1MY3A 4OENA 3VE1B 1MH4A 3MVXA 3E13X 1SVXB 3HHGA 4GQOA 1USYH 4EUOA 3S9NC 3OSQA 1ZLQA 1BKAA 4NF6B 4WKMA 1NNKA 1R6ZA 3RT6B 1BP5A 1A8EA 1WVJA 5I56B 4DXBA 4MBPA 1H43A 5AA2D 3G3JA 1PDAA 2XXUA 4ZECA 4GF8A 5CMCA 3UIFA 3DRJA 2HCAA 3SKPA 5I2NA 4WXJA 1M5BA 3S9LC 3JV9A 2X26A 1OLCA 4Q8RA 1POTA 4R73A 2XXIA 2UVIA 1B46A 3M3FA 4QHQA 4PFTA 1R1NA 4OZ9A 1H3DA 4JWOA 1GR2A 3FXQA 1GTKA 3T66A 4FJPA 2DP8A 1B7UA 4MH5A 2V25A 4LA9A 4ELPA 1UIUA 4G68A 2QPQA 1RYXA 5F1QA 1VE4A 4O3BA 4F2OA 4NF5B 3D4GA 2HXWA 3CRBA 3M3KA 1XC1A 2ESNA 3PUVE 3TYHA 2QJEA 1D3KA 3UA8A 4R6HA 3TDJA 3DRIA 1P1UA 4GVOA 3ZS6A 3TTRA 3K02A 3GXAA 3TEPA 2VD3A 4P11A 3IO4A 1A40A 4U22A 5CRYA 2X7PA 5L8DA 1URDA 4LZ5A 3TKDA 2NXOA 5I57B 1VR5A 3H6UA 3IO6A 2ZYKA 4H67A 4P0IA 3HV1A 3KOTA 1QVSA 4YAHX 4BLAA 2UXAA 4R9GA 4F3BA 2D5WA 4F1VA 1R9QA 1TT1A 1MPBA 2Y7IA 3UN6A 4KYDA 4ZEKA 3IOVA 3O6PA 4JDFA 4F31B 2XXYA 3IAZA 4NF8A 4PFUA 4HS7A 3RYAA 3H6VA 3VLVA 2H9BA 4OERA 1VFEA 1FQAA 3OMBA 2AYSA 3PPRA 3R26A 2REGA 5H8NB 3SEYA 4YKIA 3T9XB 2I4CA 1SBPA 4IY5A 3IJXB 2AL4A 1Z7ME 2QMXA 1AL3A 3HHFA 1MXUA 2DVCA 1B7ZA 3OENA 4C1TA 4PP0A 4PFYA 1I6QA 1MY4A 3T9HB 3O6IA 5FTHA 4X1DA 1FQDA 1QW0A 2AL5A 2QL3A 4EF1A 2H4IA 3MVWA 2OCUA 3T96B 3TTLA 2ZNUA 2F6GA 3KOSA 2M8CA 4YKKA 1H76A 4LVQA 3QIMA 1IITA 3RNNA 5DVJA 2QSXA 3LUYA 3UK4A 3O28A 1IXHA 5J1DA 4F3GA 3TCHA 3C34A 1ZJLA 4NF4A 2Z23A 2AIXA 1DMBA 3H6WA 5CBSA 5B7DA 3N26A 1FQFA 3VVFA 1GGGA 3DRKA 1ZMGA 2UYFA 4U1OA 4QFLA 3TTMA 3MWBA 4YB5A 1S7YA 4OMBA 3FXUA 4OVJA 4ELOA 4OFJA 3C31A 1MXXA 3C35A 3K6VA 3H7MA 4DDDA 1YPNA 3PPPA 4BDLA 3EF7A 2I49A 3BFTA 1MQJA 3PMVA 4Q5TA 2H5YA 3RTWB 1HSJA 4KCCA 3VFJA 1B0LA 3OEKA 3W9VA 3VLUA 1TXFA 4U1ZA 3U72A 4M1VA 3MP6A 5EYFA 3IOTA 4YB7A 2G93A 4OYVA 1DOTA 5L9MA 3FVOA 3K6XA 4G4PA 5HM4B 3TAJA 1B51A 1FTKA 3PUWE 5K2XA 5CMBA 3W9WA 1DTZA 1UTBA 1MM6A 3UGWA 4KI0E 1NH8A 3G3KA 4ISUA 1N04A 1B32A 3PPOA 4F1YA 1JEVA 5I2KB 5AA2B 1JW5A 3IK6B 3K4UA 2NUVA 5BUUA 4KQPA 1MXVA 1NMUA 1NKXA 2F36A 2FNCA 2GHBA 3EHTA 2Z22A 1ZTYA 4OQOA 4NF6A 3S9MC 3IL1B 4HTGA 3MP1A 4GL0A 1IIWA 4JB7A 4ZEBA 5I58B 4XXUA 1SW4A 3UORA 5I56A 3PUXE 4N13A 4TLMB 5EHMA 4DXCA 4LP2B 3SETA 1J1NA 4OWDA 2D3IA 5KZTA 1A55A 4I62A 2XXHA 1Z7NE 3K1NA 3E4RA 3PV0E 2RC8A 4UA8A 2YLNA 1M5DA 1M5EA 4OESA 1CB6A 3ZSFA 4PFWA 1PBQA 4LZ7A 4FATA 1MY1A 3B6TA 3LVUA 4GXSB 3K6UA 5DEXA 3MBPA 3G3IA 1NL5A 4OFLA 1A8FA 4GRKA 1PB7A 4XKPA 1QUKA 2GRVA 5H8FA 1D4NA 1B3HA 5KDTA 1MH3A 5A5XB 3MAMA 1SDXA 2OLBA 5TP9B 3SEVA 2O7IA 1ZKBA 4QSDA 2XXXA 3TZAA 2WOLA 5DVFA 2PYYA 4MLVA 2XXWA 4FEDA 4IO4A 4YB6A 4GFRA 2Y7RA 4E0XA 3H3GA 3O29A 2I48A 4OEUA 3Q26A 3VLWA 2B65A 2PT1A 3FGSA 1B3FA 1P1WA 2Y84A 2V93A 3PD9A 5TPAA 2XXVA 3CG3A 1SQYA 3KSJA 3ECRA 4ZE9A 1FTLA 1LGBC 2RCAA 1OQGA 2F34A 4EQ9A 4DE8A 1QUIA 3FZVA 4N07A 3MZBA 2VGQA 3OOAA 3TUSA 2R9JA 4R72A 3U93A 1XVYA 5L9SA 2RF1A 1XS5A 5M2VA 3RLFE 3EHUA 4ND9A 4KR5A 4U4SA 4YU0A 3I5OA 1MQGA 1M5CA 1CE2A 3PPNA 2HAVA 4RK2A 4FECA 5I84A 1IXGA 4NE4A 2ZNSA 1PEBA 4OXVA 4F29A 4R6YA 2O68A 4RNSA 4XKQA 2DSFA 3KN8A 1IEJA 1JNFA 2O51A 5LOMA 4JBZA 1ZIUA 1N7WA 3G3FA 1EZ9A 1US5A 5FHMA 1H45A 3L6GA 1SI1A 2Y7PA 1A99A 2NOOA 1B5HA 3LSLA 3FXRA 2V3UA 1Y3PA 3EN3A 2XD3A 2QMWA 5HBCA 1MS7A 2DWJA 4FEBA 4Z0IA 2DWAA 4YKJA 4RPOA 1A54A 2G29A 4OHNA 1FTMA 4C1UA 1VSOA 4NWCA 3MP8A 1PC3A 4POXA 1IXCA 1QKBA 1UTHA 3FJGA 1B1XA 3KGCA 5ITOA 3DRGA 2XHDA 4PE5B 2IA4A 5I59A 3O6HA 5AE4A 1MRPA 3IB1A 2I0CA 3IR1A 4MLQA 3PU5A 2ZYNA 2UYEA 1TFDA 2A5TA 2BJJX 3Q27A 5AA4B 3D4CA 3RUMA 4NWDA 1ZBMA 3OXNA 1B6HA 2Q2CA 2Q89A 2Q9TA 5L9OA 3QSLA 1LBBA 3IJOB 3QUFA 3FASA 2RINA 3OO6A 4FAJA 3ZKLA 1WDNA 2PX1A 3PAMA 4THIA 1N84A 2RC7A 5K2YA 2ALUA 1FQBA 1MG1A 4R9FA 1NNFA 2Q8JA 2QS4A 5JK4A 4BDRA 4TQUQ 3TMGA 4QFPA 4KYEA 1HSLA 4IB2A 3MZ9A 1D9YA 5EHSA 4LATA 5DVIA 4GLIA 1EZPA 2XX7A 3ODBA 2ANJA 1B3GA 1PBPA 1B3LA 3RQTA 3EQ1A 4G8MA 4ZE8A 1NFTA 4H0WA 1LB9A 2F7BA 2ABHA 3FVNA 1QUJA 4OFOA 2I3WA 4X48A 4DLDA 1B5JA 1URSA 1MDP1 1IXIA 1M5FA 3N5LA 2V3QA 1OLAA 2RC9A 1O63A 3T9UA 3ONMA 3A09A 1ANFA 3B7DA 1N3WA 3SEWA 2PVUA 4OTEA 5H8HA 2V84A 2GHAA 2DXRA 1F9BA 3B6QA 3GBAA 5CMKA 1Y1ZA 2UVHA 3K2DA 3R6UA 5I2NB 3FJMA 1VFDA 1AOVA 3VV5A 3LBSA 3OELA 1AIVA 3Q29A 3U94A 5H8QA 4WEDA 4H1XA 1T0KA 2KLFA 3A3UA 3GBBA 5F7VA 4YZZA 2W7YA 2DYXA 3MZ1A 1BTJA 4RYAA 3A3CA 2OK2A 3PUZE 4G68B 4BDNA 3DLNA 2E1SA 2I6EA 2DE2A 1B4ZA 1B52A 4G8NA 3K01A 4RY1A 2WOPA 4EDPA 5CBRA 2R71A 2F7CA 2NWJA 4P0GA 3RPWA 1XHYA 2E0SA 3VXBA 1I69A 1NH7A 1JVYA 2H99A 1NNPA 2O1MA 4LUBA 1MDQA 1FW0A 3DP6A 5ELVA 4RPNA 5DTBA 1Y9UA 4EXLA 2CZLA 3M3LA 4YKPA 4H5FA 3KN7A 4M4GA 5DYHA 1EU8A 3MPKA 5KCJA 1ATGA 4EXKA 1P1OA 3HCQA 3PUYE 2QS2A 1OVBA 4GL8A 3FTOA 4KHZE 2YJPA 3O2AA 3MVZA 2F6PA 2YPNA 4H65A 3DRFA 1YAEA 1JW1A 4K3FA 3PMWA 3B6WA 3FJ7A 3CSGA 5JTYB 1LAHE 1SW5A 2F97A 4ZEIA 4NF8B 1OMPA 2Y7KA 2H98A 2Q2AA 4KCDA 5ICTA 3S9EA 4R2BA 1PB9A 4ELQA 4R2FA 2D21A 2O7UA 4IGRA 1XOCA 2P0SA 2XXPA 3MPLA 4AQ4A 3CR9A 1RYOA 3HSTA 4H8JA 3KZGA 3OO7A 3TTNA 1USYE 5CMMA 2F8DA 1MQIA 5DT6A 1MPCA 2P2AA 3K1PA 3N6TA 3K0VA 1B40A 2B4MA 3CIJA 1SW2A 4XKRA 4IO7A 1QKAA 3MVYA 3L6HA 4G68C 1Y4TA 3BBRA 2HEUA 4XKNA 3KJ7A 1LAGE 4QF9A 3LSXA 3QK6A 3TQWA 2F7AA 2I0BA 1OQHA 4NF5A 4F39A 4TOZA 3HN0A 1LAXA 3TCFA 1MY2A 2Q88A 4F3SA 3IB0A 3C33A 2Z8FA 3C4MA 3HO7A 3I3VA 4U21A 1N3XA 1QULA 2F35A 3TFLA 1ELJA 3MJNA 1HSEA 3WAFA 3W15C 1FTOA 4QFOA 4JXIA 2DVZA 2OWTA 5ICQA 1SI0A 4EQBA 2VP1A 3BKIB 5I57A 2QRYA 5FHNA 4HCWA 2Z8EA 1LFIA 2B3BA 4U2RA 3RYBA 3MUQA 1SYIA 1N76A 4LQ5A 1MM7A 4FORA 1BIYA 2DE4A 4ESWA 2REJA 1FQEA 2Y7WA 1SD3A 1OVTA 4Q30B 3LC8A 4U23A 2CMOA 1UTBB 1B7HA 3SERA 3CHGA 2XD2A 3V89B 3GLBA 3C32A 1MXWA 4DCXA 3VXCA 1L5TA 5TU0A 1LAFE 3CVGA 3MQ9A 4MF3A 2DS9A 5H8NA 1D9VA 3KN3A 4HW8A 1LLSA 1BLFA 3MW0A 3N6UA 1TFAA 1ZU0A 1B58A 4I8CA 2F5XA 2I58A 4F1UA 1I6BA 3FD3A 3FUZA 3KEIA 4KFQA 3O6GA 4KPTA 4DCYA 5CC2A 1GVCA 1H44A 1LCTA 1UIVA 3DELB 3K6WA 2PT2A 3SEUA 1B05A 3G3GA 4N6PA 3FV1A 3EHSA 1FQCA 4O3AA 5H8SA 4FIMA 4QSEA 3G3HA 2OJTA 4ZZEA
chains in the Genus database with same CATH superfamily
4DIGA 1TWYA 5EQ8A 5DEXB 1JW4A 4PTKA 1JQFA 4EF2A 1NUWA 3RN8A 2HAUA 3FIRA 2O6AA 1AH5A 4GWOA 4MFIA 1KWHA 2HQ0A 3FV2A 3Q25A 1URGA 3IX1A 5H8FB 2I3VA 5B70A 5KDTB 4G77A 4LQ2A 2QS1A 2IEEA 3H4ZA 1GV8A 4KD5A 5ISUA 2XWVA 2OBGA 2P1SA 2UVGA 4HCYA 4JWYA 2WOKA 3E9XA 4Q0CA 1P1QA 3CFZA 3SESA 4BDQA 3JYRA 2WKYA 3TODA 1DPPA 2PBWA 4GIZA 2QFLA 3OEMA 2DWIA 3O97A 5TPAB 3KJTA 1JVXA 1FCKA 3ILTB 3T9VA 2QS3A 3RY3A 3VDFA 4GD5A 2DOJA 2R6GE 3HPIA 2ZMBA 4NGUA 1NV6A 4H5GA 3SDFA 4F3PA 5I2KA 2HZKA 4X9TA 2Y5LA 5AA2A 4LONB 2VOZA 3M8UA 3FVKA 4PETA 5ET8A 4R75A 4IO6A 5IKBA 5A5LA 3JZJA 5FTIA 3WAEA 2Z8DA 3OD7A 2XXTA 5BWJA 1P1NA 3V83A 5IAIA 3S2VA 2ZYOA 2GFEA 5JTYA 1PB8A 1FBPA 4G2ZA 3DRHA 4NMYA 4AB6A 3USDA 5I58A 4Z7EA 1MXZA 3TELA 1POY1 2RKMA 2O84X 1P99A 1JETA 1UQWA 3U1OA 3U8QA 2VD2A 3A29A 3U92A 2B3FA 4ZS9A 1Y20A 3DP4A 2DQVA 3EKIA 1LFHA 1FPIA 3FXBA 3PMXA 3OO8A 2HFBA 1LBWA 2LAOA 3Q28A 4GXAA 4PBHA 1Q1KA 1YCJA 3C36A 5EYHA 1Y4CA 1CNQA 1IUDA 1A7LA 2MKZA 2XXRA 1JEUA 1IQ7A 4GWUA 1BK4A 3H06B 4WEPA 4I40A 2XXQA 3IORA 4YMBA 3PD8A 1FBEA 1B0HA 3ZKKA 1MXYA 4MNIA 4UABA 3EPEA 2I4BA 3ILUB 1LFGA 4G61A 3OSRA 4U4XA 3KSXA 5A5XA 4YMAA 1FJ9A 5TP9A 1MQDA 4QRZA 1Y3NA 4MHFA 2OWSA 1UTHB 1Y1MA 3K1MA 1OIBA 1AMFA 3O9PA 5I59B 2B4LA 2HHMA 1N7XA 1NNTA 4YICA 2FVZA 1NV0A 2A5SA 1US4A 1FTJA 3O66A 1DSNA 5FHOA 2VHAA 2QVVA 2A5TB 5CM6A 3T93B 4H6DA 3V5AA 3KBRA 1R9LA 1S9TA 3LSWA 1DPEA 2H25A 2DWHA 1O64A 4BDMA 3PGFA 1XVXA 3H03A 4NEDA 1II5A 3CG1A 5JEIA 4KXPA 2FA7A 4QSCA 3QUJA 1MPDA 4I9DA 2ZNTA 4ZEDA 1LBCA 2V3TA 2DXYA 1B1HA 1EZOA 4PFRA 2UVJA 4QFKA 3T22A 2DE3A 1NUXA 4EQ7A 3QYTA 2KQZA 5I7IA 1B5IA 2WX9A 3FATA 1O7TA 1XT8A 5AA3A 4AB5A 2L5VA 2CZHA 3CFLA 4JSOA 3QXMA 4ONYA 2O69A 4UACA 3TCGA 4DXUA 3LSFB 4FE8A 4L17A 2ONKE 1LB8A 2ONRA 4N6DA 4C0RA 4N91A 2PMSA 4RJZA 3C9HA 5I3SA 1RKMA 2WYPA 1FPLA 3CFXA 4F18A 1LBXA 3IOWA 2OZZA 4KYSA 1Q9DA 3TTKA 3DP8A 3KFMA 3KG2A 4BDOA 1K9ZA 5I5PA 3IB2A 4NTLA 3CI8A 3SEXA 3BFUA 2XX9A 1FRPA 3FVGA 4IO2A 4OEVA 4HE2A 4GOTA 1B2HA 3R7XA 2THIA 1MQHA 4POWA 3P7IA 1IZ1A 4ZZAA 5H8HB 4ZEFA 5HPQA 4XEQA 3CSBA 4F19A 1SYHA 1N0TA 4QFNA 3F11A 3RTFB 4IO5A 1SW1A 1FBGA 3IOUA 1B3EA 4ECFA 1LCFA 1YTVA 5EQ9A 5ET6A 4NG7A 1LSTA 4IGTA 4XTCQ 3T1BA 4NQ8A 3I6VA 5AA1A 2WEFA 4X1BA 1INPA 5IGAA 5H8QB 4R6KA 4MNCA 3GZGA 1MY0A 4NF4B 4E0WA 5IZ3A 1DTGA 3H6TA 1LBZA 2FYIA 2ZXTA 4G8HA 3V8XB 2GH9A 5AA4A 3N94A 2ONSA 2HZLA 4DZ1A 2Y5KA 5FBPA 2XX8A 4LZ8A 5EQ7A 2NVUB 4F22A 4R74A 4IO3A 4RK9A 4PE3A 1WODA 3K00A 4OETA 1Y3QA 3LR1A 3OO9A 4H8IA 4OA4A 5CI5A 3S4UA 3QAXA 2PFYA 3PPQA 2P3NA 4RA1A 2FIEA 5ITPA 3THIA 2PFZA 1QJMA 4JSDA 2RCBA 1EH3A 4I1DA 3RGYA 4JWXA 3G7WA 1S50A 3RT8A 3MC2A 1I6AA 4F2QA 3DM0A 3TQLA 4ESXA 5KCJB 4AS4A 3UP9A 4IY6A 5IZZA 4XIGQ 4O3CA 2ZYMA 1B4HA 2X7QA 4TLLB 3VVEA 3VVDA 4RXLA 4PQJA 2F78A 1Q35A 1B9JA 3IFAA 4ZDMA 3ROJA 2V4CA 4ELRA 3TPAA 2O1LA 3E3KA 3AXFA 1MY3A 3E78A 4OENA 3VE1B 1MH4A 3MVXA 3E13X 1SVXB 3HHGA 4GQOA 1USYH 4EUOA 3S9NC 3OSQA 1ZLQA 1BKAA 1FBHA 3T0JA 4NF6B 4WKMA 1NNKA 1R6ZA 3RT6B 1BP5A 1A8EA 1FPKA 1WVJA 5I56B 4DXBA 1NUZA 4MBPA 1H43A 5AA2D 3G3JA 1KZ8A 1PDAA 2XXUA 2PCRA 4ZECA 4H45A 4GF8A 5CMCA 3UIFA 3DRJA 2HCAA 3SKPA 5I2NA 4WXJA 1M5BA 3S9LC 3JV9A 2X26A 1OLCA 4Q8RA 1POTA 4PFIA 4R73A 2XXIA 4O7MA 4GX3A 2UVIA 4GWZA 1B46A 3M3FA 4QHQA 4PFTA 1R1NA 4OZ9A 1H3DA 4JWOA 2CEYA 1GR2A 3FXQA 1GTKA 3T66A 4FJPA 2DP8A 1B7UA 4MH5A 2V25A 4LA9A 4ELPA 1UIUA 4G68A 2QPQA 1RYXA 5F1QA 4N8GA 1VE4A 4O3BA 4F2OA 4NF5B 1QGXA 3D4GA 2HXWA 4N8YA 3CRBA 3M3KA 4O7IA 1XC1A 2ESNA 3PUVE 3TYHA 1FJ6A 2QJEA 4P1LA 3B8BA 1D3KA 4PGNA 3UA8A 4R6HA 3TDJA 3DRIA 1NV7A 1P1UA 4GVOA 3ZS6A 3TTRA 3K02A 3GXAA 3TEPA 2VD3A 4P11A 3IO4A 1A40A 4U22A 5CRYA 2X7PA 3PTYA 4N81A 5L8DA 1URDA 1KA0A 1RDYA 4LZ5A 4OVPA 3TKDA 2NXOA 5I57B 1FPGA 1VR5A 3H6UA 3IO6A 2ZYKA 4H67A 4P0IA 3HV1A 3KOTA 1QVSA 4YAHX 4BLAA 2UXAA 4R9GA 1RDZA 4F3BA 2D5WA 1VDWA 4F1VA 1R9QA 1TT1A 1MPBA 2Y7IA 3UN6A 4KYDA 4ZEKA 3IOVA 3O6PA 4JDFA 4F31B 2XXYA 3IAZA 4NF8A 4HS7A 4PFUA 3RYAA 3H6VA 3VLVA 1LBYA 2H9BA 4OERA 2FIXA 1FPBA 1VFEA 1FQAA 3OMBA 2AYSA 3PPRA 3R26A 4N15A 2REGA 5H8NB 3SEYA 4YKIA 4MEVA 2I4CA 3T9XB 1SBPA 4IY5A 3IJXB 2AL4A 1Z7ME 2QMXA 1AL3A 5EYGA 4N4UA 3HHFA 1MXUA 2DVCA 4O8MA 1B7ZA 4I3EA 3OENA 4C1TA 4PP0A 4PFYA 1I6QA 1MY4A 3T9HB 3O6IA 5FTHA 4X1DA 1FQDA 4MCOA 1QW0A 2AL5A 2QL3A 4EF1A 2H4IA 3MVWA 2OCUA 3SZPA 3T96B 3TTLA 2ZNUA 2F6GA 3KOSA 2M8CA 4YKKA 1H76A 2GQ1A 4LVQA 3QIMA 1IITA 3RNNA 5DVJA 2QSXA 3LUYA 3UK4A 3KC0A 3O28A 1IXHA 5J1DA 4F3GA 3TCHA 3C34A 4NX1A 3RPLB 1ZJLA 4NF4A 2Z23A 2AIXA 1DMBA 3H6WA 5CBSA 5B7DA 3N26A 1FQFA 3VVFA 1GGGA 1XI6A 1IMCA 3DRKA 1ZMGA 2UYFA 4U1OA 4QFLA 3TTMA 3MWBA 4YB5A 1S7YA 4OMBA 3FXUA 4PC9A 4OVJA 4ELOA 4OFJA 1YYZA 3C31A 1MXXA 3C35A 1FPDA 3K6VA 3H7MA 4DDDA 1YPNA 3PPPA 4MIJA 1FPEA 4MAGA 4BDLA 3EF7A 4JVIA 2I49A 3BFTA 1MQJA 3PMVA 4Q5TA 2H5YA 3RTWB 1HSJA 4KCCA 3VFJA 1B0LA 3OEKA 3W9VA 3VLUA 1TXFA 4U1ZA 3U72A 4M1VA 3MP6A 5EYFA 4N17A 3IOTA 4YB7A 4OYVA 2G93A 1DOTA 5L9MA 3FVOA 3K6XA 4G4PA 5HM4B 3TAJA 1B51A 1FTKA 3PUWE 5K2XA 5CMBA 3W9WA 1DTZA 1UTBA 1MM6A 3UGWA 4KI0E 1NH8A 3G3KA 4ISUA 1N04A 1B32A 3PPOA 4HXVA 4F1YA 1JEVA 5I2KB 4NN3A 2OX3A 5AA2B 1JW5A 3IK6B 4P3LA 3K4UA 2R8TA 2NUVA 5BUUA 4KQPA 1MXVA 1DBZA 1NMUA 4JVDA 4DI4B 1NKXA 2F36A 2FNCA 2GHBA 3EHTA 2Z22A 1ZTYA 4OQOA 1KA1A 4NF6A 3S9MC 3IL1B 4HTGA 3MP1A 4GL0A 4GX4A 1IIWA 4I3YA 4JB7A 4ZEBA 5I58B 4XXUA 1IMBA 1SW4A 3UORA 5I56A 3PUXE 4N13A 4PAIA 4TLMB 2VT5A 1DCUA 5EHMA 4DXCA 4LP2B 3SETA 1J1NA 4OWDA 1NI9A 2D3IA 5KZTA 1A55A 4GBVA 4I62A 2XXHA 1Z7NE 3K1NA 3E4RA 4X8RA 3PV0E 2RC8A 4UA8A 2YLNA 1M5DA 1FPJA 1M5EA 4OESA 4PGPA 1CB6A 3ZSFA 4PFWA 1PBQA 1FBDA 4LZ7A 4FATA 1MY1A 3B6TA 3LVUA 1LEVA 4GXSB 3K6UA 5DEXA 2HPGA 3MBPA 3G3IA 1NL5A 4OFLA 1A8FA 2VPOA 4GRKA 1PB7A 4XKPA 4GBWA 3LV0A 1QUKA 2GRVA 5H8FA 1D4NA 1B3HA 5KDTA 1MH3A 5A5XB 3MAMA 4O94A 3E79A 3MYUA 1SDXA 2OLBA 4MJOA 5TP9B 3SEVA 2O7IA 1ZKBA 4QSDA 2XXXA 3TZAA 2WOLA 3HFUA 4MX6A 5DVFA 2FBPA 2PYYA 4MLVA 2XXWA 3B50A 4FEDA 1AWBA 4IO4A 4YB6A 1IMFA 4GFRA 2Y7RA 4E0XA 3H3GA 3O29A 2I48A 4OEUA 3Q26A 3VLWA 4H46A 2B65A 1IMDA 2PT1A 3FGSA 1B3FA 1P1WA 2Y84A 1NV1A 2V93A 3D1RA 3PD9A 5TPAA 2XXVA 3CG3A 1SQYA 3KSJA 2F3DA 3ECRA 4ZE9A 2WBDA 2VPNA 1FTLA 1LGBC 2RCAA 1OQGA 2F34A 4QBAA 4EQ9A 4DE8A 1QUIA 3FZVA 4N07A 4N6KA 3MZBA 2VGQA 3OOAA 4PAFA 3KBZA 3MSTA 3TUSA 2R9JA 1D9QA 4R72A 2DDKA 3U93A 1XVYA 5L9SA 2RF1A 1XS5A 5M2VA 3RLFE 3EHUA 4ND9A 4KR5A 4U4SA 4YU0A 3I5OA 1MQGA 3ISPA 1M5CA 1CE2A 3PPNA 2HAVA 4RK2A 4FECA 1K9YA 5I84A 1IXGA 4NE4A 2ZNSA 1PEBA 4OXVA 4F29A 4R6YA 4X04A 2O68A 4RNSA 4XKQA 2DSFA 3KN8A 1IEJA 1JNFA 2O51A 5LOMA 4JBZA 4HE1A 1ZIUA 1N7WA 1JP4A 5T3JA 3G3FA 1EZ9A 1US5A 5FHMA 1H45A 3L6GA 1SI1A 2Y7PA 1A99A 2NOOA 1B5HA 4OVRA 3LSLA 3FXRA 2V3UA 1Y3PA 3EN3A 2XD3A 2QMWA 5HBCA 1MS7A 2DWJA 4FEBA 1LBVA 4Z0IA 2DWAA 4YKJA 5ESYA 4RPOA 1A54A 2G29A 4OHNA 1FTMA 4C1UA 1SPIA 1VSOA 4NWCA 3MP8A 1PC3A 4POXA 1IXCA 1QKBA 1UTHA 3FJGA 3RPLA 1B1XA 3KGCA 5ITOA 3DRGA 2XHDA 4PE5B 2IA4A 5F24A 5I59A 3O6HA 5AE4A 1MRPA 3IB1A 2I0CA 3IR1A 5IZ1A 4MLQA 3PU5A 2ZYNA 5IZ3B 2UYEA 1TFDA 3GYYA 4NAPA 2A5TA 2BJJX 1NV3A 3Q27A 5AA4B 3D4CA 3RUMA 4NWDA 1ZBMA 2ZZVA 3OXNA 1B6HA 2Q2CA 2Q89A 2Q9TA 5L9OA 3QSLA 1LBBA 3IJOB 3QUFA 3FASA 2RINA 3OO6A 4FAJA 3ZKLA 1WDNA 2PX1A 3PAMA 4THIA 1N84A 2RC7A 5K2YA 1YZ0A 2ALUA 1FQBA 1MG1A 4R9FA 1NNFA 2Q8JA 2QS4A 5JK4A 4BDRA 4TQUQ 3TMGA 4QFPA 4KYEA 4PBQA 1HSLA 4IB2A 3MZ9A 1D9YA 5EHSA 4LATA 5DVIA 4GLIA 1FTAA 1EZPA 5J16A 2XX7A 3ODBA 2ANJA 4OVQA 4PAKA 1B3GA 3BIGA 1PBPA 2XWIA 1B3LA 3RQTA 1DK4A 3EQ1A 4G8MA 4ZE8A 1NFTA 4H0WA 1LB9A 2F7BA 2ABHA 3FVNA 1QUJA 1IMAA 4OFOA 2I3WA 4X48A 4DLDA 1B5JA 1URSA 1MDP1 1IXIA 1M5FA 3N5LA 2V3QA 1OLAA 2RC9A 1O63A 3T9UA 3ONMA 3A09A 1ANFA 3LUZA 3B7DA 4GWWA 1N3WA 3SEWA 2PVUA 4OTEA 2ZZWA 2Q8MA 5H8HA 4NF0A 2JJKA 2V84A 2GHAA 4MMPA 2DXRA 1F9BA 3B6QA 3GBAA 5CMKA 1NV2A 4OVSA 1Y1ZA 1G0HA 2UVHA 3K2DA 3R6UA 5I2NB 3FJMA 4NHBA 1VFDA 1AOVA 1FPFA 1EYJA 3VV5A 4GWXA 3LBSA 3OELA 1AIVA 1EYIA 3Q29A 4PDHA 3U94A 2WYKA 5H8QA 4WEDA 4H1XA 1NUYA 1T0KA 2KLFA 3A3UA 3GBBA 5F7VA 4YZZA 2W7YA 2DYXA 3MZ1A 1BTJA 4RYAA 3A3CA 2OK2A 1YXIA 3PUZE 4G68B 4BDNA 3DLNA 2E1SA 2I6EA 2QVUA 2DE2A 1B4ZA 1B52A 4G8NA 3K01A 4RY1A 2WOPA 4EDPA 5CBRA 4PF6A 2R71A 2F7CA 2NWJA 4P0GA 3RPWA 1XHYA 2E0SA 3VXBA 1I69A 1NH7A 3QMFA 1JVYA 5LDZA 2H99A 1NNPA 2ZZXA 2O1MA 4LUBA 1MDQA 1FW0A 3DP6A 5ELVA 4RPNA 5DTBA 1Y9UA 4EXLA 1FBCA 2CZLA 3M3LA 4YKPA 4H5FA 3KN7A 4M4GA 5DYHA 1EU8A 3MPKA 5KCJA 1ATGA 4IR8A 4EXKA 3NOHA 1P1OA 3HCQA 3PUYE 1NV5A 2QS2A 1OVBA 4GL8A 2XWOA 3KC1A 3FTOA 2P3VA 4KHZE 4GWYA 2YJPA 3O2AA 5IM2A 3MVZA 2F6PA 2YPNA 4H65A 3DRFA 4QXDA 1YAEA 1JW1A 5LTCA 4K3FA 3PMWA 3B6WA 3FJ7A 3CSGA 5JTYB 4AS5A 1LAHE 1SW5A 2F97A 4ZEIA 4FBPA 4NF8B 4PDDA 1OMPA 2Y7KA 2H98A 2Q2AA 4KCDA 3FBPA 5ICTA 4GX6A 3S9EA 1FBFA 1PB9A 4R2BA 4ELQA 4R2FA 1EYKA 2D21A 2O7UA 4IGRA 1XOCA 2P0SA 1RDXA 2QVRA 2XXPA 3MPLA 4AQ4A 3CR9A 1RYOA 4XFEA 3HSTA 4H8JA 3KZGA 4LN5A 3OO7A 3TTNA 1USYE 5CMMA 2F8DA 1MQIA 5DT6A 5ET7A 1MPCA 2P2AA 2HXRA 3K1PA 3N6TA 4P1EA 3RYDA 3K0VA 1B40A 2B4MA 3CIJA 4JVCA 1SW2A 3U65A 4XKRA 4IO7A 1QKAA 4P8BA 3MVYA 3L6HA 4G68C 1Y4TA 3BBRA 2HEUA 4XKNA 3KJ7A 1LAGE 4QF9A 3LSXA 3QK6A 3TQWA 2F7AA 2I0BA 4P47A 1OQHA 4NF5A 4F39A 4TOZA 3HN0A 1LAXA 3TCFA 1MY2A 3BIHA 2Q88A 4F3SA 1G0IA 3IB0A 3C33A 2XXKA 2Z8FA 3C4MA 3HO7A 3I3VA 4U21A 1N3XA 1QULA 5EQAA 2F35A 3TFLA 1ELJA 3MJNA 1HSEA 2BJIA 2XA5A 2F3BA 3WAFA 3W15C 1FTOA 4QFOA 4MNPA 1FSAA 4JXIA 2KR0A 2DVZA 2OWTA 5ICQA 1SI0A 4P9KA 4HE0A 4EQBA 2VP1A 3IFCA 3BKIB 5I57A 4XF5A 2QRYA 2CZKA 1IMEA 5FHNA 4HCWA 2Z8EA 1LFIA 2B3BA 4U2RA 3RYBA 3MUQA 1SYIA 1N76A 4OVTA 4LQ5A 1MM7A 4FORA 4PFBA 1BIYA 2DE4A 4ESWA 2REJA 1FQEA 4P56A 2Y7WA 1SD3A 1OVTA 4Q30B 3LC8A 4U23A 2CMOA 1UTBB 1B7HA 3SERA 3CHGA 2XD2A 3V89B 3GLBA 3C32A 1MXWA 2FHYA 4DCXA 3VXCA 1L5TA 5TU0A 4PCDA 1LAFE 3CVGA 2CZIA 2WBBA 3MQ9A 5ET5A 4MF3A 2DS9A 4PF8A 5H8NA 1D9VA 5DW8A 4DI3D 3KN3A 4HW8A 1LLSA 1BLFA 2OWZA 3MW0A 2CEXA 3N6UA 1TFAA 4OANA 1ZU0A 1B58A 4I8CA 2F5XA 2I58A 4F1UA 2XWKA 1I6BA 3FD3A 3FUZA 3KEIA 1NV4A 4KFQA 3O6GA 4KPTA 4DCYA 5CC2A 1GVCA 1H44A 1LCTA 1UIVA 3DELB 3K6WA 2PT2A 3SEUA 1B05A 3G3GA 4N6PA 3FV1A 3EHSA 1FQCA 4O3AA 5H8SA 4FIMA 4GWSA 4QSEA 3G3HA 2Q74A 2OJTA 4ZZEA
chains in the Genus database with same CATH topology
4DIGA 1TWYA 5DEXB 1JW4A 1JQFA 4EF2A 3RN8A 2HAUA 3FIRA 2O6AA 1AH5A 4GWOA 4MFIA 1KWHA 2HQ0A 3FV2A 3Q25A 1URGA 3IX1A 5H8FB 2I3VA 5B70A 5KDTB 4G77A 4LQ2A 2QS1A 2IEEA 3H4ZA 1GV8A 4KD5A 5ISUA 2OBGA 2P1SA 2UVGA 4HCYA 4JWYA 2WOKA 3E9XA 4Q0CA 1P1QA 3CFZA 3SESA 4BDQA 3JYRA 2WKYA 3TODA 1DPPA 2PBWA 4GIZA 3OEMA 2DWIA 3O97A 5TPAB 3KJTA 1JVXA 1FCKA 3ILTB 3T9VA 2QS3A 3RY3A 3VDFA 4GD5A 2DOJA 2R6GE 3HPIA 2ZMBA 4H5GA 3SDFA 4F3PA 5I2KA 2HZKA 4X9TA 5AA2A 4LONB 2VOZA 3M8UA 3FVKA 4PETA 4R75A 4IO6A 5IKBA 3JZJA 5FTIA 3WAEA 2Z8DA 3OD7A 2XXTA 5BWJA 1P1NA 3V83A 5IAIA 3S2VA 2ZYOA 2GFEA 5JTYA 1PB8A 4G2ZA 3DRHA 4NMYA 4AB6A 3USDA 5I58A 4Z7EA 1MXZA 3TELA 1POY1 2RKMA 2O84X 1P99A 1JETA 1UQWA 3U1OA 3U8QA 2VD2A 3U92A 2B3FA 4ZS9A 1Y20A 3DP4A 2DQVA 1LFHA 3PMXA 3OO8A 2HFBA 2LAOA 3Q28A 4GXAA 1Q1KA 1YCJA 3C36A 1Y4CA 1IUDA 1A7LA 2XXRA 1JEUA 1IQ7A 3H06B 4WEPA 2XXQA 3IORA 4YMBA 3PD8A 1B0HA 3ZKKA 1MXYA 3EPEA 2I4BA 3ILUB 1LFGA 3OSRA 4U4XA 3KSXA 5A5XA 4YMAA 5TP9A 1MQDA 4QRZA 1Y3NA 2OWSA 1UTHB 1Y1MA 3K1MA 1OIBA 1AMFA 3O9PA 5I59B 2B4LA 1N7XA 1NNTA 4YICA 2A5SA 1US4A 1FTJA 3O66A 1DSNA 5FHOA 2VHAA 2A5TB 5CM6A 3T93B 4H6DA 3V5AA 3KBRA 1R9LA 1S9TA 3LSWA 1DPEA 2H25A 2DWHA 1O64A 4BDMA 3PGFA 1XVXA 3H03A 4NEDA 1II5A 3CG1A 5JEIA 2FA7A 4QSCA 3QUJA 1MPDA 4I9DA 2ZNTA 4ZEDA 1LBCA 2V3TA 2DXYA 1B1HA 1EZOA 2UVJA 4QFKA 3T22A 2DE3A 4EQ7A 3QYTA 1B5IA 3FATA 1O7TA 1XT8A 5AA3A 4AB5A 3CFLA 4JSOA 3QXMA 4ONYA 2O69A 4UACA 3TCGA 4DXUA 3LSFB 4FE8A 4L17A 2ONKE 1LB8A 2ONRA 4C0RA 2PMSA 4RJZA 3C9HA 1RKMA 3CFXA 4F18A 3IOWA 2OZZA 4KYSA 3TTKA 3DP8A 3KFMA 3KG2A 4BDOA 3IB2A 4NTLA 3CI8A 3SEXA 3BFUA 2XX9A 3FVGA 4IO2A 4OEVA 4GOTA 1B2HA 3R7XA 2THIA 1MQHA 4POWA 3P7IA 1IZ1A 4ZZAA 5H8HB 4ZEFA 5HPQA 3CSBA 4F19A 1SYHA 1N0TA 4QFNA 3F11A 3RTFB 4IO5A 1SW1A 3IOUA 1B3EA 4ECFA 1LCFA 1YTVA 1LSTA 4IGTA 4XTCQ 3I6VA 5AA1A 4X1BA 5H8QB 4R6KA 3GZGA 1MY0A 4NF4B 4E0WA 1DTGA 3H6TA 2FYIA 2ZXTA 4G8HA 3V8XB 2GH9A 5AA4A 3N94A 2ONSA 2HZLA 4DZ1A 2XX8A 4LZ8A 2NVUB 4F22A 4R74A 4IO3A 4RK9A 1WODA 3K00A 4OETA 1Y3QA 3LR1A 3OO9A 4H8IA 5CI5A 3S4UA 3QAXA 3PPQA 4RA1A 5ITPA 3THIA 1QJMA 4JSDA 2RCBA 1EH3A 4I1DA 3RGYA 4JWXA 3G7WA 1S50A 3RT8A 3MC2A 1I6AA 4F2QA 3DM0A 3TQLA 4ESXA 5KCJB 3UP9A 4IY6A 4XIGQ 4O3CA 2ZYMA 1B4HA 2X7QA 4TLLB 3VVEA 3VVDA 4RXLA 4PQJA 2F78A 1Q35A 1B9JA 4ZDMA 4ELRA 3TPAA 2O1LA 3E3KA 3AXFA 1MY3A 4OENA 3VE1B 1MH4A 3MVXA 3E13X 1SVXB 3HHGA 4GQOA 1USYH 4EUOA 3S9NC 3OSQA 1ZLQA 1BKAA 4NF6B 4WKMA 1NNKA 1R6ZA 3RT6B 1BP5A 1A8EA 1WVJA 5I56B 4DXBA 4MBPA 1H43A 5AA2D 3G3JA 1PDAA 2XXUA 4ZECA 4GF8A 5CMCA 3UIFA 3DRJA 2HCAA 3SKPA 5I2NA 4WXJA 1M5BA 3S9LC 3JV9A 2X26A 1OLCA 4Q8RA 1POTA 4R73A 2XXIA 2UVIA 1B46A 3M3FA 4QHQA 4PFTA 1R1NA 4OZ9A 1H3DA 4JWOA 1GR2A 3FXQA 1GTKA 3T66A 4FJPA 2DP8A 1B7UA 4MH5A 2V25A 4LA9A 4ELPA 1UIUA 4G68A 2QPQA 1RYXA 5F1QA 1VE4A 4O3BA 4F2OA 4NF5B 3D4GA 2HXWA 3CRBA 3M3KA 1XC1A 2ESNA 3PUVE 3TYHA 2QJEA 1D3KA 3UA8A 4R6HA 3TDJA 3DRIA 1P1UA 4GVOA 3ZS6A 3TTRA 3K02A 3GXAA 3TEPA 2VD3A 4P11A 3IO4A 1A40A 4U22A 5CRYA 2X7PA 5L8DA 1URDA 4LZ5A 3TKDA 2NXOA 5I57B 1VR5A 3H6UA 3IO6A 2ZYKA 4H67A 4P0IA 3HV1A 3KOTA 1QVSA 4YAHX 4BLAA 2UXAA 4R9GA 4F3BA 2D5WA 4F1VA 1R9QA 1TT1A 1MPBA 2Y7IA 3UN6A 4KYDA 4ZEKA 3IOVA 3O6PA 4JDFA 4F31B 2XXYA 3IAZA 4NF8A 4PFUA 4HS7A 3RYAA 3H6VA 3VLVA 2H9BA 4OERA 1VFEA 1FQAA 3OMBA 2AYSA 3PPRA 3R26A 2REGA 5H8NB 3SEYA 4YKIA 3T9XB 2I4CA 1SBPA 4IY5A 3IJXB 2AL4A 1Z7ME 2QMXA 1AL3A 3HHFA 1MXUA 2DVCA 1B7ZA 3OENA 4C1TA 4PP0A 4PFYA 1I6QA 1MY4A 3T9HB 3O6IA 5FTHA 4X1DA 1FQDA 1QW0A 2AL5A 2QL3A 4EF1A 2H4IA 3MVWA 2OCUA 3T96B 3TTLA 2ZNUA 2F6GA 3KOSA 2M8CA 4YKKA 1H76A 4LVQA 3QIMA 1IITA 3RNNA 5DVJA 2QSXA 3LUYA 3UK4A 3O28A 1IXHA 5J1DA 4F3GA 3TCHA 3C34A 1ZJLA 4NF4A 2Z23A 2AIXA 1DMBA 3H6WA 5CBSA 5B7DA 3N26A 1FQFA 3VVFA 1GGGA 3DRKA 1ZMGA 2UYFA 4U1OA 4QFLA 3TTMA 3MWBA 4YB5A 1S7YA 4OMBA 3FXUA 4OVJA 4ELOA 4OFJA 3C31A 1MXXA 3C35A 3K6VA 3H7MA 4DDDA 1YPNA 3PPPA 4BDLA 3EF7A 2I49A 3BFTA 1MQJA 3PMVA 4Q5TA 2H5YA 3RTWB 1HSJA 4KCCA 3VFJA 1B0LA 3OEKA 3W9VA 3VLUA 1TXFA 4U1ZA 3U72A 4M1VA 3MP6A 5EYFA 3IOTA 4YB7A 2G93A 4OYVA 1DOTA 5L9MA 3FVOA 3K6XA 4G4PA 5HM4B 3TAJA 1B51A 1FTKA 3PUWE 5K2XA 5CMBA 3W9WA 1DTZA 1UTBA 1MM6A 3UGWA 4KI0E 1NH8A 3G3KA 4ISUA 1N04A 1B32A 3PPOA 4F1YA 1JEVA 5I2KB 5AA2B 1JW5A 3IK6B 3K4UA 2NUVA 5BUUA 4KQPA 1MXVA 1NMUA 1NKXA 2F36A 2FNCA 2GHBA 3EHTA 2Z22A 1ZTYA 4OQOA 4NF6A 3S9MC 3IL1B 4HTGA 3MP1A 4GL0A 1IIWA 4JB7A 4ZEBA 5I58B 4XXUA 1SW4A 3UORA 5I56A 3PUXE 4N13A 4TLMB 5EHMA 4DXCA 4LP2B 3SETA 1J1NA 4OWDA 2D3IA 5KZTA 1A55A 4I62A 2XXHA 1Z7NE 3K1NA 3E4RA 3PV0E 2RC8A 4UA8A 2YLNA 1M5DA 1M5EA 4OESA 1CB6A 3ZSFA 4PFWA 1PBQA 4LZ7A 4FATA 1MY1A 3B6TA 3LVUA 4GXSB 3K6UA 5DEXA 3MBPA 3G3IA 1NL5A 4OFLA 1A8FA 4GRKA 1PB7A 4XKPA 1QUKA 2GRVA 5H8FA 1D4NA 1B3HA 5KDTA 1MH3A 5A5XB 3MAMA 1SDXA 2OLBA 5TP9B 3SEVA 2O7IA 1ZKBA 4QSDA 2XXXA 3TZAA 2WOLA 5DVFA 2PYYA 4MLVA 2XXWA 4FEDA 4IO4A 4YB6A 4GFRA 2Y7RA 4E0XA 3H3GA 3O29A 2I48A 4OEUA 3Q26A 3VLWA 2B65A 2PT1A 3FGSA 1B3FA 1P1WA 2Y84A 2V93A 3PD9A 5TPAA 2XXVA 3CG3A 1SQYA 3KSJA 3ECRA 4ZE9A 1FTLA 1LGBC 2RCAA 1OQGA 2F34A 4EQ9A 4DE8A 1QUIA 3FZVA 4N07A 3MZBA 2VGQA 3OOAA 3TUSA 2R9JA 4R72A 3U93A 1XVYA 5L9SA 2RF1A 1XS5A 5M2VA 3RLFE 3EHUA 4ND9A 4KR5A 4U4SA 4YU0A 3I5OA 1MQGA 1M5CA 1CE2A 3PPNA 2HAVA 4RK2A 4FECA 5I84A 1IXGA 4NE4A 2ZNSA 1PEBA 4OXVA 4F29A 4R6YA 2O68A 4RNSA 4XKQA 2DSFA 3KN8A 1IEJA 1JNFA 2O51A 5LOMA 4JBZA 1ZIUA 1N7WA 3G3FA 1EZ9A 1US5A 5FHMA 1H45A 3L6GA 1SI1A 2Y7PA 1A99A 2NOOA 1B5HA 3LSLA 3FXRA 2V3UA 1Y3PA 3EN3A 2XD3A 2QMWA 5HBCA 1MS7A 2DWJA 4FEBA 4Z0IA 2DWAA 4YKJA 4RPOA 1A54A 2G29A 4OHNA 1FTMA 4C1UA 1VSOA 4NWCA 3MP8A 1PC3A 4POXA 1IXCA 1QKBA 1UTHA 3FJGA 1B1XA 3KGCA 5ITOA 3DRGA 2XHDA 4PE5B 2IA4A 5I59A 3O6HA 5AE4A 1MRPA 3IB1A 2I0CA 3IR1A 4MLQA 3PU5A 2ZYNA 2UYEA 1TFDA 2A5TA 2BJJX 3Q27A 5AA4B 3D4CA 3RUMA 4NWDA 1ZBMA 3OXNA 1B6HA 2Q2CA 2Q89A 2Q9TA 5L9OA 3QSLA 1LBBA 3IJOB 3QUFA 3FASA 2RINA 3OO6A 4FAJA 3ZKLA 1WDNA 2PX1A 3PAMA 4THIA 1N84A 2RC7A 5K2YA 2ALUA 1FQBA 1MG1A 4R9FA 1NNFA 2Q8JA 2QS4A 5JK4A 4BDRA 4TQUQ 3TMGA 4QFPA 4KYEA 1HSLA 4IB2A 3MZ9A 1D9YA 5EHSA 4LATA 5DVIA 4GLIA 1EZPA 2XX7A 3ODBA 2ANJA 1B3GA 1PBPA 1B3LA 3RQTA 3EQ1A 4G8MA 4ZE8A 1NFTA 4H0WA 1LB9A 2F7BA 2ABHA 3FVNA 1QUJA 4OFOA 2I3WA 4X48A 4DLDA 1B5JA 1URSA 1MDP1 1IXIA 1M5FA 3N5LA 2V3QA 1OLAA 2RC9A 1O63A 3T9UA 3ONMA 3A09A 1ANFA 3B7DA 1N3WA 3SEWA 2PVUA 4OTEA 5H8HA 2V84A 2GHAA 2DXRA 1F9BA 3B6QA 3GBAA 5CMKA 1Y1ZA 2UVHA 3K2DA 3R6UA 5I2NB 3FJMA 1VFDA 1AOVA 3VV5A 3LBSA 3OELA 1AIVA 3Q29A 3U94A 5H8QA 4WEDA 4H1XA 1T0KA 2KLFA 3A3UA 3GBBA 5F7VA 4YZZA 2W7YA 2DYXA 3MZ1A 1BTJA 4RYAA 3A3CA 2OK2A 3PUZE 4G68B 4BDNA 3DLNA 2E1SA 2I6EA 2DE2A 1B4ZA 1B52A 4G8NA 3K01A 4RY1A 2WOPA 4EDPA 5CBRA 2R71A 2F7CA 2NWJA 4P0GA 3RPWA 1XHYA 2E0SA 3VXBA 1I69A 1NH7A 1JVYA 2H99A 1NNPA 2O1MA 4LUBA 1MDQA 1FW0A 3DP6A 5ELVA 4RPNA 5DTBA 1Y9UA 4EXLA 2CZLA 3M3LA 4YKPA 4H5FA 3KN7A 4M4GA 5DYHA 1EU8A 3MPKA 5KCJA 1ATGA 4EXKA 1P1OA 3HCQA 3PUYE 2QS2A 1OVBA 4GL8A 3FTOA 4KHZE 2YJPA 3O2AA 3MVZA 2F6PA 2YPNA 4H65A 3DRFA 1YAEA 1JW1A 4K3FA 3PMWA 3B6WA 3FJ7A 3CSGA 5JTYB 1LAHE 1SW5A 2F97A 4ZEIA 4NF8B 1OMPA 2Y7KA 2H98A 2Q2AA 4KCDA 5ICTA 3S9EA 4R2BA 1PB9A 4ELQA 4R2FA 2D21A 2O7UA 4IGRA 1XOCA 2P0SA 2XXPA 3MPLA 4AQ4A 3CR9A 1RYOA 3HSTA 4H8JA 3KZGA 3OO7A 3TTNA 1USYE 5CMMA 2F8DA 1MQIA 5DT6A 1MPCA 2P2AA 3K1PA 3N6TA 3K0VA 1B40A 2B4MA 3CIJA 1SW2A 4XKRA 4IO7A 1QKAA 3MVYA 3L6HA 4G68C 1Y4TA 3BBRA 2HEUA 4XKNA 3KJ7A 1LAGE 4QF9A 3LSXA 3QK6A 3TQWA 2F7AA 2I0BA 1OQHA 4NF5A 4F39A 4TOZA 3HN0A 1LAXA 3TCFA 1MY2A 2Q88A 4F3SA 3IB0A 3C33A 2Z8FA 3C4MA 3HO7A 3I3VA 4U21A 1N3XA 1QULA 2F35A 3TFLA 1ELJA 3MJNA 1HSEA 3WAFA 3W15C 1FTOA 4QFOA 4JXIA 2DVZA 2OWTA 5ICQA 1SI0A 4EQBA 2VP1A 3BKIB 5I57A 2QRYA 5FHNA 4HCWA 2Z8EA 1LFIA 2B3BA 4U2RA 3RYBA 3MUQA 1SYIA 1N76A 4LQ5A 1MM7A 4FORA 1BIYA 2DE4A 4ESWA 2REJA 1FQEA 2Y7WA 1SD3A 1OVTA 4Q30B 3LC8A 4U23A 2CMOA 1UTBB 1B7HA 3SERA 3CHGA 2XD2A 3V89B 3GLBA 3C32A 1MXWA 4DCXA 3VXCA 1L5TA 5TU0A 1LAFE 3CVGA 3MQ9A 4MF3A 2DS9A 5H8NA 1D9VA 3KN3A 4HW8A 1LLSA 1BLFA 3MW0A 3N6UA 1TFAA 1ZU0A 1B58A 4I8CA 2F5XA 2I58A 4F1UA 1I6BA 3FD3A 3FUZA 3KEIA 4KFQA 3O6GA 4KPTA 4DCYA 5CC2A 1GVCA 1H44A 1LCTA 1UIVA 3DELB 3K6WA 2PT2A 3SEUA 1B05A 3G3GA 4N6PA 3FV1A 3EHSA 1FQCA 4O3AA 5H8SA 4FIMA 4QSEA 3G3HA 2OJTA 4ZZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DIG A;  1TWY A;  5DEX B;  1JW4 A;  1JQF A;  4EF2 A;  3RN8 A;  2HAU A;  3FIR A;  2O6A A;  1AH5 A;  4GWO A;  4MFI A;  1KWH A;  2HQ0 A;  3FV2 A;  3Q25 A;  1URG A;  3IX1 A;  5H8F B;  2I3V A;  5B70 A;  5KDT B;  4G77 A;  4LQ2 A;  2QS1 A;  2IEE A;  3H4Z A;  1GV8 A;  4KD5 A;  5ISU A;  2OBG A;  2P1S A;  2UVG A;  4HCY A;  4JWY A;  2WOK A;  3E9X A;  4Q0C A;  1P1Q A;  3CFZ A;  3SES A;  4BDQ A;  3JYR A;  2WKY A;  3TOD A;  1DPP A;  2PBW A;  4GIZ A;  3OEM A;  2DWI A;  3O97 A;  5TPA B;  3KJT A;  1JVX A;  1FCK A;  3ILT B;  3T9V A;  2QS3 A;  3RY3 A;  3VDF A;  4GD5 A;  2DOJ A;  2R6G E;  3HPI A;  2ZMB A;  4H5G A;  3SDF A;  4F3P A;  5I2K A;  2HZK A;  4X9T A;  5AA2 A;  4LON B;  2VOZ A;  3M8U A;  3FVK A;  4PET A;  4R75 A;  4IO6 A;  5IKB A;  3JZJ A;  5FTI A;  3WAE A;  2Z8D A;  3OD7 A;  2XXT A;  5BWJ A;  1P1N A;  3V83 A;  5IAI A;  3S2V A;  2ZYO A;  2GFE A;  5JTY A;  1PB8 A;  4G2Z A;  3DRH A;  4NMY A;  4AB6 A;  3USD A;  5I58 A;  4Z7E A;  1MXZ A;  3TEL A;  1POY 1;  2RKM A;  2O84 X;  1P99 A;  1JET A;  1UQW A;  3U1O A;  3U8Q A;  2VD2 A;  3U92 A;  2B3F A;  4ZS9 A;  1Y20 A;  3DP4 A;  2DQV A;  1LFH A;  3PMX A;  3OO8 A;  2HFB A;  2LAO A;  3Q28 A;  4GXA A;  1Q1K A;  1YCJ A;  3C36 A;  1Y4C A;  1IUD A;  1A7L A;  2XXR A;  1JEU A;  1IQ7 A;  3H06 B;  4WEP A;  2XXQ A;  3IOR A;  4YMB A;  3PD8 A;  1B0H A;  3ZKK A;  1MXY A;  3EPE A;  2I4B A;  3ILU B;  1LFG A;  3OSR A;  4U4X A;  3KSX A;  5A5X A;  4YMA A;  5TP9 A;  1MQD A;  4QRZ A;  1Y3N A;  2OWS A;  1UTH B;  1Y1M A;  3K1M A;  1OIB A;  1AMF A;  3O9P A;  5I59 B;  2B4L A;  1N7X A;  1NNT A;  4YIC A;  2A5S A;  1US4 A;  1FTJ A;  3O66 A;  1DSN A;  5FHO A;  2VHA A;  2A5T B;  5CM6 A;  3T93 B;  4H6D A;  3V5A A;  3KBR A;  1R9L A;  1S9T A;  3LSW A;  1DPE A;  2H25 A;  2DWH A;  1O64 A;  4BDM A;  3PGF A;  1XVX A;  3H03 A;  4NED A;  1II5 A;  3CG1 A;  5JEI A;  2FA7 A;  4QSC A;  3QUJ A;  1MPD A;  4I9D A;  2ZNT A;  4ZED A;  1LBC A;  2V3T A;  2DXY A;  1B1H A;  1EZO A;  2UVJ A;  4QFK A;  3T22 A;  2DE3 A;  4EQ7 A;  3QYT A;  1B5I A;  3FAT A;  1O7T A;  1XT8 A;  5AA3 A;  4AB5 A;  3CFL A;  4JSO A;  3QXM A;  4ONY A;  2O69 A;  4UAC A;  3TCG A;  4DXU A;  3LSF B;  4FE8 A;  4L17 A;  2ONK E;  1LB8 A;  2ONR A;  4C0R A;  2PMS A;  4RJZ A;  3C9H A;  1RKM A;  3CFX A;  4F18 A;  3IOW A;  2OZZ A;  4KYS A;  3TTK A;  3DP8 A;  3KFM A;  3KG2 A;  4BDO A;  3IB2 A;  4NTL A;  3CI8 A;  3SEX A;  3BFU A;  2XX9 A;  3FVG A;  4IO2 A;  4OEV A;  4GOT A;  1B2H A;  3R7X A;  2THI A;  1MQH A;  4POW A;  3P7I A;  1IZ1 A;  4ZZA A;  5H8H B;  4ZEF A;  5HPQ A;  3CSB A;  4F19 A;  1SYH A;  1N0T A;  4QFN A;  3F11 A;  3RTF B;  4IO5 A;  1SW1 A;  3IOU A;  1B3E A;  4ECF A;  1LCF A;  1YTV A;  1LST A;  4IGT A;  4XTC Q;  3I6V A;  5AA1 A;  4X1B A;  5H8Q B;  4R6K A;  3GZG A;  1MY0 A;  4NF4 B;  4E0W A;  1DTG A;  3H6T A;  2FYI A;  2ZXT A;  4G8H A;  3V8X B;  2GH9 A;  5AA4 A;  3N94 A;  2ONS A;  2HZL A;  4DZ1 A;  2XX8 A;  4LZ8 A;  2NVU B;  4F22 A;  4R74 A;  4IO3 A;  4RK9 A;  1WOD A;  3K00 A;  4OET A;  1Y3Q A;  3LR1 A;  3OO9 A;  4H8I A;  5CI5 A;  3S4U A;  3QAX A;  3PPQ A;  4RA1 A;  5ITP A;  3THI A;  1QJM A;  4JSD A;  2RCB A;  1EH3 A;  4I1D A;  3RGY A;  4JWX A;  3G7W A;  1S50 A;  3RT8 A;  3MC2 A;  1I6A A;  4F2Q A;  3DM0 A;  3TQL A;  4ESX A;  5KCJ B;  3UP9 A;  4IY6 A;  4XIG Q;  4O3C A;  2ZYM A;  1B4H A;  2X7Q A;  4TLL B;  3VVE A;  3VVD A;  4RXL A;  4PQJ A;  2F78 A;  1Q35 A;  1B9J A;  4ZDM A;  4ELR A;  3TPA A;  2O1L A;  3E3K A;  3AXF A;  1MY3 A;  4OEN A;  3VE1 B;  1MH4 A;  3MVX A;  3E13 X;  1SVX B;  3HHG A;  4GQO A;  1USY H;  4EUO A;  3S9N C;  3OSQ A;  1ZLQ A;  1BKA A;  4NF6 B;  4WKM A;  1NNK A;  1R6Z A;  3RT6 B;  1BP5 A;  1A8E A;  1WVJ A;  5I56 B;  4DXB A;  4MBP A;  1H43 A;  5AA2 D;  3G3J A;  1PDA A;  2XXU A;  4ZEC A;  4GF8 A;  5CMC A;  3UIF A;  3DRJ A;  2HCA A;  3SKP A;  5I2N A;  4WXJ A;  1M5B A;  3S9L C;  3JV9 A;  2X26 A;  1OLC A;  4Q8R A;  1POT A;  4R73 A;  2XXI A;  2UVI A;  1B46 A;  3M3F A;  4QHQ A;  4PFT A;  1R1N A;  4OZ9 A;  1H3D A;  4JWO A;  1GR2 A;  3FXQ A;  1GTK A;  3T66 A;  4FJP A;  2DP8 A;  1B7U A;  4MH5 A;  2V25 A;  4LA9 A;  4ELP A;  1UIU A;  4G68 A;  2QPQ A;  1RYX A;  5F1Q A;  1VE4 A;  4O3B A;  4F2O A;  4NF5 B;  3D4G A;  2HXW A;  3CRB A;  3M3K A;  1XC1 A;  2ESN A;  3PUV E;  3TYH A;  2QJE A;  1D3K A;  3UA8 A;  4R6H A;  3TDJ A;  3DRI A;  1P1U A;  4GVO A;  3ZS6 A;  3TTR A;  3K02 A;  3GXA A;  3TEP A;  2VD3 A;  4P11 A;  3IO4 A;  1A40 A;  4U22 A;  5CRY A;  2X7P A;  5L8D A;  1URD A;  4LZ5 A;  3TKD A;  2NXO A;  5I57 B;  1VR5 A;  3H6U A;  3IO6 A;  2ZYK A;  4H67 A;  4P0I A;  3HV1 A;  3KOT A;  1QVS A;  4YAH X;  4BLA A;  2UXA A;  4R9G A;  4F3B A;  2D5W A;  4F1V A;  1R9Q A;  1TT1 A;  1MPB A;  2Y7I A;  3UN6 A;  4KYD A;  4ZEK A;  3IOV A;  3O6P A;  4JDF A;  4F31 B;  2XXY A;  3IAZ A;  4NF8 A;  4PFU A;  4HS7 A;  3RYA A;  3H6V A;  3VLV A;  2H9B A;  4OER A;  1VFE A;  1FQA A;  3OMB A;  2AYS A;  3PPR A;  3R26 A;  2REG A;  5H8N B;  3SEY A;  4YKI A;  3T9X B;  2I4C A;  1SBP A;  4IY5 A;  3IJX B;  2AL4 A;  1Z7M E;  2QMX A;  1AL3 A;  3HHF A;  1MXU A;  2DVC A;  1B7Z A;  3OEN A;  4C1T A;  4PP0 A;  4PFY A;  1I6Q A;  1MY4 A;  3T9H B;  3O6I A;  5FTH A;  4X1D A;  1FQD A;  1QW0 A;  2AL5 A;  2QL3 A;  4EF1 A;  2H4I A;  3MVW A;  2OCU A;  3T96 B;  3TTL A;  2ZNU A;  2F6G A;  3KOS A;  2M8C A;  4YKK A;  1H76 A;  4LVQ A;  3QIM A;  1IIT A;  3RNN A;  5DVJ A;  2QSX A;  3LUY A;  3UK4 A;  3O28 A;  1IXH A;  5J1D A;  4F3G A;  3TCH A;  3C34 A;  1ZJL A;  4NF4 A;  2Z23 A;  2AIX A;  1DMB A;  3H6W A;  5CBS A;  5B7D A;  3N26 A;  1FQF A;  3VVF A;  1GGG A;  3DRK A;  1ZMG A;  2UYF A;  4U1O A;  4QFL A;  3TTM A;  3MWB A;  4YB5 A;  1S7Y A;  4OMB A;  3FXU A;  4OVJ A;  4ELO A;  4OFJ A;  3C31 A;  1MXX A;  3C35 A;  3K6V A;  3H7M A;  4DDD A;  1YPN A;  3PPP A;  4BDL A;  3EF7 A;  2I49 A;  3BFT A;  1MQJ A;  3PMV A;  4Q5T A;  2H5Y A;  3RTW B;  1HSJ A;  4KCC A;  3VFJ A;  1B0L A;  3OEK A;  3W9V A;  3VLU A;  1TXF A;  4U1Z A;  3U72 A;  4M1V A;  3MP6 A;  5EYF A;  3IOT A;  4YB7 A;  2G93 A;  4OYV A;  1DOT A;  5L9M A;  3FVO A;  3K6X A;  4G4P A;  5HM4 B;  3TAJ A;  1B51 A;  1FTK A;  3PUW E;  5K2X A;  5CMB A;  3W9W A;  1DTZ A;  1UTB A;  1MM6 A;  3UGW A;  4KI0 E;  1NH8 A;  3G3K A;  4ISU A;  1N04 A;  1B32 A;  3PPO A;  4F1Y A;  1JEV A;  5I2K B;  5AA2 B;  1JW5 A;  3IK6 B;  3K4U A;  2NUV A;  5BUU A;  4KQP A;  1MXV A;  1NMU A;  1NKX A;  2F36 A;  2FNC A;  2GHB A;  3EHT A;  2Z22 A;  1ZTY A;  4OQO A;  4NF6 A;  3S9M C;  3IL1 B;  4HTG A;  3MP1 A;  4GL0 A;  1IIW A;  4JB7 A;  4ZEB A;  5I58 B;  4XXU A;  1SW4 A;  3UOR A;  5I56 A;  3PUX E;  4N13 A;  4TLM B;  5EHM A;  4DXC A;  4LP2 B;  3SET A;  1J1N A;  4OWD A;  2D3I A;  5KZT A;  1A55 A;  4I62 A;  2XXH A;  1Z7N E;  3K1N A;  3E4R A;  3PV0 E;  2RC8 A;  4UA8 A;  2YLN A;  1M5D A;  1M5E A;  4OES A;  1CB6 A;  3ZSF A;  4PFW A;  1PBQ A;  4LZ7 A;  4FAT A;  1MY1 A;  3B6T A;  3LVU A;  4GXS B;  3K6U A;  5DEX A;  3MBP A;  3G3I A;  1NL5 A;  4OFL A;  1A8F A;  4GRK A;  1PB7 A;  4XKP A;  1QUK A;  2GRV A;  5H8F A;  1D4N A;  1B3H A;  5KDT A;  1MH3 A;  5A5X B;  3MAM A;  1SDX A;  2OLB A;  5TP9 B;  3SEV A;  2O7I A;  1ZKB A;  4QSD A;  2XXX A;  3TZA A;  2WOL A;  5DVF A;  2PYY A;  4MLV A;  2XXW A;  4FED A;  4IO4 A;  4YB6 A;  4GFR A;  2Y7R A;  4E0X A;  3H3G A;  3O29 A;  2I48 A;  4OEU A;  3Q26 A;  3VLW A;  2B65 A;  2PT1 A;  3FGS A;  1B3F A;  1P1W A;  2Y84 A;  2V93 A;  3PD9 A;  5TPA A;  2XXV A;  3CG3 A;  1SQY A;  3KSJ A;  3ECR A;  4ZE9 A;  1FTL A;  1LGB C;  2RCA A;  1OQG A;  2F34 A;  4EQ9 A;  4DE8 A;  1QUI A;  3FZV A;  4N07 A;  3MZB A;  2VGQ A;  3OOA A;  3TUS A;  2R9J A;  4R72 A;  3U93 A;  1XVY A;  5L9S A;  2RF1 A;  1XS5 A;  5M2V A;  3RLF E;  3EHU A;  4ND9 A;  4KR5 A;  4U4S A;  4YU0 A;  3I5O A;  1MQG A;  1M5C A;  1CE2 A;  3PPN A;  2HAV A;  4RK2 A;  4FEC A;  5I84 A;  1IXG A;  4NE4 A;  2ZNS A;  1PEB A;  4OXV A;  4F29 A;  4R6Y A;  2O68 A;  4RNS A;  4XKQ A;  2DSF A;  3KN8 A;  1IEJ A;  1JNF A;  2O51 A;  5LOM A;  4JBZ A;  1ZIU A;  1N7W A;  3G3F A;  1EZ9 A;  1US5 A;  5FHM A;  1H45 A;  3L6G A;  1SI1 A;  2Y7P A;  1A99 A;  2NOO A;  1B5H A;  3LSL A;  3FXR A;  2V3U A;  1Y3P A;  3EN3 A;  2XD3 A;  2QMW A;  5HBC A;  1MS7 A;  2DWJ A;  4FEB A;  4Z0I A;  2DWA A;  4YKJ A;  4RPO A;  1A54 A;  2G29 A;  4OHN A;  1FTM A;  4C1U A;  1VSO A;  4NWC A;  3MP8 A;  1PC3 A;  4POX A;  1IXC A;  1QKB A;  1UTH A;  3FJG A;  1B1X A;  3KGC A;  5ITO A;  3DRG A;  2XHD A;  4PE5 B;  2IA4 A;  5I59 A;  3O6H A;  5AE4 A;  1MRP A;  3IB1 A;  2I0C A;  3IR1 A;  4MLQ A;  3PU5 A;  2ZYN A;  2UYE A;  1TFD A;  2A5T A;  2BJJ X;  3Q27 A;  5AA4 B;  3D4C A;  3RUM A;  4NWD A;  1ZBM A;  3OXN A;  1B6H A;  2Q2C A;  2Q89 A;  2Q9T A;  5L9O A;  3QSL A;  1LBB A;  3IJO B;  3QUF A;  3FAS A;  2RIN A;  3OO6 A;  4FAJ A;  3ZKL A;  1WDN A;  2PX1 A;  3PAM A;  4THI A;  1N84 A;  2RC7 A;  5K2Y A;  2ALU A;  1FQB A;  1MG1 A;  4R9F A;  1NNF A;  2Q8J A;  2QS4 A;  5JK4 A;  4BDR A;  4TQU Q;  3TMG A;  4QFP A;  4KYE A;  1HSL A;  4IB2 A;  3MZ9 A;  1D9Y A;  5EHS A;  4LAT A;  5DVI A;  4GLI A;  1EZP A;  2XX7 A;  3ODB A;  2ANJ A;  1B3G A;  1PBP A;  1B3L A;  3RQT A;  3EQ1 A;  4G8M A;  4ZE8 A;  1NFT A;  4H0W A;  1LB9 A;  2F7B A;  2ABH A;  3FVN A;  1QUJ A;  4OFO A;  2I3W A;  4X48 A;  4DLD A;  1B5J A;  1URS A;  1MDP 1;  1IXI A;  1M5F A;  3N5L A;  2V3Q A;  1OLA A;  2RC9 A;  1O63 A;  3T9U A;  3ONM A;  3A09 A;  1ANF A;  3B7D A;  1N3W A;  3SEW A;  2PVU A;  4OTE A;  5H8H A;  2V84 A;  2GHA A;  2DXR A;  1F9B A;  3B6Q A;  3GBA A;  5CMK A;  1Y1Z A;  2UVH A;  3K2D A;  3R6U A;  5I2N B;  3FJM A;  1VFD A;  1AOV A;  3VV5 A;  3LBS A;  3OEL A;  1AIV A;  3Q29 A;  3U94 A;  5H8Q A;  4WED A;  4H1X A;  1T0K A;  2KLF A;  3A3U A;  3GBB A;  5F7V A;  4YZZ A;  2W7Y A;  2DYX A;  3MZ1 A;  1BTJ A;  4RYA A;  3A3C A;  2OK2 A;  3PUZ E;  4G68 B;  4BDN A;  3DLN A;  2E1S A;  2I6E A;  2DE2 A;  1B4Z A;  1B52 A;  4G8N A;  3K01 A;  4RY1 A;  2WOP A;  4EDP A;  5CBR A;  2R71 A;  2F7C A;  2NWJ A;  4P0G A;  3RPW A;  1XHY A;  2E0S A;  3VXB A;  1I69 A;  1NH7 A;  1JVY A;  2H99 A;  1NNP A;  2O1M A;  4LUB A;  1MDQ A;  1FW0 A;  3DP6 A;  5ELV A;  4RPN A;  5DTB A;  1Y9U A;  4EXL A;  2CZL A;  3M3L A;  4YKP A;  4H5F A;  3KN7 A;  4M4G A;  5DYH A;  1EU8 A;  3MPK A;  5KCJ A;  1ATG A;  4EXK A;  1P1O A;  3HCQ A;  3PUY E;  2QS2 A;  1OVB A;  4GL8 A;  3FTO A;  4KHZ E;  2YJP A;  3O2A A;  3MVZ A;  2F6P A;  2YPN A;  4H65 A;  3DRF A;  1YAE A;  1JW1 A;  4K3F A;  3PMW A;  3B6W A;  3FJ7 A;  3CSG A;  5JTY B;  1LAH E;  1SW5 A;  2F97 A;  4ZEI A;  4NF8 B;  1OMP A;  2Y7K A;  2H98 A;  2Q2A A;  4KCD A;  5ICT A;  3S9E A;  4R2B A;  1PB9 A;  4ELQ A;  4R2F A;  2D21 A;  2O7U A;  4IGR A;  1XOC A;  2P0S A;  2XXP A;  3MPL A;  4AQ4 A;  3CR9 A;  1RYO A;  3HST A;  4H8J A;  3KZG A;  3OO7 A;  3TTN A;  1USY E;  5CMM A;  2F8D A;  1MQI A;  5DT6 A;  1MPC A;  2P2A A;  3K1P A;  3N6T A;  3K0V A;  1B40 A;  2B4M A;  3CIJ A;  1SW2 A;  4XKR A;  4IO7 A;  1QKA A;  3MVY A;  3L6H A;  4G68 C;  1Y4T A;  3BBR A;  2HEU A;  4XKN A;  3KJ7 A;  1LAG E;  4QF9 A;  3LSX A;  3QK6 A;  3TQW A;  2F7A A;  2I0B A;  1OQH A;  4NF5 A;  4F39 A;  4TOZ A;  3HN0 A;  1LAX A;  3TCF A;  1MY2 A;  2Q88 A;  4F3S A;  3IB0 A;  3C33 A;  2Z8F A;  3C4M A;  3HO7 A;  3I3V A;  4U21 A;  1N3X A;  1QUL A;  2F35 A;  3TFL A;  1ELJ A;  3MJN A;  1HSE A;  3WAF A;  3W15 C;  1FTO A;  4QFO A;  4JXI A;  2DVZ A;  2OWT A;  5ICQ A;  1SI0 A;  4EQB A;  2VP1 A;  3BKI B;  5I57 A;  2QRY A;  5FHN A;  4HCW A;  2Z8E A;  1LFI A;  2B3B A;  4U2R A;  3RYB A;  3MUQ A;  1SYI A;  1N76 A;  4LQ5 A;  1MM7 A;  4FOR A;  1BIY A;  2DE4 A;  4ESW A;  2REJ A;  1FQE A;  2Y7W A;  1SD3 A;  1OVT A;  4Q30 B;  3LC8 A;  4U23 A;  2CMO A;  1UTB B;  1B7H A;  3SER A;  3CHG A;  2XD2 A;  3V89 B;  3GLB A;  3C32 A;  1MXW A;  4DCX A;  3VXC A;  1L5T A;  5TU0 A;  1LAF E;  3CVG A;  3MQ9 A;  4MF3 A;  2DS9 A;  5H8N A;  1D9V A;  3KN3 A;  4HW8 A;  1LLS A;  1BLF A;  3MW0 A;  3N6U A;  1TFA A;  1ZU0 A;  1B58 A;  4I8C A;  2F5X A;  2I58 A;  4F1U A;  1I6B A;  3FD3 A;  3FUZ A;  3KEI A;  4KFQ A;  3O6G A;  4KPT A;  4DCY A;  5CC2 A;  1GVC A;  1H44 A;  1LCT A;  1UIV A;  3DEL B;  3K6W A;  2PT2 A;  3SEU A;  1B05 A;  3G3G A;  4N6P A;  3FV1 A;  3EHS A;  1FQC A;  4O3A A;  5H8S A;  4FIM A;  4QSE A;  3G3H A;  2OJT A;  4ZZE A; 
#chains in the Genus database with same CATH topology
 4DIG A;  1TWY A;  5EQ8 A;  5DEX B;  1JW4 A;  4PTK A;  1JQF A;  4EF2 A;  1NUW A;  3RN8 A;  2HAU A;  3FIR A;  2O6A A;  1AH5 A;  4GWO A;  4MFI A;  1KWH A;  2HQ0 A;  3FV2 A;  3Q25 A;  1URG A;  3IX1 A;  5H8F B;  2I3V A;  5B70 A;  5KDT B;  4G77 A;  4LQ2 A;  2QS1 A;  2IEE A;  3H4Z A;  1GV8 A;  4KD5 A;  5ISU A;  2XWV A;  2OBG A;  2P1S A;  2UVG A;  4HCY A;  4JWY A;  2WOK A;  3E9X A;  4Q0C A;  1P1Q A;  3CFZ A;  3SES A;  4BDQ A;  3JYR A;  2WKY A;  3TOD A;  1DPP A;  2PBW A;  4GIZ A;  2QFL A;  3OEM A;  2DWI A;  3O97 A;  5TPA B;  3KJT A;  1JVX A;  1FCK A;  3ILT B;  3T9V A;  2QS3 A;  3RY3 A;  3VDF A;  4GD5 A;  2DOJ A;  2R6G E;  3HPI A;  2ZMB A;  4NGU A;  1NV6 A;  4H5G A;  3SDF A;  4F3P A;  5I2K A;  2HZK A;  4X9T A;  2Y5L A;  5AA2 A;  4LON B;  2VOZ A;  3M8U A;  3FVK A;  4PET A;  5ET8 A;  4R75 A;  4IO6 A;  5IKB A;  5A5L A;  3JZJ A;  5FTI A;  3WAE A;  2Z8D A;  3OD7 A;  2XXT A;  5BWJ A;  1P1N A;  3V83 A;  5IAI A;  3S2V A;  2ZYO A;  2GFE A;  5JTY A;  1PB8 A;  1FBP A;  4G2Z A;  3DRH A;  4NMY A;  4AB6 A;  3USD A;  5I58 A;  4Z7E A;  1MXZ A;  3TEL A;  1POY 1;  2RKM A;  2O84 X;  1P99 A;  1JET A;  1UQW A;  3U1O A;  3U8Q A;  2VD2 A;  3A29 A;  3U92 A;  2B3F A;  4ZS9 A;  1Y20 A;  3DP4 A;  2DQV A;  3EKI A;  1LFH A;  1FPI A;  3FXB A;  3PMX A;  3OO8 A;  2HFB A;  1LBW A;  2LAO A;  3Q28 A;  4GXA A;  4PBH A;  1Q1K A;  1YCJ A;  3C36 A;  5EYH A;  1Y4C A;  1CNQ A;  1IUD A;  1A7L A;  2MKZ A;  2XXR A;  1JEU A;  1IQ7 A;  4GWU A;  1BK4 A;  3H06 B;  4WEP A;  4I40 A;  2XXQ A;  3IOR A;  4YMB A;  3PD8 A;  1FBE A;  1B0H A;  3ZKK A;  1MXY A;  4MNI A;  4UAB A;  3EPE A;  2I4B A;  3ILU B;  1LFG A;  4G61 A;  3OSR A;  4U4X A;  3KSX A;  5A5X A;  4YMA A;  1FJ9 A;  5TP9 A;  1MQD A;  4QRZ A;  1Y3N A;  4MHF A;  2OWS A;  1UTH B;  1Y1M A;  3K1M A;  1OIB A;  1AMF A;  3O9P A;  5I59 B;  2B4L A;  2HHM A;  1N7X A;  1NNT A;  4YIC A;  2FVZ A;  1NV0 A;  2A5S A;  1US4 A;  1FTJ A;  3O66 A;  1DSN A;  5FHO A;  2VHA A;  2QVV A;  2A5T B;  5CM6 A;  3T93 B;  4H6D A;  3V5A A;  3KBR A;  1R9L A;  1S9T A;  3LSW A;  1DPE A;  2H25 A;  2DWH A;  1O64 A;  4BDM A;  3PGF A;  1XVX A;  3H03 A;  4NED A;  1II5 A;  3CG1 A;  5JEI A;  4KXP A;  2FA7 A;  4QSC A;  3QUJ A;  1MPD A;  4I9D A;  2ZNT A;  4ZED A;  1LBC A;  2V3T A;  2DXY A;  1B1H A;  1EZO A;  4PFR A;  2UVJ A;  4QFK A;  3T22 A;  2DE3 A;  1NUX A;  4EQ7 A;  3QYT A;  2KQZ A;  5I7I A;  1B5I A;  2WX9 A;  3FAT A;  1O7T A;  1XT8 A;  5AA3 A;  4AB5 A;  2L5V A;  2CZH A;  3CFL A;  4JSO A;  3QXM A;  4ONY A;  2O69 A;  4UAC A;  3TCG A;  4DXU A;  3LSF B;  4FE8 A;  4L17 A;  2ONK E;  1LB8 A;  2ONR A;  4N6D A;  4C0R A;  4N91 A;  2PMS A;  4RJZ A;  3C9H A;  5I3S A;  1RKM A;  2WYP A;  1FPL A;  3CFX A;  4F18 A;  1LBX A;  3IOW A;  2OZZ A;  4KYS A;  1Q9D A;  3TTK A;  3DP8 A;  3KFM A;  3KG2 A;  4BDO A;  1K9Z A;  5I5P A;  3IB2 A;  4NTL A;  3CI8 A;  3SEX A;  3BFU A;  2XX9 A;  1FRP A;  3FVG A;  4IO2 A;  4OEV A;  4HE2 A;  4GOT A;  1B2H A;  3R7X A;  2THI A;  1MQH A;  4POW A;  3P7I A;  1IZ1 A;  4ZZA A;  5H8H B;  4ZEF A;  5HPQ A;  4XEQ A;  3CSB A;  4F19 A;  1SYH A;  1N0T A;  4QFN A;  3F11 A;  3RTF B;  4IO5 A;  1SW1 A;  1FBG A;  3IOU A;  1B3E A;  4ECF A;  1LCF A;  1YTV A;  5EQ9 A;  5ET6 A;  4NG7 A;  1LST A;  4IGT A;  4XTC Q;  3T1B A;  4NQ8 A;  3I6V A;  5AA1 A;  2WEF A;  4X1B A;  1INP A;  5IGA A;  5H8Q B;  4R6K A;  4MNC A;  3GZG A;  1MY0 A;  4NF4 B;  4E0W A;  5IZ3 A;  1DTG A;  3H6T A;  1LBZ A;  2FYI A;  2ZXT A;  4G8H A;  3V8X B;  2GH9 A;  5AA4 A;  3N94 A;  2ONS A;  2HZL A;  4DZ1 A;  2Y5K A;  5FBP A;  2XX8 A;  4LZ8 A;  5EQ7 A;  2NVU B;  4F22 A;  4R74 A;  4IO3 A;  4RK9 A;  4PE3 A;  1WOD A;  3K00 A;  4OET A;  1Y3Q A;  3LR1 A;  3OO9 A;  4H8I A;  4OA4 A;  5CI5 A;  3S4U A;  3QAX A;  2PFY A;  3PPQ A;  2P3N A;  4RA1 A;  2FIE A;  5ITP A;  3THI A;  2PFZ A;  1QJM A;  4JSD A;  2RCB A;  1EH3 A;  4I1D A;  3RGY A;  4JWX A;  3G7W A;  1S50 A;  3RT8 A;  3MC2 A;  1I6A A;  4F2Q A;  3DM0 A;  3TQL A;  4ESX A;  5KCJ B;  4AS4 A;  3UP9 A;  4IY6 A;  5IZZ A;  4XIG Q;  4O3C A;  2ZYM A;  1B4H A;  2X7Q A;  4TLL B;  3VVE A;  3VVD A;  4RXL A;  4PQJ A;  2F78 A;  1Q35 A;  1B9J A;  3IFA A;  4ZDM A;  3ROJ A;  2V4C A;  4ELR A;  3TPA A;  2O1L A;  3E3K A;  3AXF A;  1MY3 A;  3E78 A;  4OEN A;  3VE1 B;  1MH4 A;  3MVX A;  3E13 X;  1SVX B;  3HHG A;  4GQO A;  1USY H;  4EUO A;  3S9N C;  3OSQ A;  1ZLQ A;  1BKA A;  1FBH A;  3T0J A;  4NF6 B;  4WKM A;  1NNK A;  1R6Z A;  3RT6 B;  1BP5 A;  1A8E A;  1FPK A;  1WVJ A;  5I56 B;  4DXB A;  1NUZ A;  4MBP A;  1H43 A;  5AA2 D;  3G3J A;  1KZ8 A;  1PDA A;  2XXU A;  2PCR A;  4ZEC A;  4H45 A;  4GF8 A;  5CMC A;  3UIF A;  3DRJ A;  2HCA A;  3SKP A;  5I2N A;  4WXJ A;  1M5B A;  3S9L C;  3JV9 A;  2X26 A;  1OLC A;  4Q8R A;  1POT A;  4PFI A;  4R73 A;  2XXI A;  4O7M A;  4GX3 A;  2UVI A;  4GWZ A;  1B46 A;  3M3F A;  4QHQ A;  4PFT A;  1R1N A;  4OZ9 A;  1H3D A;  4JWO A;  2CEY A;  1GR2 A;  3FXQ A;  1GTK A;  3T66 A;  4FJP A;  2DP8 A;  1B7U A;  4MH5 A;  2V25 A;  4LA9 A;  4ELP A;  1UIU A;  4G68 A;  2QPQ A;  1RYX A;  5F1Q A;  4N8G A;  1VE4 A;  4O3B A;  4F2O A;  4NF5 B;  1QGX A;  3D4G A;  2HXW A;  4N8Y A;  3CRB A;  3M3K A;  4O7I A;  1XC1 A;  2ESN A;  3PUV E;  3TYH A;  1FJ6 A;  2QJE A;  4P1L A;  3B8B A;  1D3K A;  4PGN A;  3UA8 A;  4R6H A;  3TDJ A;  3DRI A;  1NV7 A;  1P1U A;  4GVO A;  3ZS6 A;  3TTR A;  3K02 A;  3GXA A;  3TEP A;  2VD3 A;  4P11 A;  3IO4 A;  1A40 A;  4U22 A;  5CRY A;  2X7P A;  3PTY A;  4N81 A;  5L8D A;  1URD A;  1KA0 A;  1RDY A;  4LZ5 A;  4OVP A;  3TKD A;  2NXO A;  5I57 B;  1FPG A;  1VR5 A;  3H6U A;  3IO6 A;  2ZYK A;  4H67 A;  4P0I A;  3HV1 A;  3KOT A;  1QVS A;  4YAH X;  4BLA A;  2UXA A;  4R9G A;  1RDZ A;  4F3B A;  2D5W A;  1VDW A;  4F1V A;  1R9Q A;  1TT1 A;  1MPB A;  2Y7I A;  3UN6 A;  4KYD A;  4ZEK A;  3IOV A;  3O6P A;  4JDF A;  4F31 B;  2XXY A;  3IAZ A;  4NF8 A;  4HS7 A;  4PFU A;  3RYA A;  3H6V A;  3VLV A;  1LBY A;  2H9B A;  4OER A;  2FIX A;  1FPB A;  1VFE A;  1FQA A;  3OMB A;  2AYS A;  3PPR A;  3R26 A;  4N15 A;  2REG A;  5H8N B;  3SEY A;  4YKI A;  4MEV A;  2I4C A;  3T9X B;  1SBP A;  4IY5 A;  3IJX B;  2AL4 A;  1Z7M E;  2QMX A;  1AL3 A;  5EYG A;  4N4U A;  3HHF A;  1MXU A;  2DVC A;  4O8M A;  1B7Z A;  4I3E A;  3OEN A;  4C1T A;  4PP0 A;  4PFY A;  1I6Q A;  1MY4 A;  3T9H B;  3O6I A;  5FTH A;  4X1D A;  1FQD A;  4MCO A;  1QW0 A;  2AL5 A;  2QL3 A;  4EF1 A;  2H4I A;  3MVW A;  2OCU A;  3SZP A;  3T96 B;  3TTL A;  2ZNU A;  2F6G A;  3KOS A;  2M8C A;  4YKK A;  1H76 A;  2GQ1 A;  4LVQ A;  3QIM A;  1IIT A;  3RNN A;  5DVJ A;  2QSX A;  3LUY A;  3UK4 A;  3KC0 A;  3O28 A;  1IXH A;  5J1D A;  4F3G A;  3TCH A;  3C34 A;  4NX1 A;  3RPL B;  1ZJL A;  4NF4 A;  2Z23 A;  2AIX A;  1DMB A;  3H6W A;  5CBS A;  5B7D A;  3N26 A;  1FQF A;  3VVF A;  1GGG A;  1XI6 A;  1IMC A;  3DRK A;  1ZMG A;  2UYF A;  4U1O A;  4QFL A;  3TTM A;  3MWB A;  4YB5 A;  1S7Y A;  4OMB A;  3FXU A;  4PC9 A;  4OVJ A;  4ELO A;  4OFJ A;  1YYZ A;  3C31 A;  1MXX A;  3C35 A;  1FPD A;  3K6V A;  3H7M A;  4DDD A;  1YPN A;  3PPP A;  4MIJ A;  1FPE A;  4MAG A;  4BDL A;  3EF7 A;  4JVI A;  2I49 A;  3BFT A;  1MQJ A;  3PMV A;  4Q5T A;  2H5Y A;  3RTW B;  1HSJ A;  4KCC A;  3VFJ A;  1B0L A;  3OEK A;  3W9V A;  3VLU A;  1TXF A;  4U1Z A;  3U72 A;  4M1V A;  3MP6 A;  5EYF A;  4N17 A;  3IOT A;  4YB7 A;  4OYV A;  2G93 A;  1DOT A;  5L9M A;  3FVO A;  3K6X A;  4G4P A;  5HM4 B;  3TAJ A;  1B51 A;  1FTK A;  3PUW E;  5K2X A;  5CMB A;  3W9W A;  1DTZ A;  1UTB A;  1MM6 A;  3UGW A;  4KI0 E;  1NH8 A;  3G3K A;  4ISU A;  1N04 A;  1B32 A;  3PPO A;  4HXV A;  4F1Y A;  1JEV A;  5I2K B;  4NN3 A;  2OX3 A;  5AA2 B;  1JW5 A;  3IK6 B;  4P3L A;  3K4U A;  2R8T A;  2NUV A;  5BUU A;  4KQP A;  1MXV A;  1DBZ A;  1NMU A;  4JVD A;  4DI4 B;  1NKX A;  2F36 A;  2FNC A;  2GHB A;  3EHT A;  2Z22 A;  1ZTY A;  4OQO A;  1KA1 A;  4NF6 A;  3S9M C;  3IL1 B;  4HTG A;  3MP1 A;  4GL0 A;  4GX4 A;  1IIW A;  4I3Y A;  4JB7 A;  4ZEB A;  5I58 B;  4XXU A;  1IMB A;  1SW4 A;  3UOR A;  5I56 A;  3PUX E;  4N13 A;  4PAI A;  4TLM B;  2VT5 A;  1DCU A;  5EHM A;  4DXC A;  4LP2 B;  3SET A;  1J1N A;  4OWD A;  1NI9 A;  2D3I A;  5KZT A;  1A55 A;  4GBV A;  4I62 A;  2XXH A;  1Z7N E;  3K1N A;  3E4R A;  4X8R A;  3PV0 E;  2RC8 A;  4UA8 A;  2YLN A;  1M5D A;  1FPJ A;  1M5E A;  4OES A;  4PGP A;  1CB6 A;  3ZSF A;  4PFW A;  1PBQ A;  1FBD A;  4LZ7 A;  4FAT A;  1MY1 A;  3B6T A;  3LVU A;  1LEV A;  4GXS B;  3K6U A;  5DEX A;  2HPG A;  3MBP A;  3G3I A;  1NL5 A;  4OFL A;  1A8F A;  2VPO A;  4GRK A;  1PB7 A;  4XKP A;  4GBW A;  3LV0 A;  1QUK A;  2GRV A;  5H8F A;  1D4N A;  1B3H A;  5KDT A;  1MH3 A;  5A5X B;  3MAM A;  4O94 A;  3E79 A;  3MYU A;  1SDX A;  2OLB A;  4MJO A;  5TP9 B;  3SEV A;  2O7I A;  1ZKB A;  4QSD A;  2XXX A;  3TZA A;  2WOL A;  3HFU A;  4MX6 A;  5DVF A;  2FBP A;  2PYY A;  4MLV A;  2XXW A;  3B50 A;  4FED A;  1AWB A;  4IO4 A;  4YB6 A;  1IMF A;  4GFR A;  2Y7R A;  4E0X A;  3H3G A;  3O29 A;  2I48 A;  4OEU A;  3Q26 A;  3VLW A;  4H46 A;  2B65 A;  1IMD A;  2PT1 A;  3FGS A;  1B3F A;  1P1W A;  2Y84 A;  1NV1 A;  2V93 A;  3D1R A;  3PD9 A;  5TPA A;  2XXV A;  3CG3 A;  1SQY A;  3KSJ A;  2F3D A;  3ECR A;  4ZE9 A;  2WBD A;  2VPN A;  1FTL A;  1LGB C;  2RCA A;  1OQG A;  2F34 A;  4QBA A;  4EQ9 A;  4DE8 A;  1QUI A;  3FZV A;  4N07 A;  4N6K A;  3MZB A;  2VGQ A;  3OOA A;  4PAF A;  3KBZ A;  3MST A;  3TUS A;  2R9J A;  1D9Q A;  4R72 A;  2DDK A;  3U93 A;  1XVY A;  5L9S A;  2RF1 A;  1XS5 A;  5M2V A;  3RLF E;  3EHU A;  4ND9 A;  4KR5 A;  4U4S A;  4YU0 A;  3I5O A;  1MQG A;  3ISP A;  1M5C A;  1CE2 A;  3PPN A;  2HAV A;  4RK2 A;  4FEC A;  1K9Y A;  5I84 A;  1IXG A;  4NE4 A;  2ZNS A;  1PEB A;  4OXV A;  4F29 A;  4R6Y A;  4X04 A;  2O68 A;  4RNS A;  4XKQ A;  2DSF A;  3KN8 A;  1IEJ A;  1JNF A;  2O51 A;  5LOM A;  4JBZ A;  4HE1 A;  1ZIU A;  1N7W A;  1JP4 A;  5T3J A;  3G3F A;  1EZ9 A;  1US5 A;  5FHM A;  1H45 A;  3L6G A;  1SI1 A;  2Y7P A;  1A99 A;  2NOO A;  1B5H A;  4OVR A;  3LSL A;  3FXR A;  2V3U A;  1Y3P A;  3EN3 A;  2XD3 A;  2QMW A;  5HBC A;  1MS7 A;  2DWJ A;  4FEB A;  1LBV A;  4Z0I A;  2DWA A;  4YKJ A;  5ESY A;  4RPO A;  1A54 A;  2G29 A;  4OHN A;  1FTM A;  4C1U A;  1SPI A;  1VSO A;  4NWC A;  3MP8 A;  1PC3 A;  4POX A;  1IXC A;  1QKB A;  1UTH A;  3FJG A;  3RPL A;  1B1X A;  3KGC A;  5ITO A;  3DRG A;  2XHD A;  4PE5 B;  2IA4 A;  5F24 A;  5I59 A;  3O6H A;  5AE4 A;  1MRP A;  3IB1 A;  2I0C A;  3IR1 A;  5IZ1 A;  4MLQ A;  3PU5 A;  2ZYN A;  5IZ3 B;  2UYE A;  1TFD A;  3GYY A;  4NAP A;  2A5T A;  2BJJ X;  1NV3 A;  3Q27 A;  5AA4 B;  3D4C A;  3RUM A;  4NWD A;  1ZBM A;  2ZZV A;  3OXN A;  1B6H A;  2Q2C A;  2Q89 A;  2Q9T A;  5L9O A;  3QSL A;  1LBB A;  3IJO B;  3QUF A;  3FAS A;  2RIN A;  3OO6 A;  4FAJ A;  3ZKL A;  1WDN A;  2PX1 A;  3PAM A;  4THI A;  1N84 A;  2RC7 A;  5K2Y A;  1YZ0 A;  2ALU A;  1FQB A;  1MG1 A;  4R9F A;  1NNF A;  2Q8J A;  2QS4 A;  5JK4 A;  4BDR A;  4TQU Q;  3TMG A;  4QFP A;  4KYE A;  4PBQ A;  1HSL A;  4IB2 A;  3MZ9 A;  1D9Y A;  5EHS A;  4LAT A;  5DVI A;  4GLI A;  1FTA A;  1EZP A;  5J16 A;  2XX7 A;  3ODB A;  2ANJ A;  4OVQ A;  4PAK A;  1B3G A;  3BIG A;  1PBP A;  2XWI A;  1B3L A;  3RQT A;  1DK4 A;  3EQ1 A;  4G8M A;  4ZE8 A;  1NFT A;  4H0W A;  1LB9 A;  2F7B A;  2ABH A;  3FVN A;  1QUJ A;  1IMA A;  4OFO A;  2I3W A;  4X48 A;  4DLD A;  1B5J A;  1URS A;  1MDP 1;  1IXI A;  1M5F A;  3N5L A;  2V3Q A;  1OLA A;  2RC9 A;  1O63 A;  3T9U A;  3ONM A;  3A09 A;  1ANF A;  3LUZ A;  3B7D A;  4GWW A;  1N3W A;  3SEW A;  2PVU A;  4OTE A;  2ZZW A;  2Q8M A;  5H8H A;  4NF0 A;  2JJK A;  2V84 A;  2GHA A;  4MMP A;  2DXR A;  1F9B A;  3B6Q A;  3GBA A;  5CMK A;  1NV2 A;  4OVS A;  1Y1Z A;  1G0H A;  2UVH A;  3K2D A;  3R6U A;  5I2N B;  3FJM A;  4NHB A;  1VFD A;  1AOV A;  1FPF A;  1EYJ A;  3VV5 A;  4GWX A;  3LBS A;  3OEL A;  1AIV A;  1EYI A;  3Q29 A;  4PDH A;  3U94 A;  2WYK A;  5H8Q A;  4WED A;  4H1X A;  1NUY A;  1T0K A;  2KLF A;  3A3U A;  3GBB A;  5F7V A;  4YZZ A;  2W7Y A;  2DYX A;  3MZ1 A;  1BTJ A;  4RYA A;  3A3C A;  2OK2 A;  1YXI A;  3PUZ E;  4G68 B;  4BDN A;  3DLN A;  2E1S A;  2I6E A;  2QVU A;  2DE2 A;  1B4Z A;  1B52 A;  4G8N A;  3K01 A;  4RY1 A;  2WOP A;  4EDP A;  5CBR A;  4PF6 A;  2R71 A;  2F7C A;  2NWJ A;  4P0G A;  3RPW A;  1XHY A;  2E0S A;  3VXB A;  1I69 A;  1NH7 A;  3QMF A;  1JVY A;  5LDZ A;  2H99 A;  1NNP A;  2ZZX A;  2O1M A;  4LUB A;  1MDQ A;  1FW0 A;  3DP6 A;  5ELV A;  4RPN A;  5DTB A;  1Y9U A;  4EXL A;  1FBC A;  2CZL A;  3M3L A;  4YKP A;  4H5F A;  3KN7 A;  4M4G A;  5DYH A;  1EU8 A;  3MPK A;  5KCJ A;  1ATG A;  4IR8 A;  4EXK A;  3NOH A;  1P1O A;  3HCQ A;  3PUY E;  1NV5 A;  2QS2 A;  1OVB A;  4GL8 A;  2XWO A;  3KC1 A;  3FTO A;  2P3V A;  4KHZ E;  4GWY A;  2YJP A;  3O2A A;  5IM2 A;  3MVZ A;  2F6P A;  2YPN A;  4H65 A;  3DRF A;  4QXD A;  1YAE A;  1JW1 A;  5LTC A;  4K3F A;  3PMW A;  3B6W A;  3FJ7 A;  3CSG A;  5JTY B;  4AS5 A;  1LAH E;  1SW5 A;  2F97 A;  4ZEI A;  4FBP A;  4NF8 B;  4PDD A;  1OMP A;  2Y7K A;  2H98 A;  2Q2A A;  4KCD A;  3FBP A;  5ICT A;  4GX6 A;  3S9E A;  1FBF A;  1PB9 A;  4R2B A;  4ELQ A;  4R2F A;  1EYK A;  2D21 A;  2O7U A;  4IGR A;  1XOC A;  2P0S A;  1RDX A;  2QVR A;  2XXP A;  3MPL A;  4AQ4 A;  3CR9 A;  1RYO A;  4XFE A;  3HST A;  4H8J A;  3KZG A;  4LN5 A;  3OO7 A;  3TTN A;  1USY E;  5CMM A;  2F8D A;  1MQI A;  5DT6 A;  5ET7 A;  1MPC A;  2P2A A;  2HXR A;  3K1P A;  3N6T A;  4P1E A;  3RYD A;  3K0V A;  1B40 A;  2B4M A;  3CIJ A;  4JVC A;  1SW2 A;  3U65 A;  4XKR A;  4IO7 A;  1QKA A;  4P8B A;  3MVY A;  3L6H A;  4G68 C;  1Y4T A;  3BBR A;  2HEU A;  4XKN A;  3KJ7 A;  1LAG E;  4QF9 A;  3LSX A;  3QK6 A;  3TQW A;  2F7A A;  2I0B A;  4P47 A;  1OQH A;  4NF5 A;  4F39 A;  4TOZ A;  3HN0 A;  1LAX A;  3TCF A;  1MY2 A;  3BIH A;  2Q88 A;  4F3S A;  1G0I A;  3IB0 A;  3C33 A;  2XXK A;  2Z8F A;  3C4M A;  3HO7 A;  3I3V A;  4U21 A;  1N3X A;  1QUL A;  5EQA A;  2F35 A;  3TFL A;  1ELJ A;  3MJN A;  1HSE A;  2BJI A;  2XA5 A;  2F3B A;  3WAF A;  3W15 C;  1FTO A;  4QFO A;  4MNP A;  1FSA A;  4JXI A;  2KR0 A;  2DVZ A;  2OWT A;  5ICQ A;  1SI0 A;  4P9K A;  4HE0 A;  4EQB A;  2VP1 A;  3IFC A;  3BKI B;  5I57 A;  4XF5 A;  2QRY A;  2CZK A;  1IME A;  5FHN A;  4HCW A;  2Z8E A;  1LFI A;  2B3B A;  4U2R A;  3RYB A;  3MUQ A;  1SYI A;  1N76 A;  4OVT A;  4LQ5 A;  1MM7 A;  4FOR A;  4PFB A;  1BIY A;  2DE4 A;  4ESW A;  2REJ A;  1FQE A;  4P56 A;  2Y7W A;  1SD3 A;  1OVT A;  4Q30 B;  3LC8 A;  4U23 A;  2CMO A;  1UTB B;  1B7H A;  3SER A;  3CHG A;  2XD2 A;  3V89 B;  3GLB A;  3C32 A;  1MXW A;  2FHY A;  4DCX A;  3VXC A;  1L5T A;  5TU0 A;  4PCD A;  1LAF E;  3CVG A;  2CZI A;  2WBB A;  3MQ9 A;  5ET5 A;  4MF3 A;  2DS9 A;  4PF8 A;  5H8N A;  1D9V A;  5DW8 A;  4DI3 D;  3KN3 A;  4HW8 A;  1LLS A;  1BLF A;  2OWZ A;  3MW0 A;  2CEX A;  3N6U A;  1TFA A;  4OAN A;  1ZU0 A;  1B58 A;  4I8C A;  2F5X A;  2I58 A;  4F1U A;  2XWK A;  1I6B A;  3FD3 A;  3FUZ A;  3KEI A;  1NV4 A;  4KFQ A;  3O6G A;  4KPT A;  4DCY A;  5CC2 A;  1GVC A;  1H44 A;  1LCT A;  1UIV A;  3DEL B;  3K6W A;  2PT2 A;  3SEU A;  1B05 A;  3G3G A;  4N6P A;  3FV1 A;  3EHS A;  1FQC A;  4O3A A;  5H8S A;  4FIM A;  4GWS A;  4QSE A;  3G3H A;  2Q74 A;  2OJT A;  4ZZE A; 
#chains in the Genus database with same CATH homology
 4DIG A;  1TWY A;  5DEX B;  1JW4 A;  1JQF A;  4EF2 A;  3RN8 A;  2HAU A;  3FIR A;  2O6A A;  1AH5 A;  4GWO A;  4MFI A;  1KWH A;  2HQ0 A;  3FV2 A;  3Q25 A;  1URG A;  3IX1 A;  5H8F B;  2I3V A;  5B70 A;  5KDT B;  4G77 A;  4LQ2 A;  2QS1 A;  2IEE A;  3H4Z A;  1GV8 A;  4KD5 A;  5ISU A;  2OBG A;  2P1S A;  2UVG A;  4HCY A;  4JWY A;  2WOK A;  3E9X A;  4Q0C A;  1P1Q A;  3CFZ A;  3SES A;  4BDQ A;  3JYR A;  2WKY A;  3TOD A;  1DPP A;  2PBW A;  4GIZ A;  3OEM A;  2DWI A;  3O97 A;  5TPA B;  3KJT A;  1JVX A;  1FCK A;  3ILT B;  3T9V A;  2QS3 A;  3RY3 A;  3VDF A;  4GD5 A;  2DOJ A;  2R6G E;  3HPI A;  2ZMB A;  4H5G A;  3SDF A;  4F3P A;  5I2K A;  2HZK A;  4X9T A;  5AA2 A;  4LON B;  2VOZ A;  3M8U A;  3FVK A;  4PET A;  4R75 A;  4IO6 A;  5IKB A;  3JZJ A;  5FTI A;  3WAE A;  2Z8D A;  3OD7 A;  2XXT A;  5BWJ A;  1P1N A;  3V83 A;  5IAI A;  3S2V A;  2ZYO A;  2GFE A;  5JTY A;  1PB8 A;  4G2Z A;  3DRH A;  4NMY A;  4AB6 A;  3USD A;  5I58 A;  4Z7E A;  1MXZ A;  3TEL A;  1POY 1;  2RKM A;  2O84 X;  1P99 A;  1JET A;  1UQW A;  3U1O A;  3U8Q A;  2VD2 A;  3U92 A;  2B3F A;  4ZS9 A;  1Y20 A;  3DP4 A;  2DQV A;  1LFH A;  3PMX A;  3OO8 A;  2HFB A;  2LAO A;  3Q28 A;  4GXA A;  1Q1K A;  1YCJ A;  3C36 A;  1Y4C A;  1IUD A;  1A7L A;  2XXR A;  1JEU A;  1IQ7 A;  3H06 B;  4WEP A;  2XXQ A;  3IOR A;  4YMB A;  3PD8 A;  1B0H A;  3ZKK A;  1MXY A;  3EPE A;  2I4B A;  3ILU B;  1LFG A;  3OSR A;  4U4X A;  3KSX A;  5A5X A;  4YMA A;  5TP9 A;  1MQD A;  4QRZ A;  1Y3N A;  2OWS A;  1UTH B;  1Y1M A;  3K1M A;  1OIB A;  1AMF A;  3O9P A;  5I59 B;  2B4L A;  1N7X A;  1NNT A;  4YIC A;  2A5S A;  1US4 A;  1FTJ A;  3O66 A;  1DSN A;  5FHO A;  2VHA A;  2A5T B;  5CM6 A;  3T93 B;  4H6D A;  3V5A A;  3KBR A;  1R9L A;  1S9T A;  3LSW A;  1DPE A;  2H25 A;  2DWH A;  1O64 A;  4BDM A;  3PGF A;  1XVX A;  3H03 A;  4NED A;  1II5 A;  3CG1 A;  5JEI A;  2FA7 A;  4QSC A;  3QUJ A;  1MPD A;  4I9D A;  2ZNT A;  4ZED A;  1LBC A;  2V3T A;  2DXY A;  1B1H A;  1EZO A;  2UVJ A;  4QFK A;  3T22 A;  2DE3 A;  4EQ7 A;  3QYT A;  1B5I A;  3FAT A;  1O7T A;  1XT8 A;  5AA3 A;  4AB5 A;  3CFL A;  4JSO A;  3QXM A;  4ONY A;  2O69 A;  4UAC A;  3TCG A;  4DXU A;  3LSF B;  4FE8 A;  4L17 A;  2ONK E;  1LB8 A;  2ONR A;  4C0R A;  2PMS A;  4RJZ A;  3C9H A;  1RKM A;  3CFX A;  4F18 A;  3IOW A;  2OZZ A;  4KYS A;  3TTK A;  3DP8 A;  3KFM A;  3KG2 A;  4BDO A;  3IB2 A;  4NTL A;  3CI8 A;  3SEX A;  3BFU A;  2XX9 A;  3FVG A;  4IO2 A;  4OEV A;  4GOT A;  1B2H A;  3R7X A;  2THI A;  1MQH A;  4POW A;  3P7I A;  1IZ1 A;  4ZZA A;  5H8H B;  4ZEF A;  5HPQ A;  3CSB A;  4F19 A;  1SYH A;  1N0T A;  4QFN A;  3F11 A;  3RTF B;  4IO5 A;  1SW1 A;  3IOU A;  1B3E A;  4ECF A;  1LCF A;  1YTV A;  1LST A;  4IGT A;  4XTC Q;  3I6V A;  5AA1 A;  4X1B A;  5H8Q B;  4R6K A;  3GZG A;  1MY0 A;  4NF4 B;  4E0W A;  1DTG A;  3H6T A;  2FYI A;  2ZXT A;  4G8H A;  3V8X B;  2GH9 A;  5AA4 A;  3N94 A;  2ONS A;  2HZL A;  4DZ1 A;  2XX8 A;  4LZ8 A;  2NVU B;  4F22 A;  4R74 A;  4IO3 A;  4RK9 A;  1WOD A;  3K00 A;  4OET A;  1Y3Q A;  3LR1 A;  3OO9 A;  4H8I A;  5CI5 A;  3S4U A;  3QAX A;  3PPQ A;  4RA1 A;  5ITP A;  3THI A;  1QJM A;  4JSD A;  2RCB A;  1EH3 A;  4I1D A;  3RGY A;  4JWX A;  3G7W A;  1S50 A;  3RT8 A;  3MC2 A;  1I6A A;  4F2Q A;  3DM0 A;  3TQL A;  4ESX A;  5KCJ B;  3UP9 A;  4IY6 A;  4XIG Q;  4O3C A;  2ZYM A;  1B4H A;  2X7Q A;  4TLL B;  3VVE A;  3VVD A;  4RXL A;  4PQJ A;  2F78 A;  1Q35 A;  1B9J A;  4ZDM A;  4ELR A;  3TPA A;  2O1L A;  3E3K A;  3AXF A;  1MY3 A;  4OEN A;  3VE1 B;  1MH4 A;  3MVX A;  3E13 X;  1SVX B;  3HHG A;  4GQO A;  1USY H;  4EUO A;  3S9N C;  3OSQ A;  1ZLQ A;  1BKA A;  4NF6 B;  4WKM A;  1NNK A;  1R6Z A;  3RT6 B;  1BP5 A;  1A8E A;  1WVJ A;  5I56 B;  4DXB A;  4MBP A;  1H43 A;  5AA2 D;  3G3J A;  1PDA A;  2XXU A;  4ZEC A;  4GF8 A;  5CMC A;  3UIF A;  3DRJ A;  2HCA A;  3SKP A;  5I2N A;  4WXJ A;  1M5B A;  3S9L C;  3JV9 A;  2X26 A;  1OLC A;  4Q8R A;  1POT A;  4R73 A;  2XXI A;  2UVI A;  1B46 A;  3M3F A;  4QHQ A;  4PFT A;  1R1N A;  4OZ9 A;  1H3D A;  4JWO A;  1GR2 A;  3FXQ A;  1GTK A;  3T66 A;  4FJP A;  2DP8 A;  1B7U A;  4MH5 A;  2V25 A;  4LA9 A;  4ELP A;  1UIU A;  4G68 A;  2QPQ A;  1RYX A;  5F1Q A;  1VE4 A;  4O3B A;  4F2O A;  4NF5 B;  3D4G A;  2HXW A;  3CRB A;  3M3K A;  1XC1 A;  2ESN A;  3PUV E;  3TYH A;  2QJE A;  1D3K A;  3UA8 A;  4R6H A;  3TDJ A;  3DRI A;  1P1U A;  4GVO A;  3ZS6 A;  3TTR A;  3K02 A;  3GXA A;  3TEP A;  2VD3 A;  4P11 A;  3IO4 A;  1A40 A;  4U22 A;  5CRY A;  2X7P A;  5L8D A;  1URD A;  4LZ5 A;  3TKD A;  2NXO A;  5I57 B;  1VR5 A;  3H6U A;  3IO6 A;  2ZYK A;  4H67 A;  4P0I A;  3HV1 A;  3KOT A;  1QVS A;  4YAH X;  4BLA A;  2UXA A;  4R9G A;  4F3B A;  2D5W A;  4F1V A;  1R9Q A;  1TT1 A;  1MPB A;  2Y7I A;  3UN6 A;  4KYD A;  4ZEK A;  3IOV A;  3O6P A;  4JDF A;  4F31 B;  2XXY A;  3IAZ A;  4NF8 A;  4PFU A;  4HS7 A;  3RYA A;  3H6V A;  3VLV A;  2H9B A;  4OER A;  1VFE A;  1FQA A;  3OMB A;  2AYS A;  3PPR A;  3R26 A;  2REG A;  5H8N B;  3SEY A;  4YKI A;  3T9X B;  2I4C A;  1SBP A;  4IY5 A;  3IJX B;  2AL4 A;  1Z7M E;  2QMX A;  1AL3 A;  3HHF A;  1MXU A;  2DVC A;  1B7Z A;  3OEN A;  4C1T A;  4PP0 A;  4PFY A;  1I6Q A;  1MY4 A;  3T9H B;  3O6I A;  5FTH A;  4X1D A;  1FQD A;  1QW0 A;  2AL5 A;  2QL3 A;  4EF1 A;  2H4I A;  3MVW A;  2OCU A;  3T96 B;  3TTL A;  2ZNU A;  2F6G A;  3KOS A;  2M8C A;  4YKK A;  1H76 A;  4LVQ A;  3QIM A;  1IIT A;  3RNN A;  5DVJ A;  2QSX A;  3LUY A;  3UK4 A;  3O28 A;  1IXH A;  5J1D A;  4F3G A;  3TCH A;  3C34 A;  1ZJL A;  4NF4 A;  2Z23 A;  2AIX A;  1DMB A;  3H6W A;  5CBS A;  5B7D A;  3N26 A;  1FQF A;  3VVF A;  1GGG A;  3DRK A;  1ZMG A;  2UYF A;  4U1O A;  4QFL A;  3TTM A;  3MWB A;  4YB5 A;  1S7Y A;  4OMB A;  3FXU A;  4OVJ A;  4ELO A;  4OFJ A;  3C31 A;  1MXX A;  3C35 A;  3K6V A;  3H7M A;  4DDD A;  1YPN A;  3PPP A;  4BDL A;  3EF7 A;  2I49 A;  3BFT A;  1MQJ A;  3PMV A;  4Q5T A;  2H5Y A;  3RTW B;  1HSJ A;  4KCC A;  3VFJ A;  1B0L A;  3OEK A;  3W9V A;  3VLU A;  1TXF A;  4U1Z A;  3U72 A;  4M1V A;  3MP6 A;  5EYF A;  3IOT A;  4YB7 A;  2G93 A;  4OYV A;  1DOT A;  5L9M A;  3FVO A;  3K6X A;  4G4P A;  5HM4 B;  3TAJ A;  1B51 A;  1FTK A;  3PUW E;  5K2X A;  5CMB A;  3W9W A;  1DTZ A;  1UTB A;  1MM6 A;  3UGW A;  4KI0 E;  1NH8 A;  3G3K A;  4ISU A;  1N04 A;  1B32 A;  3PPO A;  4F1Y A;  1JEV A;  5I2K B;  5AA2 B;  1JW5 A;  3IK6 B;  3K4U A;  2NUV A;  5BUU A;  4KQP A;  1MXV A;  1NMU A;  1NKX A;  2F36 A;  2FNC A;  2GHB A;  3EHT A;  2Z22 A;  1ZTY A;  4OQO A;  4NF6 A;  3S9M C;  3IL1 B;  4HTG A;  3MP1 A;  4GL0 A;  1IIW A;  4JB7 A;  4ZEB A;  5I58 B;  4XXU A;  1SW4 A;  3UOR A;  5I56 A;  3PUX E;  4N13 A;  4TLM B;  5EHM A;  4DXC A;  4LP2 B;  3SET A;  1J1N A;  4OWD A;  2D3I A;  5KZT A;  1A55 A;  4I62 A;  2XXH A;  1Z7N E;  3K1N A;  3E4R A;  3PV0 E;  2RC8 A;  4UA8 A;  2YLN A;  1M5D A;  1M5E A;  4OES A;  1CB6 A;  3ZSF A;  4PFW A;  1PBQ A;  4LZ7 A;  4FAT A;  1MY1 A;  3B6T A;  3LVU A;  4GXS B;  3K6U A;  5DEX A;  3MBP A;  3G3I A;  1NL5 A;  4OFL A;  1A8F A;  4GRK A;  1PB7 A;  4XKP A;  1QUK A;  2GRV A;  5H8F A;  1D4N A;  1B3H A;  5KDT A;  1MH3 A;  5A5X B;  3MAM A;  1SDX A;  2OLB A;  5TP9 B;  3SEV A;  2O7I A;  1ZKB A;  4QSD A;  2XXX A;  3TZA A;  2WOL A;  5DVF A;  2PYY A;  4MLV A;  2XXW A;  4FED A;  4IO4 A;  4YB6 A;  4GFR A;  2Y7R A;  4E0X A;  3H3G A;  3O29 A;  2I48 A;  4OEU A;  3Q26 A;  3VLW A;  2B65 A;  2PT1 A;  3FGS A;  1B3F A;  1P1W A;  2Y84 A;  2V93 A;  3PD9 A;  5TPA A;  2XXV A;  3CG3 A;  1SQY A;  3KSJ A;  3ECR A;  4ZE9 A;  1FTL A;  1LGB C;  2RCA A;  1OQG A;  2F34 A;  4EQ9 A;  4DE8 A;  1QUI A;  3FZV A;  4N07 A;  3MZB A;  2VGQ A;  3OOA A;  3TUS A;  2R9J A;  4R72 A;  3U93 A;  1XVY A;  5L9S A;  2RF1 A;  1XS5 A;  5M2V A;  3RLF E;  3EHU A;  4ND9 A;  4KR5 A;  4U4S A;  4YU0 A;  3I5O A;  1MQG A;  1M5C A;  1CE2 A;  3PPN A;  2HAV A;  4RK2 A;  4FEC A;  5I84 A;  1IXG A;  4NE4 A;  2ZNS A;  1PEB A;  4OXV A;  4F29 A;  4R6Y A;  2O68 A;  4RNS A;  4XKQ A;  2DSF A;  3KN8 A;  1IEJ A;  1JNF A;  2O51 A;  5LOM A;  4JBZ A;  1ZIU A;  1N7W A;  3G3F A;  1EZ9 A;  1US5 A;  5FHM A;  1H45 A;  3L6G A;  1SI1 A;  2Y7P A;  1A99 A;  2NOO A;  1B5H A;  3LSL A;  3FXR A;  2V3U A;  1Y3P A;  3EN3 A;  2XD3 A;  2QMW A;  5HBC A;  1MS7 A;  2DWJ A;  4FEB A;  4Z0I A;  2DWA A;  4YKJ A;  4RPO A;  1A54 A;  2G29 A;  4OHN A;  1FTM A;  4C1U A;  1VSO A;  4NWC A;  3MP8 A;  1PC3 A;  4POX A;  1IXC A;  1QKB A;  1UTH A;  3FJG A;  1B1X A;  3KGC A;  5ITO A;  3DRG A;  2XHD A;  4PE5 B;  2IA4 A;  5I59 A;  3O6H A;  5AE4 A;  1MRP A;  3IB1 A;  2I0C A;  3IR1 A;  4MLQ A;  3PU5 A;  2ZYN A;  2UYE A;  1TFD A;  2A5T A;  2BJJ X;  3Q27 A;  5AA4 B;  3D4C A;  3RUM A;  4NWD A;  1ZBM A;  3OXN A;  1B6H A;  2Q2C A;  2Q89 A;  2Q9T A;  5L9O A;  3QSL A;  1LBB A;  3IJO B;  3QUF A;  3FAS A;  2RIN A;  3OO6 A;  4FAJ A;  3ZKL A;  1WDN A;  2PX1 A;  3PAM A;  4THI A;  1N84 A;  2RC7 A;  5K2Y A;  2ALU A;  1FQB A;  1MG1 A;  4R9F A;  1NNF A;  2Q8J A;  2QS4 A;  5JK4 A;  4BDR A;  4TQU Q;  3TMG A;  4QFP A;  4KYE A;  1HSL A;  4IB2 A;  3MZ9 A;  1D9Y A;  5EHS A;  4LAT A;  5DVI A;  4GLI A;  1EZP A;  2XX7 A;  3ODB A;  2ANJ A;  1B3G A;  1PBP A;  1B3L A;  3RQT A;  3EQ1 A;  4G8M A;  4ZE8 A;  1NFT A;  4H0W A;  1LB9 A;  2F7B A;  2ABH A;  3FVN A;  1QUJ A;  4OFO A;  2I3W A;  4X48 A;  4DLD A;  1B5J A;  1URS A;  1MDP 1;  1IXI A;  1M5F A;  3N5L A;  2V3Q A;  1OLA A;  2RC9 A;  1O63 A;  3T9U A;  3ONM A;  3A09 A;  1ANF A;  3B7D A;  1N3W A;  3SEW A;  2PVU A;  4OTE A;  5H8H A;  2V84 A;  2GHA A;  2DXR A;  1F9B A;  3B6Q A;  3GBA A;  5CMK A;  1Y1Z A;  2UVH A;  3K2D A;  3R6U A;  5I2N B;  3FJM A;  1VFD A;  1AOV A;  3VV5 A;  3LBS A;  3OEL A;  1AIV A;  3Q29 A;  3U94 A;  5H8Q A;  4WED A;  4H1X A;  1T0K A;  2KLF A;  3A3U A;  3GBB A;  5F7V A;  4YZZ A;  2W7Y A;  2DYX A;  3MZ1 A;  1BTJ A;  4RYA A;  3A3C A;  2OK2 A;  3PUZ E;  4G68 B;  4BDN A;  3DLN A;  2E1S A;  2I6E A;  2DE2 A;  1B4Z A;  1B52 A;  4G8N A;  3K01 A;  4RY1 A;  2WOP A;  4EDP A;  5CBR A;  2R71 A;  2F7C A;  2NWJ A;  4P0G A;  3RPW A;  1XHY A;  2E0S A;  3VXB A;  1I69 A;  1NH7 A;  1JVY A;  2H99 A;  1NNP A;  2O1M A;  4LUB A;  1MDQ A;  1FW0 A;  3DP6 A;  5ELV A;  4RPN A;  5DTB A;  1Y9U A;  4EXL A;  2CZL A;  3M3L A;  4YKP A;  4H5F A;  3KN7 A;  4M4G A;  5DYH A;  1EU8 A;  3MPK A;  5KCJ A;  1ATG A;  4EXK A;  1P1O A;  3HCQ A;  3PUY E;  2QS2 A;  1OVB A;  4GL8 A;  3FTO A;  4KHZ E;  2YJP A;  3O2A A;  3MVZ A;  2F6P A;  2YPN A;  4H65 A;  3DRF A;  1YAE A;  1JW1 A;  4K3F A;  3PMW A;  3B6W A;  3FJ7 A;  3CSG A;  5JTY B;  1LAH E;  1SW5 A;  2F97 A;  4ZEI A;  4NF8 B;  1OMP A;  2Y7K A;  2H98 A;  2Q2A A;  4KCD A;  5ICT A;  3S9E A;  4R2B A;  1PB9 A;  4ELQ A;  4R2F A;  2D21 A;  2O7U A;  4IGR A;  1XOC A;  2P0S A;  2XXP A;  3MPL A;  4AQ4 A;  3CR9 A;  1RYO A;  3HST A;  4H8J A;  3KZG A;  3OO7 A;  3TTN A;  1USY E;  5CMM A;  2F8D A;  1MQI A;  5DT6 A;  1MPC A;  2P2A A;  3K1P A;  3N6T A;  3K0V A;  1B40 A;  2B4M A;  3CIJ A;  1SW2 A;  4XKR A;  4IO7 A;  1QKA A;  3MVY A;  3L6H A;  4G68 C;  1Y4T A;  3BBR A;  2HEU A;  4XKN A;  3KJ7 A;  1LAG E;  4QF9 A;  3LSX A;  3QK6 A;  3TQW A;  2F7A A;  2I0B A;  1OQH A;  4NF5 A;  4F39 A;  4TOZ A;  3HN0 A;  1LAX A;  3TCF A;  1MY2 A;  2Q88 A;  4F3S A;  3IB0 A;  3C33 A;  2Z8F A;  3C4M A;  3HO7 A;  3I3V A;  4U21 A;  1N3X A;  1QUL A;  2F35 A;  3TFL A;  1ELJ A;  3MJN A;  1HSE A;  3WAF A;  3W15 C;  1FTO A;  4QFO A;  4JXI A;  2DVZ A;  2OWT A;  5ICQ A;  1SI0 A;  4EQB A;  2VP1 A;  3BKI B;  5I57 A;  2QRY A;  5FHN A;  4HCW A;  2Z8E A;  1LFI A;  2B3B A;  4U2R A;  3RYB A;  3MUQ A;  1SYI A;  1N76 A;  4LQ5 A;  1MM7 A;  4FOR A;  1BIY A;  2DE4 A;  4ESW A;  2REJ A;  1FQE A;  2Y7W A;  1SD3 A;  1OVT A;  4Q30 B;  3LC8 A;  4U23 A;  2CMO A;  1UTB B;  1B7H A;  3SER A;  3CHG A;  2XD2 A;  3V89 B;  3GLB A;  3C32 A;  1MXW A;  4DCX A;  3VXC A;  1L5T A;  5TU0 A;  1LAF E;  3CVG A;  3MQ9 A;  4MF3 A;  2DS9 A;  5H8N A;  1D9V A;  3KN3 A;  4HW8 A;  1LLS A;  1BLF A;  3MW0 A;  3N6U A;  1TFA A;  1ZU0 A;  1B58 A;  4I8C A;  2F5X A;  2I58 A;  4F1U A;  1I6B A;  3FD3 A;  3FUZ A;  3KEI A;  4KFQ A;  3O6G A;  4KPT A;  4DCY A;  5CC2 A;  1GVC A;  1H44 A;  1LCT A;  1UIV A;  3DEL B;  3K6W A;  2PT2 A;  3SEU A;  1B05 A;  3G3G A;  4N6P A;  3FV1 A;  3EHS A;  1FQC A;  4O3A A;  5H8S A;  4FIM A;  4QSE A;  3G3H A;  2OJT A;  4ZZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...