1ZU0A

Crystal structure of the liganded chitin oligasaccharide binding protein
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
529
structure length
529
Chain Sequence
RSELTIVPDFYPTMVRNFNPYLATNLRTTTDFIYEPLVVFNEMKGNTPVFRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRFRLSEANSNVPYEISLIPIVAEHVWKDVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQLLGKIVNSELDWTSSFVPDIDRTYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKKEALDNVDFRRAFSMALDRQTIIDIAFYGSGTVNDFASGLGYAFEAWSDEATHKKYKGFNTYDVEGSKKLLAKAGFKDVNGDGFVETPSGKSFELLIQSPNGWTDFNNTVQLAVEQLQEVGIKAKARTPEFAVYNQAMLEGTYDVAYTNYFHGADPFTYWNSGYNSALQSGDGMPRFAMHYFTDKKLDGLLDSFYKTADKNEQLAIAHGIQKIIAENQVTIPVMSGAWMYQYNTTRFTGWWSEENPKGRPSVWAGIPERLLHVLDLKPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitin Oligosaccharide Binding Protein
publication title Crystal structure of the liganded and unliganded periplasmic chitin oligosaccharide binding protein
rcsb
source organism Vibrio cholerae
molecule tags Sugar binding protein, signaling protein
total genus 168
structure length 529
sequence length 529
ec nomenclature
pdb deposition date 2005-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1zu0A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1zu0A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1zu0A02
1Y4TA 3OMBA 4G8MA 4I1DA 4BDOA 3MUQA 1SW1A 3FJ7A 2ZYKA 1P1QA 2A5TB 4ZEDA 1A99A 3UGWA 4GXSB 3MBPA 1RYXA 3SEUA 4F29A 1Y3NA 3TFLA 4ZEFA 1A54A 3ZSFA 4BDRA 5KCJA 4KYDA 1QUJA 4IY6A 3TDJA 4I9DA 2Y84A 5JTYA 3CHGA 3JYRA 4G77A 1MXZA 3BKIB 3I6VA 4OFLA 1PDAA 2HAUA 2HQ0A 3LSXA 2RF1A 1S9TA 4FJPA 3V83A 5HBCA 3MC2A 1B5HA 3LSLA 4QSEA 3PD8A 3AXFA 2DVZA 3KJ7A 3O6PA 5FTIA 2QS3A 3U72A 1MPCA 3UK4A 1MXWA 3VXCA 3CFLA 1PBQA 1P1UA 3PPQA 1L5TA 5K2YA 3ODBA 1LFIA 1Y1ZA 3A09A 4ND9A 4OXVA 4EUOA 4QSCA 4YAHX 2O6AA 3Q25A 5DT6A 3G3FA 2AYSA 5CM6A 4JXIA 3C33A 1JQFA 4IO3A 5B7DA 4NF5B 4ISUA 1YPNA 2D3IA 2DWHA 3PMVA 4RJZA 3EN3A 3T9UA 2Z8EA 3IOVA 2Y7WA 4QFLA 4F3PA 1URGA 3QXMA 3G3IA 3RN8A 4F3BA 1XVXA 4R75A 5L8DA 5DVIA 5I56A 3CSGA 3EHUA 1II5A 5AA2A 4R2BA 3RUMA 1KWHA 1B7HA 4EQ7A 4ELRA 1XVYA 2CZLA 5H8FB 3RTFB 3E13X 3PUZE 1DOTA 2F36A 1UTHA 4H8IA 5ICTA 2UYFA 4JB7A 2I6EA 4KQPA 3TTKA 4R6KA 3T22A 1VE4A 5JK4A 4PP0A 1BLFA 2QS1A 3K1PA 1MPBA 3DP8A 4F1VA 4OYVA 5I59B 2OJTA 2X26A 3TPAA 1NFTA 3HN0A 2ESNA 4HCYA 3IB2A 4DDDA 1DTGA 2RC7A 2NXOA 1NNFA 3RGYA 4F19A 3MVZA 4LZ8A 1FTOA 3O28A 5HM4B 3U94A 1OVTA 1H3DA 2XXVA 3FASA 4LZ5A 4AB5A 2F6GA 3H4ZA 2REGA 4WKMA 4F2OA 4NF4B 4ESWA 5CBSA 4MLQA 2XXYA 3IO4A 1Z7NE 3H6VA 3WAFA 2YJPA 5F1QA 4NWCA 1SQYA 1OMPA 1OLAA 1GTKA 2WOLA 1PB8A 1EH3A 5ISUA 3O2AA 1US5A 5CMBA 3V89B 4G68C 3PPRA 4E0WA 1B4ZA 3CG1A 3MAMA 2RCAA 3FIRA 3ZKKA 1B51A 1JEUA 1LBBA 5AA1A 1LAHE 1QULA 5H8QA 2FNCA 2WKYA 2DSFA 1DPPA 2B4LA 2W7YA 3FV2A 4X1BA 1MY3A 2I0CA 3TTMA 4N07A 1FW0A 3PPOA 4YKIA 3PV0E 5K2XA 1POY1 1LBCA 2Z22A 4N13A 1B0LA 3Q26A 3VLVA 4F1YA 3K01A 1NNKA 3DLNA 4IY5A 3LR1A 5AE4A 3TCHA 3QIMA 1MDP1 4ZEIA 1FTJA 1M5DA 2PT2A 1JW4A 3T66A 1NMUA 4ZZEA 1LCTA 5KDTB 4F3GA 3HPIA 1ZMGA 3DP4A 5DEXB 2OWTA 1OLCA 4U2RA 3FZVA 4NWDA 5JEIA 3H6UA 1B0HA 5FHNA 1XS5A 4GXAA 3VVFA 3DP6A 4THIA 2HAVA 4WEDA 3RQTA 2Y7KA 2P2AA 3S9EA 1H45A 3FJMA 1P1NA 3OO9A 2OLBA 2V84A 1OQGA 4OMBA 1UTBB 3IJXB 3K00A 1JETA 3CFZA 2GHAA 5M2VA 4MH5A 2VD3A 4G68A 2NVUB 3V8XB 1O63A 2OBGA 1Y3QA 2HEUA 1POTA 3MVXA 4EQ9A 5H8NA 1TFAA 4U1OA 3EPEA 3T9XB 1N76A 3C34A 3THIA 1VFDA 2ONRA 4XTCQ 3OELA 4DZ1A 1MQGA 2XXXA 4KD5A 3M3KA 4RK9A 3E9XA 3FXQA 4X48A 3KEIA 5L9OA 3PAMA 2OWSA 3L6HA 4OEUA 5I84A 1FQCA 5HPQA 5IKBA 4RA1A 3SEXA 3U1OA 2ZYOA 3CR9A 2P1SA 1OQHA 2Y7PA 4OEVA 4YKKA 3N26A 1H76A 2R71A 1IZ1A 1UIUA 1WVJA 1AH5A 4XKPA 2D5WA 2UYEA 3G7WA 3QYTA 1YTVA 2I4BA 5I2NB 5TP9A 1UIVA 4QFNA 5CI5A 4K3FA 2GHBA 1WDNA 1MRPA 4ELOA 3TMGA 2NUVA 3S9NC 4JWOA 1SI1A 2ANJA 1SW5A 2B65A 1TFDA 1O7TA 1LAXA 3TZAA 5JTYB 1QJMA 4OESA 4ESXA 3TTNA 1USYE 2HCAA 1JNFA 2ZXTA 4PQJA 2DYXA 3W9VA 5DYHA 3PD9A 3DRJA 3OXNA 3FVKA 4LZ7A 3C36A 3PU5A 3B6WA 2O7UA 4XXUA 1B7UA 2I58A 4JBZA 1XT8A 3KBRA 3KOTA 2H4IA 3C35A 3A3CA 1QUKA 2VP1A 1FTMA 3LBSA 2F5XA 2HZKA 2O84X 1MQDA 3PMWA 3MZ1A 3IOUA 3TQWA 2HZLA 4KR5A 4OHNA 1XHYA 3VVDA 1TWYA 4KYEA 5I57A 3CVGA 2PT1A 1YAEA 5FHOA 4R2FA 3V5AA 2V25A 1NNTA 5F7VA 1N7WA 1N3XA 4IO7A 5H8SA 1B52A 1VSOA 2ALUA 1SDXA 4FIMA 2UXAA 2GFEA 2I4CA 4IO5A 1B05A 4IO4A 5IAIA 1ZLQA 3K6VA 3SDFA 2O1MA 2UVHA 4GRKA 3TTLA 3T93B 1BTJA 4RPOA 5A5XB 1IITA 5J1DA 4R72A 3Q29A 3IB1A 1D3KA 1FQFA 2RKMA 1IXIA 4ZDMA 4LUBA 2F34A 4GLIA 2XXWA 1IUDA 3W9WA 5I56B 2RC8A 5AA2B 2H9BA 4U4SA 3H06B 1JEVA 1MH3A 3PUXE 1HSJA 1MM6A 1B1XA 5EHMA 1FQEA 3MP1A 3QAXA 2A5TA 3UP9A 4XIGQ 4F1UA 1UTHB 3FXRA 5FHMA 4P0GA 4KFQA 3RLFE 3VLUA 2R9JA 1P99A 4EDPA 3IJOB 4POWA 2XD2A 3TELA 3UN6A 3RT6B 3R7XA 4Q8RA 1MY1A 4OWDA 4RPNA 1ZJLA 3TODA 2H99A 3HHGA 3B7DA 4M1VA 3D4GA 3FGSA 2NOOA 1CB6A 4GWOA 1OIBA 1Y1MA 3SESA 4JWXA 3F11A 3PGFA 1D4NA 1NH7A 2A5SA 3BFUA 1SD3A 3OO7A 3K0VA 5TPAA 3EQ1A 4XKRA 2I3VA 3S2VA 3MPLA 2G29A 1US4A 3LSFB 5CMKA 2DWAA 3JZJA 3IX1A 3TCGA 3P7IA 1JVYA 2DS9A 3FVOA 1UQWA 4NE4A 4XKNA 1MQHA 4PFUA 3VVEA 2B3BA 3SEYA 1M5BA 1GGGA 5H8QB 3O9PA 4GVOA 4X1DA 1M5CA 3MWBA 4LATA 1HSEA 5AA4A 2OZZA 4NF8B 2Y7RA 4YICA 4QSDA 4H0WA 3MP6A 4U4XA 3HHFA 2FYIA 4QFOA 1LCFA 3K2DA 4GL8A 2LAOA 4YB6A 2DOJA 3CG3A 4E0XA 4NTLA 1EZOA 5KZTA 1I6QA 3MW0A 4R9FA 4F2QA 1LGBC 4Z7EA 3LUYA 3Q28A 1ATGA 3Q27A 4YB5A 4BDNA 1LLSA 3O97A 5ICQA 3ECRA 1LFHA 1SW4A 4ECFA 4GF8A 3FUZA 4PE5B 5BUUA 2UVJA 2E1SA 2F6PA 3C9HA 2ZMBA 5ITPA 2XXQA 3LC8A 1Z7ME 3IAZA 3H03A 4Q30B 4DCYA 1Y3PA 1PB9A 2O7IA 3M8UA 3VLWA 2XXUA 3CIJA 1TT1A 3K6UA 4GFRA 3OEKA 3T9HB 4FAJA 4YB7A 3QSLA 1YCJA 2DVCA 1I69A 1QKAA 3WAEA 3R26A 2ABHA 4ZECA 3GLBA 4NF4A 3RTWB 5H8NB 3RYAA 4BDQA 3OO8A 3UA8A 3K02A 2CMOA 4H6DA 3K6XA 4L17A 3E3KA 2XXHA 1QW0A 1N0TA 5L9MA 1B40A 1LB9A 4DXUA 3BFTA 4ELPA 2Z8FA 1GV8A 3VXBA 1ZBMA 4LVQA 2XX9A 3OSQA 3GXAA 5I2KA 5BWJA 2AL4A 3G3HA 1Q1KA 3EHSA 4OFOA 2AL5A 3OOAA 3FATA 4R6HA 4BDLA 3G3KA 3IOTA 2FA7A 1ZIUA 4OZ9A 4NF6A 4QFPA 1B3GA 1LAGE 2XHDA 1USYH 4HW8A 4QHQA 4JSDA 3KJTA 4P11A 1QVSA 3C4MA 3DRGA 2I0BA 5I58B 1MQIA 2F7AA 3N6TA 5TU0A 4ZEKA 1QKBA 4N6PA 3TQLA 5TP9B 3RT8A 1N3WA 1J1NA 3C31A 5B70A 2D21A 4U21A 4OENA 2V3TA 2GH9A 1MXYA 3GBAA 2DWIA 3OD7A 3U92A 2XXIA 1D9VA 2Z8DA 2VD2A 2OK2A 4BLAA 2KLFA 4YZZA 2BJJX 3PPPA 2G93A 4BDMA 1M5EA 1RYOA 4F3SA 4LONB 3PUVE 2H98A 3KOSA 1IQ7A 1R9QA 4RNSA 3KFMA 2UVIA 5H8HA 4EXKA 1B9JA 2QL3A 5LOMA 4KI0E 1ZU0A 3O6IA 3PPNA 5EYFA 1PEBA 1N7XA 1A7LA 5AA3A 1UTBA 2GRVA 3MZ9A 3KN7A 3C32A 2F78A 1F9BA 1FQAA 3TAJA 1XC1A 1SVXB 4Q5TA 1ZKBA 4NMYA 4F31B 4HTGA 1DSNA 3IR1A 1JW5A 4G2ZA 2QS2A 1NL5A 1B3EA 5CBRA 4U1ZA 2F7CA 2H5YA 2Q88A 2B4MA 3PUYE 2QPQA 1B3LA 3ZKLA 1WODA 2O69A 4EQBA 4LP2B 3S9MC 4YKPA 4IB2A 4F22A 5KCJB 4ZE8A 2Z23A 5DVFA 2THIA 3K1MA 3A3UA 1MY0A 1URSA 3FXUA 5DTBA 3FTOA 3IORA 2F35A 3SEWA 1BKAA 4H5GA 3MVYA 1MY2A 3OO6A 3B6TA 1B5IA 1EU8A 3MVWA 3TKDA 5I2NA 4MBPA 2P0SA 1NKXA 3JV9A 4G8HA 4YMBA 2QRYA 4Q0CA 3PMXA 4R6YA 2ZYNA 4QF9A 4OTEA 3U8QA 2X7QA 4GL0A 4RXLA 3EHTA 3QUJA 3D4CA 3L6GA 4WXJA 2XXPA 2QJEA 3IL1B 4EF1A 1M5FA 2DXYA 2O68A 3TYHA 4DCXA 2I3WA 1MDQA 4KCCA 1PBPA 3MQ9A 3SKPA 3N5LA 3KSXA 1FQDA 1URDA 1Y4CA 1FTLA 1I6AA 3DRKA 1N04A 1B2HA 2M8CA 4ZE9A 2OCUA 4DXBA 1Y20A 2IEEA 3T9VA 4H1XA 2ONSA 4R74A 4MLVA 4GD5A 2XD3A 4KYSA 2O1LA 3MZBA 4DE8A 2WOPA 1MG1A 1OVBA 1PC3A 2QSXA 4XKQA 2RC9A 1Q35A 1FQBA 1A8EA 2PX1A 3E4RA 4UACA 5TPAB 2REJA 1HSLA 4LQ2A 4OQOA 1ANFA 4POXA 3O6HA 4JDFA 4LQ5A 3SEVA 3B6QA 4KCDA 3H6WA 1O64A 4OERA 4H67A 2VGQA 2PBWA 2H25A 1MPDA 3O66A 1B7ZA 1SYIA 3HCQA 1SW2A 3UORA 4R9GA 4FECA 4G4PA 4R73A 4HCWA 4PFWA 1N84A 1B46A 4O3CA 2DXRA 3FV1A 5AA4B 5A5XA 1DPEA 2QS4A 2ZNTA 1ZTYA 2YLNA 3ILUB 5L9SA 4TLMB 4JWYA 1VFEA 3K4UA 4RK2A 4OFJA 2DE2A 5EHSA 2DP8A 3O29A 1RKMA 2ZNSA 1NNPA 4FATA 4U22A 1B32A 4IGRA 3IK6B 3RNNA 4GOTA 1D9YA 3CFXA 1JW1A 4I8CA 4Z0IA 3HO7A 2HFBA 3N6UA 4NF5A 2X7PA 1TXFA 2B3FA 2Q8JA 1B5JA 3CI8A 3KN3A 3KG2A 1IEJA 4H65A 1MXXA 2HXWA 3HV1A 3IB0A 3S4UA 4IGTA 3EF7A 4H5FA 4FEDA 1XOCA 4ELQA 2Y7IA 3CSBA 4FEBA 4GQOA 4U23A 1BIYA 4KHZE 5CMMA 3CRBA 5FTHA 3MJNA 1EZPA 3OSRA 3VFJA 2F7BA 3PUWE 2DWJA 1B6HA 3KZGA 4AB6A 2R6GE 5H8FA 3M3FA 2UVGA 1LSTA 4UA8A 2Q2CA 2Q9TA 4F18A 1NH8A 4OVJA 3O6GA 1SBPA 3U93A 3DRIA 4P0IA 4JSOA 4TQUQ 3MP8A 1PB7A 3KN8A 4G8NA 3H6TA 5I59A 2Q2AA 2V93A 3RY3A 4H8JA 4MFIA 2ONKE 5I2KB 2QMXA 1FTKA 1S50A 1B3HA 3FVNA 4F39A 1AL3A 2I49A 1T0KA 4NF8A 3DRHA 4G68B 1GVCA 3GZGA 4NF6B 3BBRA 4QFKA 3R6UA 2RINA 4ZS9A 2DQVA 1QUIA 4C1TA 4C1UA 3GBBA 4HS7A 1MM7A 1IXHA 3S9LC 1R9LA 2WOKA 1H44A 2YPNA 1DMBA 4I62A 1MH4A 2RCBA 3TUSA 4IO6A 3VV5A 4IO2A 3IO6A 4M4GA 4QRZA 1SI0A 1MXVA 3QK6A 2I48A 3I3VA 2F97A 3MPKA 2IA4A 3LSWA 4TOZA 1FCKA 3USDA 2VHAA 3ZS6A 4ONYA 5H8HB 2F8DA 1BP5A 2Q89A 2XXTA 1IIWA 3FD3A 1EZ9A 3G3GA 3TTRA 2VOZA 1Y9UA 1LFGA 1VR5A 5DVJA 3DRFA 4X9TA 3RPWA 1A40A 3DM0A 2AIXA 2NWJA 2XX7A 4PETA 2PYYA 5CC2A 3LVUA 3W15C 4O3AA 4C0RA 5KDTA 5ITOA 3FVGA 4O3BA 5DEXA 3KGCA 4PFYA 4DIGA 2O51A 3K6WA 3OENA 1SYHA 3ILTB 1B58A 2ZNUA 4YU0A 2DE4A 1P1OA 1R6ZA 4ZEBA 4AQ4A 1I6BA 3VE1B 3TEPA 4DXCA 1DTZA 1B4HA 3SERA 1MXUA 4OETA 4GIZA 2PVUA 1MQJA 2XXRA 4EXLA 2E0SA 1GR2A 4LA9A 1A55A 2PMSA 3H3GA 3T96B 1B3FA 3G3JA 3OEMA 4FE8A 3M3LA 5I58A 5I57B 4PFTA 4MF3A 3K1NA 4FORA 2V3QA 3FJGA 4RY1A 1JVXA 5ELVA 1LB8A 4WEPA 4EF2A 4YMAA 1IXGA 3N94A 5CMCA 4ZZAA 3DELB 3VDFA 3TCFA 5CRYA 1A8FA 3UIFA 1P1WA 1MY4A 1CE2A 3ONMA 1B1HA 1AOVA 2XX8A 4RYAA 4TLLB 5AA2D 1H43A 4DLDA 1MS7A 2DE3A 4KPTA 3IOWA 1AMFA 3SETA 4YKJA 2QMWA 1S7YA 1ELJA 3H7MA 1IXCA 2ZYMA 4NEDA 3RYBA 3KSJA 1R1NA 3I5OA 3HSTA 3QUFA 1LAFE 2V3UA 1AIVA
chains in the Genus database with same CATH superfamily
5LDZA 1Y4TA 3OMBA 4G8MA 4I1DA 4BDOA 4DI3D 3MUQA 1SW1A 3FJ7A 2ZYKA 2QFLA 1P1QA 1NV5A 2A5TB 4ZEDA 1A99A 3UGWA 4GXSB 5EQ9A 3MBPA 1RYXA 2XWOA 3SEUA 4F29A 1Y3NA 1LBVA 3TFLA 4ZEFA 2Q74A 1A54A 3ZSFA 4BDRA 4GX3A 5KCJA 4KYDA 2R8TA 1QUJA 4IY6A 4AS5A 3TDJA 1IMCA 3LV0A 4I9DA 2Y84A 5JTYA 3CHGA 3JYRA 4G77A 1MXZA 3BKIB 3I6VA 4OFLA 1PDAA 2HAUA 2HQ0A 3LSXA 2RF1A 1S9TA 4FJPA 1FPIA 3V83A 5HBCA 4FBPA 3MC2A 1B5HA 1EYIA 3LSLA 4QSEA 3PD8A 3AXFA 2DVZA 3KJ7A 3O6PA 5FTIA 2QS3A 5ET7A 3U72A 2Q8MA 1MPCA 3UK4A 1MXWA 3VXCA 3CFLA 1PBQA 2Y5KA 1P1UA 3PPQA 1L5TA 4MEVA 5K2YA 3ODBA 1LFIA 1SPIA 1Y1ZA 3A09A 4ND9A 4OXVA 4EUOA 4QSCA 4YAHX 4AS4A 2O6AA 3Q25A 5DT6A 2WX9A 3G3FA 2AYSA 5CM6A 4JXIA 3C33A 1JQFA 4IO3A 5B7DA 4NF5B 4ISUA 1YPNA 2D3IA 2DWHA 3PMVA 4RJZA 3EN3A 3T9UA 2Z8EA 3IOVA 2Y7WA 3KC1A 1RDXA 4QFLA 4F3PA 1URGA 3QXMA 3G3IA 2FIEA 3RN8A 4F3BA 1XVXA 1FBEA 4R75A 5L8DA 5DVIA 5I56A 3CSGA 3EHUA 1II5A 5AA2A 4R2BA 3RUMA 1KWHA 1B7HA 4EQ7A 4ELRA 1XVYA 2CZLA 5H8FB 3RTFB 3E13X 3PUZE 4PFIA 1DOTA 2F36A 1UTHA 2QVRA 3ROJA 4H8IA 5ICTA 2UYFA 4JB7A 2I6EA 4KQPA 3TTKA 4R6KA 3T22A 1VE4A 5JK4A 4PP0A 4NX1A 1BLFA 2QS1A 3K1PA 3BIHA 1MPBA 3DP8A 4F1VA 4OYVA 5I59B 2OJTA 2X26A 3TPAA 1NFTA 1QGXA 3HN0A 2ESNA 4HCYA 3IB2A 4DDDA 1DTGA 2RC7A 2NXOA 1NNFA 3RGYA 4F19A 3MVZA 4PCDA 4LZ8A 1FTOA 3O28A 5HM4B 3U94A 1OVTA 1H3DA 4MNIA 2XXVA 3U65A 3FASA 4LZ5A 4AB5A 2F6GA 3H4ZA 1XI6A 2REGA 4NAPA 4WKMA 4PAKA 4F2OA 4I40A 4NF4B 4ESWA 5CBSA 4MLQA 2XXYA 3IO4A 1Z7NE 3H6VA 3WAFA 1FBCA 1Q9DA 2YJPA 4UABA 5F1QA 4NWCA 1SQYA 1OMPA 1OLAA 1G0IA 1GTKA 2WOLA 1PB8A 1EH3A 5ISUA 1LEVA 3O2AA 1US5A 5CMBA 3V89B 4G68C 3PPRA 4E0WA 4GWWA 1B4ZA 3CG1A 3MAMA 2RCAA 2FBPA 3FIRA 4MNCA 3ZKKA 2WEFA 1B51A 1JEUA 1LBBA 5AA1A 1LAHE 1QULA 1FBGA 5H8QA 1NV0A 2FNCA 2WKYA 2DSFA 2XWKA 4HE2A 1DPPA 2B4LA 2W7YA 3FV2A 4X1BA 1MY3A 2I0CA 3TTMA 4JVCA 4N07A 1FW0A 3PPOA 4YKIA 3PV0E 5K2XA 2BJIA 1POY1 1K9ZA 1LBCA 2Z22A 4N13A 1B0LA 3Q26A 3VLVA 4F1YA 3K01A 1NNKA 3DLNA 4IY5A 3LR1A 5AE4A 2QVVA 3TCHA 3QIMA 1MDP1 4ZEIA 1FTJA 1M5DA 2PT2A 1JW4A 3T66A 1NMUA 4O94A 4ZZEA 1LCTA 5KDTB 4F3GA 3HPIA 1ZMGA 3DP4A 5DEXB 2OWTA 1OLCA 4U2RA 3FZVA 1IMDA 4IR8A 4NWDA 5JEIA 3IFAA 4I3EA 3H6UA 1B0HA 5FHNA 2ZZXA 1XS5A 4PGPA 4GXAA 3VVFA 4KXPA 4P1LA 3DP6A 4THIA 2HAVA 4WEDA 4NG7A 5I5PA 2WBBA 3RQTA 2Y7KA 4MIJA 2P2AA 1FBHA 4N6KA 1H45A 3S9EA 3FJMA 3OO9A 1P1NA 2OLBA 2V84A 1OQGA 4OMBA 1UTBB 3IJXB 1NV4A 3K00A 1JETA 3CFZA 2GHAA 2Y5LA 5M2VA 4MH5A 2VD3A 4G68A 2NVUB 1INPA 3V8XB 1O63A 2OBGA 1Y3QA 2HEUA 4P9KA 1LBWA 1POTA 2CZHA 3MVXA 1FPJA 4EQ9A 1NV6A 5H8NA 2KQZA 1TFAA 2HXRA 4U1OA 3EPEA 3T9XB 1N76A 2DDKA 3C34A 3THIA 1VFDA 2ONRA 4XTCQ 3OELA 4DZ1A 5I7IA 1MQGA 2XXXA 4KD5A 3M3KA 4NHBA 4RK9A 3E9XA 3FXQA 4X48A 3KEIA 5L9OA 3PAMA 2OWSA 3L6HA 4OEUA 5I84A 1FQCA 5HPQA 5IKBA 4RA1A 3SEXA 3U1OA 2ZYOA 3CR9A 2P1SA 4HXVA 1OQHA 2Y7PA 4PFBA 4OEVA 4OVTA 4YKKA 3N26A 1LBXA 1H76A 2R71A 1IZ1A 4OVQA 1UIUA 1WVJA 1AH5A 4PTKA 4XF5A 4XKPA 2D5WA 2UYEA 3G7WA 3QYTA 3KBZA 1YTVA 1KZ8A 2I4BA 5I2NB 5TP9A 1UIVA 4MHFA 4GWYA 4QFNA 5CI5A 4K3FA 2GHBA 1WDNA 1MRPA 2XA5A 4ELOA 1BK4A 3TMGA 4P1EA 2NUVA 3S9NC 4JWOA 1SI1A 2ANJA 1SW5A 2B65A 4JVIA 3LUZA 1TFDA 1O7TA 1LAXA 3TZAA 5JTYB 1QJMA 4OESA 4ESXA 1RDZA 3TTNA 1USYE 2HCAA 1JNFA 2ZXTA 4PQJA 2DYXA 3W9VA 5DYHA 3PD9A 3DRJA 3OXNA 3FVKA 4LZ7A 3C36A 3PU5A 3B6WA 2O7UA 4XXUA 1B7UA 2I58A 4JBZA 1XT8A 3KBRA 3KOTA 2H4IA 3C35A 1IMEA 3A3CA 1QUKA 2VP1A 1FTMA 3LBSA 2F5XA 2HZKA 4GBWA 2O84X 1MQDA 3PMWA 3MZ1A 2XXKA 3IOUA 3TQWA 4H45A 2HZLA 1FJ6A 4KR5A 4OHNA 1XHYA 3VVDA 1TWYA 4KYEA 5I57A 3CVGA 2PT1A 1YAEA 5FHOA 4R2FA 3V5AA 2V25A 1NNTA 5F7VA 1N7WA 1N3XA 4IO7A 5H8SA 1B52A 1IMFA 5EYGA 1VSOA 2ALUA 1SDXA 4FIMA 2UXAA 2GFEA 2I4CA 4IO5A 1B05A 4IO4A 5IAIA 1ZLQA 3K6VA 3SDFA 2O1MA 2UVHA 4GRKA 3TTLA 3T93B 2F3BA 1BTJA 3BIGA 4RPOA 5A5XB 1IITA 5J1DA 4R72A 3Q29A 3IB1A 1D3KA 1FQFA 2RKMA 4OVPA 3QMFA 1IXIA 4ZDMA 4LUBA 2F34A 2F3DA 4GLIA 2XXWA 3D1RA 1IUDA 3W9WA 5I56B 2RC8A 4P3LA 5AA2B 2H9BA 4U4SA 3H06B 1JEVA 1MH3A 3PUXE 4GX4A 3RPLA 1HSJA 1MM6A 1B1XA 5EHMA 1FQEA 4GWUA 3MP1A 3QAXA 2A5TA 3UP9A 2XWIA 4XIGQ 4F1UA 4QXDA 4GWZA 1UTHB 3FXRA 5FHMA 4P0GA 1FPDA 5DW8A 2JJKA 4OANA 3SZPA 4MAGA 5IZ3A 4KFQA 1FPBA 3RLFE 4P8BA 3VLUA 2R9JA 1P99A 4EDPA 3IJOB 2ZZVA 4POWA 2XD2A 2HPGA 3TELA 3UN6A 3RT6B 3R7XA 4Q8RA 1MY1A 4OWDA 1K9YA 4RPNA 1ZJLA 4G61A 3TODA 2H99A 2QVUA 4PE3A 3ISPA 3HHGA 3B7DA 4M1VA 3D4GA 4PAFA 3FGSA 2NOOA 1CB6A 4GWOA 1OIBA 1Y1MA 3SESA 4JWXA 3F11A 3PGFA 5FBPA 1D4NA 4GWXA 1D9QA 1NH7A 2A5SA 3BFUA 1SD3A 3OO7A 3K0VA 5TPAA 4PF8A 3EQ1A 4XKRA 2I3VA 3S2VA 3MPLA 2G29A 1US4A 3LSFB 4O8MA 5CMKA 2DWAA 3JZJA 3IX1A 3TCGA 3P7IA 1JVYA 2DS9A 3FVOA 1UQWA 4NE4A 4XKNA 1MQHA 4PFUA 3VVEA 2B3BA 3SEYA 1M5BA 1GGGA 5H8QB 3O9PA 4GVOA 4X1DA 1M5CA 3MWBA 4LATA 1HSEA 5AA4A 2OZZA 4NF8B 2Y7RA 4YICA 4LN5A 4QSDA 1FPFA 4H0WA 3MP6A 3B8BA 4U4XA 3HHFA 2FYIA 4QFOA 3FXBA 1LCFA 3K2DA 4GL8A 1YZ0A 2LAOA 4YB6A 2DOJA 3CG3A 4E0XA 4NTLA 1EZOA 5KZTA 1I6QA 1LBZA 3MW0A 4R9FA 4F2QA 4GX6A 1LGBC 4Z7EA 3LUYA 3Q28A 1ATGA 3Q27A 5F24A 4YB5A 4BDNA 4MCOA 1LLSA 3O97A 5ICQA 3ECRA 5IGAA 1LFHA 4N91A 1SW4A 4ECFA 4GF8A 1DK4A 3FUZA 4PE5B 5BUUA 2L5VA 2UVJA 2E1SA 2F6PA 3C9HA 2ZMBA 5ITPA 2XXQA 3LC8A 1Z7ME 2FIXA 3IAZA 3H03A 5LTCA 4Q30B 4DCYA 1Y3PA 1PB9A 2O7IA 3M8UA 3VLWA 2XXUA 3CIJA 1TT1A 3K6UA 4QBAA 4GFRA 3OEKA 3T9HB 4FAJA 4YB7A 3QSLA 1YCJA 2DVCA 2VPNA 1I69A 1QKAA 3WAEA 3R26A 2ABHA 4ZECA 1CNQA 3NOHA 1YXIA 3GLBA 4NF4A 4NF0A 3RTWB 5H8NB 3RYAA 4BDQA 3OO8A 3UA8A 3K02A 2CMOA 4H6DA 3K6XA 4L17A 3E3KA 2XXHA 1QW0A 1N0TA 5L9MA 1B40A 1LB9A 4DXUA 5IM2A 1JP4A 3BFTA 3GYYA 4ELPA 2Z8FA 1GV8A 2P3NA 4N15A 3VXBA 1ZBMA 4LVQA 2XX9A 3OSQA 3GXAA 5I2KA 5BWJA 4XFEA 2AL4A 3G3HA 1Q1KA 3EHSA 4OFOA 2AL5A 3OOAA 3FATA 4R6HA 4BDLA 3G3KA 3IOTA 2FA7A 1ZIUA 1EYKA 4NF6A 4OZ9A 4QFPA 1B3GA 1LAGE 2XHDA 1USYH 4HW8A 4QHQA 4JSDA 1FSAA 3KJTA 4P11A 1QVSA 3C4MA 3DRGA 4PGNA 2I0BA 5I58B 2ZZWA 1MQIA 2F7AA 3N6TA 5TU0A 4ZEKA 1QKBA 2CZKA 4N6PA 3TQLA 5TP9B 3RT8A 1N3WA 1J1NA 3C31A 5B70A 2CEXA 2D21A 1FPEA 4U21A 4OENA 1DCUA 2V3TA 2GH9A 1MXYA 3GBAA 2DWIA 3OD7A 3U92A 4PAIA 2XXIA 1D9VA 2Z8DA 2VD2A 2OK2A 4BLAA 2KLFA 4YZZA 1IMAA 2BJJX 3PPPA 2G93A 4BDMA 1M5EA 1RYOA 4F3SA 4LONB 3PUVE 2H98A 3KOSA 1IQ7A 1R9QA 4RNSA 3IFCA 3KFMA 2UVIA 5H8HA 4EXKA 1B9JA 2QL3A 5LOMA 1AWBA 1ZU0A 4KI0E 3O6IA 1NI9A 3PPNA 5EYFA 1PEBA 1N7XA 1A7LA 5AA3A 1UTBA 2GRVA 3MZ9A 3KN7A 2CZIA 3C32A 2F78A 1F9BA 1FQAA 3TAJA 1XC1A 1SVXB 4Q5TA 1ZKBA 4NMYA 4F31B 4HTGA 5EYHA 1NUXA 1DSNA 3IR1A 1JW5A 4G2ZA 2HHMA 2QS2A 1NL5A 1B3EA 5CBRA 4U1ZA 2F7CA 2H5YA 2Q88A 2B4MA 3PUYE 2QPQA 4OVSA 2OWZA 1B3LA 3ZKLA 5ESYA 1WODA 2O69A 4EQBA 4LP2B 3S9MC 4YKPA 4IB2A 4F22A 5KCJB 4ZE8A 2Z23A 5DVFA 2THIA 3K1MA 3A3UA 1MY0A 1URSA 3FXUA 5DTBA 2PFYA 3FTOA 4N4UA 3IORA 2F35A 3SEWA 1BKAA 4H5GA 3MVYA 1MY2A 3OO6A 3B6TA 4PBQA 1B5IA 4N8GA 1EU8A 3MVWA 3TKDA 1YYZA 1FRPA 5I2NA 4MBPA 2P0SA 1NKXA 3RPLB 3JV9A 4G8HA 4YMBA 2QRYA 4Q0CA 3PMXA 4R6YA 2ZYNA 4QF9A 4OTEA 3U8QA 2X7QA 4GL0A 4OA4A 4RXLA 3EHTA 3QUJA 3D4CA 3L6GA 4WXJA 1NV1A 2XXPA 2QJEA 3IL1B 4EF1A 1M5FA 2DXYA 1FJ9A 2O68A 5IZ3B 4X04A 3TYHA 4DCXA 2I3WA 1MDQA 4KCCA 1PBPA 3MQ9A 3SKPA 3N5LA 5I3SA 3KSXA 1FQDA 5ET5A 4HE1A 1URDA 2CEYA 1Y4CA 4PFRA 1FTLA 3EKIA 1I6AA 3DRKA 1N04A 1B2HA 2M8CA 4ZE9A 2OCUA 4DXBA 1Y20A 2IEEA 3T9VA 1EYJA 4H1XA 2ONSA 4MMPA 4R74A 4MLVA 1LBYA 4O7MA 3T0JA 4GD5A 2XD3A 4GWSA 4KYSA 2O1LA 3MZBA 4DE8A 2WOPA 1MG1A 1OVBA 1PC3A 5IZZA 5J16A 2QSXA 4XKQA 2RC9A 1Q35A 1FQBA 1A8EA 2PX1A 3E4RA 1FBPA 4UACA 5TPAB 1KA1A 2REJA 1VDWA 5EQ8A 1FBFA 1HSLA 4LQ2A 4OQOA 1ANFA 4POXA 3O6HA 4JDFA 4LQ5A 3SEVA 3B6QA 4KCDA 3H6WA 1O64A 4OERA 4H67A 2VGQA 2PBWA 2H25A 1MPDA 3O66A 1B7ZA 1SYIA 3HCQA 1SW2A 3UORA 4R9GA 4FECA 4G4PA 4R73A 4HCWA 5ET8A 4NN3A 2P3VA 4PFWA 1N84A 1B46A 2VPOA 4O3CA 4PDHA 2DXRA 1NV3A 3FV1A 5AA4B 5A5XA 1DPEA 5A5LA 4MNPA 2QS4A 2ZNTA 3RYDA 1ZTYA 2YLNA 3ILUB 3E78A 5L9SA 4TLMB 4JWYA 1VFEA 3K4UA 4RK2A 4OFJA 2DE2A 5EHSA 2DP8A 3O29A 1RKMA 2ZNSA 1NNPA 4FATA 1NUYA 4P47A 4U22A 1B32A 4IGRA 3IK6B 3RNNA 4GOTA 1D9YA 2WBDA 2FVZA 3CFXA 1JW1A 4I8CA 4Z0IA 4P56A 3HO7A 2MKZA 1NV2A 2HFBA 2WYKA 3N6UA 4NF5A 2X7PA 1TXFA 2B3FA 2Q8JA 1B5JA 3PTYA 4OVRA 3CI8A 3KN3A 3KG2A 1IEJA 4H65A 1MXXA 2HXWA 3T1BA 3E79A 3HV1A 3IB0A 3S4UA 5EQAA 4IGTA 3EF7A 5IZ1A 4MX6A 4H5FA 4FEDA 1XOCA 4ELQA 4NQ8A 2Y7IA 3CSBA 4FEBA 4GQOA 4U23A 4MJOA 1BIYA 4KHZE 5CMMA 3CRBA 5FTHA 3MJNA 1EZPA 3OSRA 5ET6A 3VFJA 1IMBA 2F7BA 3PUWE 2DWJA 1B6HA 3KZGA 4AB6A 2R6GE 5H8FA 3M3FA 2UVGA 4JVDA 1LSTA 4UA8A 2Q2CA 2Q9TA 4F18A 1NH8A 4OVJA 3O6GA 1SBPA 3U93A 3DRIA 3KC0A 4P0IA 4JSOA 4TQUQ 3MP8A 1PB7A 4N8YA 3KN8A 4G8NA 2PFZA 3H6TA 5I59A 4O7IA 2Q2AA 2V93A 3RY3A 4H8JA 4PDDA 4MFIA 2ONKE 5I2KB 2QMXA 1FTKA 1S50A 1B3HA 4GBVA 3FVNA 4F39A 1AL3A 2I49A 1FTAA 1T0KA 4NF8A 3DRHA 4G68B 1GVCA 3GZGA 4NF6B 2PCRA 3BBRA 4QFKA 3R6UA 2RINA 4ZS9A 2DQVA 1QUIA 4C1TA 4C1UA 3GBBA 4HS7A 1MM7A 1IXHA 3S9LC 1R9LA 2WOKA 1H44A 2YPNA 1DMBA 4I62A 1MH4A 2RCBA 1G0HA 2XWVA 3TUSA 4IO6A 3VV5A 1FPGA 4IO2A 4N6DA 2V4CA 3IO6A 4M4GA 2KR0A 4DI4B 4QRZA 1SI0A 1MXVA 1FPKA 3QK6A 4X8RA 2I48A 3I3VA 2F97A 3MPKA 2IA4A 3LSWA 4TOZA 1FCKA 3USDA 2VHAA 3ZS6A 4ONYA 5H8HB 2F8DA 1BP5A 1NUZA 2Q89A 4N81A 4PF6A 2XXTA 1IIWA 3FD3A 1EZ9A 3G3GA 3TTRA 2VOZA 1Y9UA 1LFGA 1RDYA 1VR5A 5DVJA 3DRFA 4X9TA 3RPWA 3FBPA 4NGUA 3A29A 1A40A 3DM0A 2AIXA 2NWJA 3MSTA 2XX7A 4I3YA 4PETA 2PYYA 5CC2A 3LVUA 3W15C 4O3AA 4C0RA 5KDTA 5ITOA 3FVGA 4O3BA 5DEXA 3KGCA 4PFYA 4DIGA 2O51A 3K6WA 3OENA 1SYHA 3ILTB 1B58A 1DBZA 2ZNUA 4PC9A 4YU0A 2DE4A 1P1OA 1R6ZA 4ZEBA 2OX3A 4AQ4A 4HE0A 1I6BA 2WYPA 3VE1B 3TEPA 3HFUA 4DXCA 1DTZA 1B4HA 1FBDA 3SERA 3MYUA 1MXUA 4OETA 4GIZA 2VT5A 2PVUA 1MQJA 2XXRA 4EXLA 2GQ1A 2E0SA 1GR2A 4LA9A 4XEQA 1A55A 4N17A 2PMSA 3H3GA 5EQ7A 3T96B 1B3FA 3G3JA 1FPLA 3OEMA 4FE8A 3M3LA 5I58A 5I57B 4MF3A 4PFTA 1NV7A 3K1NA 4FORA 1KA0A 2V3QA 3FJGA 4RY1A 1JVXA 5ELVA 1LB8A 4WEPA 4EF2A 4YMAA 1IXGA 3N94A 5CMCA 4ZZAA 3DELB 3VDFA 3TCFA 5CRYA 1A8FA 3B50A 3UIFA 1P1WA 5T3JA 1MY4A 1CE2A 3ONMA 1B1HA 1AOVA 2XX8A 4RYAA 4TLLB 5AA2D 1H43A 4DLDA 1MS7A 2DE3A 4KPTA 3IOWA 1AMFA 4H46A 3SETA 1NUWA 4YKJA 2QMWA 1S7YA 1ELJA 3H7MA 4PBHA 1IXCA 2ZYMA 4NEDA 3RYBA 3KSJA 2FHYA 1R1NA 3I5OA 3HSTA 3QUFA 1LAFE 2V3UA 1AIVA
chains in the Genus database with same CATH topology
1Y4TA 3OMBA 4G8MA 4I1DA 4BDOA 3MUQA 1SW1A 3FJ7A 2ZYKA 1P1QA 2A5TB 4ZEDA 1A99A 3UGWA 4GXSB 3MBPA 1RYXA 3SEUA 4F29A 1Y3NA 3TFLA 4ZEFA 1A54A 3ZSFA 4BDRA 5KCJA 4KYDA 1QUJA 4IY6A 3TDJA 4I9DA 2Y84A 5JTYA 3CHGA 3JYRA 4G77A 1MXZA 3BKIB 3I6VA 4OFLA 1PDAA 2HAUA 2HQ0A 3LSXA 2RF1A 1S9TA 4FJPA 3V83A 5HBCA 3MC2A 1B5HA 3LSLA 4QSEA 3PD8A 3AXFA 2DVZA 3KJ7A 3O6PA 5FTIA 2QS3A 3U72A 1MPCA 3UK4A 1MXWA 3VXCA 3CFLA 1PBQA 1P1UA 3PPQA 1L5TA 5K2YA 3ODBA 1LFIA 1Y1ZA 3A09A 4ND9A 4OXVA 4EUOA 4QSCA 4YAHX 2O6AA 3Q25A 5DT6A 3G3FA 2AYSA 5CM6A 4JXIA 3C33A 1JQFA 4IO3A 5B7DA 4NF5B 4ISUA 1YPNA 2D3IA 2DWHA 3PMVA 4RJZA 3EN3A 3T9UA 2Z8EA 3IOVA 2Y7WA 4QFLA 4F3PA 1URGA 3QXMA 3G3IA 3RN8A 4F3BA 1XVXA 4R75A 5L8DA 5DVIA 5I56A 3CSGA 3EHUA 1II5A 5AA2A 4R2BA 3RUMA 1KWHA 1B7HA 4EQ7A 4ELRA 1XVYA 2CZLA 5H8FB 3RTFB 3E13X 3PUZE 1DOTA 2F36A 1UTHA 4H8IA 5ICTA 2UYFA 4JB7A 2I6EA 4KQPA 3TTKA 4R6KA 3T22A 1VE4A 5JK4A 4PP0A 1BLFA 2QS1A 3K1PA 1MPBA 3DP8A 4F1VA 4OYVA 5I59B 2OJTA 2X26A 3TPAA 1NFTA 3HN0A 2ESNA 4HCYA 3IB2A 4DDDA 1DTGA 2RC7A 2NXOA 1NNFA 3RGYA 4F19A 3MVZA 4LZ8A 1FTOA 3O28A 5HM4B 3U94A 1OVTA 1H3DA 2XXVA 3FASA 4LZ5A 4AB5A 2F6GA 3H4ZA 2REGA 4WKMA 4F2OA 4NF4B 4ESWA 5CBSA 4MLQA 2XXYA 3IO4A 1Z7NE 3H6VA 3WAFA 2YJPA 5F1QA 4NWCA 1SQYA 1OMPA 1OLAA 1GTKA 2WOLA 1PB8A 1EH3A 5ISUA 3O2AA 1US5A 5CMBA 3V89B 4G68C 3PPRA 4E0WA 1B4ZA 3CG1A 3MAMA 2RCAA 3FIRA 3ZKKA 1B51A 1JEUA 1LBBA 5AA1A 1LAHE 1QULA 5H8QA 2FNCA 2WKYA 2DSFA 1DPPA 2B4LA 2W7YA 3FV2A 4X1BA 1MY3A 2I0CA 3TTMA 4N07A 1FW0A 3PPOA 4YKIA 3PV0E 5K2XA 1POY1 1LBCA 2Z22A 4N13A 1B0LA 3Q26A 3VLVA 4F1YA 3K01A 1NNKA 3DLNA 4IY5A 3LR1A 5AE4A 3TCHA 3QIMA 1MDP1 4ZEIA 1FTJA 1M5DA 2PT2A 1JW4A 3T66A 1NMUA 4ZZEA 1LCTA 5KDTB 4F3GA 3HPIA 1ZMGA 3DP4A 5DEXB 2OWTA 1OLCA 4U2RA 3FZVA 4NWDA 5JEIA 3H6UA 1B0HA 5FHNA 1XS5A 4GXAA 3VVFA 3DP6A 4THIA 2HAVA 4WEDA 3RQTA 2Y7KA 2P2AA 3S9EA 1H45A 3FJMA 1P1NA 3OO9A 2OLBA 2V84A 1OQGA 4OMBA 1UTBB 3IJXB 3K00A 1JETA 3CFZA 2GHAA 5M2VA 4MH5A 2VD3A 4G68A 2NVUB 3V8XB 1O63A 2OBGA 1Y3QA 2HEUA 1POTA 3MVXA 4EQ9A 5H8NA 1TFAA 4U1OA 3EPEA 3T9XB 1N76A 3C34A 3THIA 1VFDA 2ONRA 4XTCQ 3OELA 4DZ1A 1MQGA 2XXXA 4KD5A 3M3KA 4RK9A 3E9XA 3FXQA 4X48A 3KEIA 5L9OA 3PAMA 2OWSA 3L6HA 4OEUA 5I84A 1FQCA 5HPQA 5IKBA 4RA1A 3SEXA 3U1OA 2ZYOA 3CR9A 2P1SA 1OQHA 2Y7PA 4OEVA 4YKKA 3N26A 1H76A 2R71A 1IZ1A 1UIUA 1WVJA 1AH5A 4XKPA 2D5WA 2UYEA 3G7WA 3QYTA 1YTVA 2I4BA 5I2NB 5TP9A 1UIVA 4QFNA 5CI5A 4K3FA 2GHBA 1WDNA 1MRPA 4ELOA 3TMGA 2NUVA 3S9NC 4JWOA 1SI1A 2ANJA 1SW5A 2B65A 1TFDA 1O7TA 1LAXA 3TZAA 5JTYB 1QJMA 4OESA 4ESXA 3TTNA 1USYE 2HCAA 1JNFA 2ZXTA 4PQJA 2DYXA 3W9VA 5DYHA 3PD9A 3DRJA 3OXNA 3FVKA 4LZ7A 3C36A 3PU5A 3B6WA 2O7UA 4XXUA 1B7UA 2I58A 4JBZA 1XT8A 3KBRA 3KOTA 2H4IA 3C35A 3A3CA 1QUKA 2VP1A 1FTMA 3LBSA 2F5XA 2HZKA 2O84X 1MQDA 3PMWA 3MZ1A 3IOUA 3TQWA 2HZLA 4KR5A 4OHNA 1XHYA 3VVDA 1TWYA 4KYEA 5I57A 3CVGA 2PT1A 1YAEA 5FHOA 4R2FA 3V5AA 2V25A 1NNTA 5F7VA 1N7WA 1N3XA 4IO7A 5H8SA 1B52A 1VSOA 2ALUA 1SDXA 4FIMA 2UXAA 2GFEA 2I4CA 4IO5A 1B05A 4IO4A 5IAIA 1ZLQA 3K6VA 3SDFA 2O1MA 2UVHA 4GRKA 3TTLA 3T93B 1BTJA 4RPOA 5A5XB 1IITA 5J1DA 4R72A 3Q29A 3IB1A 1D3KA 1FQFA 2RKMA 1IXIA 4ZDMA 4LUBA 2F34A 4GLIA 2XXWA 1IUDA 3W9WA 5I56B 2RC8A 5AA2B 2H9BA 4U4SA 3H06B 1JEVA 1MH3A 3PUXE 1HSJA 1MM6A 1B1XA 5EHMA 1FQEA 3MP1A 3QAXA 2A5TA 3UP9A 4XIGQ 4F1UA 1UTHB 3FXRA 5FHMA 4P0GA 4KFQA 3RLFE 3VLUA 2R9JA 1P99A 4EDPA 3IJOB 4POWA 2XD2A 3TELA 3UN6A 3RT6B 3R7XA 4Q8RA 1MY1A 4OWDA 4RPNA 1ZJLA 3TODA 2H99A 3HHGA 3B7DA 4M1VA 3D4GA 3FGSA 2NOOA 1CB6A 4GWOA 1OIBA 1Y1MA 3SESA 4JWXA 3F11A 3PGFA 1D4NA 1NH7A 2A5SA 3BFUA 1SD3A 3OO7A 3K0VA 5TPAA 3EQ1A 4XKRA 2I3VA 3S2VA 3MPLA 2G29A 1US4A 3LSFB 5CMKA 2DWAA 3JZJA 3IX1A 3TCGA 3P7IA 1JVYA 2DS9A 3FVOA 1UQWA 4NE4A 4XKNA 1MQHA 4PFUA 3VVEA 2B3BA 3SEYA 1M5BA 1GGGA 5H8QB 3O9PA 4GVOA 4X1DA 1M5CA 3MWBA 4LATA 1HSEA 5AA4A 2OZZA 4NF8B 2Y7RA 4YICA 4QSDA 4H0WA 3MP6A 4U4XA 3HHFA 2FYIA 4QFOA 1LCFA 3K2DA 4GL8A 2LAOA 4YB6A 2DOJA 3CG3A 4E0XA 4NTLA 1EZOA 5KZTA 1I6QA 3MW0A 4R9FA 4F2QA 1LGBC 4Z7EA 3LUYA 3Q28A 1ATGA 3Q27A 4YB5A 4BDNA 1LLSA 3O97A 5ICQA 3ECRA 1LFHA 1SW4A 4ECFA 4GF8A 3FUZA 4PE5B 5BUUA 2UVJA 2E1SA 2F6PA 3C9HA 2ZMBA 5ITPA 2XXQA 3LC8A 1Z7ME 3IAZA 3H03A 4Q30B 4DCYA 1Y3PA 1PB9A 2O7IA 3M8UA 3VLWA 2XXUA 3CIJA 1TT1A 3K6UA 4GFRA 3OEKA 3T9HB 4FAJA 4YB7A 3QSLA 1YCJA 2DVCA 1I69A 1QKAA 3WAEA 3R26A 2ABHA 4ZECA 3GLBA 4NF4A 3RTWB 5H8NB 3RYAA 4BDQA 3OO8A 3UA8A 3K02A 2CMOA 4H6DA 3K6XA 4L17A 3E3KA 2XXHA 1QW0A 1N0TA 5L9MA 1B40A 1LB9A 4DXUA 3BFTA 4ELPA 2Z8FA 1GV8A 3VXBA 1ZBMA 4LVQA 2XX9A 3OSQA 3GXAA 5I2KA 5BWJA 2AL4A 3G3HA 1Q1KA 3EHSA 4OFOA 2AL5A 3OOAA 3FATA 4R6HA 4BDLA 3G3KA 3IOTA 2FA7A 1ZIUA 4OZ9A 4NF6A 4QFPA 1B3GA 1LAGE 2XHDA 1USYH 4HW8A 4QHQA 4JSDA 3KJTA 4P11A 1QVSA 3C4MA 3DRGA 2I0BA 5I58B 1MQIA 2F7AA 3N6TA 5TU0A 4ZEKA 1QKBA 4N6PA 3TQLA 5TP9B 3RT8A 1N3WA 1J1NA 3C31A 5B70A 2D21A 4U21A 4OENA 2V3TA 2GH9A 1MXYA 3GBAA 2DWIA 3OD7A 3U92A 2XXIA 1D9VA 2Z8DA 2VD2A 2OK2A 4BLAA 2KLFA 4YZZA 2BJJX 3PPPA 2G93A 4BDMA 1M5EA 1RYOA 4F3SA 4LONB 3PUVE 2H98A 3KOSA 1IQ7A 1R9QA 4RNSA 3KFMA 2UVIA 5H8HA 4EXKA 1B9JA 2QL3A 5LOMA 4KI0E 1ZU0A 3O6IA 3PPNA 5EYFA 1PEBA 1N7XA 1A7LA 5AA3A 1UTBA 2GRVA 3MZ9A 3KN7A 3C32A 2F78A 1F9BA 1FQAA 3TAJA 1XC1A 1SVXB 4Q5TA 1ZKBA 4NMYA 4F31B 4HTGA 1DSNA 3IR1A 1JW5A 4G2ZA 2QS2A 1NL5A 1B3EA 5CBRA 4U1ZA 2F7CA 2H5YA 2Q88A 2B4MA 3PUYE 2QPQA 1B3LA 3ZKLA 1WODA 2O69A 4EQBA 4LP2B 3S9MC 4YKPA 4IB2A 4F22A 5KCJB 4ZE8A 2Z23A 5DVFA 2THIA 3K1MA 3A3UA 1MY0A 1URSA 3FXUA 5DTBA 3FTOA 3IORA 2F35A 3SEWA 1BKAA 4H5GA 3MVYA 1MY2A 3OO6A 3B6TA 1B5IA 1EU8A 3MVWA 3TKDA 5I2NA 4MBPA 2P0SA 1NKXA 3JV9A 4G8HA 4YMBA 2QRYA 4Q0CA 3PMXA 4R6YA 2ZYNA 4QF9A 4OTEA 3U8QA 2X7QA 4GL0A 4RXLA 3EHTA 3QUJA 3D4CA 3L6GA 4WXJA 2XXPA 2QJEA 3IL1B 4EF1A 1M5FA 2DXYA 2O68A 3TYHA 4DCXA 2I3WA 1MDQA 4KCCA 1PBPA 3MQ9A 3SKPA 3N5LA 3KSXA 1FQDA 1URDA 1Y4CA 1FTLA 1I6AA 3DRKA 1N04A 1B2HA 2M8CA 4ZE9A 2OCUA 4DXBA 1Y20A 2IEEA 3T9VA 4H1XA 2ONSA 4R74A 4MLVA 4GD5A 2XD3A 4KYSA 2O1LA 3MZBA 4DE8A 2WOPA 1MG1A 1OVBA 1PC3A 2QSXA 4XKQA 2RC9A 1Q35A 1FQBA 1A8EA 2PX1A 3E4RA 4UACA 5TPAB 2REJA 1HSLA 4LQ2A 4OQOA 1ANFA 4POXA 3O6HA 4JDFA 4LQ5A 3SEVA 3B6QA 4KCDA 3H6WA 1O64A 4OERA 4H67A 2VGQA 2PBWA 2H25A 1MPDA 3O66A 1B7ZA 1SYIA 3HCQA 1SW2A 3UORA 4R9GA 4FECA 4G4PA 4R73A 4HCWA 4PFWA 1N84A 1B46A 4O3CA 2DXRA 3FV1A 5AA4B 5A5XA 1DPEA 2QS4A 2ZNTA 1ZTYA 2YLNA 3ILUB 5L9SA 4TLMB 4JWYA 1VFEA 3K4UA 4RK2A 4OFJA 2DE2A 5EHSA 2DP8A 3O29A 1RKMA 2ZNSA 1NNPA 4FATA 4U22A 1B32A 4IGRA 3IK6B 3RNNA 4GOTA 1D9YA 3CFXA 1JW1A 4I8CA 4Z0IA 3HO7A 2HFBA 3N6UA 4NF5A 2X7PA 1TXFA 2B3FA 2Q8JA 1B5JA 3CI8A 3KN3A 3KG2A 1IEJA 4H65A 1MXXA 2HXWA 3HV1A 3IB0A 3S4UA 4IGTA 3EF7A 4H5FA 4FEDA 1XOCA 4ELQA 2Y7IA 3CSBA 4FEBA 4GQOA 4U23A 1BIYA 4KHZE 5CMMA 3CRBA 5FTHA 3MJNA 1EZPA 3OSRA 3VFJA 2F7BA 3PUWE 2DWJA 1B6HA 3KZGA 4AB6A 2R6GE 5H8FA 3M3FA 2UVGA 1LSTA 4UA8A 2Q2CA 2Q9TA 4F18A 1NH8A 4OVJA 3O6GA 1SBPA 3U93A 3DRIA 4P0IA 4JSOA 4TQUQ 3MP8A 1PB7A 3KN8A 4G8NA 3H6TA 5I59A 2Q2AA 2V93A 3RY3A 4H8JA 4MFIA 2ONKE 5I2KB 2QMXA 1FTKA 1S50A 1B3HA 3FVNA 4F39A 1AL3A 2I49A 1T0KA 4NF8A 3DRHA 4G68B 1GVCA 3GZGA 4NF6B 3BBRA 4QFKA 3R6UA 2RINA 4ZS9A 2DQVA 1QUIA 4C1TA 4C1UA 3GBBA 4HS7A 1MM7A 1IXHA 3S9LC 1R9LA 2WOKA 1H44A 2YPNA 1DMBA 4I62A 1MH4A 2RCBA 3TUSA 4IO6A 3VV5A 4IO2A 3IO6A 4M4GA 4QRZA 1SI0A 1MXVA 3QK6A 2I48A 3I3VA 2F97A 3MPKA 2IA4A 3LSWA 4TOZA 1FCKA 3USDA 2VHAA 3ZS6A 4ONYA 5H8HB 2F8DA 1BP5A 2Q89A 2XXTA 1IIWA 3FD3A 1EZ9A 3G3GA 3TTRA 2VOZA 1Y9UA 1LFGA 1VR5A 5DVJA 3DRFA 4X9TA 3RPWA 1A40A 3DM0A 2AIXA 2NWJA 2XX7A 4PETA 2PYYA 5CC2A 3LVUA 3W15C 4O3AA 4C0RA 5KDTA 5ITOA 3FVGA 4O3BA 5DEXA 3KGCA 4PFYA 4DIGA 2O51A 3K6WA 3OENA 1SYHA 3ILTB 1B58A 2ZNUA 4YU0A 2DE4A 1P1OA 1R6ZA 4ZEBA 4AQ4A 1I6BA 3VE1B 3TEPA 4DXCA 1DTZA 1B4HA 3SERA 1MXUA 4OETA 4GIZA 2PVUA 1MQJA 2XXRA 4EXLA 2E0SA 1GR2A 4LA9A 1A55A 2PMSA 3H3GA 3T96B 1B3FA 3G3JA 3OEMA 4FE8A 3M3LA 5I58A 5I57B 4PFTA 4MF3A 3K1NA 4FORA 2V3QA 3FJGA 4RY1A 1JVXA 5ELVA 1LB8A 4WEPA 4EF2A 4YMAA 1IXGA 3N94A 5CMCA 4ZZAA 3DELB 3VDFA 3TCFA 5CRYA 1A8FA 3UIFA 1P1WA 1MY4A 1CE2A 3ONMA 1B1HA 1AOVA 2XX8A 4RYAA 4TLLB 5AA2D 1H43A 4DLDA 1MS7A 2DE3A 4KPTA 3IOWA 1AMFA 3SETA 4YKJA 2QMWA 1S7YA 1ELJA 3H7MA 1IXCA 2ZYMA 4NEDA 3RYBA 3KSJA 1R1NA 3I5OA 3HSTA 3QUFA 1LAFE 2V3UA 1AIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4T A;  3OMB A;  4G8M A;  4I1D A;  4BDO A;  3MUQ A;  1SW1 A;  3FJ7 A;  2ZYK A;  1P1Q A;  2A5T B;  4ZED A;  1A99 A;  3UGW A;  4GXS B;  3MBP A;  1RYX A;  3SEU A;  4F29 A;  1Y3N A;  3TFL A;  4ZEF A;  1A54 A;  3ZSF A;  4BDR A;  5KCJ A;  4KYD A;  1QUJ A;  4IY6 A;  3TDJ A;  4I9D A;  2Y84 A;  5JTY A;  3CHG A;  3JYR A;  4G77 A;  1MXZ A;  3BKI B;  3I6V A;  4OFL A;  1PDA A;  2HAU A;  2HQ0 A;  3LSX A;  2RF1 A;  1S9T A;  4FJP A;  3V83 A;  5HBC A;  3MC2 A;  1B5H A;  3LSL A;  4QSE A;  3PD8 A;  3AXF A;  2DVZ A;  3KJ7 A;  3O6P A;  5FTI A;  2QS3 A;  3U72 A;  1MPC A;  3UK4 A;  1MXW A;  3VXC A;  3CFL A;  1PBQ A;  1P1U A;  3PPQ A;  1L5T A;  5K2Y A;  3ODB A;  1LFI A;  1Y1Z A;  3A09 A;  4ND9 A;  4OXV A;  4EUO A;  4QSC A;  4YAH X;  2O6A A;  3Q25 A;  5DT6 A;  3G3F A;  2AYS A;  5CM6 A;  4JXI A;  3C33 A;  1JQF A;  4IO3 A;  5B7D A;  4NF5 B;  4ISU A;  1YPN A;  2D3I A;  2DWH A;  3PMV A;  4RJZ A;  3EN3 A;  3T9U A;  2Z8E A;  3IOV A;  2Y7W A;  4QFL A;  4F3P A;  1URG A;  3QXM A;  3G3I A;  3RN8 A;  4F3B A;  1XVX A;  4R75 A;  5L8D A;  5DVI A;  5I56 A;  3CSG A;  3EHU A;  1II5 A;  5AA2 A;  4R2B A;  3RUM A;  1KWH A;  1B7H A;  4EQ7 A;  4ELR A;  1XVY A;  2CZL A;  5H8F B;  3RTF B;  3E13 X;  3PUZ E;  1DOT A;  2F36 A;  1UTH A;  4H8I A;  5ICT A;  2UYF A;  4JB7 A;  2I6E A;  4KQP A;  3TTK A;  4R6K A;  3T22 A;  1VE4 A;  5JK4 A;  4PP0 A;  1BLF A;  2QS1 A;  3K1P A;  1MPB A;  3DP8 A;  4F1V A;  4OYV A;  5I59 B;  2OJT A;  2X26 A;  3TPA A;  1NFT A;  3HN0 A;  2ESN A;  4HCY A;  3IB2 A;  4DDD A;  1DTG A;  2RC7 A;  2NXO A;  1NNF A;  3RGY A;  4F19 A;  3MVZ A;  4LZ8 A;  1FTO A;  3O28 A;  5HM4 B;  3U94 A;  1OVT A;  1H3D A;  2XXV A;  3FAS A;  4LZ5 A;  4AB5 A;  2F6G A;  3H4Z A;  2REG A;  4WKM A;  4F2O A;  4NF4 B;  4ESW A;  5CBS A;  4MLQ A;  2XXY A;  3IO4 A;  1Z7N E;  3H6V A;  3WAF A;  2YJP A;  5F1Q A;  4NWC A;  1SQY A;  1OMP A;  1OLA A;  1GTK A;  2WOL A;  1PB8 A;  1EH3 A;  5ISU A;  3O2A A;  1US5 A;  5CMB A;  3V89 B;  4G68 C;  3PPR A;  4E0W A;  1B4Z A;  3CG1 A;  3MAM A;  2RCA A;  3FIR A;  3ZKK A;  1B51 A;  1JEU A;  1LBB A;  5AA1 A;  1LAH E;  1QUL A;  5H8Q A;  2FNC A;  2WKY A;  2DSF A;  1DPP A;  2B4L A;  2W7Y A;  3FV2 A;  4X1B A;  1MY3 A;  2I0C A;  3TTM A;  4N07 A;  1FW0 A;  3PPO A;  4YKI A;  3PV0 E;  5K2X A;  1POY 1;  1LBC A;  2Z22 A;  4N13 A;  1B0L A;  3Q26 A;  3VLV A;  4F1Y A;  3K01 A;  1NNK A;  3DLN A;  4IY5 A;  3LR1 A;  5AE4 A;  3TCH A;  3QIM A;  1MDP 1;  4ZEI A;  1FTJ A;  1M5D A;  2PT2 A;  1JW4 A;  3T66 A;  1NMU A;  4ZZE A;  1LCT A;  5KDT B;  4F3G A;  3HPI A;  1ZMG A;  3DP4 A;  5DEX B;  2OWT A;  1OLC A;  4U2R A;  3FZV A;  4NWD A;  5JEI A;  3H6U A;  1B0H A;  5FHN A;  1XS5 A;  4GXA A;  3VVF A;  3DP6 A;  4THI A;  2HAV A;  4WED A;  3RQT A;  2Y7K A;  2P2A A;  3S9E A;  1H45 A;  3FJM A;  1P1N A;  3OO9 A;  2OLB A;  2V84 A;  1OQG A;  4OMB A;  1UTB B;  3IJX B;  3K00 A;  1JET A;  3CFZ A;  2GHA A;  5M2V A;  4MH5 A;  2VD3 A;  4G68 A;  2NVU B;  3V8X B;  1O63 A;  2OBG A;  1Y3Q A;  2HEU A;  1POT A;  3MVX A;  4EQ9 A;  5H8N A;  1TFA A;  4U1O A;  3EPE A;  3T9X B;  1N76 A;  3C34 A;  3THI A;  1VFD A;  2ONR A;  4XTC Q;  3OEL A;  4DZ1 A;  1MQG A;  2XXX A;  4KD5 A;  3M3K A;  4RK9 A;  3E9X A;  3FXQ A;  4X48 A;  3KEI A;  5L9O A;  3PAM A;  2OWS A;  3L6H A;  4OEU A;  5I84 A;  1FQC A;  5HPQ A;  5IKB A;  4RA1 A;  3SEX A;  3U1O A;  2ZYO A;  3CR9 A;  2P1S A;  1OQH A;  2Y7P A;  4OEV A;  4YKK A;  3N26 A;  1H76 A;  2R71 A;  1IZ1 A;  1UIU A;  1WVJ A;  1AH5 A;  4XKP A;  2D5W A;  2UYE A;  3G7W A;  3QYT A;  1YTV A;  2I4B A;  5I2N B;  5TP9 A;  1UIV A;  4QFN A;  5CI5 A;  4K3F A;  2GHB A;  1WDN A;  1MRP A;  4ELO A;  3TMG A;  2NUV A;  3S9N C;  4JWO A;  1SI1 A;  2ANJ A;  1SW5 A;  2B65 A;  1TFD A;  1O7T A;  1LAX A;  3TZA A;  5JTY B;  1QJM A;  4OES A;  4ESX A;  3TTN A;  1USY E;  2HCA A;  1JNF A;  2ZXT A;  4PQJ A;  2DYX A;  3W9V A;  5DYH A;  3PD9 A;  3DRJ A;  3OXN A;  3FVK A;  4LZ7 A;  3C36 A;  3PU5 A;  3B6W A;  2O7U A;  4XXU A;  1B7U A;  2I58 A;  4JBZ A;  1XT8 A;  3KBR A;  3KOT A;  2H4I A;  3C35 A;  3A3C A;  1QUK A;  2VP1 A;  1FTM A;  3LBS A;  2F5X A;  2HZK A;  2O84 X;  1MQD A;  3PMW A;  3MZ1 A;  3IOU A;  3TQW A;  2HZL A;  4KR5 A;  4OHN A;  1XHY A;  3VVD A;  1TWY A;  4KYE A;  5I57 A;  3CVG A;  2PT1 A;  1YAE A;  5FHO A;  4R2F A;  3V5A A;  2V25 A;  1NNT A;  5F7V A;  1N7W A;  1N3X A;  4IO7 A;  5H8S A;  1B52 A;  1VSO A;  2ALU A;  1SDX A;  4FIM A;  2UXA A;  2GFE A;  2I4C A;  4IO5 A;  1B05 A;  4IO4 A;  5IAI A;  1ZLQ A;  3K6V A;  3SDF A;  2O1M A;  2UVH A;  4GRK A;  3TTL A;  3T93 B;  1BTJ A;  4RPO A;  5A5X B;  1IIT A;  5J1D A;  4R72 A;  3Q29 A;  3IB1 A;  1D3K A;  1FQF A;  2RKM A;  1IXI A;  4ZDM A;  4LUB A;  2F34 A;  4GLI A;  2XXW A;  1IUD A;  3W9W A;  5I56 B;  2RC8 A;  5AA2 B;  2H9B A;  4U4S A;  3H06 B;  1JEV A;  1MH3 A;  3PUX E;  1HSJ A;  1MM6 A;  1B1X A;  5EHM A;  1FQE A;  3MP1 A;  3QAX A;  2A5T A;  3UP9 A;  4XIG Q;  4F1U A;  1UTH B;  3FXR A;  5FHM A;  4P0G A;  4KFQ A;  3RLF E;  3VLU A;  2R9J A;  1P99 A;  4EDP A;  3IJO B;  4POW A;  2XD2 A;  3TEL A;  3UN6 A;  3RT6 B;  3R7X A;  4Q8R A;  1MY1 A;  4OWD A;  4RPN A;  1ZJL A;  3TOD A;  2H99 A;  3HHG A;  3B7D A;  4M1V A;  3D4G A;  3FGS A;  2NOO A;  1CB6 A;  4GWO A;  1OIB A;  1Y1M A;  3SES A;  4JWX A;  3F11 A;  3PGF A;  1D4N A;  1NH7 A;  2A5S A;  3BFU A;  1SD3 A;  3OO7 A;  3K0V A;  5TPA A;  3EQ1 A;  4XKR A;  2I3V A;  3S2V A;  3MPL A;  2G29 A;  1US4 A;  3LSF B;  5CMK A;  2DWA A;  3JZJ A;  3IX1 A;  3TCG A;  3P7I A;  1JVY A;  2DS9 A;  3FVO A;  1UQW A;  4NE4 A;  4XKN A;  1MQH A;  4PFU A;  3VVE A;  2B3B A;  3SEY A;  1M5B A;  1GGG A;  5H8Q B;  3O9P A;  4GVO A;  4X1D A;  1M5C A;  3MWB A;  4LAT A;  1HSE A;  5AA4 A;  2OZZ A;  4NF8 B;  2Y7R A;  4YIC A;  4QSD A;  4H0W A;  3MP6 A;  4U4X A;  3HHF A;  2FYI A;  4QFO A;  1LCF A;  3K2D A;  4GL8 A;  2LAO A;  4YB6 A;  2DOJ A;  3CG3 A;  4E0X A;  4NTL A;  1EZO A;  5KZT A;  1I6Q A;  3MW0 A;  4R9F A;  4F2Q A;  1LGB C;  4Z7E A;  3LUY A;  3Q28 A;  1ATG A;  3Q27 A;  4YB5 A;  4BDN A;  1LLS A;  3O97 A;  5ICQ A;  3ECR A;  1LFH A;  1SW4 A;  4ECF A;  4GF8 A;  3FUZ A;  4PE5 B;  5BUU A;  2UVJ A;  2E1S A;  2F6P A;  3C9H A;  2ZMB A;  5ITP A;  2XXQ A;  3LC8 A;  1Z7M E;  3IAZ A;  3H03 A;  4Q30 B;  4DCY A;  1Y3P A;  1PB9 A;  2O7I A;  3M8U A;  3VLW A;  2XXU A;  3CIJ A;  1TT1 A;  3K6U A;  4GFR A;  3OEK A;  3T9H B;  4FAJ A;  4YB7 A;  3QSL A;  1YCJ A;  2DVC A;  1I69 A;  1QKA A;  3WAE A;  3R26 A;  2ABH A;  4ZEC A;  3GLB A;  4NF4 A;  3RTW B;  5H8N B;  3RYA A;  4BDQ A;  3OO8 A;  3UA8 A;  3K02 A;  2CMO A;  4H6D A;  3K6X A;  4L17 A;  3E3K A;  2XXH A;  1QW0 A;  1N0T A;  5L9M A;  1B40 A;  1LB9 A;  4DXU A;  3BFT A;  4ELP A;  2Z8F A;  1GV8 A;  3VXB A;  1ZBM A;  4LVQ A;  2XX9 A;  3OSQ A;  3GXA A;  5I2K A;  5BWJ A;  2AL4 A;  3G3H A;  1Q1K A;  3EHS A;  4OFO A;  2AL5 A;  3OOA A;  3FAT A;  4R6H A;  4BDL A;  3G3K A;  3IOT A;  2FA7 A;  1ZIU A;  4OZ9 A;  4NF6 A;  4QFP A;  1B3G A;  1LAG E;  2XHD A;  1USY H;  4HW8 A;  4QHQ A;  4JSD A;  3KJT A;  4P11 A;  1QVS A;  3C4M A;  3DRG A;  2I0B A;  5I58 B;  1MQI A;  2F7A A;  3N6T A;  5TU0 A;  4ZEK A;  1QKB A;  4N6P A;  3TQL A;  5TP9 B;  3RT8 A;  1N3W A;  1J1N A;  3C31 A;  5B70 A;  2D21 A;  4U21 A;  4OEN A;  2V3T A;  2GH9 A;  1MXY A;  3GBA A;  2DWI A;  3OD7 A;  3U92 A;  2XXI A;  1D9V A;  2Z8D A;  2VD2 A;  2OK2 A;  4BLA A;  2KLF A;  4YZZ A;  2BJJ X;  3PPP A;  2G93 A;  4BDM A;  1M5E A;  1RYO A;  4F3S A;  4LON B;  3PUV E;  2H98 A;  3KOS A;  1IQ7 A;  1R9Q A;  4RNS A;  3KFM A;  2UVI A;  5H8H A;  4EXK A;  1B9J A;  2QL3 A;  5LOM A;  4KI0 E;  1ZU0 A;  3O6I A;  3PPN A;  5EYF A;  1PEB A;  1N7X A;  1A7L A;  5AA3 A;  1UTB A;  2GRV A;  3MZ9 A;  3KN7 A;  3C32 A;  2F78 A;  1F9B A;  1FQA A;  3TAJ A;  1XC1 A;  1SVX B;  4Q5T A;  1ZKB A;  4NMY A;  4F31 B;  4HTG A;  1DSN A;  3IR1 A;  1JW5 A;  4G2Z A;  2QS2 A;  1NL5 A;  1B3E A;  5CBR A;  4U1Z A;  2F7C A;  2H5Y A;  2Q88 A;  2B4M A;  3PUY E;  2QPQ A;  1B3L A;  3ZKL A;  1WOD A;  2O69 A;  4EQB A;  4LP2 B;  3S9M C;  4YKP A;  4IB2 A;  4F22 A;  5KCJ B;  4ZE8 A;  2Z23 A;  5DVF A;  2THI A;  3K1M A;  3A3U A;  1MY0 A;  1URS A;  3FXU A;  5DTB A;  3FTO A;  3IOR A;  2F35 A;  3SEW A;  1BKA A;  4H5G A;  3MVY A;  1MY2 A;  3OO6 A;  3B6T A;  1B5I A;  1EU8 A;  3MVW A;  3TKD A;  5I2N A;  4MBP A;  2P0S A;  1NKX A;  3JV9 A;  4G8H A;  4YMB A;  2QRY A;  4Q0C A;  3PMX A;  4R6Y A;  2ZYN A;  4QF9 A;  4OTE A;  3U8Q A;  2X7Q A;  4GL0 A;  4RXL A;  3EHT A;  3QUJ A;  3D4C A;  3L6G A;  4WXJ A;  2XXP A;  2QJE A;  3IL1 B;  4EF1 A;  1M5F A;  2DXY A;  2O68 A;  3TYH A;  4DCX A;  2I3W A;  1MDQ A;  4KCC A;  1PBP A;  3MQ9 A;  3SKP A;  3N5L A;  3KSX A;  1FQD A;  1URD A;  1Y4C A;  1FTL A;  1I6A A;  3DRK A;  1N04 A;  1B2H A;  2M8C A;  4ZE9 A;  2OCU A;  4DXB A;  1Y20 A;  2IEE A;  3T9V A;  4H1X A;  2ONS A;  4R74 A;  4MLV A;  4GD5 A;  2XD3 A;  4KYS A;  2O1L A;  3MZB A;  4DE8 A;  2WOP A;  1MG1 A;  1OVB A;  1PC3 A;  2QSX A;  4XKQ A;  2RC9 A;  1Q35 A;  1FQB A;  1A8E A;  2PX1 A;  3E4R A;  4UAC A;  5TPA B;  2REJ A;  1HSL A;  4LQ2 A;  4OQO A;  1ANF A;  4POX A;  3O6H A;  4JDF A;  4LQ5 A;  3SEV A;  3B6Q A;  4KCD A;  3H6W A;  1O64 A;  4OER A;  4H67 A;  2VGQ A;  2PBW A;  2H25 A;  1MPD A;  3O66 A;  1B7Z A;  1SYI A;  3HCQ A;  1SW2 A;  3UOR A;  4R9G A;  4FEC A;  4G4P A;  4R73 A;  4HCW A;  4PFW A;  1N84 A;  1B46 A;  4O3C A;  2DXR A;  3FV1 A;  5AA4 B;  5A5X A;  1DPE A;  2QS4 A;  2ZNT A;  1ZTY A;  2YLN A;  3ILU B;  5L9S A;  4TLM B;  4JWY A;  1VFE A;  3K4U A;  4RK2 A;  4OFJ A;  2DE2 A;  5EHS A;  2DP8 A;  3O29 A;  1RKM A;  2ZNS A;  1NNP A;  4FAT A;  4U22 A;  1B32 A;  4IGR A;  3IK6 B;  3RNN A;  4GOT A;  1D9Y A;  3CFX A;  1JW1 A;  4I8C A;  4Z0I A;  3HO7 A;  2HFB A;  3N6U A;  4NF5 A;  2X7P A;  1TXF A;  2B3F A;  2Q8J A;  1B5J A;  3CI8 A;  3KN3 A;  3KG2 A;  1IEJ A;  4H65 A;  1MXX A;  2HXW A;  3HV1 A;  3IB0 A;  3S4U A;  4IGT A;  3EF7 A;  4H5F A;  4FED A;  1XOC A;  4ELQ A;  2Y7I A;  3CSB A;  4FEB A;  4GQO A;  4U23 A;  1BIY A;  4KHZ E;  5CMM A;  3CRB A;  5FTH A;  3MJN A;  1EZP A;  3OSR A;  3VFJ A;  2F7B A;  3PUW E;  2DWJ A;  1B6H A;  3KZG A;  4AB6 A;  2R6G E;  5H8F A;  3M3F A;  2UVG A;  1LST A;  4UA8 A;  2Q2C A;  2Q9T A;  4F18 A;  1NH8 A;  4OVJ A;  3O6G A;  1SBP A;  3U93 A;  3DRI A;  4P0I A;  4JSO A;  4TQU Q;  3MP8 A;  1PB7 A;  3KN8 A;  4G8N A;  3H6T A;  5I59 A;  2Q2A A;  2V93 A;  3RY3 A;  4H8J A;  4MFI A;  2ONK E;  5I2K B;  2QMX A;  1FTK A;  1S50 A;  1B3H A;  3FVN A;  4F39 A;  1AL3 A;  2I49 A;  1T0K A;  4NF8 A;  3DRH A;  4G68 B;  1GVC A;  3GZG A;  4NF6 B;  3BBR A;  4QFK A;  3R6U A;  2RIN A;  4ZS9 A;  2DQV A;  1QUI A;  4C1T A;  4C1U A;  3GBB A;  4HS7 A;  1MM7 A;  1IXH A;  3S9L C;  1R9L A;  2WOK A;  1H44 A;  2YPN A;  1DMB A;  4I62 A;  1MH4 A;  2RCB A;  3TUS A;  4IO6 A;  3VV5 A;  4IO2 A;  3IO6 A;  4M4G A;  4QRZ A;  1SI0 A;  1MXV A;  3QK6 A;  2I48 A;  3I3V A;  2F97 A;  3MPK A;  2IA4 A;  3LSW A;  4TOZ A;  1FCK A;  3USD A;  2VHA A;  3ZS6 A;  4ONY A;  5H8H B;  2F8D A;  1BP5 A;  2Q89 A;  2XXT A;  1IIW A;  3FD3 A;  1EZ9 A;  3G3G A;  3TTR A;  2VOZ A;  1Y9U A;  1LFG A;  1VR5 A;  5DVJ A;  3DRF A;  4X9T A;  3RPW A;  1A40 A;  3DM0 A;  2AIX A;  2NWJ A;  2XX7 A;  4PET A;  2PYY A;  5CC2 A;  3LVU A;  3W15 C;  4O3A A;  4C0R A;  5KDT A;  5ITO A;  3FVG A;  4O3B A;  5DEX A;  3KGC A;  4PFY A;  4DIG A;  2O51 A;  3K6W A;  3OEN A;  1SYH A;  3ILT B;  1B58 A;  2ZNU A;  4YU0 A;  2DE4 A;  1P1O A;  1R6Z A;  4ZEB A;  4AQ4 A;  1I6B A;  3VE1 B;  3TEP A;  4DXC A;  1DTZ A;  1B4H A;  3SER A;  1MXU A;  4OET A;  4GIZ A;  2PVU A;  1MQJ A;  2XXR A;  4EXL A;  2E0S A;  1GR2 A;  4LA9 A;  1A55 A;  2PMS A;  3H3G A;  3T96 B;  1B3F A;  3G3J A;  3OEM A;  4FE8 A;  3M3L A;  5I58 A;  5I57 B;  4PFT A;  4MF3 A;  3K1N A;  4FOR A;  2V3Q A;  3FJG A;  4RY1 A;  1JVX A;  5ELV A;  1LB8 A;  4WEP A;  4EF2 A;  4YMA A;  1IXG A;  3N94 A;  5CMC A;  4ZZA A;  3DEL B;  3VDF A;  3TCF A;  5CRY A;  1A8F A;  3UIF A;  1P1W A;  1MY4 A;  1CE2 A;  3ONM A;  1B1H A;  1AOV A;  2XX8 A;  4RYA A;  4TLL B;  5AA2 D;  1H43 A;  4DLD A;  1MS7 A;  2DE3 A;  4KPT A;  3IOW A;  1AMF A;  3SET A;  4YKJ A;  2QMW A;  1S7Y A;  1ELJ A;  3H7M A;  1IXC A;  2ZYM A;  4NED A;  3RYB A;  3KSJ A;  1R1N A;  3I5O A;  3HST A;  3QUF A;  1LAF E;  2V3U A;  1AIV A; 
#chains in the Genus database with same CATH topology
 5LDZ A;  1Y4T A;  3OMB A;  4G8M A;  4I1D A;  4BDO A;  4DI3 D;  3MUQ A;  1SW1 A;  3FJ7 A;  2ZYK A;  2QFL A;  1P1Q A;  1NV5 A;  2A5T B;  4ZED A;  1A99 A;  3UGW A;  4GXS B;  5EQ9 A;  3MBP A;  1RYX A;  2XWO A;  3SEU A;  4F29 A;  1Y3N A;  1LBV A;  3TFL A;  4ZEF A;  2Q74 A;  1A54 A;  3ZSF A;  4BDR A;  4GX3 A;  5KCJ A;  4KYD A;  2R8T A;  1QUJ A;  4IY6 A;  4AS5 A;  3TDJ A;  1IMC A;  3LV0 A;  4I9D A;  2Y84 A;  5JTY A;  3CHG A;  3JYR A;  4G77 A;  1MXZ A;  3BKI B;  3I6V A;  4OFL A;  1PDA A;  2HAU A;  2HQ0 A;  3LSX A;  2RF1 A;  1S9T A;  4FJP A;  1FPI A;  3V83 A;  5HBC A;  4FBP A;  3MC2 A;  1B5H A;  1EYI A;  3LSL A;  4QSE A;  3PD8 A;  3AXF A;  2DVZ A;  3KJ7 A;  3O6P A;  5FTI A;  2QS3 A;  5ET7 A;  3U72 A;  2Q8M A;  1MPC A;  3UK4 A;  1MXW A;  3VXC A;  3CFL A;  1PBQ A;  2Y5K A;  1P1U A;  3PPQ A;  1L5T A;  4MEV A;  5K2Y A;  3ODB A;  1LFI A;  1SPI A;  1Y1Z A;  3A09 A;  4ND9 A;  4OXV A;  4EUO A;  4QSC A;  4YAH X;  4AS4 A;  2O6A A;  3Q25 A;  5DT6 A;  2WX9 A;  3G3F A;  2AYS A;  5CM6 A;  4JXI A;  3C33 A;  1JQF A;  4IO3 A;  5B7D A;  4NF5 B;  4ISU A;  1YPN A;  2D3I A;  2DWH A;  3PMV A;  4RJZ A;  3EN3 A;  3T9U A;  2Z8E A;  3IOV A;  2Y7W A;  3KC1 A;  1RDX A;  4QFL A;  4F3P A;  1URG A;  3QXM A;  3G3I A;  2FIE A;  3RN8 A;  4F3B A;  1XVX A;  1FBE A;  4R75 A;  5L8D A;  5DVI A;  5I56 A;  3CSG A;  3EHU A;  1II5 A;  5AA2 A;  4R2B A;  3RUM A;  1KWH A;  1B7H A;  4EQ7 A;  4ELR A;  1XVY A;  2CZL A;  5H8F B;  3RTF B;  3E13 X;  3PUZ E;  4PFI A;  1DOT A;  2F36 A;  1UTH A;  2QVR A;  3ROJ A;  4H8I A;  5ICT A;  2UYF A;  4JB7 A;  2I6E A;  4KQP A;  3TTK A;  4R6K A;  3T22 A;  1VE4 A;  5JK4 A;  4PP0 A;  4NX1 A;  1BLF A;  2QS1 A;  3K1P A;  3BIH A;  1MPB A;  3DP8 A;  4F1V A;  4OYV A;  5I59 B;  2OJT A;  2X26 A;  3TPA A;  1NFT A;  1QGX A;  3HN0 A;  2ESN A;  4HCY A;  3IB2 A;  4DDD A;  1DTG A;  2RC7 A;  2NXO A;  1NNF A;  3RGY A;  4F19 A;  3MVZ A;  4PCD A;  4LZ8 A;  1FTO A;  3O28 A;  5HM4 B;  3U94 A;  1OVT A;  1H3D A;  4MNI A;  2XXV A;  3U65 A;  3FAS A;  4LZ5 A;  4AB5 A;  2F6G A;  3H4Z A;  1XI6 A;  2REG A;  4NAP A;  4WKM A;  4PAK A;  4F2O A;  4I40 A;  4NF4 B;  4ESW A;  5CBS A;  4MLQ A;  2XXY A;  3IO4 A;  1Z7N E;  3H6V A;  3WAF A;  1FBC A;  1Q9D A;  2YJP A;  4UAB A;  5F1Q A;  4NWC A;  1SQY A;  1OMP A;  1OLA A;  1G0I A;  1GTK A;  2WOL A;  1PB8 A;  1EH3 A;  5ISU A;  1LEV A;  3O2A A;  1US5 A;  5CMB A;  3V89 B;  4G68 C;  3PPR A;  4E0W A;  4GWW A;  1B4Z A;  3CG1 A;  3MAM A;  2RCA A;  2FBP A;  3FIR A;  4MNC A;  3ZKK A;  2WEF A;  1B51 A;  1JEU A;  1LBB A;  5AA1 A;  1LAH E;  1QUL A;  1FBG A;  5H8Q A;  1NV0 A;  2FNC A;  2WKY A;  2DSF A;  2XWK A;  4HE2 A;  1DPP A;  2B4L A;  2W7Y A;  3FV2 A;  4X1B A;  1MY3 A;  2I0C A;  3TTM A;  4JVC A;  4N07 A;  1FW0 A;  3PPO A;  4YKI A;  3PV0 E;  5K2X A;  2BJI A;  1POY 1;  1K9Z A;  1LBC A;  2Z22 A;  4N13 A;  1B0L A;  3Q26 A;  3VLV A;  4F1Y A;  3K01 A;  1NNK A;  3DLN A;  4IY5 A;  3LR1 A;  5AE4 A;  2QVV A;  3TCH A;  3QIM A;  1MDP 1;  4ZEI A;  1FTJ A;  1M5D A;  2PT2 A;  1JW4 A;  3T66 A;  1NMU A;  4O94 A;  4ZZE A;  1LCT A;  5KDT B;  4F3G A;  3HPI A;  1ZMG A;  3DP4 A;  5DEX B;  2OWT A;  1OLC A;  4U2R A;  3FZV A;  1IMD A;  4IR8 A;  4NWD A;  5JEI A;  3IFA A;  4I3E A;  3H6U A;  1B0H A;  5FHN A;  2ZZX A;  1XS5 A;  4PGP A;  4GXA A;  3VVF A;  4KXP A;  4P1L A;  3DP6 A;  4THI A;  2HAV A;  4WED A;  4NG7 A;  5I5P A;  2WBB A;  3RQT A;  2Y7K A;  4MIJ A;  2P2A A;  1FBH A;  4N6K A;  1H45 A;  3S9E A;  3FJM A;  3OO9 A;  1P1N A;  2OLB A;  2V84 A;  1OQG A;  4OMB A;  1UTB B;  3IJX B;  1NV4 A;  3K00 A;  1JET A;  3CFZ A;  2GHA A;  2Y5L A;  5M2V A;  4MH5 A;  2VD3 A;  4G68 A;  2NVU B;  1INP A;  3V8X B;  1O63 A;  2OBG A;  1Y3Q A;  2HEU A;  4P9K A;  1LBW A;  1POT A;  2CZH A;  3MVX A;  1FPJ A;  4EQ9 A;  1NV6 A;  5H8N A;  2KQZ A;  1TFA A;  2HXR A;  4U1O A;  3EPE A;  3T9X B;  1N76 A;  2DDK A;  3C34 A;  3THI A;  1VFD A;  2ONR A;  4XTC Q;  3OEL A;  4DZ1 A;  5I7I A;  1MQG A;  2XXX A;  4KD5 A;  3M3K A;  4NHB A;  4RK9 A;  3E9X A;  3FXQ A;  4X48 A;  3KEI A;  5L9O A;  3PAM A;  2OWS A;  3L6H A;  4OEU A;  5I84 A;  1FQC A;  5HPQ A;  5IKB A;  4RA1 A;  3SEX A;  3U1O A;  2ZYO A;  3CR9 A;  2P1S A;  4HXV A;  1OQH A;  2Y7P A;  4PFB A;  4OEV A;  4OVT A;  4YKK A;  3N26 A;  1LBX A;  1H76 A;  2R71 A;  1IZ1 A;  4OVQ A;  1UIU A;  1WVJ A;  1AH5 A;  4PTK A;  4XF5 A;  4XKP A;  2D5W A;  2UYE A;  3G7W A;  3QYT A;  3KBZ A;  1YTV A;  1KZ8 A;  2I4B A;  5I2N B;  5TP9 A;  1UIV A;  4MHF A;  4GWY A;  4QFN A;  5CI5 A;  4K3F A;  2GHB A;  1WDN A;  1MRP A;  2XA5 A;  4ELO A;  1BK4 A;  3TMG A;  4P1E A;  2NUV A;  3S9N C;  4JWO A;  1SI1 A;  2ANJ A;  1SW5 A;  2B65 A;  4JVI A;  3LUZ A;  1TFD A;  1O7T A;  1LAX A;  3TZA A;  5JTY B;  1QJM A;  4OES A;  4ESX A;  1RDZ A;  3TTN A;  1USY E;  2HCA A;  1JNF A;  2ZXT A;  4PQJ A;  2DYX A;  3W9V A;  5DYH A;  3PD9 A;  3DRJ A;  3OXN A;  3FVK A;  4LZ7 A;  3C36 A;  3PU5 A;  3B6W A;  2O7U A;  4XXU A;  1B7U A;  2I58 A;  4JBZ A;  1XT8 A;  3KBR A;  3KOT A;  2H4I A;  3C35 A;  1IME A;  3A3C A;  1QUK A;  2VP1 A;  1FTM A;  3LBS A;  2F5X A;  2HZK A;  4GBW A;  2O84 X;  1MQD A;  3PMW A;  3MZ1 A;  2XXK A;  3IOU A;  3TQW A;  4H45 A;  2HZL A;  1FJ6 A;  4KR5 A;  4OHN A;  1XHY A;  3VVD A;  1TWY A;  4KYE A;  5I57 A;  3CVG A;  2PT1 A;  1YAE A;  5FHO A;  4R2F A;  3V5A A;  2V25 A;  1NNT A;  5F7V A;  1N7W A;  1N3X A;  4IO7 A;  5H8S A;  1B52 A;  1IMF A;  5EYG A;  1VSO A;  2ALU A;  1SDX A;  4FIM A;  2UXA A;  2GFE A;  2I4C A;  4IO5 A;  1B05 A;  4IO4 A;  5IAI A;  1ZLQ A;  3K6V A;  3SDF A;  2O1M A;  2UVH A;  4GRK A;  3TTL A;  3T93 B;  2F3B A;  1BTJ A;  3BIG A;  4RPO A;  5A5X B;  1IIT A;  5J1D A;  4R72 A;  3Q29 A;  3IB1 A;  1D3K A;  1FQF A;  2RKM A;  4OVP A;  3QMF A;  1IXI A;  4ZDM A;  4LUB A;  2F34 A;  2F3D A;  4GLI A;  2XXW A;  3D1R A;  1IUD A;  3W9W A;  5I56 B;  2RC8 A;  4P3L A;  5AA2 B;  2H9B A;  4U4S A;  3H06 B;  1JEV A;  1MH3 A;  3PUX E;  4GX4 A;  3RPL A;  1HSJ A;  1MM6 A;  1B1X A;  5EHM A;  1FQE A;  4GWU A;  3MP1 A;  3QAX A;  2A5T A;  3UP9 A;  2XWI A;  4XIG Q;  4F1U A;  4QXD A;  4GWZ A;  1UTH B;  3FXR A;  5FHM A;  4P0G A;  1FPD A;  5DW8 A;  2JJK A;  4OAN A;  3SZP A;  4MAG A;  5IZ3 A;  4KFQ A;  1FPB A;  3RLF E;  4P8B A;  3VLU A;  2R9J A;  1P99 A;  4EDP A;  3IJO B;  2ZZV A;  4POW A;  2XD2 A;  2HPG A;  3TEL A;  3UN6 A;  3RT6 B;  3R7X A;  4Q8R A;  1MY1 A;  4OWD A;  1K9Y A;  4RPN A;  1ZJL A;  4G61 A;  3TOD A;  2H99 A;  2QVU A;  4PE3 A;  3ISP A;  3HHG A;  3B7D A;  4M1V A;  3D4G A;  4PAF A;  3FGS A;  2NOO A;  1CB6 A;  4GWO A;  1OIB A;  1Y1M A;  3SES A;  4JWX A;  3F11 A;  3PGF A;  5FBP A;  1D4N A;  4GWX A;  1D9Q A;  1NH7 A;  2A5S A;  3BFU A;  1SD3 A;  3OO7 A;  3K0V A;  5TPA A;  4PF8 A;  3EQ1 A;  4XKR A;  2I3V A;  3S2V A;  3MPL A;  2G29 A;  1US4 A;  3LSF B;  4O8M A;  5CMK A;  2DWA A;  3JZJ A;  3IX1 A;  3TCG A;  3P7I A;  1JVY A;  2DS9 A;  3FVO A;  1UQW A;  4NE4 A;  4XKN A;  1MQH A;  4PFU A;  3VVE A;  2B3B A;  3SEY A;  1M5B A;  1GGG A;  5H8Q B;  3O9P A;  4GVO A;  4X1D A;  1M5C A;  3MWB A;  4LAT A;  1HSE A;  5AA4 A;  2OZZ A;  4NF8 B;  2Y7R A;  4YIC A;  4LN5 A;  4QSD A;  1FPF A;  4H0W A;  3MP6 A;  3B8B A;  4U4X A;  3HHF A;  2FYI A;  4QFO A;  3FXB A;  1LCF A;  3K2D A;  4GL8 A;  1YZ0 A;  2LAO A;  4YB6 A;  2DOJ A;  3CG3 A;  4E0X A;  4NTL A;  1EZO A;  5KZT A;  1I6Q A;  1LBZ A;  3MW0 A;  4R9F A;  4F2Q A;  4GX6 A;  1LGB C;  4Z7E A;  3LUY A;  3Q28 A;  1ATG A;  3Q27 A;  5F24 A;  4YB5 A;  4BDN A;  4MCO A;  1LLS A;  3O97 A;  5ICQ A;  3ECR A;  5IGA A;  1LFH A;  4N91 A;  1SW4 A;  4ECF A;  4GF8 A;  1DK4 A;  3FUZ A;  4PE5 B;  5BUU A;  2L5V A;  2UVJ A;  2E1S A;  2F6P A;  3C9H A;  2ZMB A;  5ITP A;  2XXQ A;  3LC8 A;  1Z7M E;  2FIX A;  3IAZ A;  3H03 A;  5LTC A;  4Q30 B;  4DCY A;  1Y3P A;  1PB9 A;  2O7I A;  3M8U A;  3VLW A;  2XXU A;  3CIJ A;  1TT1 A;  3K6U A;  4QBA A;  4GFR A;  3OEK A;  3T9H B;  4FAJ A;  4YB7 A;  3QSL A;  1YCJ A;  2DVC A;  2VPN A;  1I69 A;  1QKA A;  3WAE A;  3R26 A;  2ABH A;  4ZEC A;  1CNQ A;  3NOH A;  1YXI A;  3GLB A;  4NF4 A;  4NF0 A;  3RTW B;  5H8N B;  3RYA A;  4BDQ A;  3OO8 A;  3UA8 A;  3K02 A;  2CMO A;  4H6D A;  3K6X A;  4L17 A;  3E3K A;  2XXH A;  1QW0 A;  1N0T A;  5L9M A;  1B40 A;  1LB9 A;  4DXU A;  5IM2 A;  1JP4 A;  3BFT A;  3GYY A;  4ELP A;  2Z8F A;  1GV8 A;  2P3N A;  4N15 A;  3VXB A;  1ZBM A;  4LVQ A;  2XX9 A;  3OSQ A;  3GXA A;  5I2K A;  5BWJ A;  4XFE A;  2AL4 A;  3G3H A;  1Q1K A;  3EHS A;  4OFO A;  2AL5 A;  3OOA A;  3FAT A;  4R6H A;  4BDL A;  3G3K A;  3IOT A;  2FA7 A;  1ZIU A;  1EYK A;  4NF6 A;  4OZ9 A;  4QFP A;  1B3G A;  1LAG E;  2XHD A;  1USY H;  4HW8 A;  4QHQ A;  4JSD A;  1FSA A;  3KJT A;  4P11 A;  1QVS A;  3C4M A;  3DRG A;  4PGN A;  2I0B A;  5I58 B;  2ZZW A;  1MQI A;  2F7A A;  3N6T A;  5TU0 A;  4ZEK A;  1QKB A;  2CZK A;  4N6P A;  3TQL A;  5TP9 B;  3RT8 A;  1N3W A;  1J1N A;  3C31 A;  5B70 A;  2CEX A;  2D21 A;  1FPE A;  4U21 A;  4OEN A;  1DCU A;  2V3T A;  2GH9 A;  1MXY A;  3GBA A;  2DWI A;  3OD7 A;  3U92 A;  4PAI A;  2XXI A;  1D9V A;  2Z8D A;  2VD2 A;  2OK2 A;  4BLA A;  2KLF A;  4YZZ A;  1IMA A;  2BJJ X;  3PPP A;  2G93 A;  4BDM A;  1M5E A;  1RYO A;  4F3S A;  4LON B;  3PUV E;  2H98 A;  3KOS A;  1IQ7 A;  1R9Q A;  4RNS A;  3IFC A;  3KFM A;  2UVI A;  5H8H A;  4EXK A;  1B9J A;  2QL3 A;  5LOM A;  1AWB A;  1ZU0 A;  4KI0 E;  3O6I A;  1NI9 A;  3PPN A;  5EYF A;  1PEB A;  1N7X A;  1A7L A;  5AA3 A;  1UTB A;  2GRV A;  3MZ9 A;  3KN7 A;  2CZI A;  3C32 A;  2F78 A;  1F9B A;  1FQA A;  3TAJ A;  1XC1 A;  1SVX B;  4Q5T A;  1ZKB A;  4NMY A;  4F31 B;  4HTG A;  5EYH A;  1NUX A;  1DSN A;  3IR1 A;  1JW5 A;  4G2Z A;  2HHM A;  2QS2 A;  1NL5 A;  1B3E A;  5CBR A;  4U1Z A;  2F7C A;  2H5Y A;  2Q88 A;  2B4M A;  3PUY E;  2QPQ A;  4OVS A;  2OWZ A;  1B3L A;  3ZKL A;  5ESY A;  1WOD A;  2O69 A;  4EQB A;  4LP2 B;  3S9M C;  4YKP A;  4IB2 A;  4F22 A;  5KCJ B;  4ZE8 A;  2Z23 A;  5DVF A;  2THI A;  3K1M A;  3A3U A;  1MY0 A;  1URS A;  3FXU A;  5DTB A;  2PFY A;  3FTO A;  4N4U A;  3IOR A;  2F35 A;  3SEW A;  1BKA A;  4H5G A;  3MVY A;  1MY2 A;  3OO6 A;  3B6T A;  4PBQ A;  1B5I A;  4N8G A;  1EU8 A;  3MVW A;  3TKD A;  1YYZ A;  1FRP A;  5I2N A;  4MBP A;  2P0S A;  1NKX A;  3RPL B;  3JV9 A;  4G8H A;  4YMB A;  2QRY A;  4Q0C A;  3PMX A;  4R6Y A;  2ZYN A;  4QF9 A;  4OTE A;  3U8Q A;  2X7Q A;  4GL0 A;  4OA4 A;  4RXL A;  3EHT A;  3QUJ A;  3D4C A;  3L6G A;  4WXJ A;  1NV1 A;  2XXP A;  2QJE A;  3IL1 B;  4EF1 A;  1M5F A;  2DXY A;  1FJ9 A;  2O68 A;  5IZ3 B;  4X04 A;  3TYH A;  4DCX A;  2I3W A;  1MDQ A;  4KCC A;  1PBP A;  3MQ9 A;  3SKP A;  3N5L A;  5I3S A;  3KSX A;  1FQD A;  5ET5 A;  4HE1 A;  1URD A;  2CEY A;  1Y4C A;  4PFR A;  1FTL A;  3EKI A;  1I6A A;  3DRK A;  1N04 A;  1B2H A;  2M8C A;  4ZE9 A;  2OCU A;  4DXB A;  1Y20 A;  2IEE A;  3T9V A;  1EYJ A;  4H1X A;  2ONS A;  4MMP A;  4R74 A;  4MLV A;  1LBY A;  4O7M A;  3T0J A;  4GD5 A;  2XD3 A;  4GWS A;  4KYS A;  2O1L A;  3MZB A;  4DE8 A;  2WOP A;  1MG1 A;  1OVB A;  1PC3 A;  5IZZ A;  5J16 A;  2QSX A;  4XKQ A;  2RC9 A;  1Q35 A;  1FQB A;  1A8E A;  2PX1 A;  3E4R A;  1FBP A;  4UAC A;  5TPA B;  1KA1 A;  2REJ A;  1VDW A;  5EQ8 A;  1FBF A;  1HSL A;  4LQ2 A;  4OQO A;  1ANF A;  4POX A;  3O6H A;  4JDF A;  4LQ5 A;  3SEV A;  3B6Q A;  4KCD A;  3H6W A;  1O64 A;  4OER A;  4H67 A;  2VGQ A;  2PBW A;  2H25 A;  1MPD A;  3O66 A;  1B7Z A;  1SYI A;  3HCQ A;  1SW2 A;  3UOR A;  4R9G A;  4FEC A;  4G4P A;  4R73 A;  4HCW A;  5ET8 A;  4NN3 A;  2P3V A;  4PFW A;  1N84 A;  1B46 A;  2VPO A;  4O3C A;  4PDH A;  2DXR A;  1NV3 A;  3FV1 A;  5AA4 B;  5A5X A;  1DPE A;  5A5L A;  4MNP A;  2QS4 A;  2ZNT A;  3RYD A;  1ZTY A;  2YLN A;  3ILU B;  3E78 A;  5L9S A;  4TLM B;  4JWY A;  1VFE A;  3K4U A;  4RK2 A;  4OFJ A;  2DE2 A;  5EHS A;  2DP8 A;  3O29 A;  1RKM A;  2ZNS A;  1NNP A;  4FAT A;  1NUY A;  4P47 A;  4U22 A;  1B32 A;  4IGR A;  3IK6 B;  3RNN A;  4GOT A;  1D9Y A;  2WBD A;  2FVZ A;  3CFX A;  1JW1 A;  4I8C A;  4Z0I A;  4P56 A;  3HO7 A;  2MKZ A;  1NV2 A;  2HFB A;  2WYK A;  3N6U A;  4NF5 A;  2X7P A;  1TXF A;  2B3F A;  2Q8J A;  1B5J A;  3PTY A;  4OVR A;  3CI8 A;  3KN3 A;  3KG2 A;  1IEJ A;  4H65 A;  1MXX A;  2HXW A;  3T1B A;  3E79 A;  3HV1 A;  3IB0 A;  3S4U A;  5EQA A;  4IGT A;  3EF7 A;  5IZ1 A;  4MX6 A;  4H5F A;  4FED A;  1XOC A;  4ELQ A;  4NQ8 A;  2Y7I A;  3CSB A;  4FEB A;  4GQO A;  4U23 A;  4MJO A;  1BIY A;  4KHZ E;  5CMM A;  3CRB A;  5FTH A;  3MJN A;  1EZP A;  3OSR A;  5ET6 A;  3VFJ A;  1IMB A;  2F7B A;  3PUW E;  2DWJ A;  1B6H A;  3KZG A;  4AB6 A;  2R6G E;  5H8F A;  3M3F A;  2UVG A;  4JVD A;  1LST A;  4UA8 A;  2Q2C A;  2Q9T A;  4F18 A;  1NH8 A;  4OVJ A;  3O6G A;  1SBP A;  3U93 A;  3DRI A;  3KC0 A;  4P0I A;  4JSO A;  4TQU Q;  3MP8 A;  1PB7 A;  4N8Y A;  3KN8 A;  4G8N A;  2PFZ A;  3H6T A;  5I59 A;  4O7I A;  2Q2A A;  2V93 A;  3RY3 A;  4H8J A;  4PDD A;  4MFI A;  2ONK E;  5I2K B;  2QMX A;  1FTK A;  1S50 A;  1B3H A;  4GBV A;  3FVN A;  4F39 A;  1AL3 A;  2I49 A;  1FTA A;  1T0K A;  4NF8 A;  3DRH A;  4G68 B;  1GVC A;  3GZG A;  4NF6 B;  2PCR A;  3BBR A;  4QFK A;  3R6U A;  2RIN A;  4ZS9 A;  2DQV A;  1QUI A;  4C1T A;  4C1U A;  3GBB A;  4HS7 A;  1MM7 A;  1IXH A;  3S9L C;  1R9L A;  2WOK A;  1H44 A;  2YPN A;  1DMB A;  4I62 A;  1MH4 A;  2RCB A;  1G0H A;  2XWV A;  3TUS A;  4IO6 A;  3VV5 A;  1FPG A;  4IO2 A;  4N6D A;  2V4C A;  3IO6 A;  4M4G A;  2KR0 A;  4DI4 B;  4QRZ A;  1SI0 A;  1MXV A;  1FPK A;  3QK6 A;  4X8R A;  2I48 A;  3I3V A;  2F97 A;  3MPK A;  2IA4 A;  3LSW A;  4TOZ A;  1FCK A;  3USD A;  2VHA A;  3ZS6 A;  4ONY A;  5H8H B;  2F8D A;  1BP5 A;  1NUZ A;  2Q89 A;  4N81 A;  4PF6 A;  2XXT A;  1IIW A;  3FD3 A;  1EZ9 A;  3G3G A;  3TTR A;  2VOZ A;  1Y9U A;  1LFG A;  1RDY A;  1VR5 A;  5DVJ A;  3DRF A;  4X9T A;  3RPW A;  3FBP A;  4NGU A;  3A29 A;  1A40 A;  3DM0 A;  2AIX A;  2NWJ A;  3MST A;  2XX7 A;  4I3Y A;  4PET A;  2PYY A;  5CC2 A;  3LVU A;  3W15 C;  4O3A A;  4C0R A;  5KDT A;  5ITO A;  3FVG A;  4O3B A;  5DEX A;  3KGC A;  4PFY A;  4DIG A;  2O51 A;  3K6W A;  3OEN A;  1SYH A;  3ILT B;  1B58 A;  1DBZ A;  2ZNU A;  4PC9 A;  4YU0 A;  2DE4 A;  1P1O A;  1R6Z A;  4ZEB A;  2OX3 A;  4AQ4 A;  4HE0 A;  1I6B A;  2WYP A;  3VE1 B;  3TEP A;  3HFU A;  4DXC A;  1DTZ A;  1B4H A;  1FBD A;  3SER A;  3MYU A;  1MXU A;  4OET A;  4GIZ A;  2VT5 A;  2PVU A;  1MQJ A;  2XXR A;  4EXL A;  2GQ1 A;  2E0S A;  1GR2 A;  4LA9 A;  4XEQ A;  1A55 A;  4N17 A;  2PMS A;  3H3G A;  5EQ7 A;  3T96 B;  1B3F A;  3G3J A;  1FPL A;  3OEM A;  4FE8 A;  3M3L A;  5I58 A;  5I57 B;  4MF3 A;  4PFT A;  1NV7 A;  3K1N A;  4FOR A;  1KA0 A;  2V3Q A;  3FJG A;  4RY1 A;  1JVX A;  5ELV A;  1LB8 A;  4WEP A;  4EF2 A;  4YMA A;  1IXG A;  3N94 A;  5CMC A;  4ZZA A;  3DEL B;  3VDF A;  3TCF A;  5CRY A;  1A8F A;  3B50 A;  3UIF A;  1P1W A;  5T3J A;  1MY4 A;  1CE2 A;  3ONM A;  1B1H A;  1AOV A;  2XX8 A;  4RYA A;  4TLL B;  5AA2 D;  1H43 A;  4DLD A;  1MS7 A;  2DE3 A;  4KPT A;  3IOW A;  1AMF A;  4H46 A;  3SET A;  1NUW A;  4YKJ A;  2QMW A;  1S7Y A;  1ELJ A;  3H7M A;  4PBH A;  1IXC A;  2ZYM A;  4NED A;  3RYB A;  3KSJ A;  2FHY A;  1R1N A;  3I5O A;  3HST A;  3QUF A;  1LAF E;  2V3U A;  1AIV A; 
#chains in the Genus database with same CATH homology
 1Y4T A;  3OMB A;  4G8M A;  4I1D A;  4BDO A;  3MUQ A;  1SW1 A;  3FJ7 A;  2ZYK A;  1P1Q A;  2A5T B;  4ZED A;  1A99 A;  3UGW A;  4GXS B;  3MBP A;  1RYX A;  3SEU A;  4F29 A;  1Y3N A;  3TFL A;  4ZEF A;  1A54 A;  3ZSF A;  4BDR A;  5KCJ A;  4KYD A;  1QUJ A;  4IY6 A;  3TDJ A;  4I9D A;  2Y84 A;  5JTY A;  3CHG A;  3JYR A;  4G77 A;  1MXZ A;  3BKI B;  3I6V A;  4OFL A;  1PDA A;  2HAU A;  2HQ0 A;  3LSX A;  2RF1 A;  1S9T A;  4FJP A;  3V83 A;  5HBC A;  3MC2 A;  1B5H A;  3LSL A;  4QSE A;  3PD8 A;  3AXF A;  2DVZ A;  3KJ7 A;  3O6P A;  5FTI A;  2QS3 A;  3U72 A;  1MPC A;  3UK4 A;  1MXW A;  3VXC A;  3CFL A;  1PBQ A;  1P1U A;  3PPQ A;  1L5T A;  5K2Y A;  3ODB A;  1LFI A;  1Y1Z A;  3A09 A;  4ND9 A;  4OXV A;  4EUO A;  4QSC A;  4YAH X;  2O6A A;  3Q25 A;  5DT6 A;  3G3F A;  2AYS A;  5CM6 A;  4JXI A;  3C33 A;  1JQF A;  4IO3 A;  5B7D A;  4NF5 B;  4ISU A;  1YPN A;  2D3I A;  2DWH A;  3PMV A;  4RJZ A;  3EN3 A;  3T9U A;  2Z8E A;  3IOV A;  2Y7W A;  4QFL A;  4F3P A;  1URG A;  3QXM A;  3G3I A;  3RN8 A;  4F3B A;  1XVX A;  4R75 A;  5L8D A;  5DVI A;  5I56 A;  3CSG A;  3EHU A;  1II5 A;  5AA2 A;  4R2B A;  3RUM A;  1KWH A;  1B7H A;  4EQ7 A;  4ELR A;  1XVY A;  2CZL A;  5H8F B;  3RTF B;  3E13 X;  3PUZ E;  1DOT A;  2F36 A;  1UTH A;  4H8I A;  5ICT A;  2UYF A;  4JB7 A;  2I6E A;  4KQP A;  3TTK A;  4R6K A;  3T22 A;  1VE4 A;  5JK4 A;  4PP0 A;  1BLF A;  2QS1 A;  3K1P A;  1MPB A;  3DP8 A;  4F1V A;  4OYV A;  5I59 B;  2OJT A;  2X26 A;  3TPA A;  1NFT A;  3HN0 A;  2ESN A;  4HCY A;  3IB2 A;  4DDD A;  1DTG A;  2RC7 A;  2NXO A;  1NNF A;  3RGY A;  4F19 A;  3MVZ A;  4LZ8 A;  1FTO A;  3O28 A;  5HM4 B;  3U94 A;  1OVT A;  1H3D A;  2XXV A;  3FAS A;  4LZ5 A;  4AB5 A;  2F6G A;  3H4Z A;  2REG A;  4WKM A;  4F2O A;  4NF4 B;  4ESW A;  5CBS A;  4MLQ A;  2XXY A;  3IO4 A;  1Z7N E;  3H6V A;  3WAF A;  2YJP A;  5F1Q A;  4NWC A;  1SQY A;  1OMP A;  1OLA A;  1GTK A;  2WOL A;  1PB8 A;  1EH3 A;  5ISU A;  3O2A A;  1US5 A;  5CMB A;  3V89 B;  4G68 C;  3PPR A;  4E0W A;  1B4Z A;  3CG1 A;  3MAM A;  2RCA A;  3FIR A;  3ZKK A;  1B51 A;  1JEU A;  1LBB A;  5AA1 A;  1LAH E;  1QUL A;  5H8Q A;  2FNC A;  2WKY A;  2DSF A;  1DPP A;  2B4L A;  2W7Y A;  3FV2 A;  4X1B A;  1MY3 A;  2I0C A;  3TTM A;  4N07 A;  1FW0 A;  3PPO A;  4YKI A;  3PV0 E;  5K2X A;  1POY 1;  1LBC A;  2Z22 A;  4N13 A;  1B0L A;  3Q26 A;  3VLV A;  4F1Y A;  3K01 A;  1NNK A;  3DLN A;  4IY5 A;  3LR1 A;  5AE4 A;  3TCH A;  3QIM A;  1MDP 1;  4ZEI A;  1FTJ A;  1M5D A;  2PT2 A;  1JW4 A;  3T66 A;  1NMU A;  4ZZE A;  1LCT A;  5KDT B;  4F3G A;  3HPI A;  1ZMG A;  3DP4 A;  5DEX B;  2OWT A;  1OLC A;  4U2R A;  3FZV A;  4NWD A;  5JEI A;  3H6U A;  1B0H A;  5FHN A;  1XS5 A;  4GXA A;  3VVF A;  3DP6 A;  4THI A;  2HAV A;  4WED A;  3RQT A;  2Y7K A;  2P2A A;  3S9E A;  1H45 A;  3FJM A;  1P1N A;  3OO9 A;  2OLB A;  2V84 A;  1OQG A;  4OMB A;  1UTB B;  3IJX B;  3K00 A;  1JET A;  3CFZ A;  2GHA A;  5M2V A;  4MH5 A;  2VD3 A;  4G68 A;  2NVU B;  3V8X B;  1O63 A;  2OBG A;  1Y3Q A;  2HEU A;  1POT A;  3MVX A;  4EQ9 A;  5H8N A;  1TFA A;  4U1O A;  3EPE A;  3T9X B;  1N76 A;  3C34 A;  3THI A;  1VFD A;  2ONR A;  4XTC Q;  3OEL A;  4DZ1 A;  1MQG A;  2XXX A;  4KD5 A;  3M3K A;  4RK9 A;  3E9X A;  3FXQ A;  4X48 A;  3KEI A;  5L9O A;  3PAM A;  2OWS A;  3L6H A;  4OEU A;  5I84 A;  1FQC A;  5HPQ A;  5IKB A;  4RA1 A;  3SEX A;  3U1O A;  2ZYO A;  3CR9 A;  2P1S A;  1OQH A;  2Y7P A;  4OEV A;  4YKK A;  3N26 A;  1H76 A;  2R71 A;  1IZ1 A;  1UIU A;  1WVJ A;  1AH5 A;  4XKP A;  2D5W A;  2UYE A;  3G7W A;  3QYT A;  1YTV A;  2I4B A;  5I2N B;  5TP9 A;  1UIV A;  4QFN A;  5CI5 A;  4K3F A;  2GHB A;  1WDN A;  1MRP A;  4ELO A;  3TMG A;  2NUV A;  3S9N C;  4JWO A;  1SI1 A;  2ANJ A;  1SW5 A;  2B65 A;  1TFD A;  1O7T A;  1LAX A;  3TZA A;  5JTY B;  1QJM A;  4OES A;  4ESX A;  3TTN A;  1USY E;  2HCA A;  1JNF A;  2ZXT A;  4PQJ A;  2DYX A;  3W9V A;  5DYH A;  3PD9 A;  3DRJ A;  3OXN A;  3FVK A;  4LZ7 A;  3C36 A;  3PU5 A;  3B6W A;  2O7U A;  4XXU A;  1B7U A;  2I58 A;  4JBZ A;  1XT8 A;  3KBR A;  3KOT A;  2H4I A;  3C35 A;  3A3C A;  1QUK A;  2VP1 A;  1FTM A;  3LBS A;  2F5X A;  2HZK A;  2O84 X;  1MQD A;  3PMW A;  3MZ1 A;  3IOU A;  3TQW A;  2HZL A;  4KR5 A;  4OHN A;  1XHY A;  3VVD A;  1TWY A;  4KYE A;  5I57 A;  3CVG A;  2PT1 A;  1YAE A;  5FHO A;  4R2F A;  3V5A A;  2V25 A;  1NNT A;  5F7V A;  1N7W A;  1N3X A;  4IO7 A;  5H8S A;  1B52 A;  1VSO A;  2ALU A;  1SDX A;  4FIM A;  2UXA A;  2GFE A;  2I4C A;  4IO5 A;  1B05 A;  4IO4 A;  5IAI A;  1ZLQ A;  3K6V A;  3SDF A;  2O1M A;  2UVH A;  4GRK A;  3TTL A;  3T93 B;  1BTJ A;  4RPO A;  5A5X B;  1IIT A;  5J1D A;  4R72 A;  3Q29 A;  3IB1 A;  1D3K A;  1FQF A;  2RKM A;  1IXI A;  4ZDM A;  4LUB A;  2F34 A;  4GLI A;  2XXW A;  1IUD A;  3W9W A;  5I56 B;  2RC8 A;  5AA2 B;  2H9B A;  4U4S A;  3H06 B;  1JEV A;  1MH3 A;  3PUX E;  1HSJ A;  1MM6 A;  1B1X A;  5EHM A;  1FQE A;  3MP1 A;  3QAX A;  2A5T A;  3UP9 A;  4XIG Q;  4F1U A;  1UTH B;  3FXR A;  5FHM A;  4P0G A;  4KFQ A;  3RLF E;  3VLU A;  2R9J A;  1P99 A;  4EDP A;  3IJO B;  4POW A;  2XD2 A;  3TEL A;  3UN6 A;  3RT6 B;  3R7X A;  4Q8R A;  1MY1 A;  4OWD A;  4RPN A;  1ZJL A;  3TOD A;  2H99 A;  3HHG A;  3B7D A;  4M1V A;  3D4G A;  3FGS A;  2NOO A;  1CB6 A;  4GWO A;  1OIB A;  1Y1M A;  3SES A;  4JWX A;  3F11 A;  3PGF A;  1D4N A;  1NH7 A;  2A5S A;  3BFU A;  1SD3 A;  3OO7 A;  3K0V A;  5TPA A;  3EQ1 A;  4XKR A;  2I3V A;  3S2V A;  3MPL A;  2G29 A;  1US4 A;  3LSF B;  5CMK A;  2DWA A;  3JZJ A;  3IX1 A;  3TCG A;  3P7I A;  1JVY A;  2DS9 A;  3FVO A;  1UQW A;  4NE4 A;  4XKN A;  1MQH A;  4PFU A;  3VVE A;  2B3B A;  3SEY A;  1M5B A;  1GGG A;  5H8Q B;  3O9P A;  4GVO A;  4X1D A;  1M5C A;  3MWB A;  4LAT A;  1HSE A;  5AA4 A;  2OZZ A;  4NF8 B;  2Y7R A;  4YIC A;  4QSD A;  4H0W A;  3MP6 A;  4U4X A;  3HHF A;  2FYI A;  4QFO A;  1LCF A;  3K2D A;  4GL8 A;  2LAO A;  4YB6 A;  2DOJ A;  3CG3 A;  4E0X A;  4NTL A;  1EZO A;  5KZT A;  1I6Q A;  3MW0 A;  4R9F A;  4F2Q A;  1LGB C;  4Z7E A;  3LUY A;  3Q28 A;  1ATG A;  3Q27 A;  4YB5 A;  4BDN A;  1LLS A;  3O97 A;  5ICQ A;  3ECR A;  1LFH A;  1SW4 A;  4ECF A;  4GF8 A;  3FUZ A;  4PE5 B;  5BUU A;  2UVJ A;  2E1S A;  2F6P A;  3C9H A;  2ZMB A;  5ITP A;  2XXQ A;  3LC8 A;  1Z7M E;  3IAZ A;  3H03 A;  4Q30 B;  4DCY A;  1Y3P A;  1PB9 A;  2O7I A;  3M8U A;  3VLW A;  2XXU A;  3CIJ A;  1TT1 A;  3K6U A;  4GFR A;  3OEK A;  3T9H B;  4FAJ A;  4YB7 A;  3QSL A;  1YCJ A;  2DVC A;  1I69 A;  1QKA A;  3WAE A;  3R26 A;  2ABH A;  4ZEC A;  3GLB A;  4NF4 A;  3RTW B;  5H8N B;  3RYA A;  4BDQ A;  3OO8 A;  3UA8 A;  3K02 A;  2CMO A;  4H6D A;  3K6X A;  4L17 A;  3E3K A;  2XXH A;  1QW0 A;  1N0T A;  5L9M A;  1B40 A;  1LB9 A;  4DXU A;  3BFT A;  4ELP A;  2Z8F A;  1GV8 A;  3VXB A;  1ZBM A;  4LVQ A;  2XX9 A;  3OSQ A;  3GXA A;  5I2K A;  5BWJ A;  2AL4 A;  3G3H A;  1Q1K A;  3EHS A;  4OFO A;  2AL5 A;  3OOA A;  3FAT A;  4R6H A;  4BDL A;  3G3K A;  3IOT A;  2FA7 A;  1ZIU A;  4OZ9 A;  4NF6 A;  4QFP A;  1B3G A;  1LAG E;  2XHD A;  1USY H;  4HW8 A;  4QHQ A;  4JSD A;  3KJT A;  4P11 A;  1QVS A;  3C4M A;  3DRG A;  2I0B A;  5I58 B;  1MQI A;  2F7A A;  3N6T A;  5TU0 A;  4ZEK A;  1QKB A;  4N6P A;  3TQL A;  5TP9 B;  3RT8 A;  1N3W A;  1J1N A;  3C31 A;  5B70 A;  2D21 A;  4U21 A;  4OEN A;  2V3T A;  2GH9 A;  1MXY A;  3GBA A;  2DWI A;  3OD7 A;  3U92 A;  2XXI A;  1D9V A;  2Z8D A;  2VD2 A;  2OK2 A;  4BLA A;  2KLF A;  4YZZ A;  2BJJ X;  3PPP A;  2G93 A;  4BDM A;  1M5E A;  1RYO A;  4F3S A;  4LON B;  3PUV E;  2H98 A;  3KOS A;  1IQ7 A;  1R9Q A;  4RNS A;  3KFM A;  2UVI A;  5H8H A;  4EXK A;  1B9J A;  2QL3 A;  5LOM A;  4KI0 E;  1ZU0 A;  3O6I A;  3PPN A;  5EYF A;  1PEB A;  1N7X A;  1A7L A;  5AA3 A;  1UTB A;  2GRV A;  3MZ9 A;  3KN7 A;  3C32 A;  2F78 A;  1F9B A;  1FQA A;  3TAJ A;  1XC1 A;  1SVX B;  4Q5T A;  1ZKB A;  4NMY A;  4F31 B;  4HTG A;  1DSN A;  3IR1 A;  1JW5 A;  4G2Z A;  2QS2 A;  1NL5 A;  1B3E A;  5CBR A;  4U1Z A;  2F7C A;  2H5Y A;  2Q88 A;  2B4M A;  3PUY E;  2QPQ A;  1B3L A;  3ZKL A;  1WOD A;  2O69 A;  4EQB A;  4LP2 B;  3S9M C;  4YKP A;  4IB2 A;  4F22 A;  5KCJ B;  4ZE8 A;  2Z23 A;  5DVF A;  2THI A;  3K1M A;  3A3U A;  1MY0 A;  1URS A;  3FXU A;  5DTB A;  3FTO A;  3IOR A;  2F35 A;  3SEW A;  1BKA A;  4H5G A;  3MVY A;  1MY2 A;  3OO6 A;  3B6T A;  1B5I A;  1EU8 A;  3MVW A;  3TKD A;  5I2N A;  4MBP A;  2P0S A;  1NKX A;  3JV9 A;  4G8H A;  4YMB A;  2QRY A;  4Q0C A;  3PMX A;  4R6Y A;  2ZYN A;  4QF9 A;  4OTE A;  3U8Q A;  2X7Q A;  4GL0 A;  4RXL A;  3EHT A;  3QUJ A;  3D4C A;  3L6G A;  4WXJ A;  2XXP A;  2QJE A;  3IL1 B;  4EF1 A;  1M5F A;  2DXY A;  2O68 A;  3TYH A;  4DCX A;  2I3W A;  1MDQ A;  4KCC A;  1PBP A;  3MQ9 A;  3SKP A;  3N5L A;  3KSX A;  1FQD A;  1URD A;  1Y4C A;  1FTL A;  1I6A A;  3DRK A;  1N04 A;  1B2H A;  2M8C A;  4ZE9 A;  2OCU A;  4DXB A;  1Y20 A;  2IEE A;  3T9V A;  4H1X A;  2ONS A;  4R74 A;  4MLV A;  4GD5 A;  2XD3 A;  4KYS A;  2O1L A;  3MZB A;  4DE8 A;  2WOP A;  1MG1 A;  1OVB A;  1PC3 A;  2QSX A;  4XKQ A;  2RC9 A;  1Q35 A;  1FQB A;  1A8E A;  2PX1 A;  3E4R A;  4UAC A;  5TPA B;  2REJ A;  1HSL A;  4LQ2 A;  4OQO A;  1ANF A;  4POX A;  3O6H A;  4JDF A;  4LQ5 A;  3SEV A;  3B6Q A;  4KCD A;  3H6W A;  1O64 A;  4OER A;  4H67 A;  2VGQ A;  2PBW A;  2H25 A;  1MPD A;  3O66 A;  1B7Z A;  1SYI A;  3HCQ A;  1SW2 A;  3UOR A;  4R9G A;  4FEC A;  4G4P A;  4R73 A;  4HCW A;  4PFW A;  1N84 A;  1B46 A;  4O3C A;  2DXR A;  3FV1 A;  5AA4 B;  5A5X A;  1DPE A;  2QS4 A;  2ZNT A;  1ZTY A;  2YLN A;  3ILU B;  5L9S A;  4TLM B;  4JWY A;  1VFE A;  3K4U A;  4RK2 A;  4OFJ A;  2DE2 A;  5EHS A;  2DP8 A;  3O29 A;  1RKM A;  2ZNS A;  1NNP A;  4FAT A;  4U22 A;  1B32 A;  4IGR A;  3IK6 B;  3RNN A;  4GOT A;  1D9Y A;  3CFX A;  1JW1 A;  4I8C A;  4Z0I A;  3HO7 A;  2HFB A;  3N6U A;  4NF5 A;  2X7P A;  1TXF A;  2B3F A;  2Q8J A;  1B5J A;  3CI8 A;  3KN3 A;  3KG2 A;  1IEJ A;  4H65 A;  1MXX A;  2HXW A;  3HV1 A;  3IB0 A;  3S4U A;  4IGT A;  3EF7 A;  4H5F A;  4FED A;  1XOC A;  4ELQ A;  2Y7I A;  3CSB A;  4FEB A;  4GQO A;  4U23 A;  1BIY A;  4KHZ E;  5CMM A;  3CRB A;  5FTH A;  3MJN A;  1EZP A;  3OSR A;  3VFJ A;  2F7B A;  3PUW E;  2DWJ A;  1B6H A;  3KZG A;  4AB6 A;  2R6G E;  5H8F A;  3M3F A;  2UVG A;  1LST A;  4UA8 A;  2Q2C A;  2Q9T A;  4F18 A;  1NH8 A;  4OVJ A;  3O6G A;  1SBP A;  3U93 A;  3DRI A;  4P0I A;  4JSO A;  4TQU Q;  3MP8 A;  1PB7 A;  3KN8 A;  4G8N A;  3H6T A;  5I59 A;  2Q2A A;  2V93 A;  3RY3 A;  4H8J A;  4MFI A;  2ONK E;  5I2K B;  2QMX A;  1FTK A;  1S50 A;  1B3H A;  3FVN A;  4F39 A;  1AL3 A;  2I49 A;  1T0K A;  4NF8 A;  3DRH A;  4G68 B;  1GVC A;  3GZG A;  4NF6 B;  3BBR A;  4QFK A;  3R6U A;  2RIN A;  4ZS9 A;  2DQV A;  1QUI A;  4C1T A;  4C1U A;  3GBB A;  4HS7 A;  1MM7 A;  1IXH A;  3S9L C;  1R9L A;  2WOK A;  1H44 A;  2YPN A;  1DMB A;  4I62 A;  1MH4 A;  2RCB A;  3TUS A;  4IO6 A;  3VV5 A;  4IO2 A;  3IO6 A;  4M4G A;  4QRZ A;  1SI0 A;  1MXV A;  3QK6 A;  2I48 A;  3I3V A;  2F97 A;  3MPK A;  2IA4 A;  3LSW A;  4TOZ A;  1FCK A;  3USD A;  2VHA A;  3ZS6 A;  4ONY A;  5H8H B;  2F8D A;  1BP5 A;  2Q89 A;  2XXT A;  1IIW A;  3FD3 A;  1EZ9 A;  3G3G A;  3TTR A;  2VOZ A;  1Y9U A;  1LFG A;  1VR5 A;  5DVJ A;  3DRF A;  4X9T A;  3RPW A;  1A40 A;  3DM0 A;  2AIX A;  2NWJ A;  2XX7 A;  4PET A;  2PYY A;  5CC2 A;  3LVU A;  3W15 C;  4O3A A;  4C0R A;  5KDT A;  5ITO A;  3FVG A;  4O3B A;  5DEX A;  3KGC A;  4PFY A;  4DIG A;  2O51 A;  3K6W A;  3OEN A;  1SYH A;  3ILT B;  1B58 A;  2ZNU A;  4YU0 A;  2DE4 A;  1P1O A;  1R6Z A;  4ZEB A;  4AQ4 A;  1I6B A;  3VE1 B;  3TEP A;  4DXC A;  1DTZ A;  1B4H A;  3SER A;  1MXU A;  4OET A;  4GIZ A;  2PVU A;  1MQJ A;  2XXR A;  4EXL A;  2E0S A;  1GR2 A;  4LA9 A;  1A55 A;  2PMS A;  3H3G A;  3T96 B;  1B3F A;  3G3J A;  3OEM A;  4FE8 A;  3M3L A;  5I58 A;  5I57 B;  4PFT A;  4MF3 A;  3K1N A;  4FOR A;  2V3Q A;  3FJG A;  4RY1 A;  1JVX A;  5ELV A;  1LB8 A;  4WEP A;  4EF2 A;  4YMA A;  1IXG A;  3N94 A;  5CMC A;  4ZZA A;  3DEL B;  3VDF A;  3TCF A;  5CRY A;  1A8F A;  3UIF A;  1P1W A;  1MY4 A;  1CE2 A;  3ONM A;  1B1H A;  1AOV A;  2XX8 A;  4RYA A;  4TLL B;  5AA2 D;  1H43 A;  4DLD A;  1MS7 A;  2DE3 A;  4KPT A;  3IOW A;  1AMF A;  3SET A;  4YKJ A;  2QMW A;  1S7Y A;  1ELJ A;  3H7M A;  1IXC A;  2ZYM A;  4NED A;  3RYB A;  3KSJ A;  1R1N A;  3I5O A;  3HST A;  3QUF A;  1LAF E;  2V3U A;  1AIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...