1RKMA

Structure of oppa
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Peptide binding in OppA, the crystal structures of the periplasmic oligopeptide binding protein in the unliganded form and in complex with lysyllysine.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Binding protein
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
total genus 170
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1997-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1rkmA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1rkmA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1rkmA02
4RJZA 4DXCA 3G3GA 3KFMA 4QHQA 2ESNA 2Y7PA 4G68C 2DWAA 2QMWA 3IORA 3LSFB 2ZYMA 2QL3A 1I6AA 4YKPA 3ZKKA 2D3IA 2XX9A 1WVJA 5AA2D 4I62A 3D4CA 2A5SA 1JVXA 3GXAA 2ANJA 1B0HA 3N6UA 5CMCA 5H8QA 3DP8A 4ZE8A 1FTJA 2OWSA 3OXNA 4I1DA 4F2OA 1MXYA 1MDP1 1SW4A 2XXHA 4G2ZA 4QSCA 4F3GA 1M5BA 3TEPA 4HW8A 1LB9A 1BTJA 3IAZA 3CFLA 4OENA 3T66A 2M8CA 5DVJA 1SW2A 1GGGA 3IB0A 5I56A 5L9OA 1IXHA 5B7DA 5K2YA 4AB6A 4ELOA 5I59B 4DCYA 4U4XA 1SYHA 4HCYA 1CE2A 1NH7A 5F7VA 5TP9B 1LBCA 3SEWA 1NNFA 2P2AA 3FATA 3V89B 1QJMA 4OXVA 4X1DA 1OQHA 4PFYA 3H4ZA 3QXMA 2V3QA 2RC7A 4O3CA 4ZZAA 2O68A 4GL8A 5KCJB 4ZE9A 2ZXTA 1DOTA 1PB9A 3DRKA 1F9BA 2I4CA 4NF6A 1VFEA 4R6YA 3ILUB 2D5WA 3PGFA 4JB7A 4ZECA 1B7HA 4RYAA 2ZYKA 1B58A 5KDTA 1P1WA 3PPOA 4GD5A 1MH4A 1RYXA 3Q25A 5IKBA 3RYBA 4M4GA 2V25A 4QSDA 5L9MA 3H6UA 1OLCA 3KN8A 3T9UA 3HHGA 1P1UA 3K1MA 3DRGA 4YU0A 3MUQA 5ELVA 4M1VA 1N84A 4IY6A 1MS7A 2Q89A 1XVXA 3I6VA 1TXFA 4E0XA 1UIVA 4FATA 4YMAA 3SERA 5H8NB 4QFOA 1GTKA 5CM6A 5I58B 3TPAA 3CHGA 1LAFE 1NH8A 4EDPA 2H4IA 2HAVA 3JV9A 4LZ5A 5AA2B 1EZPA 2UVIA 3KOTA 3V83A 4ELRA 4E0WA 3O9PA 4P0GA 4R74A 1TFAA 4RPNA 1D4NA 1NL5A 2CZLA 2Y7KA 3C36A 4POXA 3T9XB 3FVNA 4PFWA 3RYAA 2H5YA 1KWHA 3I3VA 1HSLA 3SEUA 4G8HA 5IAIA 4F3PA 2H9BA 4G68A 3IL1B 5I2NB 3A09A 1PB8A 3O97A 1B51A 1P1NA 2XXUA 5EYFA 1MXWA 5TPAA 5CI5A 3CFZA 3KJ7A 3IOTA 3Q26A 4NF4A 1ZLQA 3VXBA 3ZSFA 4BDOA 4RK9A 2HCAA 3L6GA 4HCWA 4RPOA 1MPDA 1QUJA 1I69A 3FIRA 5L8DA 3FVGA 5H8FB 3PUYE 5AA4B 4ZEBA 2DQVA 2V3TA 2E0SA 5DT6A 3KG2A 2PT2A 3JYRA 3KN3A 1QKAA 1SD3A 2R71A 2CMOA 3PPNA 3U72A 4F3BA 1M5CA 3Q28A 2REGA 2B4MA 4GXAA 3CSBA 4U4SA 4H8IA 2REJA 4TLLB 2F7CA 3KBRA 1URSA 2QPQA 2Q88A 3RTWB 3T9HB 1TWYA 5F1QA 3IB2A 4IGRA 4H8JA 4DXUA 1B4HA 3VE1B 1UQWA 4I8CA 2DSFA 3IX1A 3K6VA 3ODBA 5KZTA 3IJXB 4LQ5A 4XTCQ 3FJMA 3S9EA 1B5JA 3MVYA 4GRKA 4MFIA 2FA7A 2HFBA 3D4GA 2F34A 3FJGA 1D9VA 3MZ9A 4U1OA 2ONKE 3TELA 3U8QA 5FHMA 2GFEA 3UIFA 3KGCA 5ITPA 4I9DA 3VLUA 1J1NA 3M8UA 4H5GA 4QSEA 5B70A 5HM4B 3MPKA 1EU8A 1QVSA 4O3AA 5DEXA 2O69A 1IQ7A 4NTLA 4G8MA 3IJOB 1YTVA 4ESWA 3CFXA 4EXLA 3MPLA 4ZZEA 4XKRA 1B1XA 1MM7A 3H06B 1SW1A 2ONRA 4YB5A 2I0CA 1MY2A 1S9TA 3ILTB 3K2DA 2VD2A 4Z7EA 3E3KA 2UVGA 3OSQA 3MVZA 3R7XA 3TTRA 3TQLA 3IO4A 1MQGA 1A8EA 4N07A 2R9JA 2E1SA 4WKMA 1UTBB 4H6DA 5CMBA 1ZBMA 1Z7ME 2XXXA 4X9TA 3CRBA 5FTIA 1PEBA 1Y4TA 1MQDA 2AIXA 3DELB 3K00A 2HEUA 4Q30B 5EHSA 5H8HB 4F29A 3DM0A 3FXQA 3MVXA 2OWTA 4ELQA 4NF5A 1MG1A 4JSDA 1BP5A 2F35A 4NF5B 5ICQA 4GOTA 1H43A 4F31B 3H6TA 4OQOA 5A5XA 5H8HA 4ZEFA 2PBWA 4EXKA 3OO9A 4TOZA 1RKMA 4GL0A 4RXLA 3TQWA 3FJ7A 3PD9A 2UYFA 4H5FA 4LZ8A 1UTHB 1ZMGA 2O6AA 1US4A 2DWHA 1JNFA 3PUZE 3SETA 1MDQA 1LAHE 2Z8EA 2XXYA 3G3HA 3H7MA 3RT6B 3UORA 1B9JA 5I2KA 4LUBA 2GRVA 2DVZA 4Z0IA 3KSXA 3PUVE 2HZKA 5BUUA 2Y7WA 4THIA 2I58A 1ELJA 2IEEA 1FQBA 1FCKA 4FE8A 4MLQA 1H76A 3BKIB 4GLIA 4NF4B 3LR1A 4YAHX 3VV5A 4C0RA 1JW5A 4ZS9A 3H3GA 3SEYA 3B7DA 2ZMBA 4G68B 5I2NA 1O7TA 4QRZA 1L5TA 3WAEA 4F39A 2UVHA 1JVYA 1GV8A 3RNNA 4ESXA 1XHYA 2Q8JA 4FECA 2LAOA 3RUMA 2UXAA 4U1ZA 4OEUA 1DMBA 3PD8A 1Y1ZA 3DRHA 1Y9UA 4GVOA 1LB8A 4R9GA 1II5A 1Y3NA 2Z22A 3TTKA 2AL4A 4DIGA 4RY1A 4LP2B 1LFIA 4ECFA 3QSLA 4KHZE 4DXBA 1LFHA 3RQTA 1B3HA 4NEDA 4HS7A 2OZZA 3RY3A 4YB7A 4BDLA 2HQ0A 3C9HA 3MAMA 4FEDA 2KLFA 3K01A 2UVJA 4DDDA 1B40A 2I49A 4FAJA 2QS4A 1BLFA 3LUYA 4EF2A 1EH3A 2XXVA 1OMPA 2X26A 3MJNA 5ICTA 2I3WA 4F1YA 2G29A 2OLBA 1YAEA 2DYXA 2PX1A 2Z8DA 4IO7A 2P0SA 5JK4A 1N0TA 3H6WA 3S4UA 1MXZA 1OVTA 3R26A 3OOAA 4F19A 5I84A 1PBPA 3N26A 5AA1A 3G3IA 1R9LA 1MPBA 2XXIA 2XXTA 1Y3PA 5I2KB 2QS3A 3MW0A 2GHAA 2HXWA 3BBRA 3K4UA 2WOPA 3P7IA 3UP9A 3C35A 3K6WA 4KPTA 5TPAB 1VSOA 3BFUA 4MBPA 3O28A 4IO2A 1AOVA 2I4BA 4IO4A 1FQEA 2R6GE 3LSWA 3IOVA 2F6PA 1B7UA 4FIMA 4PETA 1Y20A 1N3XA 4BDMA 2VP1A 3UA8A 1B3GA 3V8XB 4TLMB 2F7BA 5CMKA 5I56B 3RPWA 3S9NC 2B3BA 4UA8A 2RCBA 1A8FA 1GVCA 3SDFA 3K6XA 5J1DA 5FTHA 1SYIA 1M5FA 3I5OA 1Y4CA 2XX8A 1B32A 1UTBA 3E13X 3FV2A 3CIJA 3N6TA 4FEBA 1B5HA 4BLAA 4IO3A 1ZTYA 2G93A 3FGSA 3M3LA 1NFTA 1XT8A 4QF9A 3K6UA 4HTGA 1Q1KA 5FHNA 2OCUA 5FHOA 3MWBA 1MQIA 3VVEA 3ONMA 3KN7A 2RINA 1B4ZA 3H03A 2I0BA 3E9XA 3K02A 3U1OA 3ZKLA 4QFNA 4FORA 4EQ7A 1T0KA 1P1OA 1N04A 4QFLA 2THIA 4IO6A 1N7XA 4PQJA 1DTZA 5DEXB 3U93A 3FVOA 3C34A 1POTA 5H8SA 3SESA 1AH5A 1MY3A 3GBBA 1LAXA 3S2VA 1XC1A 1PBQA 2H99A 3C32A 4XKNA 1JEVA 1IXCA 4ZDMA 1XOCA 5AA3A 3CSGA 2NXOA 3TODA 3VVFA 2X7PA 4GXSB 5M2VA 1UTHA 4YB6A 3LSXA 3O6PA 3QUFA 4DE8A 4P0IA 3EN3A 4ZEDA 2O51A 3OENA 4JWYA 2Z8FA 3E4RA 3G3FA 4X48A 2XD3A 1USYE 4IB2A 5A5XB 3U92A 4F22A 2XXWA 4OETA 3ECRA 1VFDA 1QUKA 2FYIA 4WEPA 2D21A 1US5A 1JEUA 3R6UA 3TCFA 3K0VA 1FTOA 2O1MA 3C33A 3TMGA 3VLWA 1B2HA 1FQAA 3LC8A 1MY0A 3RT8A 1QUIA 1IIWA 3USDA 5AE4A 1WDNA 4F1UA 1ANFA 2F8DA 1XS5A 5CRYA 5H8QB 3TAJA 4MLVA 3PMVA 2F36A 1O64A 3HHFA 3M3KA 4Q5TA 4YZZA 1SI0A 3B6QA 2PVUA 1SW5A 3W15C 1MQJA 1OVBA 3HSTA 3VXCA 1DPPA 4G77A 4KYDA 4EUOA 5TU0A 2O7UA 1LFGA 3IB1A 4JSOA 1B1HA 3DRIA 1I6QA 1YCJA 3DP6A 2F78A 3OEKA 4K3FA 1VR5A 4N13A 3O66A 3OO7A 4NWCA 1MH3A 2V93A 3T9VA 1B3FA 4GWOA 3MQ9A 2QJEA 4DCXA 2I6EA 1VE4A 1OIBA 4F18A 4R2BA 3CVGA 3JZJA 1FQFA 2DOJA 1SQYA 3FVKA 1P1QA 2DE4A 4R9FA 3EQ1A 1NNKA 4MF3A 5DTBA 3MZBA 3KSJA 2RC8A 3UN6A 3PPQA 5AA2A 2PMSA 2QSXA 3OEMA 4F1VA 4TQUQ 1PDAA 4FJPA 5DVFA 3FD3A 5I58A 4ZEIA 1H45A 2W7YA 4YKKA 3K1NA 3MC2A 3O6HA 4JXIA 4NWDA 4R72A 2GH9A 2ZYNA 3W9WA 5L9SA 4BDQA 3G3KA 3THIA 5CBSA 1BKAA 2ONSA 4LVQA 1B7ZA 3SKPA 4IGTA 4YMBA 3TCHA 3MBPA 3VDFA 4GF8A 2AYSA 2B3FA 1SVXB 2DE3A 2F7AA 2OJTA 1B05A 4R73A 4U22A 3TYHA 4BDNA 1MRPA 4PFUA 1D9YA 2PT1A 2ZYOA 3AXFA 4GFRA 4C1UA 4ZEKA 5KDTB 4EQBA 1MPCA 1MY1A 2VOZA 2O7IA 2I48A 4P11A 4U21A 5DVIA 5AA4A 5H8FA 3TUSA 1DPEA 2XHDA 4NF6B 4U2RA 3EHUA 2NUVA 5KCJA 1FTMA 1SBPA 5BWJA 1EZOA 1MQHA 3IR1A 2HZLA 3IK6B 3MP1A 4WEDA 4KCDA 3KEIA 3S9MC 3MZ1A 3BFTA 2NOOA 4OFOA 4MH5A 5HPQA 3RGYA 3HPIA 2XXPA 3QUJA 5CMMA 5I59A 1HSJA 4DLDA 2BJJX 3MP6A 1OLAA 3IOWA 4PP0A 3DLNA 1JQFA 3V5AA 1USYH 1QW0A 2ABHA 4GQOA 3OELA 5CC2A 1MY4A 2DP8A 3LSLA 1B6HA 1ZIUA 2H25A 3HCQA 3TCGA 3RLFE 3TTMA 4WXJA 3L6HA 4JWXA 1IXIA 4LONB 1PC3A 1S50A 1R9QA 3LBSA 4G4PA 4ONYA 4ISUA 3B6WA 2WOKA 5H8NA 4RA1A 3MVWA 1Q35A 1IITA 3OSRA 1UIUA 2F6GA 4JBZA 3S9LC 3QAXA 1N3WA 2DWJA 3CG3A 3VVDA 1RYOA 4XXUA 4OYVA 2ALUA 3TDJA 4F3SA 1LCFA 2AL5A 2DXYA 4KYEA 3OO8A 3TFLA 4R6HA 1DSNA 4KCCA 1EZ9A 2B4LA 2WKYA 4KD5A 4UACA 2O84X 2RKMA 3FTOA 2ZNUA 3EHSA 3H6VA 3PPPA 4H65A 4NMYA 4OZ9A 1YPNA 4OESA 1QKBA 2YLNA 4ND9A 1N76A 3GLBA 4YICA 2IA4A 1JW1A 3CG1A 2UYEA 1A55A 4R6KA 2RC9A 2XD2A 3PUWE 4YKIA 1O63A 4BDRA 3O6GA 4GIZA 1B46A 2Z23A 1LLSA 5TP9A 5JTYA 3FXRA 2HAUA 2A5TA 3DRFA 1Z7NE 3PU5A 3FASA 3PV0E 5ITOA 2Q9TA 2VD3A 3O29A 1M5EA 1PB7A 1IZ1A 1LGBC 1JW4A 2V3UA 3EF7A 3FXUA 3HO7A 3IOUA 4R75A 4JWOA 5JTYB 2VGQA 4OTEA 2NWJA 1IUDA 4H1XA 3A3UA 1I6BA 4H67A 3B6TA 5I57A 3IO6A 3T96B 1NNPA 1MXXA 1TFDA 2DXRA 3CR9A 4N6PA 2YJPA 3G3JA 1N7WA 4H0WA 3ZS6A 1B3EA 5EHMA 3PPRA 2OBGA 2ZNTA 3RTFB 1ZU0A 1LAGE 3HV1A 3K1PA 4NE4A 1FTLA 3TZAA 4OFLA 1DTGA 4X1BA 3SEXA 3EHTA 3OD7A 2F97A 3FZVA 3N5LA 3OO6A 4JDFA 1ZJLA 4KR5A 3PMXA 2H98A 3A3CA 1H3DA 3F11A 3FV1A 3PUXE 4IY5A 1Y1MA 2V84A 4ELPA 1Y3QA 2RCAA 4KYSA 1A99A 3PAMA 3T93B 4C1TA 4XKPA 2YPNA 1NKXA 1SI1A 4KQPA 1MXVA 4NF8B 1GR2A 4XKQA 3MP8A 2VHAA 4U23A 3QIMA 3LVUA 1MM6A 1R6ZA 4POWA 4EF1A 4PE5B 2I3VA 2XXRA 4R2FA 2Q2AA 3CI8A 4OFJA 1AIVA 1POY1 1FTKA 1LBBA 4OERA 2Q2CA 1A54A 1ATGA 2DWIA 3EPEA 1A7LA 1WODA 4Q0CA 3FUZA 3TTNA 1URDA 5K2XA 3T22A 1QULA 1TT1A 1LCTA 5LOMA 4F2QA 2Y7RA 3KJTA 1NNTA 3O2AA 3W9VA 4EQ9A 2P1SA 1B0LA 1OQGA 2Y7IA 4OHNA 3U94A 4OWDA 3DRJA 2DVCA 2NVUB 1NMUA 2FNCA 4L17A 1IXGA 2OK2A 4LATA 1M5DA 3DP4A 3SEVA 3O6IA 2QS1A 3G7WA 3TTLA 3QK6A 3WAFA 1FQDA 4QFPA 3UGWA 4LQ2A 2PYYA 5I57B 1FW0A 2X7QA 2ZNSA 1A40A 4OEVA 3TKDA 1CB6A 1JETA 3VFJA 1B52A 2XXQA 3Q27A 2RF1A 1HSEA 2QRYA 1IEJA 1MXUA 1B3LA 1FQCA 2QS2A 2WOLA 4LZ7A 1AL3A 1B5IA 1S7YA 4RK2A 1LSTA 2A5TB 4Q8RA 4LA9A 4O3BA 2GHBA 3HN0A 2DS9A 5HBCA 3C4MA 3KOSA 3RN8A 4XIGQ 3UK4A 4AQ4A 4PFTA 3M3FA 4DZ1A 2DE2A 3Q29A 4RNSA 3VLVA 1R1NA 1D3KA 4G8NA 1BIYA 4AB5A 1XVYA 4IO5A 2O1LA 3OMBA 2F5XA 5ISUA 3GZGA 3KZGA 4NF8A 4OVJA 3N94A 1URGA 2B65A 5CBRA 1SDXA 1ZKBA 3C31A 4OMBA 2Y84A 1P99A 4KFQA 1H44A 3PMWA 3QYTA 3GBAA 5JEIA 4QFKA 4KI0E 4YKJA 1AMFA 2XX7A 2QMXA 5DYHA
chains in the Genus database with same CATH superfamily
4RJZA 2ZYMA 2QL3A 1I6AA 2Y5LA 1WVJA 4I62A 2A5SA 3N6UA 5CMCA 4ZE8A 4I1DA 4F2OA 2XXHA 4QSCA 1M5BA 4HW8A 3IAZA 4OENA 5L9OA 1SW2A 5B7DA 4HCYA 2FHYA 2P2AA 4X1DA 4PFYA 3H4ZA 4PC9A 4O3CA 4ZZAA 1LBYA 4ZE9A 1DOTA 2CEYA 1F9BA 1INPA 1VFEA 4RYAA 1P1WA 3PPOA 3RYBA 3LUZA 4GWUA 4YU0A 4OVQA 1XVXA 1FPDA 4FATA 3SERA 5H8NB 1NH8A 4LZ5A 1EZPA 5IZZA 3V83A 4ELRA 4R74A 1TFAA 1D4NA 3C36A 4PFWA 3I3VA 2H5YA 4P1EA 2VPNA 1MXWA 4PGNA 3Q26A 4NF4A 1FPJA 1ZLQA 3VXBA 2FBPA 4BDOA 4RK9A 1MPDA 1I69A 4QBAA 3PUYE 2DQVA 2PT2A 1SD3A 2R71A 4F3BA 3Q28A 2B4MA 3CSBA 3SZPA 3RTWB 1FPBA 2Y5KA 3VE1B 1NUYA 4I8CA 2DSFA 4PE3A 2F3DA 5KZTA 3IJXB 4HE1A 3S9EA 3FJMA 1B5JA 5AA2B 4U1OA 3D4GA 3FJGA 2ONKE 2GFEA 3UIFA 3KGCA 5I7IA 4H5GA 1Q9DA 1QVSA 5DEXA 2XWVA 4XKRA 1MM7A 2ONRA 3OSQA 3R7XA 4N07A 2XXXA 3CRBA 2FVZA 1PEBA 5H8HB 3MVXA 4NF5A 1MG1A 2F35A 2PFYA 4F31B 4OVPA 1G0IA 1RKMA 3TQWA 5F24A 3PD9A 4MEVA 4LZ8A 1UTHB 1MDQA 2Z8EA 3RT6B 5I2KA 4LUBA 3KSXA 1NV5A 4JVIA 2Y7WA 5EYHA 4N4UA 1FPGA 3BKIB 4YAHX 1LEVA 1DBZA 2ZMBA 5I2NA 1O7TA 4OVRA 3WAEA 4F39A 3RPLA 1XHYA 2Q8JA 1Y1ZA 1LB8A 1II5A 4N81A 4LP2B 4NG7A 3MYUA 2OZZA 3RY3A 4DDDA 2I49A 4OVTA 4EF2A 2XWKA 4F1YA 1YAEA 2DYXA 5I84A 1OVTA 1Y3PA 3BBRA 3UP9A 3C35A 5TPAB 4IO2A 1AOVA 1FPLA 4GWSA 2F7BA 5I56B 1FJ9A 2RCBA 5FTHA 1SYIA 1M5FA 5ET8A 3N6TA 1B32A 4N8YA 3CIJA 1B5HA 4GWXA 4IO3A 3FGSA 3M3LA 1NFTA 4QF9A 4HTGA 5FHOA 5FHNA 3VVEA 3E9XA 3K02A 3U1OA 4FORA 2THIA 4QFLA 1LBVA 1IMAA 1DTZA 2ZZWA 3FVOA 3C34A 3GBBA 2H99A 4XKNA 1JEVA 1XOCA 2X7PA 4YB6A 3O6PA 4P0IA 3OENA 3E4RA 5A5XB 4OETA 2FYIA 1QUKA 3ISPA 3VLWA 1FQAA 1ANFA 5H8QB 3PMVA 1O64A 4Q5TA 5T3JA 2PVUA 1DPPA 4G77A 3DRIA 1I6QA 3DP6A 3OEKA 1VR5A 2P3VA 3OO7A 3MQ9A 2QJEA 5FBPA 3JZJA 1P1QA 3UN6A 4FJPA 4ZEIA 2W7YA 4X04A 2GH9A 1B7ZA 3SKPA 4YMBA 3TCHA 4U22A 3TYHA 4C1UA 4GFRA 2VOZA 3IR1A 2HZLA 3IK6B 4WEDA 3KEIA 1RDZA 3HPIA 3IOWA 1JQFA 1QW0A 3OELA 2DP8A 1PC3A 5H8NA 4G4PA 3MVWA 1IITA 4JBZA 1UIUA 4O7IA 3VVDA 4XXUA 4OYVA 2ALUA 1LCFA 2DXYA 2B4LA 3EHSA 3PPPA 4OESA 3NOHA 4ND9A 2BJIA 1JW1A 4H46A 1O63A 1NV2A 4GIZA 5ITOA 3FASA 3O29A 5EQAA 1M5EA 1IZ1A 2V3UA 3FXUA 4JWOA 4H1XA 2CZKA 4GWZA 4P1LA 3KC1A 4H67A 1KA1A 2YJPA 3G3JA 3ZS6A 5DW8A 2ZNTA 4N17A 3K1PA 4NE4A 4OFLA 4JDFA 4KR5A 4IY5A 1Y1MA 2RCAA 1A99A 3T93B 4C1TA 4NAPA 4EF1A 2WBBA 1MM6A 4MNPA 1R6ZA 2XXRA 3B8BA 2Q2CA 1ATGA 5K2XA 4XEQA 1QULA 4F2QA 4EQ9A 1B0LA 2Y7IA 4OHNA 2DVCA 3O6IA 3TTLA 1FQDA 2PYYA 2R8TA 1B52A 2XXQA 2RF1A 3QMFA 1B3LA 1FQCA 1B5IA 4Q8RA 3FBPA 2DS9A 3C4MA 3M3FA 2DE2A 4RNSA 4N6DA 4G8NA 1VDWA 1XVYA 4IO5A 2O1LA 3OMBA 3GZGA 1ZKBA 4OMBA 4KFQA 3PMWA 1EYIA 4YKJA 2Y7PA 4G68C 2DWAA 2QMWA 3ZKKA 2D3IA 4MCOA 2P3NA 3GXAA 5H8QA 3DP8A 3T1BA 1FTJA 3OXNA 1MXYA 3TEPA 3T66A 5K2YA 5I59B 4U4XA 5TP9B 1LBCA 4PF6A 4GL8A 2ZXTA 4R6YA 1B7HA 1YYZA 1MH4A 3IFAA 3Q25A 5IKBA 4M4GA 4QSDA 5L9MA 4E0WA 3KN8A 3T9UA 3HHGA 1P1UA 5ELVA 1FPEA 4O7MA 4M1VA 3I6VA 1TXFA 4YMAA 4JVCA 3TPAA 1LAFE 2H4IA 2UVIA 4P0GA 2CZLA 4POXA 1KWHA 2H9BA 1PB8A 1P1NA 5TPAA 3CFZA 5H8FB 4P9KA 2V3TA 2E0SA 4PDHA 1QKAA 3PPNA 3U72A 1NV3A 4I40A 4U4SA 1URSA 1FBGA 2QPQA 3IB2A 4H8JA 4DXUA 1UQWA 3K6VA 4LQ5A 4XTCQ 4MFIA 1D9VA 5FHMA 3VLUA 3M8UA 5EQ9A 1EU8A 2O69A 4NF0A 1IQ7A 4G8MA 1YTVA 3CFXA 2I0CA 1S9TA 2UVGA 3TTRA 3IO4A 2ZZXA 5CMBA 2E1SA 1UTBB 4H6DA 1Z7ME 2AIXA 3K00A 5EHSA 3DM0A 2OWTA 1LFHA 4NF5B 1BP5A 1H43A 5H8HA 4GL0A 3FJ7A 3B50A 2DWHA 2XXKA 1FBDA 1RDYA 4P47A 3H7MA 3UORA 1B9JA 2GRVA 2HZKA 2IEEA 3VLVA 1FCKA 4FE8A 3VDFA 4C0RA 1JW5A 3B7DA 1K9YA 3RNNA 1JVYA 4PFIA 4ESXA 4FECA 3RUMA 4U1ZA 4OEUA 4R9GA 4ECFA 4RY1A 4YB7A 4FEDA 3K01A 4FAJA 1EH3A 2XXVA 3MJNA 5ICTA 4MX6A 2OLBA 4GWYA 4IO7A 3H6WA 1MXZA 3OOAA 1SPIA 3N26A 2QS3A 3K4UA 3P7IA 3K6WA 1VSOA 4MBPA 3O28A 4IO4A 1FQEA 2R6GE 3IOVA 4FIMA 4PETA 1Y20A 3UA8A 5CMKA 3RPWA 3SDFA 2QVRA 5J1DA 2XX8A 3I5OA 4FEBA 2WX9A 1ZTYA 3FXBA 3K6UA 4NHBA 4NX1A 3MWBA 1MQIA 1B4ZA 3H03A 2I0BA 4O94A 3ZKLA 4IO6A 4PQJA 5DEXB 4I3EA 4PFRA 4XF5A 3S2VA 1XC1A 3C32A 3CSGA 3VVFA 4GXSB 3QUFA 3EN3A 4ZEDA 2O51A 2Z8FA 4X48A 3G3FA 4IB2A 3ECRA 2D21A 3R6UA 1FTOA 3TMGA 1B2HA 1MY0A 4PF8A 1G0HA 1XS5A 3HHFA 4GBVA 4YZZA 3B6QA 3W15C 1OVBA 3HSTA 1B1HA 1FRPA 3KBZA 4GWOA 4R2BA 3CVGA 1FPIA 3FVKA 2DE4A 1NNKA 3KSJA 2PMSA 1KZ8A 5DVFA 3FD3A 4MAGA 3K1NA 4R72A 2ZYNA 3W9WA 5L9SA 3THIA 3A29A 4Z0IA 2B3FA 4BDNA 1B05A 2ZYOA 4ZEKA 5DVIA 2I48A 5H8FA 2XHDA 1FTMA 1EZOA 5BWJA 2CEXA 3MP1A 4KCDA 3MZ1A 3BFTA 3QUJA 5CMMA 1NV7A 1OLAA 4PP0A 3V5AA 3LSLA 4MNCA 1ZIUA 4WXJA 4JWXA 4LONB 1R9QA 1S50A 3LBSA 4RA1A 1Q35A 3OSRA 2DWJA 1RYOA 2AL5A 3TFLA 2WYKA 4KCCA 2WKYA 4UACA 2ZNUA 4OZ9A 3GLBA 2IA4A 1A55A 2XD2A 1B46A 3PV0E 2Q9TA 4H45A 1LGBC 3EF7A 1I6BA 5I57A 3IO6A 1NNPA 2DXRA 3CR9A 4H0WA 3LV0A 1FBPA 1LAGE 2MKZA 3HV1A 2F97A 3N5LA 3PMXA 5LTCA 2WYPA 3IFCA 3F11A 3FV1A 4LN5A 1NKXA 1SI1A 4KQPA 1GR2A 4XKQA 4U23A 2VHAA 2QVVA 2Q2AA 1FTKA 1A54A 1LCTA 3KJTA 1NNTA 2P1SA 1OQGA 4PBQA 4GX4A 1NMUA 4P3LA 2OK2A 3QK6A 4FBPA 1A40A 4OEVA 3TKDA 3VFJA 1MXUA 1AL3A 4RK2A 2A5TB 1DCUA 4LA9A 5HBCA 3KOSA 4PFTA 4DZ1A 5IZ1A 1BIYA 4AB5A 5ISUA 3N94A 1URGA 5CBRA 1SDXA 3QYTA 2VPOA 3GBAA 4X8RA 4G61A 2XX7A 5DYHA 4DXCA 4QHQA 4JVDA 3LSFB 3IORA 4YKPA 2XX9A 3D4CA 2ANJA 1EYJA 4G2ZA 1MDP1 4F3GA 5DVJA 3CFLA 2M8CA 5I56A 3IB0A 4AB6A 4ELOA 1SYHA 1CE2A 1NH7A 5F7VA 3SEWA 3FATA 4NQ8A 1IMCA 1QJMA 4OXVA 1OQHA 2RC7A 2HXRA 5KCJB 2PCRA 3PGFA 4ZECA 1B58A 4GD5A 1RYXA 2V25A 1OLCA 3K1MA 3DRGA 3MUQA 1MS7A 4E0XA 1UIVA 1NV6A 3CHGA 5ET5A 2HAVA 3O9PA 4RPNA 1CNQA 3RYAA 1RDXA 3SEUA 5IAIA 4GBWA 5I2NB 2PFZA 3A09A 2GQ1A 3ZSFA 3L6GA 3FIRA 4ZEBA 3KG2A 3JYRA 3KN3A 2OX3A 1M5CA 2REGA 4GXAA 4TLLB 2F7CA 3KBRA 2Q88A 3T9HB 5F1QA 4IGRA 5ET6A 3ODBA 4GRKA 2FA7A 2HFBA 2F34A 3TELA 3U8QA 3MZ9A 1NV4A 5HM4B 3E79A 4NTLA 4ZZEA 1B1XA 3H06B 1SW1A 4YB5A 3ILTB 2VD2A 4Z7EA 3E3KA 3MVZA 3TQLA 1MQGA 4WKMA 2R9JA 1ZBMA 4X9TA 5FTIA 4F29A 3H6TA 4OQOA 5A5XA 4ZEFA 4EXKA 3OO9A 4TOZA 4H5FA 1ZMGA 3SETA 3G3HA 5BUUA 3PUVE 1IMDA 4DXBA 4MLQA 1H76A 4NF4B 3VV5A 4ZS9A 3SEYA 1L5TA 2UVHA 2UXAA 1AWBA 1DMBA 3E78A 1Y3NA 5I5PA 2AL4A 1LFIA 3QSLA 1FBEA 1B3HA 4HS7A 4KXPA 4BDLA 2HQ0A 3MAMA 2KLFA 2UVJA 1B40A 1BLFA 2CZHA 3LUYA 1OMPA 2I3WA 2Z8DA 2P0SA 3S4UA 4F19A 1PBPA 5AA1A 1MPBA 2XXTA 2GHAA 3BFUA 2F6PA 4N91A 4TLMB 4LATA 1Y4CA 1UTBA 3HFUA 2G93A 1KA0A 3ONMA 4PAKA 2V4CA 4EQ7A 1N04A 1P1OA 2HPGA 1FPFA 1N7XA 3U93A 3T0JA 1PBQA 4ZDMA 1NV0A 3TODA 1UTHA 3LSXA 2WBDA 4JWYA 1USYE 3U92A 2XXWA 4WEPA 1US5A 1JEUA 3TCFA 5ET7A 4DI3D 2O1MA 3C33A 3USDA 3LC8A 5AE4A 1QUIA 1IIWA 2F8DA 4GWWA 5CRYA 3TAJA 2F36A 3M3KA 3VXCA 4EUOA 5TU0A 5EQ7A 4JSOA 1JP4A 4DCXA 4F18A 1SQYA 5DTBA 4PFBA 3MZBA 5AA2A 4OA4A 3PPQA 3OEMA 5EYGA 1PDAA 4PAIA 5IZ3A 5I58A 2JJKA 4BDQA 3G3KA 5CBSA 1BKAA 4HE0A 4IGTA 3MBPA 4GF8A 2F7AA 2OJTA 1SVXB 4R73A 1MRPA 4PFUA 3AXFA 5KDTB 4EQBA 4P11A 4NF6B 4U2RA 3EHUA 4UABA 1MQHA 1LBZA 1YZ0A 3ROJA 3S9MC 4MH5A 4OFOA 3RGYA 2XXPA 5I59A 2WEFA 2BJJX 3MP6A 4DLDA 4MHFA 3DLNA 1USYH 3RYDA 1MY4A 1B6HA 2H25A 3HCQA 3TTMA 4ONYA 4AS4A 3B6WA 2WOKA 3S9LC 3QAXA 3CG3A 2Q8MA 4F3SA 4KYEA 1IMFA 1EZ9A 4KD5A 3FTOA 1YPNA 2YLNA 2UYEA 4BDRA 1LLSA 2Z23A 5JTYA 3FXRA 2HAUA 3DRFA 3PU5A 2VD3A 1PB7A 5JTYB 3HO7A 2NWJA 2VGQA 4OTEA 1IUDA 1TFDA 4OANA 1ZU0A 3TZAA 1FTLA 4X1BA 3EHTA 3OO6A 1ZJLA 3U65A 2H98A 3A3CA 5IM2A 4PTKA 1H3DA 2QVUA 4KYSA 2YPNA 2DDKA 1MXVA 4R2FA 2QFLA 1POY1 1LBBA 4OERA 2DWIA 1A7LA 3TTNA 1NV1A 3T22A 1TT1A 3D1RA 5LOMA 2Y7RA 3W9VA 3U94A 4DI4B 3DRJA 2NVUB 2FNCA 4L17A 1FBFA 1M5DA 3DP4A 3SEVA 3WAFA 4QFPA 2X7QA 2ZNSA 1CB6A 1JETA 3MSTA 1HSEA 1IEJA 1IMEA 4LZ7A 2WOLA 5LDZA 1LSTA 1NUZA 4O3BA 3RN8A 3UK4A 4AQ4A 3Q29A 1D3KA 1NUWA 4NF8A 2F5XA 3KZGA 2B65A 4GX6A 2FIXA 1AMFA 2QMXA 3G3GA 3KFMA 2ESNA 4PAFA 5AA2D 1JVXA 1B0HA 4N6KA 2OWSA 1D9QA 1SW4A 4GX3A 1LB9A 1BTJA 1GGGA 1IXHA 4DCYA 1NNFA 3V89B 3QXMA 2V3QA 2O68A 1PB9A 3DRKA 2I4CA 4NF6A 3ILUB 2D5WA 4JB7A 2ZYKA 5A5LA 5KDTA 3H6UA 1N84A 4IY6A 2Q89A 4HE2A 4QFOA 1GTKA 5IZ3B 5CM6A 5I58B 3JV9A 3KOTA 3T9XB 1NL5A 2Y7KA 4QXDA 3FVNA 1HSLA 4G8HA 4F3PA 2ZZVA 4G68A 2HHMA 3IL1B 5EYFA 3O97A 1B51A 2XXUA 5CI5A 3KJ7A 3IOTA 3EKIA 2HCAA 4HCWA 4RPOA 1QUJA 5L8DA 3FVGA 5AA4B 5DT6A 2CMOA 4H8IA 2REJA 1TWYA 1B4HA 1IMBA 3IX1A 1FJ6A 2L5VA 3MVYA 5I3SA 5ITPA 4HXVA 4I9DA 1J1NA 4QSEA 5B70A 3MPKA 5ESYA 4O3AA 1NUXA 3IJOB 4ESWA 4EXLA 3MPLA 2OWZA 1MY2A 3K2DA 1A8EA 1FBHA 1Y4TA 1MQDA 3DELB 3GYYA 4Q30B 2HEUA 3FXQA 4ELQA 4JSDA 5ICQA 4GOTA 2PBWA 4RXLA 2UYFA 2O6AA 1US4A 3PUZE 1JNFA 1LAHE 2XXYA 2DVZA 1YXIA 4THIA 2I58A 1ELJA 1FQBA 4GLIA 3LR1A 4XFEA 3H3GA 4G68B 4QRZA 1GV8A 4AS5A 2LAOA 3PD8A 3DRHA 1Y9UA 4GVOA 2Z22A 5EQ8A 3TTKA 1DK4A 4DIGA 4KHZE 4PDDA 1LBXA 3RQTA 3RPLB 4NEDA 1FSAA 3C9HA 4N15A 2QS4A 2X26A 3PTYA 1QGXA 2G29A 2PX1A 5JK4A 1N0TA 3R26A 4N8GA 3G3IA 1R9LA 4NN3A 2XXIA 5I2KB 3MW0A 2HXWA 2WOPA 2FIEA 4KPTA 2KR0A 2I4BA 1K9ZA 3LSWA 1B7UA 4PGPA 1N3XA 4BDMA 2VP1A 1B3GA 4P8BA 3V8XB 3S9NC 4MMPA 2B3BA 4UA8A 1GVCA 1A8FA 3K6XA 3E13X 3FV2A 4BLAA 1XT8A 1Q1KA 2OCUA 4IR8A 3KN7A 2RINA 4QFNA 1T0KA 3SESA 1POTA 5H8SA 1AH5A 1MY3A 1BK4A 1FBCA 1LAXA 1IXCA 5AA3A 2NXOA 5M2VA 2KQZA 2XD3A 1NI9A 4F22A 4I3YA 1VFDA 3K0VA 4EDPA 3RT8A 1WDNA 4F1UA 4MLVA 1SI0A 1SW5A 1MQJA 4KYDA 2O7UA 3BIGA 1LFGA 3IB1A 1YCJA 4K3FA 2F78A 4NGUA 2XA5A 4N13A 3O66A 4NWCA 1MH3A 2V93A 3T9VA 1B3FA 2I6EA 1VE4A 1OIBA 1FQFA 2DOJA 4R9FA 3EQ1A 4MF3A 2RC8A 2QSXA 4F1VA 4TQUQ 1H45A 4YKKA 2XWOA 3MC2A 4JXIA 3O6HA 4NWDA 2ONSA 4LVQA 2AYSA 2DE3A 4DE8A 1D9YA 2PT1A 1MPCA 1MY1A 4U21A 2O7IA 5AA4A 4PBHA 3TUSA 1DPEA 2NUVA 5KCJA 1SBPA 2NOOA 5HPQA 1HSJA 4P56A 2ABHA 1FTAA 4GQOA 5CC2A 3RLFE 3TCGA 3L6HA 1IXIA 4ISUA 2F6GA 1N3WA 3TDJA 5J16A 4MNIA 3OO8A 4R6HA 1DSNA 1LBWA 2O84X 2RKMA 3H6VA 4NMYA 5IGAA 4H65A 1QKBA 1N76A 4YICA 3CG1A 4R6KA 2RC9A 3PUWE 4YKIA 4O8MA 3O6GA 5TP9A 2A5TA 1Z7NE 1JW4A 4R75A 3IOUA 3A3UA 3B6TA 3T96B 1MXXA 2Q74A 4N6PA 1N7WA 2F3BA 1B3EA 5EHMA 3PPRA 2OBGA 3RTFB 1FPKA 1DTGA 3SEXA 3OD7A 3FZVA 3PUXE 2V84A 4ELPA 1Y3QA 3PAMA 4XKPA 4NF8B 3MP8A 3QIMA 4POWA 3LVUA 4PE5B 2I3VA 1XI6A 1AIVA 3CI8A 4OFJA 3EPEA 4Q0CA 1WODA 3FUZA 1URDA 3O2AA 4OWDA 2XWIA 1IXGA 2QS1A 3G7WA 1EYKA 3UGWA 4LQ2A 5I57B 1FW0A 3BIHA 3Q27A 4MJOA 2QRYA 3KC0A 2QS2A 1S7YA 2CZIA 2GHBA 3HN0A 4XIGQ 4PCDA 1R1NA 4OVSA 4OVJA 2VT5A 4MIJA 3C31A 2Y84A 1P99A 1H44A 5JEIA 4QFKA 4KI0E
chains in the Genus database with same CATH topology
4RJZA 4DXCA 3G3GA 3KFMA 4QHQA 2ESNA 2Y7PA 4G68C 2DWAA 2QMWA 3IORA 3LSFB 2ZYMA 2QL3A 1I6AA 4YKPA 3ZKKA 2D3IA 2XX9A 1WVJA 5AA2D 4I62A 3D4CA 2A5SA 1JVXA 3GXAA 2ANJA 1B0HA 3N6UA 5CMCA 5H8QA 3DP8A 4ZE8A 1FTJA 2OWSA 3OXNA 4I1DA 4F2OA 1MXYA 1MDP1 1SW4A 2XXHA 4G2ZA 4QSCA 4F3GA 1M5BA 3TEPA 4HW8A 1LB9A 1BTJA 3IAZA 3CFLA 4OENA 3T66A 2M8CA 5DVJA 1SW2A 1GGGA 3IB0A 5I56A 5L9OA 1IXHA 5B7DA 5K2YA 4AB6A 4ELOA 5I59B 4DCYA 4U4XA 1SYHA 4HCYA 1CE2A 1NH7A 5F7VA 5TP9B 1LBCA 3SEWA 1NNFA 2P2AA 3FATA 3V89B 1QJMA 4OXVA 4X1DA 1OQHA 4PFYA 3H4ZA 3QXMA 2V3QA 2RC7A 4O3CA 4ZZAA 2O68A 4GL8A 5KCJB 4ZE9A 2ZXTA 1DOTA 1PB9A 3DRKA 1F9BA 2I4CA 4NF6A 1VFEA 4R6YA 3ILUB 2D5WA 3PGFA 4JB7A 4ZECA 1B7HA 4RYAA 2ZYKA 1B58A 5KDTA 1P1WA 3PPOA 4GD5A 1MH4A 1RYXA 3Q25A 5IKBA 3RYBA 4M4GA 2V25A 4QSDA 5L9MA 3H6UA 1OLCA 3KN8A 3T9UA 3HHGA 1P1UA 3K1MA 3DRGA 4YU0A 3MUQA 5ELVA 4M1VA 1N84A 4IY6A 1MS7A 2Q89A 1XVXA 3I6VA 1TXFA 4E0XA 1UIVA 4FATA 4YMAA 3SERA 5H8NB 4QFOA 1GTKA 5CM6A 5I58B 3TPAA 3CHGA 1LAFE 1NH8A 4EDPA 2H4IA 2HAVA 3JV9A 4LZ5A 5AA2B 1EZPA 2UVIA 3KOTA 3V83A 4ELRA 4E0WA 3O9PA 4P0GA 4R74A 1TFAA 4RPNA 1D4NA 1NL5A 2CZLA 2Y7KA 3C36A 4POXA 3T9XB 3FVNA 4PFWA 3RYAA 2H5YA 1KWHA 3I3VA 1HSLA 3SEUA 4G8HA 5IAIA 4F3PA 2H9BA 4G68A 3IL1B 5I2NB 3A09A 1PB8A 3O97A 1B51A 1P1NA 2XXUA 5EYFA 1MXWA 5TPAA 5CI5A 3CFZA 3KJ7A 3IOTA 3Q26A 4NF4A 1ZLQA 3VXBA 3ZSFA 4BDOA 4RK9A 2HCAA 3L6GA 4HCWA 4RPOA 1MPDA 1QUJA 1I69A 3FIRA 5L8DA 3FVGA 5H8FB 3PUYE 5AA4B 4ZEBA 2DQVA 2V3TA 2E0SA 5DT6A 3KG2A 2PT2A 3JYRA 3KN3A 1QKAA 1SD3A 2R71A 2CMOA 3PPNA 3U72A 4F3BA 1M5CA 3Q28A 2REGA 2B4MA 4GXAA 3CSBA 4U4SA 4H8IA 2REJA 4TLLB 2F7CA 3KBRA 1URSA 2QPQA 2Q88A 3RTWB 3T9HB 1TWYA 5F1QA 3IB2A 4IGRA 4H8JA 4DXUA 1B4HA 3VE1B 1UQWA 4I8CA 2DSFA 3IX1A 3K6VA 3ODBA 5KZTA 3IJXB 4LQ5A 4XTCQ 3FJMA 3S9EA 1B5JA 3MVYA 4GRKA 4MFIA 2FA7A 2HFBA 3D4GA 2F34A 3FJGA 1D9VA 3MZ9A 4U1OA 2ONKE 3TELA 3U8QA 5FHMA 2GFEA 3UIFA 3KGCA 5ITPA 4I9DA 3VLUA 1J1NA 3M8UA 4H5GA 4QSEA 5B70A 5HM4B 3MPKA 1EU8A 1QVSA 4O3AA 5DEXA 2O69A 1IQ7A 4NTLA 4G8MA 3IJOB 1YTVA 4ESWA 3CFXA 4EXLA 3MPLA 4ZZEA 4XKRA 1B1XA 1MM7A 3H06B 1SW1A 2ONRA 4YB5A 2I0CA 1MY2A 1S9TA 3ILTB 3K2DA 2VD2A 4Z7EA 3E3KA 2UVGA 3OSQA 3MVZA 3R7XA 3TTRA 3TQLA 3IO4A 1MQGA 1A8EA 4N07A 2R9JA 2E1SA 4WKMA 1UTBB 4H6DA 5CMBA 1ZBMA 1Z7ME 2XXXA 4X9TA 3CRBA 5FTIA 1PEBA 1Y4TA 1MQDA 2AIXA 3DELB 3K00A 2HEUA 4Q30B 5EHSA 5H8HB 4F29A 3DM0A 3FXQA 3MVXA 2OWTA 4ELQA 4NF5A 1MG1A 4JSDA 1BP5A 2F35A 4NF5B 5ICQA 4GOTA 1H43A 4F31B 3H6TA 4OQOA 5A5XA 5H8HA 4ZEFA 2PBWA 4EXKA 3OO9A 4TOZA 1RKMA 4GL0A 4RXLA 3TQWA 3FJ7A 3PD9A 2UYFA 4H5FA 4LZ8A 1UTHB 1ZMGA 2O6AA 1US4A 2DWHA 1JNFA 3PUZE 3SETA 1MDQA 1LAHE 2Z8EA 2XXYA 3G3HA 3H7MA 3RT6B 3UORA 1B9JA 5I2KA 4LUBA 2GRVA 2DVZA 4Z0IA 3KSXA 3PUVE 2HZKA 5BUUA 2Y7WA 4THIA 2I58A 1ELJA 2IEEA 1FQBA 1FCKA 4FE8A 4MLQA 1H76A 3BKIB 4GLIA 4NF4B 3LR1A 4YAHX 3VV5A 4C0RA 1JW5A 4ZS9A 3H3GA 3SEYA 3B7DA 2ZMBA 4G68B 5I2NA 1O7TA 4QRZA 1L5TA 3WAEA 4F39A 2UVHA 1JVYA 1GV8A 3RNNA 4ESXA 1XHYA 2Q8JA 4FECA 2LAOA 3RUMA 2UXAA 4U1ZA 4OEUA 1DMBA 3PD8A 1Y1ZA 3DRHA 1Y9UA 4GVOA 1LB8A 4R9GA 1II5A 1Y3NA 2Z22A 3TTKA 2AL4A 4DIGA 4RY1A 4LP2B 1LFIA 4ECFA 3QSLA 4KHZE 4DXBA 1LFHA 3RQTA 1B3HA 4NEDA 4HS7A 2OZZA 3RY3A 4YB7A 4BDLA 2HQ0A 3C9HA 3MAMA 4FEDA 2KLFA 3K01A 2UVJA 4DDDA 1B40A 2I49A 4FAJA 2QS4A 1BLFA 3LUYA 4EF2A 1EH3A 2XXVA 1OMPA 2X26A 3MJNA 5ICTA 2I3WA 4F1YA 2G29A 2OLBA 1YAEA 2DYXA 2PX1A 2Z8DA 4IO7A 2P0SA 5JK4A 1N0TA 3H6WA 3S4UA 1MXZA 1OVTA 3R26A 3OOAA 4F19A 5I84A 1PBPA 3N26A 5AA1A 3G3IA 1R9LA 1MPBA 2XXIA 2XXTA 1Y3PA 5I2KB 2QS3A 3MW0A 2GHAA 2HXWA 3BBRA 3K4UA 2WOPA 3P7IA 3UP9A 3C35A 3K6WA 4KPTA 5TPAB 1VSOA 3BFUA 4MBPA 3O28A 4IO2A 1AOVA 2I4BA 4IO4A 1FQEA 2R6GE 3LSWA 3IOVA 2F6PA 1B7UA 4FIMA 4PETA 1Y20A 1N3XA 4BDMA 2VP1A 3UA8A 1B3GA 3V8XB 4TLMB 2F7BA 5CMKA 5I56B 3RPWA 3S9NC 2B3BA 4UA8A 2RCBA 1A8FA 1GVCA 3SDFA 3K6XA 5J1DA 5FTHA 1SYIA 1M5FA 3I5OA 1Y4CA 2XX8A 1B32A 1UTBA 3E13X 3FV2A 3CIJA 3N6TA 4FEBA 1B5HA 4BLAA 4IO3A 1ZTYA 2G93A 3FGSA 3M3LA 1NFTA 1XT8A 4QF9A 3K6UA 4HTGA 1Q1KA 5FHNA 2OCUA 5FHOA 3MWBA 1MQIA 3VVEA 3ONMA 3KN7A 2RINA 1B4ZA 3H03A 2I0BA 3E9XA 3K02A 3U1OA 3ZKLA 4QFNA 4FORA 4EQ7A 1T0KA 1P1OA 1N04A 4QFLA 2THIA 4IO6A 1N7XA 4PQJA 1DTZA 5DEXB 3U93A 3FVOA 3C34A 1POTA 5H8SA 3SESA 1AH5A 1MY3A 3GBBA 1LAXA 3S2VA 1XC1A 1PBQA 2H99A 3C32A 4XKNA 1JEVA 1IXCA 4ZDMA 1XOCA 5AA3A 3CSGA 2NXOA 3TODA 3VVFA 2X7PA 4GXSB 5M2VA 1UTHA 4YB6A 3LSXA 3O6PA 3QUFA 4DE8A 4P0IA 3EN3A 4ZEDA 2O51A 3OENA 4JWYA 2Z8FA 3E4RA 3G3FA 4X48A 2XD3A 1USYE 4IB2A 5A5XB 3U92A 4F22A 2XXWA 4OETA 3ECRA 1VFDA 1QUKA 2FYIA 4WEPA 2D21A 1US5A 1JEUA 3R6UA 3TCFA 3K0VA 1FTOA 2O1MA 3C33A 3TMGA 3VLWA 1B2HA 1FQAA 3LC8A 1MY0A 3RT8A 1QUIA 1IIWA 3USDA 5AE4A 1WDNA 4F1UA 1ANFA 2F8DA 1XS5A 5CRYA 5H8QB 3TAJA 4MLVA 3PMVA 2F36A 1O64A 3HHFA 3M3KA 4Q5TA 4YZZA 1SI0A 3B6QA 2PVUA 1SW5A 3W15C 1MQJA 1OVBA 3HSTA 3VXCA 1DPPA 4G77A 4KYDA 4EUOA 5TU0A 2O7UA 1LFGA 3IB1A 4JSOA 1B1HA 3DRIA 1I6QA 1YCJA 3DP6A 2F78A 3OEKA 4K3FA 1VR5A 4N13A 3O66A 3OO7A 4NWCA 1MH3A 2V93A 3T9VA 1B3FA 4GWOA 3MQ9A 2QJEA 4DCXA 2I6EA 1VE4A 1OIBA 4F18A 4R2BA 3CVGA 3JZJA 1FQFA 2DOJA 1SQYA 3FVKA 1P1QA 2DE4A 4R9FA 3EQ1A 1NNKA 4MF3A 5DTBA 3MZBA 3KSJA 2RC8A 3UN6A 3PPQA 5AA2A 2PMSA 2QSXA 3OEMA 4F1VA 4TQUQ 1PDAA 4FJPA 5DVFA 3FD3A 5I58A 4ZEIA 1H45A 2W7YA 4YKKA 3K1NA 3MC2A 3O6HA 4JXIA 4NWDA 4R72A 2GH9A 2ZYNA 3W9WA 5L9SA 4BDQA 3G3KA 3THIA 5CBSA 1BKAA 2ONSA 4LVQA 1B7ZA 3SKPA 4IGTA 4YMBA 3TCHA 3MBPA 3VDFA 4GF8A 2AYSA 2B3FA 1SVXB 2DE3A 2F7AA 2OJTA 1B05A 4R73A 4U22A 3TYHA 4BDNA 1MRPA 4PFUA 1D9YA 2PT1A 2ZYOA 3AXFA 4GFRA 4C1UA 4ZEKA 5KDTB 4EQBA 1MPCA 1MY1A 2VOZA 2O7IA 2I48A 4P11A 4U21A 5DVIA 5AA4A 5H8FA 3TUSA 1DPEA 2XHDA 4NF6B 4U2RA 3EHUA 2NUVA 5KCJA 1FTMA 1SBPA 5BWJA 1EZOA 1MQHA 3IR1A 2HZLA 3IK6B 3MP1A 4WEDA 4KCDA 3KEIA 3S9MC 3MZ1A 3BFTA 2NOOA 4OFOA 4MH5A 5HPQA 3RGYA 3HPIA 2XXPA 3QUJA 5CMMA 5I59A 1HSJA 4DLDA 2BJJX 3MP6A 1OLAA 3IOWA 4PP0A 3DLNA 1JQFA 3V5AA 1USYH 1QW0A 2ABHA 4GQOA 3OELA 5CC2A 1MY4A 2DP8A 3LSLA 1B6HA 1ZIUA 2H25A 3HCQA 3TCGA 3RLFE 3TTMA 4WXJA 3L6HA 4JWXA 1IXIA 4LONB 1PC3A 1S50A 1R9QA 3LBSA 4G4PA 4ONYA 4ISUA 3B6WA 2WOKA 5H8NA 4RA1A 3MVWA 1Q35A 1IITA 3OSRA 1UIUA 2F6GA 4JBZA 3S9LC 3QAXA 1N3WA 2DWJA 3CG3A 3VVDA 1RYOA 4XXUA 4OYVA 2ALUA 3TDJA 4F3SA 1LCFA 2AL5A 2DXYA 4KYEA 3OO8A 3TFLA 4R6HA 1DSNA 4KCCA 1EZ9A 2B4LA 2WKYA 4KD5A 4UACA 2O84X 2RKMA 3FTOA 2ZNUA 3EHSA 3H6VA 3PPPA 4H65A 4NMYA 4OZ9A 1YPNA 4OESA 1QKBA 2YLNA 4ND9A 1N76A 3GLBA 4YICA 2IA4A 1JW1A 3CG1A 2UYEA 1A55A 4R6KA 2RC9A 2XD2A 3PUWE 4YKIA 1O63A 4BDRA 3O6GA 4GIZA 1B46A 2Z23A 1LLSA 5TP9A 5JTYA 3FXRA 2HAUA 2A5TA 3DRFA 1Z7NE 3PU5A 3FASA 3PV0E 5ITOA 2Q9TA 2VD3A 3O29A 1M5EA 1PB7A 1IZ1A 1LGBC 1JW4A 2V3UA 3EF7A 3FXUA 3HO7A 3IOUA 4R75A 4JWOA 5JTYB 2VGQA 4OTEA 2NWJA 1IUDA 4H1XA 3A3UA 1I6BA 4H67A 3B6TA 5I57A 3IO6A 3T96B 1NNPA 1MXXA 1TFDA 2DXRA 3CR9A 4N6PA 2YJPA 3G3JA 1N7WA 4H0WA 3ZS6A 1B3EA 5EHMA 3PPRA 2OBGA 2ZNTA 3RTFB 1ZU0A 1LAGE 3HV1A 3K1PA 4NE4A 1FTLA 3TZAA 4OFLA 1DTGA 4X1BA 3SEXA 3EHTA 3OD7A 2F97A 3FZVA 3N5LA 3OO6A 4JDFA 1ZJLA 4KR5A 3PMXA 2H98A 3A3CA 1H3DA 3F11A 3FV1A 3PUXE 4IY5A 1Y1MA 2V84A 4ELPA 1Y3QA 2RCAA 4KYSA 1A99A 3PAMA 3T93B 4C1TA 4XKPA 2YPNA 1NKXA 1SI1A 4KQPA 1MXVA 4NF8B 1GR2A 4XKQA 3MP8A 2VHAA 4U23A 3QIMA 3LVUA 1MM6A 1R6ZA 4POWA 4EF1A 4PE5B 2I3VA 2XXRA 4R2FA 2Q2AA 3CI8A 4OFJA 1AIVA 1POY1 1FTKA 1LBBA 4OERA 2Q2CA 1A54A 1ATGA 2DWIA 3EPEA 1A7LA 1WODA 4Q0CA 3FUZA 3TTNA 1URDA 5K2XA 3T22A 1QULA 1TT1A 1LCTA 5LOMA 4F2QA 2Y7RA 3KJTA 1NNTA 3O2AA 3W9VA 4EQ9A 2P1SA 1B0LA 1OQGA 2Y7IA 4OHNA 3U94A 4OWDA 3DRJA 2DVCA 2NVUB 1NMUA 2FNCA 4L17A 1IXGA 2OK2A 4LATA 1M5DA 3DP4A 3SEVA 3O6IA 2QS1A 3G7WA 3TTLA 3QK6A 3WAFA 1FQDA 4QFPA 3UGWA 4LQ2A 2PYYA 5I57B 1FW0A 2X7QA 2ZNSA 1A40A 4OEVA 3TKDA 1CB6A 1JETA 3VFJA 1B52A 2XXQA 3Q27A 2RF1A 1HSEA 2QRYA 1IEJA 1MXUA 1B3LA 1FQCA 2QS2A 2WOLA 4LZ7A 1AL3A 1B5IA 1S7YA 4RK2A 1LSTA 2A5TB 4Q8RA 4LA9A 4O3BA 2GHBA 3HN0A 2DS9A 5HBCA 3C4MA 3KOSA 3RN8A 4XIGQ 3UK4A 4AQ4A 4PFTA 3M3FA 4DZ1A 2DE2A 3Q29A 4RNSA 3VLVA 1R1NA 1D3KA 4G8NA 1BIYA 4AB5A 1XVYA 4IO5A 2O1LA 3OMBA 2F5XA 5ISUA 3GZGA 3KZGA 4NF8A 4OVJA 3N94A 1URGA 2B65A 5CBRA 1SDXA 1ZKBA 3C31A 4OMBA 2Y84A 1P99A 4KFQA 1H44A 3PMWA 3QYTA 3GBAA 5JEIA 4QFKA 4KI0E 4YKJA 1AMFA 2XX7A 2QMXA 5DYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJZ A;  4DXC A;  3G3G A;  3KFM A;  4QHQ A;  2ESN A;  2Y7P A;  4G68 C;  2DWA A;  2QMW A;  3IOR A;  3LSF B;  2ZYM A;  2QL3 A;  1I6A A;  4YKP A;  3ZKK A;  2D3I A;  2XX9 A;  1WVJ A;  5AA2 D;  4I62 A;  3D4C A;  2A5S A;  1JVX A;  3GXA A;  2ANJ A;  1B0H A;  3N6U A;  5CMC A;  5H8Q A;  3DP8 A;  4ZE8 A;  1FTJ A;  2OWS A;  3OXN A;  4I1D A;  4F2O A;  1MXY A;  1MDP 1;  1SW4 A;  2XXH A;  4G2Z A;  4QSC A;  4F3G A;  1M5B A;  3TEP A;  4HW8 A;  1LB9 A;  1BTJ A;  3IAZ A;  3CFL A;  4OEN A;  3T66 A;  2M8C A;  5DVJ A;  1SW2 A;  1GGG A;  3IB0 A;  5I56 A;  5L9O A;  1IXH A;  5B7D A;  5K2Y A;  4AB6 A;  4ELO A;  5I59 B;  4DCY A;  4U4X A;  1SYH A;  4HCY A;  1CE2 A;  1NH7 A;  5F7V A;  5TP9 B;  1LBC A;  3SEW A;  1NNF A;  2P2A A;  3FAT A;  3V89 B;  1QJM A;  4OXV A;  4X1D A;  1OQH A;  4PFY A;  3H4Z A;  3QXM A;  2V3Q A;  2RC7 A;  4O3C A;  4ZZA A;  2O68 A;  4GL8 A;  5KCJ B;  4ZE9 A;  2ZXT A;  1DOT A;  1PB9 A;  3DRK A;  1F9B A;  2I4C A;  4NF6 A;  1VFE A;  4R6Y A;  3ILU B;  2D5W A;  3PGF A;  4JB7 A;  4ZEC A;  1B7H A;  4RYA A;  2ZYK A;  1B58 A;  5KDT A;  1P1W A;  3PPO A;  4GD5 A;  1MH4 A;  1RYX A;  3Q25 A;  5IKB A;  3RYB A;  4M4G A;  2V25 A;  4QSD A;  5L9M A;  3H6U A;  1OLC A;  3KN8 A;  3T9U A;  3HHG A;  1P1U A;  3K1M A;  3DRG A;  4YU0 A;  3MUQ A;  5ELV A;  4M1V A;  1N84 A;  4IY6 A;  1MS7 A;  2Q89 A;  1XVX A;  3I6V A;  1TXF A;  4E0X A;  1UIV A;  4FAT A;  4YMA A;  3SER A;  5H8N B;  4QFO A;  1GTK A;  5CM6 A;  5I58 B;  3TPA A;  3CHG A;  1LAF E;  1NH8 A;  4EDP A;  2H4I A;  2HAV A;  3JV9 A;  4LZ5 A;  5AA2 B;  1EZP A;  2UVI A;  3KOT A;  3V83 A;  4ELR A;  4E0W A;  3O9P A;  4P0G A;  4R74 A;  1TFA A;  4RPN A;  1D4N A;  1NL5 A;  2CZL A;  2Y7K A;  3C36 A;  4POX A;  3T9X B;  3FVN A;  4PFW A;  3RYA A;  2H5Y A;  1KWH A;  3I3V A;  1HSL A;  3SEU A;  4G8H A;  5IAI A;  4F3P A;  2H9B A;  4G68 A;  3IL1 B;  5I2N B;  3A09 A;  1PB8 A;  3O97 A;  1B51 A;  1P1N A;  2XXU A;  5EYF A;  1MXW A;  5TPA A;  5CI5 A;  3CFZ A;  3KJ7 A;  3IOT A;  3Q26 A;  4NF4 A;  1ZLQ A;  3VXB A;  3ZSF A;  4BDO A;  4RK9 A;  2HCA A;  3L6G A;  4HCW A;  4RPO A;  1MPD A;  1QUJ A;  1I69 A;  3FIR A;  5L8D A;  3FVG A;  5H8F B;  3PUY E;  5AA4 B;  4ZEB A;  2DQV A;  2V3T A;  2E0S A;  5DT6 A;  3KG2 A;  2PT2 A;  3JYR A;  3KN3 A;  1QKA A;  1SD3 A;  2R71 A;  2CMO A;  3PPN A;  3U72 A;  4F3B A;  1M5C A;  3Q28 A;  2REG A;  2B4M A;  4GXA A;  3CSB A;  4U4S A;  4H8I A;  2REJ A;  4TLL B;  2F7C A;  3KBR A;  1URS A;  2QPQ A;  2Q88 A;  3RTW B;  3T9H B;  1TWY A;  5F1Q A;  3IB2 A;  4IGR A;  4H8J A;  4DXU A;  1B4H A;  3VE1 B;  1UQW A;  4I8C A;  2DSF A;  3IX1 A;  3K6V A;  3ODB A;  5KZT A;  3IJX B;  4LQ5 A;  4XTC Q;  3FJM A;  3S9E A;  1B5J A;  3MVY A;  4GRK A;  4MFI A;  2FA7 A;  2HFB A;  3D4G A;  2F34 A;  3FJG A;  1D9V A;  3MZ9 A;  4U1O A;  2ONK E;  3TEL A;  3U8Q A;  5FHM A;  2GFE A;  3UIF A;  3KGC A;  5ITP A;  4I9D A;  3VLU A;  1J1N A;  3M8U A;  4H5G A;  4QSE A;  5B70 A;  5HM4 B;  3MPK A;  1EU8 A;  1QVS A;  4O3A A;  5DEX A;  2O69 A;  1IQ7 A;  4NTL A;  4G8M A;  3IJO B;  1YTV A;  4ESW A;  3CFX A;  4EXL A;  3MPL A;  4ZZE A;  4XKR A;  1B1X A;  1MM7 A;  3H06 B;  1SW1 A;  2ONR A;  4YB5 A;  2I0C A;  1MY2 A;  1S9T A;  3ILT B;  3K2D A;  2VD2 A;  4Z7E A;  3E3K A;  2UVG A;  3OSQ A;  3MVZ A;  3R7X A;  3TTR A;  3TQL A;  3IO4 A;  1MQG A;  1A8E A;  4N07 A;  2R9J A;  2E1S A;  4WKM A;  1UTB B;  4H6D A;  5CMB A;  1ZBM A;  1Z7M E;  2XXX A;  4X9T A;  3CRB A;  5FTI A;  1PEB A;  1Y4T A;  1MQD A;  2AIX A;  3DEL B;  3K00 A;  2HEU A;  4Q30 B;  5EHS A;  5H8H B;  4F29 A;  3DM0 A;  3FXQ A;  3MVX A;  2OWT A;  4ELQ A;  4NF5 A;  1MG1 A;  4JSD A;  1BP5 A;  2F35 A;  4NF5 B;  5ICQ A;  4GOT A;  1H43 A;  4F31 B;  3H6T A;  4OQO A;  5A5X A;  5H8H A;  4ZEF A;  2PBW A;  4EXK A;  3OO9 A;  4TOZ A;  1RKM A;  4GL0 A;  4RXL A;  3TQW A;  3FJ7 A;  3PD9 A;  2UYF A;  4H5F A;  4LZ8 A;  1UTH B;  1ZMG A;  2O6A A;  1US4 A;  2DWH A;  1JNF A;  3PUZ E;  3SET A;  1MDQ A;  1LAH E;  2Z8E A;  2XXY A;  3G3H A;  3H7M A;  3RT6 B;  3UOR A;  1B9J A;  5I2K A;  4LUB A;  2GRV A;  2DVZ A;  4Z0I A;  3KSX A;  3PUV E;  2HZK A;  5BUU A;  2Y7W A;  4THI A;  2I58 A;  1ELJ A;  2IEE A;  1FQB A;  1FCK A;  4FE8 A;  4MLQ A;  1H76 A;  3BKI B;  4GLI A;  4NF4 B;  3LR1 A;  4YAH X;  3VV5 A;  4C0R A;  1JW5 A;  4ZS9 A;  3H3G A;  3SEY A;  3B7D A;  2ZMB A;  4G68 B;  5I2N A;  1O7T A;  4QRZ A;  1L5T A;  3WAE A;  4F39 A;  2UVH A;  1JVY A;  1GV8 A;  3RNN A;  4ESX A;  1XHY A;  2Q8J A;  4FEC A;  2LAO A;  3RUM A;  2UXA A;  4U1Z A;  4OEU A;  1DMB A;  3PD8 A;  1Y1Z A;  3DRH A;  1Y9U A;  4GVO A;  1LB8 A;  4R9G A;  1II5 A;  1Y3N A;  2Z22 A;  3TTK A;  2AL4 A;  4DIG A;  4RY1 A;  4LP2 B;  1LFI A;  4ECF A;  3QSL A;  4KHZ E;  4DXB A;  1LFH A;  3RQT A;  1B3H A;  4NED A;  4HS7 A;  2OZZ A;  3RY3 A;  4YB7 A;  4BDL A;  2HQ0 A;  3C9H A;  3MAM A;  4FED A;  2KLF A;  3K01 A;  2UVJ A;  4DDD A;  1B40 A;  2I49 A;  4FAJ A;  2QS4 A;  1BLF A;  3LUY A;  4EF2 A;  1EH3 A;  2XXV A;  1OMP A;  2X26 A;  3MJN A;  5ICT A;  2I3W A;  4F1Y A;  2G29 A;  2OLB A;  1YAE A;  2DYX A;  2PX1 A;  2Z8D A;  4IO7 A;  2P0S A;  5JK4 A;  1N0T A;  3H6W A;  3S4U A;  1MXZ A;  1OVT A;  3R26 A;  3OOA A;  4F19 A;  5I84 A;  1PBP A;  3N26 A;  5AA1 A;  3G3I A;  1R9L A;  1MPB A;  2XXI A;  2XXT A;  1Y3P A;  5I2K B;  2QS3 A;  3MW0 A;  2GHA A;  2HXW A;  3BBR A;  3K4U A;  2WOP A;  3P7I A;  3UP9 A;  3C35 A;  3K6W A;  4KPT A;  5TPA B;  1VSO A;  3BFU A;  4MBP A;  3O28 A;  4IO2 A;  1AOV A;  2I4B A;  4IO4 A;  1FQE A;  2R6G E;  3LSW A;  3IOV A;  2F6P A;  1B7U A;  4FIM A;  4PET A;  1Y20 A;  1N3X A;  4BDM A;  2VP1 A;  3UA8 A;  1B3G A;  3V8X B;  4TLM B;  2F7B A;  5CMK A;  5I56 B;  3RPW A;  3S9N C;  2B3B A;  4UA8 A;  2RCB A;  1A8F A;  1GVC A;  3SDF A;  3K6X A;  5J1D A;  5FTH A;  1SYI A;  1M5F A;  3I5O A;  1Y4C A;  2XX8 A;  1B32 A;  1UTB A;  3E13 X;  3FV2 A;  3CIJ A;  3N6T A;  4FEB A;  1B5H A;  4BLA A;  4IO3 A;  1ZTY A;  2G93 A;  3FGS A;  3M3L A;  1NFT A;  1XT8 A;  4QF9 A;  3K6U A;  4HTG A;  1Q1K A;  5FHN A;  2OCU A;  5FHO A;  3MWB A;  1MQI A;  3VVE A;  3ONM A;  3KN7 A;  2RIN A;  1B4Z A;  3H03 A;  2I0B A;  3E9X A;  3K02 A;  3U1O A;  3ZKL A;  4QFN A;  4FOR A;  4EQ7 A;  1T0K A;  1P1O A;  1N04 A;  4QFL A;  2THI A;  4IO6 A;  1N7X A;  4PQJ A;  1DTZ A;  5DEX B;  3U93 A;  3FVO A;  3C34 A;  1POT A;  5H8S A;  3SES A;  1AH5 A;  1MY3 A;  3GBB A;  1LAX A;  3S2V A;  1XC1 A;  1PBQ A;  2H99 A;  3C32 A;  4XKN A;  1JEV A;  1IXC A;  4ZDM A;  1XOC A;  5AA3 A;  3CSG A;  2NXO A;  3TOD A;  3VVF A;  2X7P A;  4GXS B;  5M2V A;  1UTH A;  4YB6 A;  3LSX A;  3O6P A;  3QUF A;  4DE8 A;  4P0I A;  3EN3 A;  4ZED A;  2O51 A;  3OEN A;  4JWY A;  2Z8F A;  3E4R A;  3G3F A;  4X48 A;  2XD3 A;  1USY E;  4IB2 A;  5A5X B;  3U92 A;  4F22 A;  2XXW A;  4OET A;  3ECR A;  1VFD A;  1QUK A;  2FYI A;  4WEP A;  2D21 A;  1US5 A;  1JEU A;  3R6U A;  3TCF A;  3K0V A;  1FTO A;  2O1M A;  3C33 A;  3TMG A;  3VLW A;  1B2H A;  1FQA A;  3LC8 A;  1MY0 A;  3RT8 A;  1QUI A;  1IIW A;  3USD A;  5AE4 A;  1WDN A;  4F1U A;  1ANF A;  2F8D A;  1XS5 A;  5CRY A;  5H8Q B;  3TAJ A;  4MLV A;  3PMV A;  2F36 A;  1O64 A;  3HHF A;  3M3K A;  4Q5T A;  4YZZ A;  1SI0 A;  3B6Q A;  2PVU A;  1SW5 A;  3W15 C;  1MQJ A;  1OVB A;  3HST A;  3VXC A;  1DPP A;  4G77 A;  4KYD A;  4EUO A;  5TU0 A;  2O7U A;  1LFG A;  3IB1 A;  4JSO A;  1B1H A;  3DRI A;  1I6Q A;  1YCJ A;  3DP6 A;  2F78 A;  3OEK A;  4K3F A;  1VR5 A;  4N13 A;  3O66 A;  3OO7 A;  4NWC A;  1MH3 A;  2V93 A;  3T9V A;  1B3F A;  4GWO A;  3MQ9 A;  2QJE A;  4DCX A;  2I6E A;  1VE4 A;  1OIB A;  4F18 A;  4R2B A;  3CVG A;  3JZJ A;  1FQF A;  2DOJ A;  1SQY A;  3FVK A;  1P1Q A;  2DE4 A;  4R9F A;  3EQ1 A;  1NNK A;  4MF3 A;  5DTB A;  3MZB A;  3KSJ A;  2RC8 A;  3UN6 A;  3PPQ A;  5AA2 A;  2PMS A;  2QSX A;  3OEM A;  4F1V A;  4TQU Q;  1PDA A;  4FJP A;  5DVF A;  3FD3 A;  5I58 A;  4ZEI A;  1H45 A;  2W7Y A;  4YKK A;  3K1N A;  3MC2 A;  3O6H A;  4JXI A;  4NWD A;  4R72 A;  2GH9 A;  2ZYN A;  3W9W A;  5L9S A;  4BDQ A;  3G3K A;  3THI A;  5CBS A;  1BKA A;  2ONS A;  4LVQ A;  1B7Z A;  3SKP A;  4IGT A;  4YMB A;  3TCH A;  3MBP A;  3VDF A;  4GF8 A;  2AYS A;  2B3F A;  1SVX B;  2DE3 A;  2F7A A;  2OJT A;  1B05 A;  4R73 A;  4U22 A;  3TYH A;  4BDN A;  1MRP A;  4PFU A;  1D9Y A;  2PT1 A;  2ZYO A;  3AXF A;  4GFR A;  4C1U A;  4ZEK A;  5KDT B;  4EQB A;  1MPC A;  1MY1 A;  2VOZ A;  2O7I A;  2I48 A;  4P11 A;  4U21 A;  5DVI A;  5AA4 A;  5H8F A;  3TUS A;  1DPE A;  2XHD A;  4NF6 B;  4U2R A;  3EHU A;  2NUV A;  5KCJ A;  1FTM A;  1SBP A;  5BWJ A;  1EZO A;  1MQH A;  3IR1 A;  2HZL A;  3IK6 B;  3MP1 A;  4WED A;  4KCD A;  3KEI A;  3S9M C;  3MZ1 A;  3BFT A;  2NOO A;  4OFO A;  4MH5 A;  5HPQ A;  3RGY A;  3HPI A;  2XXP A;  3QUJ A;  5CMM A;  5I59 A;  1HSJ A;  4DLD A;  2BJJ X;  3MP6 A;  1OLA A;  3IOW A;  4PP0 A;  3DLN A;  1JQF A;  3V5A A;  1USY H;  1QW0 A;  2ABH A;  4GQO A;  3OEL A;  5CC2 A;  1MY4 A;  2DP8 A;  3LSL A;  1B6H A;  1ZIU A;  2H25 A;  3HCQ A;  3TCG A;  3RLF E;  3TTM A;  4WXJ A;  3L6H A;  4JWX A;  1IXI A;  4LON B;  1PC3 A;  1S50 A;  1R9Q A;  3LBS A;  4G4P A;  4ONY A;  4ISU A;  3B6W A;  2WOK A;  5H8N A;  4RA1 A;  3MVW A;  1Q35 A;  1IIT A;  3OSR A;  1UIU A;  2F6G A;  4JBZ A;  3S9L C;  3QAX A;  1N3W A;  2DWJ A;  3CG3 A;  3VVD A;  1RYO A;  4XXU A;  4OYV A;  2ALU A;  3TDJ A;  4F3S A;  1LCF A;  2AL5 A;  2DXY A;  4KYE A;  3OO8 A;  3TFL A;  4R6H A;  1DSN A;  4KCC A;  1EZ9 A;  2B4L A;  2WKY A;  4KD5 A;  4UAC A;  2O84 X;  2RKM A;  3FTO A;  2ZNU A;  3EHS A;  3H6V A;  3PPP A;  4H65 A;  4NMY A;  4OZ9 A;  1YPN A;  4OES A;  1QKB A;  2YLN A;  4ND9 A;  1N76 A;  3GLB A;  4YIC A;  2IA4 A;  1JW1 A;  3CG1 A;  2UYE A;  1A55 A;  4R6K A;  2RC9 A;  2XD2 A;  3PUW E;  4YKI A;  1O63 A;  4BDR A;  3O6G A;  4GIZ A;  1B46 A;  2Z23 A;  1LLS A;  5TP9 A;  5JTY A;  3FXR A;  2HAU A;  2A5T A;  3DRF A;  1Z7N E;  3PU5 A;  3FAS A;  3PV0 E;  5ITO A;  2Q9T A;  2VD3 A;  3O29 A;  1M5E A;  1PB7 A;  1IZ1 A;  1LGB C;  1JW4 A;  2V3U A;  3EF7 A;  3FXU A;  3HO7 A;  3IOU A;  4R75 A;  4JWO A;  5JTY B;  2VGQ A;  4OTE A;  2NWJ A;  1IUD A;  4H1X A;  3A3U A;  1I6B A;  4H67 A;  3B6T A;  5I57 A;  3IO6 A;  3T96 B;  1NNP A;  1MXX A;  1TFD A;  2DXR A;  3CR9 A;  4N6P A;  2YJP A;  3G3J A;  1N7W A;  4H0W A;  3ZS6 A;  1B3E A;  5EHM A;  3PPR A;  2OBG A;  2ZNT A;  3RTF B;  1ZU0 A;  1LAG E;  3HV1 A;  3K1P A;  4NE4 A;  1FTL A;  3TZA A;  4OFL A;  1DTG A;  4X1B A;  3SEX A;  3EHT A;  3OD7 A;  2F97 A;  3FZV A;  3N5L A;  3OO6 A;  4JDF A;  1ZJL A;  4KR5 A;  3PMX A;  2H98 A;  3A3C A;  1H3D A;  3F11 A;  3FV1 A;  3PUX E;  4IY5 A;  1Y1M A;  2V84 A;  4ELP A;  1Y3Q A;  2RCA A;  4KYS A;  1A99 A;  3PAM A;  3T93 B;  4C1T A;  4XKP A;  2YPN A;  1NKX A;  1SI1 A;  4KQP A;  1MXV A;  4NF8 B;  1GR2 A;  4XKQ A;  3MP8 A;  2VHA A;  4U23 A;  3QIM A;  3LVU A;  1MM6 A;  1R6Z A;  4POW A;  4EF1 A;  4PE5 B;  2I3V A;  2XXR A;  4R2F A;  2Q2A A;  3CI8 A;  4OFJ A;  1AIV A;  1POY 1;  1FTK A;  1LBB A;  4OER A;  2Q2C A;  1A54 A;  1ATG A;  2DWI A;  3EPE A;  1A7L A;  1WOD A;  4Q0C A;  3FUZ A;  3TTN A;  1URD A;  5K2X A;  3T22 A;  1QUL A;  1TT1 A;  1LCT A;  5LOM A;  4F2Q A;  2Y7R A;  3KJT A;  1NNT A;  3O2A A;  3W9V A;  4EQ9 A;  2P1S A;  1B0L A;  1OQG A;  2Y7I A;  4OHN A;  3U94 A;  4OWD A;  3DRJ A;  2DVC A;  2NVU B;  1NMU A;  2FNC A;  4L17 A;  1IXG A;  2OK2 A;  4LAT A;  1M5D A;  3DP4 A;  3SEV A;  3O6I A;  2QS1 A;  3G7W A;  3TTL A;  3QK6 A;  3WAF A;  1FQD A;  4QFP A;  3UGW A;  4LQ2 A;  2PYY A;  5I57 B;  1FW0 A;  2X7Q A;  2ZNS A;  1A40 A;  4OEV A;  3TKD A;  1CB6 A;  1JET A;  3VFJ A;  1B52 A;  2XXQ A;  3Q27 A;  2RF1 A;  1HSE A;  2QRY A;  1IEJ A;  1MXU A;  1B3L A;  1FQC A;  2QS2 A;  2WOL A;  4LZ7 A;  1AL3 A;  1B5I A;  1S7Y A;  4RK2 A;  1LST A;  2A5T B;  4Q8R A;  4LA9 A;  4O3B A;  2GHB A;  3HN0 A;  2DS9 A;  5HBC A;  3C4M A;  3KOS A;  3RN8 A;  4XIG Q;  3UK4 A;  4AQ4 A;  4PFT A;  3M3F A;  4DZ1 A;  2DE2 A;  3Q29 A;  4RNS A;  3VLV A;  1R1N A;  1D3K A;  4G8N A;  1BIY A;  4AB5 A;  1XVY A;  4IO5 A;  2O1L A;  3OMB A;  2F5X A;  5ISU A;  3GZG A;  3KZG A;  4NF8 A;  4OVJ A;  3N94 A;  1URG A;  2B65 A;  5CBR A;  1SDX A;  1ZKB A;  3C31 A;  4OMB A;  2Y84 A;  1P99 A;  4KFQ A;  1H44 A;  3PMW A;  3QYT A;  3GBA A;  5JEI A;  4QFK A;  4KI0 E;  4YKJ A;  1AMF A;  2XX7 A;  2QMX A;  5DYH A; 
#chains in the Genus database with same CATH topology
 4RJZ A;  2ZYM A;  2QL3 A;  1I6A A;  2Y5L A;  1WVJ A;  4I62 A;  2A5S A;  3N6U A;  5CMC A;  4ZE8 A;  4I1D A;  4F2O A;  2XXH A;  4QSC A;  1M5B A;  4HW8 A;  3IAZ A;  4OEN A;  5L9O A;  1SW2 A;  5B7D A;  4HCY A;  2FHY A;  2P2A A;  4X1D A;  4PFY A;  3H4Z A;  4PC9 A;  4O3C A;  4ZZA A;  1LBY A;  4ZE9 A;  1DOT A;  2CEY A;  1F9B A;  1INP A;  1VFE A;  4RYA A;  1P1W A;  3PPO A;  3RYB A;  3LUZ A;  4GWU A;  4YU0 A;  4OVQ A;  1XVX A;  1FPD A;  4FAT A;  3SER A;  5H8N B;  1NH8 A;  4LZ5 A;  1EZP A;  5IZZ A;  3V83 A;  4ELR A;  4R74 A;  1TFA A;  1D4N A;  3C36 A;  4PFW A;  3I3V A;  2H5Y A;  4P1E A;  2VPN A;  1MXW A;  4PGN A;  3Q26 A;  4NF4 A;  1FPJ A;  1ZLQ A;  3VXB A;  2FBP A;  4BDO A;  4RK9 A;  1MPD A;  1I69 A;  4QBA A;  3PUY E;  2DQV A;  2PT2 A;  1SD3 A;  2R71 A;  4F3B A;  3Q28 A;  2B4M A;  3CSB A;  3SZP A;  3RTW B;  1FPB A;  2Y5K A;  3VE1 B;  1NUY A;  4I8C A;  2DSF A;  4PE3 A;  2F3D A;  5KZT A;  3IJX B;  4HE1 A;  3S9E A;  3FJM A;  1B5J A;  5AA2 B;  4U1O A;  3D4G A;  3FJG A;  2ONK E;  2GFE A;  3UIF A;  3KGC A;  5I7I A;  4H5G A;  1Q9D A;  1QVS A;  5DEX A;  2XWV A;  4XKR A;  1MM7 A;  2ONR A;  3OSQ A;  3R7X A;  4N07 A;  2XXX A;  3CRB A;  2FVZ A;  1PEB A;  5H8H B;  3MVX A;  4NF5 A;  1MG1 A;  2F35 A;  2PFY A;  4F31 B;  4OVP A;  1G0I A;  1RKM A;  3TQW A;  5F24 A;  3PD9 A;  4MEV A;  4LZ8 A;  1UTH B;  1MDQ A;  2Z8E A;  3RT6 B;  5I2K A;  4LUB A;  3KSX A;  1NV5 A;  4JVI A;  2Y7W A;  5EYH A;  4N4U A;  1FPG A;  3BKI B;  4YAH X;  1LEV A;  1DBZ A;  2ZMB A;  5I2N A;  1O7T A;  4OVR A;  3WAE A;  4F39 A;  3RPL A;  1XHY A;  2Q8J A;  1Y1Z A;  1LB8 A;  1II5 A;  4N81 A;  4LP2 B;  4NG7 A;  3MYU A;  2OZZ A;  3RY3 A;  4DDD A;  2I49 A;  4OVT A;  4EF2 A;  2XWK A;  4F1Y A;  1YAE A;  2DYX A;  5I84 A;  1OVT A;  1Y3P A;  3BBR A;  3UP9 A;  3C35 A;  5TPA B;  4IO2 A;  1AOV A;  1FPL A;  4GWS A;  2F7B A;  5I56 B;  1FJ9 A;  2RCB A;  5FTH A;  1SYI A;  1M5F A;  5ET8 A;  3N6T A;  1B32 A;  4N8Y A;  3CIJ A;  1B5H A;  4GWX A;  4IO3 A;  3FGS A;  3M3L A;  1NFT A;  4QF9 A;  4HTG A;  5FHO A;  5FHN A;  3VVE A;  3E9X A;  3K02 A;  3U1O A;  4FOR A;  2THI A;  4QFL A;  1LBV A;  1IMA A;  1DTZ A;  2ZZW A;  3FVO A;  3C34 A;  3GBB A;  2H99 A;  4XKN A;  1JEV A;  1XOC A;  2X7P A;  4YB6 A;  3O6P A;  4P0I A;  3OEN A;  3E4R A;  5A5X B;  4OET A;  2FYI A;  1QUK A;  3ISP A;  3VLW A;  1FQA A;  1ANF A;  5H8Q B;  3PMV A;  1O64 A;  4Q5T A;  5T3J A;  2PVU A;  1DPP A;  4G77 A;  3DRI A;  1I6Q A;  3DP6 A;  3OEK A;  1VR5 A;  2P3V A;  3OO7 A;  3MQ9 A;  2QJE A;  5FBP A;  3JZJ A;  1P1Q A;  3UN6 A;  4FJP A;  4ZEI A;  2W7Y A;  4X04 A;  2GH9 A;  1B7Z A;  3SKP A;  4YMB A;  3TCH A;  4U22 A;  3TYH A;  4C1U A;  4GFR A;  2VOZ A;  3IR1 A;  2HZL A;  3IK6 B;  4WED A;  3KEI A;  1RDZ A;  3HPI A;  3IOW A;  1JQF A;  1QW0 A;  3OEL A;  2DP8 A;  1PC3 A;  5H8N A;  4G4P A;  3MVW A;  1IIT A;  4JBZ A;  1UIU A;  4O7I A;  3VVD A;  4XXU A;  4OYV A;  2ALU A;  1LCF A;  2DXY A;  2B4L A;  3EHS A;  3PPP A;  4OES A;  3NOH A;  4ND9 A;  2BJI A;  1JW1 A;  4H46 A;  1O63 A;  1NV2 A;  4GIZ A;  5ITO A;  3FAS A;  3O29 A;  5EQA A;  1M5E A;  1IZ1 A;  2V3U A;  3FXU A;  4JWO A;  4H1X A;  2CZK A;  4GWZ A;  4P1L A;  3KC1 A;  4H67 A;  1KA1 A;  2YJP A;  3G3J A;  3ZS6 A;  5DW8 A;  2ZNT A;  4N17 A;  3K1P A;  4NE4 A;  4OFL A;  4JDF A;  4KR5 A;  4IY5 A;  1Y1M A;  2RCA A;  1A99 A;  3T93 B;  4C1T A;  4NAP A;  4EF1 A;  2WBB A;  1MM6 A;  4MNP A;  1R6Z A;  2XXR A;  3B8B A;  2Q2C A;  1ATG A;  5K2X A;  4XEQ A;  1QUL A;  4F2Q A;  4EQ9 A;  1B0L A;  2Y7I A;  4OHN A;  2DVC A;  3O6I A;  3TTL A;  1FQD A;  2PYY A;  2R8T A;  1B52 A;  2XXQ A;  2RF1 A;  3QMF A;  1B3L A;  1FQC A;  1B5I A;  4Q8R A;  3FBP A;  2DS9 A;  3C4M A;  3M3F A;  2DE2 A;  4RNS A;  4N6D A;  4G8N A;  1VDW A;  1XVY A;  4IO5 A;  2O1L A;  3OMB A;  3GZG A;  1ZKB A;  4OMB A;  4KFQ A;  3PMW A;  1EYI A;  4YKJ A;  2Y7P A;  4G68 C;  2DWA A;  2QMW A;  3ZKK A;  2D3I A;  4MCO A;  2P3N A;  3GXA A;  5H8Q A;  3DP8 A;  3T1B A;  1FTJ A;  3OXN A;  1MXY A;  3TEP A;  3T66 A;  5K2Y A;  5I59 B;  4U4X A;  5TP9 B;  1LBC A;  4PF6 A;  4GL8 A;  2ZXT A;  4R6Y A;  1B7H A;  1YYZ A;  1MH4 A;  3IFA A;  3Q25 A;  5IKB A;  4M4G A;  4QSD A;  5L9M A;  4E0W A;  3KN8 A;  3T9U A;  3HHG A;  1P1U A;  5ELV A;  1FPE A;  4O7M A;  4M1V A;  3I6V A;  1TXF A;  4YMA A;  4JVC A;  3TPA A;  1LAF E;  2H4I A;  2UVI A;  4P0G A;  2CZL A;  4POX A;  1KWH A;  2H9B A;  1PB8 A;  1P1N A;  5TPA A;  3CFZ A;  5H8F B;  4P9K A;  2V3T A;  2E0S A;  4PDH A;  1QKA A;  3PPN A;  3U72 A;  1NV3 A;  4I40 A;  4U4S A;  1URS A;  1FBG A;  2QPQ A;  3IB2 A;  4H8J A;  4DXU A;  1UQW A;  3K6V A;  4LQ5 A;  4XTC Q;  4MFI A;  1D9V A;  5FHM A;  3VLU A;  3M8U A;  5EQ9 A;  1EU8 A;  2O69 A;  4NF0 A;  1IQ7 A;  4G8M A;  1YTV A;  3CFX A;  2I0C A;  1S9T A;  2UVG A;  3TTR A;  3IO4 A;  2ZZX A;  5CMB A;  2E1S A;  1UTB B;  4H6D A;  1Z7M E;  2AIX A;  3K00 A;  5EHS A;  3DM0 A;  2OWT A;  1LFH A;  4NF5 B;  1BP5 A;  1H43 A;  5H8H A;  4GL0 A;  3FJ7 A;  3B50 A;  2DWH A;  2XXK A;  1FBD A;  1RDY A;  4P47 A;  3H7M A;  3UOR A;  1B9J A;  2GRV A;  2HZK A;  2IEE A;  3VLV A;  1FCK A;  4FE8 A;  3VDF A;  4C0R A;  1JW5 A;  3B7D A;  1K9Y A;  3RNN A;  1JVY A;  4PFI A;  4ESX A;  4FEC A;  3RUM A;  4U1Z A;  4OEU A;  4R9G A;  4ECF A;  4RY1 A;  4YB7 A;  4FED A;  3K01 A;  4FAJ A;  1EH3 A;  2XXV A;  3MJN A;  5ICT A;  4MX6 A;  2OLB A;  4GWY A;  4IO7 A;  3H6W A;  1MXZ A;  3OOA A;  1SPI A;  3N26 A;  2QS3 A;  3K4U A;  3P7I A;  3K6W A;  1VSO A;  4MBP A;  3O28 A;  4IO4 A;  1FQE A;  2R6G E;  3IOV A;  4FIM A;  4PET A;  1Y20 A;  3UA8 A;  5CMK A;  3RPW A;  3SDF A;  2QVR A;  5J1D A;  2XX8 A;  3I5O A;  4FEB A;  2WX9 A;  1ZTY A;  3FXB A;  3K6U A;  4NHB A;  4NX1 A;  3MWB A;  1MQI A;  1B4Z A;  3H03 A;  2I0B A;  4O94 A;  3ZKL A;  4IO6 A;  4PQJ A;  5DEX B;  4I3E A;  4PFR A;  4XF5 A;  3S2V A;  1XC1 A;  3C32 A;  3CSG A;  3VVF A;  4GXS B;  3QUF A;  3EN3 A;  4ZED A;  2O51 A;  2Z8F A;  4X48 A;  3G3F A;  4IB2 A;  3ECR A;  2D21 A;  3R6U A;  1FTO A;  3TMG A;  1B2H A;  1MY0 A;  4PF8 A;  1G0H A;  1XS5 A;  3HHF A;  4GBV A;  4YZZ A;  3B6Q A;  3W15 C;  1OVB A;  3HST A;  1B1H A;  1FRP A;  3KBZ A;  4GWO A;  4R2B A;  3CVG A;  1FPI A;  3FVK A;  2DE4 A;  1NNK A;  3KSJ A;  2PMS A;  1KZ8 A;  5DVF A;  3FD3 A;  4MAG A;  3K1N A;  4R72 A;  2ZYN A;  3W9W A;  5L9S A;  3THI A;  3A29 A;  4Z0I A;  2B3F A;  4BDN A;  1B05 A;  2ZYO A;  4ZEK A;  5DVI A;  2I48 A;  5H8F A;  2XHD A;  1FTM A;  1EZO A;  5BWJ A;  2CEX A;  3MP1 A;  4KCD A;  3MZ1 A;  3BFT A;  3QUJ A;  5CMM A;  1NV7 A;  1OLA A;  4PP0 A;  3V5A A;  3LSL A;  4MNC A;  1ZIU A;  4WXJ A;  4JWX A;  4LON B;  1R9Q A;  1S50 A;  3LBS A;  4RA1 A;  1Q35 A;  3OSR A;  2DWJ A;  1RYO A;  2AL5 A;  3TFL A;  2WYK A;  4KCC A;  2WKY A;  4UAC A;  2ZNU A;  4OZ9 A;  3GLB A;  2IA4 A;  1A55 A;  2XD2 A;  1B46 A;  3PV0 E;  2Q9T A;  4H45 A;  1LGB C;  3EF7 A;  1I6B A;  5I57 A;  3IO6 A;  1NNP A;  2DXR A;  3CR9 A;  4H0W A;  3LV0 A;  1FBP A;  1LAG E;  2MKZ A;  3HV1 A;  2F97 A;  3N5L A;  3PMX A;  5LTC A;  2WYP A;  3IFC A;  3F11 A;  3FV1 A;  4LN5 A;  1NKX A;  1SI1 A;  4KQP A;  1GR2 A;  4XKQ A;  4U23 A;  2VHA A;  2QVV A;  2Q2A A;  1FTK A;  1A54 A;  1LCT A;  3KJT A;  1NNT A;  2P1S A;  1OQG A;  4PBQ A;  4GX4 A;  1NMU A;  4P3L A;  2OK2 A;  3QK6 A;  4FBP A;  1A40 A;  4OEV A;  3TKD A;  3VFJ A;  1MXU A;  1AL3 A;  4RK2 A;  2A5T B;  1DCU A;  4LA9 A;  5HBC A;  3KOS A;  4PFT A;  4DZ1 A;  5IZ1 A;  1BIY A;  4AB5 A;  5ISU A;  3N94 A;  1URG A;  5CBR A;  1SDX A;  3QYT A;  2VPO A;  3GBA A;  4X8R A;  4G61 A;  2XX7 A;  5DYH A;  4DXC A;  4QHQ A;  4JVD A;  3LSF B;  3IOR A;  4YKP A;  2XX9 A;  3D4C A;  2ANJ A;  1EYJ A;  4G2Z A;  1MDP 1;  4F3G A;  5DVJ A;  3CFL A;  2M8C A;  5I56 A;  3IB0 A;  4AB6 A;  4ELO A;  1SYH A;  1CE2 A;  1NH7 A;  5F7V A;  3SEW A;  3FAT A;  4NQ8 A;  1IMC A;  1QJM A;  4OXV A;  1OQH A;  2RC7 A;  2HXR A;  5KCJ B;  2PCR A;  3PGF A;  4ZEC A;  1B58 A;  4GD5 A;  1RYX A;  2V25 A;  1OLC A;  3K1M A;  3DRG A;  3MUQ A;  1MS7 A;  4E0X A;  1UIV A;  1NV6 A;  3CHG A;  5ET5 A;  2HAV A;  3O9P A;  4RPN A;  1CNQ A;  3RYA A;  1RDX A;  3SEU A;  5IAI A;  4GBW A;  5I2N B;  2PFZ A;  3A09 A;  2GQ1 A;  3ZSF A;  3L6G A;  3FIR A;  4ZEB A;  3KG2 A;  3JYR A;  3KN3 A;  2OX3 A;  1M5C A;  2REG A;  4GXA A;  4TLL B;  2F7C A;  3KBR A;  2Q88 A;  3T9H B;  5F1Q A;  4IGR A;  5ET6 A;  3ODB A;  4GRK A;  2FA7 A;  2HFB A;  2F34 A;  3TEL A;  3U8Q A;  3MZ9 A;  1NV4 A;  5HM4 B;  3E79 A;  4NTL A;  4ZZE A;  1B1X A;  3H06 B;  1SW1 A;  4YB5 A;  3ILT B;  2VD2 A;  4Z7E A;  3E3K A;  3MVZ A;  3TQL A;  1MQG A;  4WKM A;  2R9J A;  1ZBM A;  4X9T A;  5FTI A;  4F29 A;  3H6T A;  4OQO A;  5A5X A;  4ZEF A;  4EXK A;  3OO9 A;  4TOZ A;  4H5F A;  1ZMG A;  3SET A;  3G3H A;  5BUU A;  3PUV E;  1IMD A;  4DXB A;  4MLQ A;  1H76 A;  4NF4 B;  3VV5 A;  4ZS9 A;  3SEY A;  1L5T A;  2UVH A;  2UXA A;  1AWB A;  1DMB A;  3E78 A;  1Y3N A;  5I5P A;  2AL4 A;  1LFI A;  3QSL A;  1FBE A;  1B3H A;  4HS7 A;  4KXP A;  4BDL A;  2HQ0 A;  3MAM A;  2KLF A;  2UVJ A;  1B40 A;  1BLF A;  2CZH A;  3LUY A;  1OMP A;  2I3W A;  2Z8D A;  2P0S A;  3S4U A;  4F19 A;  1PBP A;  5AA1 A;  1MPB A;  2XXT A;  2GHA A;  3BFU A;  2F6P A;  4N91 A;  4TLM B;  4LAT A;  1Y4C A;  1UTB A;  3HFU A;  2G93 A;  1KA0 A;  3ONM A;  4PAK A;  2V4C A;  4EQ7 A;  1N04 A;  1P1O A;  2HPG A;  1FPF A;  1N7X A;  3U93 A;  3T0J A;  1PBQ A;  4ZDM A;  1NV0 A;  3TOD A;  1UTH A;  3LSX A;  2WBD A;  4JWY A;  1USY E;  3U92 A;  2XXW A;  4WEP A;  1US5 A;  1JEU A;  3TCF A;  5ET7 A;  4DI3 D;  2O1M A;  3C33 A;  3USD A;  3LC8 A;  5AE4 A;  1QUI A;  1IIW A;  2F8D A;  4GWW A;  5CRY A;  3TAJ A;  2F36 A;  3M3K A;  3VXC A;  4EUO A;  5TU0 A;  5EQ7 A;  4JSO A;  1JP4 A;  4DCX A;  4F18 A;  1SQY A;  5DTB A;  4PFB A;  3MZB A;  5AA2 A;  4OA4 A;  3PPQ A;  3OEM A;  5EYG A;  1PDA A;  4PAI A;  5IZ3 A;  5I58 A;  2JJK A;  4BDQ A;  3G3K A;  5CBS A;  1BKA A;  4HE0 A;  4IGT A;  3MBP A;  4GF8 A;  2F7A A;  2OJT A;  1SVX B;  4R73 A;  1MRP A;  4PFU A;  3AXF A;  5KDT B;  4EQB A;  4P11 A;  4NF6 B;  4U2R A;  3EHU A;  4UAB A;  1MQH A;  1LBZ A;  1YZ0 A;  3ROJ A;  3S9M C;  4MH5 A;  4OFO A;  3RGY A;  2XXP A;  5I59 A;  2WEF A;  2BJJ X;  3MP6 A;  4DLD A;  4MHF A;  3DLN A;  1USY H;  3RYD A;  1MY4 A;  1B6H A;  2H25 A;  3HCQ A;  3TTM A;  4ONY A;  4AS4 A;  3B6W A;  2WOK A;  3S9L C;  3QAX A;  3CG3 A;  2Q8M A;  4F3S A;  4KYE A;  1IMF A;  1EZ9 A;  4KD5 A;  3FTO A;  1YPN A;  2YLN A;  2UYE A;  4BDR A;  1LLS A;  2Z23 A;  5JTY A;  3FXR A;  2HAU A;  3DRF A;  3PU5 A;  2VD3 A;  1PB7 A;  5JTY B;  3HO7 A;  2NWJ A;  2VGQ A;  4OTE A;  1IUD A;  1TFD A;  4OAN A;  1ZU0 A;  3TZA A;  1FTL A;  4X1B A;  3EHT A;  3OO6 A;  1ZJL A;  3U65 A;  2H98 A;  3A3C A;  5IM2 A;  4PTK A;  1H3D A;  2QVU A;  4KYS A;  2YPN A;  2DDK A;  1MXV A;  4R2F A;  2QFL A;  1POY 1;  1LBB A;  4OER A;  2DWI A;  1A7L A;  3TTN A;  1NV1 A;  3T22 A;  1TT1 A;  3D1R A;  5LOM A;  2Y7R A;  3W9V A;  3U94 A;  4DI4 B;  3DRJ A;  2NVU B;  2FNC A;  4L17 A;  1FBF A;  1M5D A;  3DP4 A;  3SEV A;  3WAF A;  4QFP A;  2X7Q A;  2ZNS A;  1CB6 A;  1JET A;  3MST A;  1HSE A;  1IEJ A;  1IME A;  4LZ7 A;  2WOL A;  5LDZ A;  1LST A;  1NUZ A;  4O3B A;  3RN8 A;  3UK4 A;  4AQ4 A;  3Q29 A;  1D3K A;  1NUW A;  4NF8 A;  2F5X A;  3KZG A;  2B65 A;  4GX6 A;  2FIX A;  1AMF A;  2QMX A;  3G3G A;  3KFM A;  2ESN A;  4PAF A;  5AA2 D;  1JVX A;  1B0H A;  4N6K A;  2OWS A;  1D9Q A;  1SW4 A;  4GX3 A;  1LB9 A;  1BTJ A;  1GGG A;  1IXH A;  4DCY A;  1NNF A;  3V89 B;  3QXM A;  2V3Q A;  2O68 A;  1PB9 A;  3DRK A;  2I4C A;  4NF6 A;  3ILU B;  2D5W A;  4JB7 A;  2ZYK A;  5A5L A;  5KDT A;  3H6U A;  1N84 A;  4IY6 A;  2Q89 A;  4HE2 A;  4QFO A;  1GTK A;  5IZ3 B;  5CM6 A;  5I58 B;  3JV9 A;  3KOT A;  3T9X B;  1NL5 A;  2Y7K A;  4QXD A;  3FVN A;  1HSL A;  4G8H A;  4F3P A;  2ZZV A;  4G68 A;  2HHM A;  3IL1 B;  5EYF A;  3O97 A;  1B51 A;  2XXU A;  5CI5 A;  3KJ7 A;  3IOT A;  3EKI A;  2HCA A;  4HCW A;  4RPO A;  1QUJ A;  5L8D A;  3FVG A;  5AA4 B;  5DT6 A;  2CMO A;  4H8I A;  2REJ A;  1TWY A;  1B4H A;  1IMB A;  3IX1 A;  1FJ6 A;  2L5V A;  3MVY A;  5I3S A;  5ITP A;  4HXV A;  4I9D A;  1J1N A;  4QSE A;  5B70 A;  3MPK A;  5ESY A;  4O3A A;  1NUX A;  3IJO B;  4ESW A;  4EXL A;  3MPL A;  2OWZ A;  1MY2 A;  3K2D A;  1A8E A;  1FBH A;  1Y4T A;  1MQD A;  3DEL B;  3GYY A;  4Q30 B;  2HEU A;  3FXQ A;  4ELQ A;  4JSD A;  5ICQ A;  4GOT A;  2PBW A;  4RXL A;  2UYF A;  2O6A A;  1US4 A;  3PUZ E;  1JNF A;  1LAH E;  2XXY A;  2DVZ A;  1YXI A;  4THI A;  2I58 A;  1ELJ A;  1FQB A;  4GLI A;  3LR1 A;  4XFE A;  3H3G A;  4G68 B;  4QRZ A;  1GV8 A;  4AS5 A;  2LAO A;  3PD8 A;  3DRH A;  1Y9U A;  4GVO A;  2Z22 A;  5EQ8 A;  3TTK A;  1DK4 A;  4DIG A;  4KHZ E;  4PDD A;  1LBX A;  3RQT A;  3RPL B;  4NED A;  1FSA A;  3C9H A;  4N15 A;  2QS4 A;  2X26 A;  3PTY A;  1QGX A;  2G29 A;  2PX1 A;  5JK4 A;  1N0T A;  3R26 A;  4N8G A;  3G3I A;  1R9L A;  4NN3 A;  2XXI A;  5I2K B;  3MW0 A;  2HXW A;  2WOP A;  2FIE A;  4KPT A;  2KR0 A;  2I4B A;  1K9Z A;  3LSW A;  1B7U A;  4PGP A;  1N3X A;  4BDM A;  2VP1 A;  1B3G A;  4P8B A;  3V8X B;  3S9N C;  4MMP A;  2B3B A;  4UA8 A;  1GVC A;  1A8F A;  3K6X A;  3E13 X;  3FV2 A;  4BLA A;  1XT8 A;  1Q1K A;  2OCU A;  4IR8 A;  3KN7 A;  2RIN A;  4QFN A;  1T0K A;  3SES A;  1POT A;  5H8S A;  1AH5 A;  1MY3 A;  1BK4 A;  1FBC A;  1LAX A;  1IXC A;  5AA3 A;  2NXO A;  5M2V A;  2KQZ A;  2XD3 A;  1NI9 A;  4F22 A;  4I3Y A;  1VFD A;  3K0V A;  4EDP A;  3RT8 A;  1WDN A;  4F1U A;  4MLV A;  1SI0 A;  1SW5 A;  1MQJ A;  4KYD A;  2O7U A;  3BIG A;  1LFG A;  3IB1 A;  1YCJ A;  4K3F A;  2F78 A;  4NGU A;  2XA5 A;  4N13 A;  3O66 A;  4NWC A;  1MH3 A;  2V93 A;  3T9V A;  1B3F A;  2I6E A;  1VE4 A;  1OIB A;  1FQF A;  2DOJ A;  4R9F A;  3EQ1 A;  4MF3 A;  2RC8 A;  2QSX A;  4F1V A;  4TQU Q;  1H45 A;  4YKK A;  2XWO A;  3MC2 A;  4JXI A;  3O6H A;  4NWD A;  2ONS A;  4LVQ A;  2AYS A;  2DE3 A;  4DE8 A;  1D9Y A;  2PT1 A;  1MPC A;  1MY1 A;  4U21 A;  2O7I A;  5AA4 A;  4PBH A;  3TUS A;  1DPE A;  2NUV A;  5KCJ A;  1SBP A;  2NOO A;  5HPQ A;  1HSJ A;  4P56 A;  2ABH A;  1FTA A;  4GQO A;  5CC2 A;  3RLF E;  3TCG A;  3L6H A;  1IXI A;  4ISU A;  2F6G A;  1N3W A;  3TDJ A;  5J16 A;  4MNI A;  3OO8 A;  4R6H A;  1DSN A;  1LBW A;  2O84 X;  2RKM A;  3H6V A;  4NMY A;  5IGA A;  4H65 A;  1QKB A;  1N76 A;  4YIC A;  3CG1 A;  4R6K A;  2RC9 A;  3PUW E;  4YKI A;  4O8M A;  3O6G A;  5TP9 A;  2A5T A;  1Z7N E;  1JW4 A;  4R75 A;  3IOU A;  3A3U A;  3B6T A;  3T96 B;  1MXX A;  2Q74 A;  4N6P A;  1N7W A;  2F3B A;  1B3E A;  5EHM A;  3PPR A;  2OBG A;  3RTF B;  1FPK A;  1DTG A;  3SEX A;  3OD7 A;  3FZV A;  3PUX E;  2V84 A;  4ELP A;  1Y3Q A;  3PAM A;  4XKP A;  4NF8 B;  3MP8 A;  3QIM A;  4POW A;  3LVU A;  4PE5 B;  2I3V A;  1XI6 A;  1AIV A;  3CI8 A;  4OFJ A;  3EPE A;  4Q0C A;  1WOD A;  3FUZ A;  1URD A;  3O2A A;  4OWD A;  2XWI A;  1IXG A;  2QS1 A;  3G7W A;  1EYK A;  3UGW A;  4LQ2 A;  5I57 B;  1FW0 A;  3BIH A;  3Q27 A;  4MJO A;  2QRY A;  3KC0 A;  2QS2 A;  1S7Y A;  2CZI A;  2GHB A;  3HN0 A;  4XIG Q;  4PCD A;  1R1N A;  4OVS A;  4OVJ A;  2VT5 A;  4MIJ A;  3C31 A;  2Y84 A;  1P99 A;  1H44 A;  5JEI A;  4QFK A;  4KI0 E; 
#chains in the Genus database with same CATH homology
 4RJZ A;  4DXC A;  3G3G A;  3KFM A;  4QHQ A;  2ESN A;  2Y7P A;  4G68 C;  2DWA A;  2QMW A;  3IOR A;  3LSF B;  2ZYM A;  2QL3 A;  1I6A A;  4YKP A;  3ZKK A;  2D3I A;  2XX9 A;  1WVJ A;  5AA2 D;  4I62 A;  3D4C A;  2A5S A;  1JVX A;  3GXA A;  2ANJ A;  1B0H A;  3N6U A;  5CMC A;  5H8Q A;  3DP8 A;  4ZE8 A;  1FTJ A;  2OWS A;  3OXN A;  4I1D A;  4F2O A;  1MXY A;  1MDP 1;  1SW4 A;  2XXH A;  4G2Z A;  4QSC A;  4F3G A;  1M5B A;  3TEP A;  4HW8 A;  1LB9 A;  1BTJ A;  3IAZ A;  3CFL A;  4OEN A;  3T66 A;  2M8C A;  5DVJ A;  1SW2 A;  1GGG A;  3IB0 A;  5I56 A;  5L9O A;  1IXH A;  5B7D A;  5K2Y A;  4AB6 A;  4ELO A;  5I59 B;  4DCY A;  4U4X A;  1SYH A;  4HCY A;  1CE2 A;  1NH7 A;  5F7V A;  5TP9 B;  1LBC A;  3SEW A;  1NNF A;  2P2A A;  3FAT A;  3V89 B;  1QJM A;  4OXV A;  4X1D A;  1OQH A;  4PFY A;  3H4Z A;  3QXM A;  2V3Q A;  2RC7 A;  4O3C A;  4ZZA A;  2O68 A;  4GL8 A;  5KCJ B;  4ZE9 A;  2ZXT A;  1DOT A;  1PB9 A;  3DRK A;  1F9B A;  2I4C A;  4NF6 A;  1VFE A;  4R6Y A;  3ILU B;  2D5W A;  3PGF A;  4JB7 A;  4ZEC A;  1B7H A;  4RYA A;  2ZYK A;  1B58 A;  5KDT A;  1P1W A;  3PPO A;  4GD5 A;  1MH4 A;  1RYX A;  3Q25 A;  5IKB A;  3RYB A;  4M4G A;  2V25 A;  4QSD A;  5L9M A;  3H6U A;  1OLC A;  3KN8 A;  3T9U A;  3HHG A;  1P1U A;  3K1M A;  3DRG A;  4YU0 A;  3MUQ A;  5ELV A;  4M1V A;  1N84 A;  4IY6 A;  1MS7 A;  2Q89 A;  1XVX A;  3I6V A;  1TXF A;  4E0X A;  1UIV A;  4FAT A;  4YMA A;  3SER A;  5H8N B;  4QFO A;  1GTK A;  5CM6 A;  5I58 B;  3TPA A;  3CHG A;  1LAF E;  1NH8 A;  4EDP A;  2H4I A;  2HAV A;  3JV9 A;  4LZ5 A;  5AA2 B;  1EZP A;  2UVI A;  3KOT A;  3V83 A;  4ELR A;  4E0W A;  3O9P A;  4P0G A;  4R74 A;  1TFA A;  4RPN A;  1D4N A;  1NL5 A;  2CZL A;  2Y7K A;  3C36 A;  4POX A;  3T9X B;  3FVN A;  4PFW A;  3RYA A;  2H5Y A;  1KWH A;  3I3V A;  1HSL A;  3SEU A;  4G8H A;  5IAI A;  4F3P A;  2H9B A;  4G68 A;  3IL1 B;  5I2N B;  3A09 A;  1PB8 A;  3O97 A;  1B51 A;  1P1N A;  2XXU A;  5EYF A;  1MXW A;  5TPA A;  5CI5 A;  3CFZ A;  3KJ7 A;  3IOT A;  3Q26 A;  4NF4 A;  1ZLQ A;  3VXB A;  3ZSF A;  4BDO A;  4RK9 A;  2HCA A;  3L6G A;  4HCW A;  4RPO A;  1MPD A;  1QUJ A;  1I69 A;  3FIR A;  5L8D A;  3FVG A;  5H8F B;  3PUY E;  5AA4 B;  4ZEB A;  2DQV A;  2V3T A;  2E0S A;  5DT6 A;  3KG2 A;  2PT2 A;  3JYR A;  3KN3 A;  1QKA A;  1SD3 A;  2R71 A;  2CMO A;  3PPN A;  3U72 A;  4F3B A;  1M5C A;  3Q28 A;  2REG A;  2B4M A;  4GXA A;  3CSB A;  4U4S A;  4H8I A;  2REJ A;  4TLL B;  2F7C A;  3KBR A;  1URS A;  2QPQ A;  2Q88 A;  3RTW B;  3T9H B;  1TWY A;  5F1Q A;  3IB2 A;  4IGR A;  4H8J A;  4DXU A;  1B4H A;  3VE1 B;  1UQW A;  4I8C A;  2DSF A;  3IX1 A;  3K6V A;  3ODB A;  5KZT A;  3IJX B;  4LQ5 A;  4XTC Q;  3FJM A;  3S9E A;  1B5J A;  3MVY A;  4GRK A;  4MFI A;  2FA7 A;  2HFB A;  3D4G A;  2F34 A;  3FJG A;  1D9V A;  3MZ9 A;  4U1O A;  2ONK E;  3TEL A;  3U8Q A;  5FHM A;  2GFE A;  3UIF A;  3KGC A;  5ITP A;  4I9D A;  3VLU A;  1J1N A;  3M8U A;  4H5G A;  4QSE A;  5B70 A;  5HM4 B;  3MPK A;  1EU8 A;  1QVS A;  4O3A A;  5DEX A;  2O69 A;  1IQ7 A;  4NTL A;  4G8M A;  3IJO B;  1YTV A;  4ESW A;  3CFX A;  4EXL A;  3MPL A;  4ZZE A;  4XKR A;  1B1X A;  1MM7 A;  3H06 B;  1SW1 A;  2ONR A;  4YB5 A;  2I0C A;  1MY2 A;  1S9T A;  3ILT B;  3K2D A;  2VD2 A;  4Z7E A;  3E3K A;  2UVG A;  3OSQ A;  3MVZ A;  3R7X A;  3TTR A;  3TQL A;  3IO4 A;  1MQG A;  1A8E A;  4N07 A;  2R9J A;  2E1S A;  4WKM A;  1UTB B;  4H6D A;  5CMB A;  1ZBM A;  1Z7M E;  2XXX A;  4X9T A;  3CRB A;  5FTI A;  1PEB A;  1Y4T A;  1MQD A;  2AIX A;  3DEL B;  3K00 A;  2HEU A;  4Q30 B;  5EHS A;  5H8H B;  4F29 A;  3DM0 A;  3FXQ A;  3MVX A;  2OWT A;  4ELQ A;  4NF5 A;  1MG1 A;  4JSD A;  1BP5 A;  2F35 A;  4NF5 B;  5ICQ A;  4GOT A;  1H43 A;  4F31 B;  3H6T A;  4OQO A;  5A5X A;  5H8H A;  4ZEF A;  2PBW A;  4EXK A;  3OO9 A;  4TOZ A;  1RKM A;  4GL0 A;  4RXL A;  3TQW A;  3FJ7 A;  3PD9 A;  2UYF A;  4H5F A;  4LZ8 A;  1UTH B;  1ZMG A;  2O6A A;  1US4 A;  2DWH A;  1JNF A;  3PUZ E;  3SET A;  1MDQ A;  1LAH E;  2Z8E A;  2XXY A;  3G3H A;  3H7M A;  3RT6 B;  3UOR A;  1B9J A;  5I2K A;  4LUB A;  2GRV A;  2DVZ A;  4Z0I A;  3KSX A;  3PUV E;  2HZK A;  5BUU A;  2Y7W A;  4THI A;  2I58 A;  1ELJ A;  2IEE A;  1FQB A;  1FCK A;  4FE8 A;  4MLQ A;  1H76 A;  3BKI B;  4GLI A;  4NF4 B;  3LR1 A;  4YAH X;  3VV5 A;  4C0R A;  1JW5 A;  4ZS9 A;  3H3G A;  3SEY A;  3B7D A;  2ZMB A;  4G68 B;  5I2N A;  1O7T A;  4QRZ A;  1L5T A;  3WAE A;  4F39 A;  2UVH A;  1JVY A;  1GV8 A;  3RNN A;  4ESX A;  1XHY A;  2Q8J A;  4FEC A;  2LAO A;  3RUM A;  2UXA A;  4U1Z A;  4OEU A;  1DMB A;  3PD8 A;  1Y1Z A;  3DRH A;  1Y9U A;  4GVO A;  1LB8 A;  4R9G A;  1II5 A;  1Y3N A;  2Z22 A;  3TTK A;  2AL4 A;  4DIG A;  4RY1 A;  4LP2 B;  1LFI A;  4ECF A;  3QSL A;  4KHZ E;  4DXB A;  1LFH A;  3RQT A;  1B3H A;  4NED A;  4HS7 A;  2OZZ A;  3RY3 A;  4YB7 A;  4BDL A;  2HQ0 A;  3C9H A;  3MAM A;  4FED A;  2KLF A;  3K01 A;  2UVJ A;  4DDD A;  1B40 A;  2I49 A;  4FAJ A;  2QS4 A;  1BLF A;  3LUY A;  4EF2 A;  1EH3 A;  2XXV A;  1OMP A;  2X26 A;  3MJN A;  5ICT A;  2I3W A;  4F1Y A;  2G29 A;  2OLB A;  1YAE A;  2DYX A;  2PX1 A;  2Z8D A;  4IO7 A;  2P0S A;  5JK4 A;  1N0T A;  3H6W A;  3S4U A;  1MXZ A;  1OVT A;  3R26 A;  3OOA A;  4F19 A;  5I84 A;  1PBP A;  3N26 A;  5AA1 A;  3G3I A;  1R9L A;  1MPB A;  2XXI A;  2XXT A;  1Y3P A;  5I2K B;  2QS3 A;  3MW0 A;  2GHA A;  2HXW A;  3BBR A;  3K4U A;  2WOP A;  3P7I A;  3UP9 A;  3C35 A;  3K6W A;  4KPT A;  5TPA B;  1VSO A;  3BFU A;  4MBP A;  3O28 A;  4IO2 A;  1AOV A;  2I4B A;  4IO4 A;  1FQE A;  2R6G E;  3LSW A;  3IOV A;  2F6P A;  1B7U A;  4FIM A;  4PET A;  1Y20 A;  1N3X A;  4BDM A;  2VP1 A;  3UA8 A;  1B3G A;  3V8X B;  4TLM B;  2F7B A;  5CMK A;  5I56 B;  3RPW A;  3S9N C;  2B3B A;  4UA8 A;  2RCB A;  1A8F A;  1GVC A;  3SDF A;  3K6X A;  5J1D A;  5FTH A;  1SYI A;  1M5F A;  3I5O A;  1Y4C A;  2XX8 A;  1B32 A;  1UTB A;  3E13 X;  3FV2 A;  3CIJ A;  3N6T A;  4FEB A;  1B5H A;  4BLA A;  4IO3 A;  1ZTY A;  2G93 A;  3FGS A;  3M3L A;  1NFT A;  1XT8 A;  4QF9 A;  3K6U A;  4HTG A;  1Q1K A;  5FHN A;  2OCU A;  5FHO A;  3MWB A;  1MQI A;  3VVE A;  3ONM A;  3KN7 A;  2RIN A;  1B4Z A;  3H03 A;  2I0B A;  3E9X A;  3K02 A;  3U1O A;  3ZKL A;  4QFN A;  4FOR A;  4EQ7 A;  1T0K A;  1P1O A;  1N04 A;  4QFL A;  2THI A;  4IO6 A;  1N7X A;  4PQJ A;  1DTZ A;  5DEX B;  3U93 A;  3FVO A;  3C34 A;  1POT A;  5H8S A;  3SES A;  1AH5 A;  1MY3 A;  3GBB A;  1LAX A;  3S2V A;  1XC1 A;  1PBQ A;  2H99 A;  3C32 A;  4XKN A;  1JEV A;  1IXC A;  4ZDM A;  1XOC A;  5AA3 A;  3CSG A;  2NXO A;  3TOD A;  3VVF A;  2X7P A;  4GXS B;  5M2V A;  1UTH A;  4YB6 A;  3LSX A;  3O6P A;  3QUF A;  4DE8 A;  4P0I A;  3EN3 A;  4ZED A;  2O51 A;  3OEN A;  4JWY A;  2Z8F A;  3E4R A;  3G3F A;  4X48 A;  2XD3 A;  1USY E;  4IB2 A;  5A5X B;  3U92 A;  4F22 A;  2XXW A;  4OET A;  3ECR A;  1VFD A;  1QUK A;  2FYI A;  4WEP A;  2D21 A;  1US5 A;  1JEU A;  3R6U A;  3TCF A;  3K0V A;  1FTO A;  2O1M A;  3C33 A;  3TMG A;  3VLW A;  1B2H A;  1FQA A;  3LC8 A;  1MY0 A;  3RT8 A;  1QUI A;  1IIW A;  3USD A;  5AE4 A;  1WDN A;  4F1U A;  1ANF A;  2F8D A;  1XS5 A;  5CRY A;  5H8Q B;  3TAJ A;  4MLV A;  3PMV A;  2F36 A;  1O64 A;  3HHF A;  3M3K A;  4Q5T A;  4YZZ A;  1SI0 A;  3B6Q A;  2PVU A;  1SW5 A;  3W15 C;  1MQJ A;  1OVB A;  3HST A;  3VXC A;  1DPP A;  4G77 A;  4KYD A;  4EUO A;  5TU0 A;  2O7U A;  1LFG A;  3IB1 A;  4JSO A;  1B1H A;  3DRI A;  1I6Q A;  1YCJ A;  3DP6 A;  2F78 A;  3OEK A;  4K3F A;  1VR5 A;  4N13 A;  3O66 A;  3OO7 A;  4NWC A;  1MH3 A;  2V93 A;  3T9V A;  1B3F A;  4GWO A;  3MQ9 A;  2QJE A;  4DCX A;  2I6E A;  1VE4 A;  1OIB A;  4F18 A;  4R2B A;  3CVG A;  3JZJ A;  1FQF A;  2DOJ A;  1SQY A;  3FVK A;  1P1Q A;  2DE4 A;  4R9F A;  3EQ1 A;  1NNK A;  4MF3 A;  5DTB A;  3MZB A;  3KSJ A;  2RC8 A;  3UN6 A;  3PPQ A;  5AA2 A;  2PMS A;  2QSX A;  3OEM A;  4F1V A;  4TQU Q;  1PDA A;  4FJP A;  5DVF A;  3FD3 A;  5I58 A;  4ZEI A;  1H45 A;  2W7Y A;  4YKK A;  3K1N A;  3MC2 A;  3O6H A;  4JXI A;  4NWD A;  4R72 A;  2GH9 A;  2ZYN A;  3W9W A;  5L9S A;  4BDQ A;  3G3K A;  3THI A;  5CBS A;  1BKA A;  2ONS A;  4LVQ A;  1B7Z A;  3SKP A;  4IGT A;  4YMB A;  3TCH A;  3MBP A;  3VDF A;  4GF8 A;  2AYS A;  2B3F A;  1SVX B;  2DE3 A;  2F7A A;  2OJT A;  1B05 A;  4R73 A;  4U22 A;  3TYH A;  4BDN A;  1MRP A;  4PFU A;  1D9Y A;  2PT1 A;  2ZYO A;  3AXF A;  4GFR A;  4C1U A;  4ZEK A;  5KDT B;  4EQB A;  1MPC A;  1MY1 A;  2VOZ A;  2O7I A;  2I48 A;  4P11 A;  4U21 A;  5DVI A;  5AA4 A;  5H8F A;  3TUS A;  1DPE A;  2XHD A;  4NF6 B;  4U2R A;  3EHU A;  2NUV A;  5KCJ A;  1FTM A;  1SBP A;  5BWJ A;  1EZO A;  1MQH A;  3IR1 A;  2HZL A;  3IK6 B;  3MP1 A;  4WED A;  4KCD A;  3KEI A;  3S9M C;  3MZ1 A;  3BFT A;  2NOO A;  4OFO A;  4MH5 A;  5HPQ A;  3RGY A;  3HPI A;  2XXP A;  3QUJ A;  5CMM A;  5I59 A;  1HSJ A;  4DLD A;  2BJJ X;  3MP6 A;  1OLA A;  3IOW A;  4PP0 A;  3DLN A;  1JQF A;  3V5A A;  1USY H;  1QW0 A;  2ABH A;  4GQO A;  3OEL A;  5CC2 A;  1MY4 A;  2DP8 A;  3LSL A;  1B6H A;  1ZIU A;  2H25 A;  3HCQ A;  3TCG A;  3RLF E;  3TTM A;  4WXJ A;  3L6H A;  4JWX A;  1IXI A;  4LON B;  1PC3 A;  1S50 A;  1R9Q A;  3LBS A;  4G4P A;  4ONY A;  4ISU A;  3B6W A;  2WOK A;  5H8N A;  4RA1 A;  3MVW A;  1Q35 A;  1IIT A;  3OSR A;  1UIU A;  2F6G A;  4JBZ A;  3S9L C;  3QAX A;  1N3W A;  2DWJ A;  3CG3 A;  3VVD A;  1RYO A;  4XXU A;  4OYV A;  2ALU A;  3TDJ A;  4F3S A;  1LCF A;  2AL5 A;  2DXY A;  4KYE A;  3OO8 A;  3TFL A;  4R6H A;  1DSN A;  4KCC A;  1EZ9 A;  2B4L A;  2WKY A;  4KD5 A;  4UAC A;  2O84 X;  2RKM A;  3FTO A;  2ZNU A;  3EHS A;  3H6V A;  3PPP A;  4H65 A;  4NMY A;  4OZ9 A;  1YPN A;  4OES A;  1QKB A;  2YLN A;  4ND9 A;  1N76 A;  3GLB A;  4YIC A;  2IA4 A;  1JW1 A;  3CG1 A;  2UYE A;  1A55 A;  4R6K A;  2RC9 A;  2XD2 A;  3PUW E;  4YKI A;  1O63 A;  4BDR A;  3O6G A;  4GIZ A;  1B46 A;  2Z23 A;  1LLS A;  5TP9 A;  5JTY A;  3FXR A;  2HAU A;  2A5T A;  3DRF A;  1Z7N E;  3PU5 A;  3FAS A;  3PV0 E;  5ITO A;  2Q9T A;  2VD3 A;  3O29 A;  1M5E A;  1PB7 A;  1IZ1 A;  1LGB C;  1JW4 A;  2V3U A;  3EF7 A;  3FXU A;  3HO7 A;  3IOU A;  4R75 A;  4JWO A;  5JTY B;  2VGQ A;  4OTE A;  2NWJ A;  1IUD A;  4H1X A;  3A3U A;  1I6B A;  4H67 A;  3B6T A;  5I57 A;  3IO6 A;  3T96 B;  1NNP A;  1MXX A;  1TFD A;  2DXR A;  3CR9 A;  4N6P A;  2YJP A;  3G3J A;  1N7W A;  4H0W A;  3ZS6 A;  1B3E A;  5EHM A;  3PPR A;  2OBG A;  2ZNT A;  3RTF B;  1ZU0 A;  1LAG E;  3HV1 A;  3K1P A;  4NE4 A;  1FTL A;  3TZA A;  4OFL A;  1DTG A;  4X1B A;  3SEX A;  3EHT A;  3OD7 A;  2F97 A;  3FZV A;  3N5L A;  3OO6 A;  4JDF A;  1ZJL A;  4KR5 A;  3PMX A;  2H98 A;  3A3C A;  1H3D A;  3F11 A;  3FV1 A;  3PUX E;  4IY5 A;  1Y1M A;  2V84 A;  4ELP A;  1Y3Q A;  2RCA A;  4KYS A;  1A99 A;  3PAM A;  3T93 B;  4C1T A;  4XKP A;  2YPN A;  1NKX A;  1SI1 A;  4KQP A;  1MXV A;  4NF8 B;  1GR2 A;  4XKQ A;  3MP8 A;  2VHA A;  4U23 A;  3QIM A;  3LVU A;  1MM6 A;  1R6Z A;  4POW A;  4EF1 A;  4PE5 B;  2I3V A;  2XXR A;  4R2F A;  2Q2A A;  3CI8 A;  4OFJ A;  1AIV A;  1POY 1;  1FTK A;  1LBB A;  4OER A;  2Q2C A;  1A54 A;  1ATG A;  2DWI A;  3EPE A;  1A7L A;  1WOD A;  4Q0C A;  3FUZ A;  3TTN A;  1URD A;  5K2X A;  3T22 A;  1QUL A;  1TT1 A;  1LCT A;  5LOM A;  4F2Q A;  2Y7R A;  3KJT A;  1NNT A;  3O2A A;  3W9V A;  4EQ9 A;  2P1S A;  1B0L A;  1OQG A;  2Y7I A;  4OHN A;  3U94 A;  4OWD A;  3DRJ A;  2DVC A;  2NVU B;  1NMU A;  2FNC A;  4L17 A;  1IXG A;  2OK2 A;  4LAT A;  1M5D A;  3DP4 A;  3SEV A;  3O6I A;  2QS1 A;  3G7W A;  3TTL A;  3QK6 A;  3WAF A;  1FQD A;  4QFP A;  3UGW A;  4LQ2 A;  2PYY A;  5I57 B;  1FW0 A;  2X7Q A;  2ZNS A;  1A40 A;  4OEV A;  3TKD A;  1CB6 A;  1JET A;  3VFJ A;  1B52 A;  2XXQ A;  3Q27 A;  2RF1 A;  1HSE A;  2QRY A;  1IEJ A;  1MXU A;  1B3L A;  1FQC A;  2QS2 A;  2WOL A;  4LZ7 A;  1AL3 A;  1B5I A;  1S7Y A;  4RK2 A;  1LST A;  2A5T B;  4Q8R A;  4LA9 A;  4O3B A;  2GHB A;  3HN0 A;  2DS9 A;  5HBC A;  3C4M A;  3KOS A;  3RN8 A;  4XIG Q;  3UK4 A;  4AQ4 A;  4PFT A;  3M3F A;  4DZ1 A;  2DE2 A;  3Q29 A;  4RNS A;  3VLV A;  1R1N A;  1D3K A;  4G8N A;  1BIY A;  4AB5 A;  1XVY A;  4IO5 A;  2O1L A;  3OMB A;  2F5X A;  5ISU A;  3GZG A;  3KZG A;  4NF8 A;  4OVJ A;  3N94 A;  1URG A;  2B65 A;  5CBR A;  1SDX A;  1ZKB A;  3C31 A;  4OMB A;  2Y84 A;  1P99 A;  4KFQ A;  1H44 A;  3PMW A;  3QYT A;  3GBA A;  5JEI A;  4QFK A;  4KI0 E;  4YKJ A;  1AMF A;  2XX7 A;  2QMX A;  5DYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...