1RKMA

Structure of oppa
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Binding protein
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title Peptide binding in OppA, the crystal structures of the periplasmic oligopeptide binding protein in the unliganded form and in complex with lysyllysine.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 170
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1997-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1rkmA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1rkmA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1rkmA02
4NF6B 2F36A 3K00A 3KN3A 2Y7KA 5H8HB 3V8XB 2UXAA 3CIJA 4PQJA 4X1DA 1O63A 1UTBB 2OZZA 1Y3QA 3N6UA 2QSXA 3RGYA 4OERA 3FXQA 2ZXTA 1B5JA 3K02A 1BLFA 1D9VA 2AIXA 4LVQA 3RTWB 2XXIA 3M3LA 4FEDA 2I49A 1BTJA 4IY5A 1NH8A 3BBRA 2XD3A 5I56B 1AOVA 4AQ4A 1M5DA 1NL5A 3SDFA 2ZMBA 2XHDA 2R71A 2ZNUA 4RY1A 3HSTA 3RLFE 1ATGA 1R6ZA 1OIBA 3PMVA 3OSRA 4JB7A 3S9LC 3TEPA 4YAHX 1I6BA 3TCGA 3UP9A 4F3PA 3IX1A 1QKAA 4OEUA 4N13A 3PPQA 3SEVA 3PD8A 4TLLB 5B70A 1BP5A 1Q1KA 3DELB 4KCDA 1DTGA 1SW5A 4F1YA 4I8CA 3KFMA 4GFRA 1QW0A 4KYSA 1OLAA 3TDJA 1FCKA 1MM6A 3FZVA 4E0XA 3JV9A 1M5EA 2H98A 4MF3A 3N5LA 4EUOA 4DIGA 4I1DA 4YKJA 4F2QA 3MWBA 4YB7A 3N94A 1S9TA 1R9QA 3FXRA 1D3KA 2XXPA 1HSEA 2B4LA 3CG3A 3L6HA 4R6HA 4AB5A 3HPIA 1AIVA 1TFDA 1A8FA 3O9PA 3CSBA 4LQ5A 2O51A 4I62A 3O28A 4YU0A 4F3SA 4RK2A 2O7UA 3IK6B 3IR1A 3KEIA 1FQDA 4IB2A 4XXUA 4PFUA 1IEJA 4NF8B 4MBPA 3PMXA 3RN8A 4BDRA 3PUXE 1B0LA 1O7TA 3RYAA 3TTMA 1SYIA 2GH9A 4LP2B 3W15C 5JTYA 5IKBA 4F1UA 1P1QA 2AL5A 2I3WA 3D4GA 3DRGA 2F34A 2B65A 1AMFA 2D3IA 4MH5A 4ONYA 3LSWA 4F19A 4NWCA 5JK4A 1GR2A 1I69A 2WOPA 3VDFA 5I57A 3Q28A 4RYAA 3BFTA 3Q29A 2F97A 4TOZA 3TTNA 3TTLA 1PBPA 2CMOA 5KZTA 2H99A 5KCJA 3MQ9A 4O3AA 5AA2D 1MS7A 4ISUA 4QHQA 2D5WA 2P2AA 2UYFA 2XXWA 3QXMA 1OMPA 5AA4B 2PT2A 3S9MC 4KCCA 4OESA 3S2VA 3K1MA 1B5IA 4MFIA 3CI8A 4QFKA 2VD2A 1DPEA 3IO6A 3KJTA 1MQJA 4YZZA 2AL4A 4IO2A 3G3JA 5I59B 1FTJA 2PMSA 3PUVE 3SERA 3KG2A 5TP9B 1JNFA 4RPNA 2RCAA 4NF6A 4XIGQ 3SETA 3DP4A 4GXSB 1MXYA 5H8HA 4U23A 4G4PA 4H67A 4JWOA 2E0SA 1UTBA 1GTKA 1SDXA 1MXZA 1JVXA 1VFEA 5DT6A 4FJPA 5CMCA 3OEKA 1QUJA 2V93A 1WDNA 1DPPA 4GXAA 3ZKKA 4NF4B 3O6GA 2F7BA 3CRBA 4NE4A 3GZGA 5I56A 3FTOA 4IO7A 2ZYNA 4OZ9A 1SYHA 4FORA 1SI1A 3OXNA 3UA8A 3C33A 3S9NC 2P1SA 3HHGA 4BDNA 1MQIA 4P11A 4H65A 3Q26A 3TFLA 1B7UA 4KFQA 3H6WA 1POY1 4ELPA 3O66A 4R2FA 4N6PA 2CZLA 2DE3A 3MP1A 1LFIA 1PBQA 1NNTA 2O7IA 3O29A 2R9JA 3PMWA 4OQOA 4DXUA 3I5OA 2DE2A 2G29A 3B6WA 3MVWA 1TT1A 1S7YA 4MLVA 3T93B 2Z8EA 3O2AA 3IB1A 1B05A 4H5GA 4Q5TA 1N3XA 4GL0A 5FHMA 4ESWA 5H8SA 4OXVA 2O68A 2Q2AA 1XHYA 1SVXB 1YTVA 1POTA 2KLFA 4HS7A 1QULA 4R75A 4G8HA 3PPPA 1I6AA 2I0BA 3MC2A 3DM0A 3CHGA 1A7LA 3H6TA 2QS3A 2DP8A 5AA2B 2ONRA 4ELQA 3QUFA 3C31A 3VVEA 5HPQA 3IORA 3GBBA 1L5TA 3SESA 4P0GA 5L9SA 2Q8JA 2FNCA 1B5HA 5FTHA 3QSLA 4NF8A 3C4MA 1D4NA 3K4UA 2BJJX 3OENA 3UK4A 1MY0A 2ABHA 4BLAA 4EF1A 1LAGE 1DOTA 1LSTA 4GL8A 4RA1A 1SD3A 2PBWA 4FAJA 1LGBC 3TKDA 1HSJA 5EHSA 1XVXA 2RC9A 1VFDA 3TZAA 1YCJA 5BUUA 4PFWA 1Y1MA 4ZZEA 3G3KA 3G3GA 4KYEA 1MXUA 3M3KA 1ZBMA 2DWIA 2VOZA 2XXYA 3R7XA 3ZKLA 4EQ7A 5AA4A 2GHAA 4U2RA 1FTKA 5F1QA 4AB6A 2O1LA 3CFZA 1B3FA 1O64A 1M5CA 2DWJA 3QUJA 2OLBA 2A5TB 2V84A 3PUZE 3HCQA 3TODA 1MQDA 2XXTA 1QJMA 1MG1A 2NUVA 3MJNA 2HAVA 4LZ5A 2I4BA 5I59A 3OMBA 1MY1A 2Y84A 1FQAA 4R6KA 5TP9A 3EQ1A 3QIMA 1UIUA 4IGRA 3TQWA 2QS4A 1Y9UA 2X26A 2V3QA 1RKMA 4R2BA 3G3HA 1M5BA 1WVJA 3T9HB 5B7DA 4OETA 2F35A 3CG1A 3E9XA 3I3VA 4YB6A 3SEUA 4MLQA 3IB2A 2QPQA 4NF4A 4KR5A 2ZYMA 2O69A 3IJXB 3LC8A 2DXYA 2RKMA 3TCHA 2DQVA 2I3VA 4JWYA 4IO5A 2O1MA 4ZEKA 1ZU0A 3LSXA 1LB9A 2QS2A 2PVUA 1B3HA 2O84X 3SKPA 4ZZAA 1DMBA 1EZPA 2REJA 2PX1A 1JW5A 3PUYE 2H25A 2HEUA 1P1WA 4GIZA 2I48A 4OTEA 5CMMA 3RT8A 1B51A 2HAUA 2ZYOA 4Q30B 5H8QA 1MY4A 2DXRA 4LZ8A 1PB7A 4RNSA 3R26A 2ZNTA 2Y7RA 4BDMA 4LQ2A 4ZEFA 2LAOA 3K6VA 4F3GA 4F29A 3MVXA 2QMXA 5I2KB 1PB9A 2G93A 3VXBA 3N26A 4IGTA 4QSDA 2A5SA 4GRKA 1XS5A 1H43A 3ZS6A 4ESXA 1SW4A 4BDOA 3K01A 3U93A 1AL3A 2OCUA 1FTOA 3EF7A 4FECA 1M5FA 3KSXA 4EQ9A 5A5XB 4QFNA 1QUIA 3VXCA 4PP0A 4H6DA 3FVKA 2QRYA 4DDDA 5AA2A 2RC8A 5AA3A 1HSLA 3K6UA 4KYDA 5L8DA 3AXFA 3V5AA 1ZMGA 3TQLA 2OK2A 3B6QA 2V25A 2YPNA 4H0WA 2UVGA 2Z23A 2Y7IA 4DCYA 1PC3A 2ESNA 2NVUB 4POWA 2I58A 2DWAA 3PPNA 1Z7NE 1LCFA 1DSNA 4DLDA 4KHZE 2OJTA 3MZBA 2F8DA 2Z8DA 1B7ZA 3Q27A 5FHNA 2OWTA 1N7XA 4JWXA 1LFGA 4YICA 5ICTA 3HO7A 4F3BA 3TTKA 3H6VA 4F22A 1NFTA 2F7CA 3LVUA 1US5A 2ZNSA 3RPWA 1FQCA 3DRHA 3OEMA 1TXFA 1P99A 3WAEA 2VD3A 4OENA 3R6UA 2X7PA 3CR9A 3VLWA 1PDAA 2B3FA 2A5TA 2UVJA 1VE4A 4FIMA 4UA8A 4EF2A 3WAFA 1GGGA 2F5XA 4QFPA 3OD7A 3G3IA 3T9UA 1BIYA 2WOLA 3K1NA 4F1VA 1LCTA 1A55A 1OVTA 5ITPA 3LBSA 3MVYA 2HZLA 2DOJA 2DE4A 4ZDMA 4DZ1A 5BWJA 3QAXA 3MZ9A 4X9TA 3RQTA 2NWJA 5CI5A 3T66A 2XX7A 2H5YA 2VHAA 3H03A 2H4IA 4XKRA 1OQHA 4ZEIA 3MZ1A 3T96B 3W9VA 4PETA 1II5A 2PYYA 2HQ0A 1XC1A 1GVCA 4YMBA 4THIA 4RJZA 2Q89A 4G2ZA 5J1DA 4ZEBA 3IAZA 1JW1A 3FVOA 2Z22A 4QSCA 2DVCA 4WXJA 4EQBA 2AYSA 1NMUA 2UVHA 3HHFA 1SW1A 1OLCA 1B46A 4IO6A 1B32A 3G7WA 4O3BA 2VP1A 1Y4TA 4LONB 3PV0E 1B3LA 1XT8A 4GQOA 4U4SA 1UTHB 4KD5A 1H45A 2OWSA 5CM6A 3LUYA 5H8QB 1URSA 2DYXA 1YAEA 4ZE8A 4OEVA 1CB6A 3ONMA 1RYOA 3D4CA 5I58B 2XX8A 5JEIA 1TWYA 2XXUA 1B52A 1BKAA 3VFJA 1D9YA 4ZS9A 4N07A 2VGQA 5FTIA 5CMKA 1MY2A 3V83A 4K3FA 3FV2A 5I2KA 2ONSA 5AA1A 2DWHA 1IXCA 1LLSA 4NWDA 4NF5B 3U8QA 4KI0E 2F6PA 3H4ZA 1SI0A 4RK9A 4L17A 3K2DA 4XTCQ 1R1NA 5I2NB 3PUWE 3KJ7A 2XD2A 3DRIA 1T0KA 5A5XA 3MUQA 4PFYA 5H8NB 3GBAA 3C36A 3FIRA 3P7IA 4WEPA 5K2YA 3O6HA 4G68C 3S9EA 1IZ1A 4FEBA 4JXIA 1FQBA 2ALUA 5ICQA 2V3TA 2V3UA 3VE1B 1B2HA 1DTZA 3IJOB 5ELVA 1IXGA 1J1NA 4QFOA 3LSFB 1LB8A 4IO4A 4OFJA 1SBPA 4Q0CA 3Q25A 1B3EA 3UN6A 1USYE 1R9LA 5CBRA 3PD9A 2REGA 2HZKA 2ZYKA 2DS9A 1P1UA 4JSOA 1URGA 1N84A 4R9GA 1IQ7A 4H8JA 3UIFA 1N76A 3KBRA 2OBGA 1LBCA 3EHUA 4IO3A 4KQPA 4H1XA 4WEDA 2P0SA 3UGWA 3RTFB 4NMYA 2ANJA 1JEVA 3EPEA 3PPRA 1SQYA 5AE4A 1MH4A 4JBZA 2O6AA 2Q88A 1MM7A 2W7YA 1Y3NA 1FTLA 2M8CA 3TUSA 3H7MA 3KSJA 4BDQA 1ANFA 4XKQA 3SEYA 2RC7A 3IOWA 3O6IA 2QL3A 5HM4B 3T9VA 4YB5A 1JETA 1USYH 3IOTA 4NEDA 2THIA 3EHTA 4GOTA 2NOOA 5DEXB 4LA9A 4R9FA 3FUZA 2PT1A 1MXWA 3FVNA 2XX9A 1ZLQA 1AH5A 1TFAA 3T9XB 1B0HA 1IITA 1IXHA 3EN3A 4QFLA 4U1OA 2UVIA 1Q35A 3FXUA 2XXXA 3QYTA 1A40A 1A99A 4OFOA 2HXWA 3E13X 1VSOA 3QK6A 4ND9A 2YJPA 1KWHA 3GLBA 4M4GA 4F2OA 4OWDA 5CBSA 4YMAA 3U92A 4R6YA 3K1PA 1ELJA 1ZTYA 4G77A 3BFUA 3DRKA 4R73A 4G68A 5KDTB 3TCFA 1PEBA 2RF1A 4X1BA 1ZIUA 4KPTA 1B4HA 3FJMA 1LAXA 4EXLA 5TU0A 4HCYA 3FJ7A 4JSDA 4C0RA 1UTHA 4U1ZA 3HV1A 1NNFA 3W9WA 4I9DA 3RNNA 3IOUA 1XOCA 1NNPA 3PGFA 3MVZA 5I58A 4TQUQ 4OMBA 3B7DA 3TPAA 2Y7WA 4RXLA 4RPOA 1ZJLA 3F11A 1MDQA 3OO7A 1A54A 4ELRA 1I6QA 1EH3A 1Z7ME 1UIVA 3B6TA 3KN7A 3OELA 1Y20A 4GD5A 3FD3A 2NXOA 3U94A 4NF5A 3RT6B 2I6EA 5H8FB 2UYEA 5I2NA 4X48A 2IA4A 1B1XA 4U21A 3ECRA 4DXBA 1NH7A 2Z8FA 4Z7EA 5HBCA 3H3GA 2WKYA 3MP6A 5H8NA 1H44A 1B9JA 3TAJA 4QSEA 4U4XA 1YPNA 4IY6A 3THIA 5TPAB 1EU8A 3MBPA 5DVIA 3K6XA 4QF9A 3DP8A 1LFHA 3IL1B 1H3DA 1UQWA 3IO4A 3USDA 4JDFA 1MXVA 2DVZA 3VV5A 1MPBA 5IAIA 1OVBA 3C34A 2RINA 4G8MA 3FATA 3FV1A 1H76A 4U22A 4ECFA 4P0IA 3TYHA 1WODA 5L9MA 2FA7A 3PU5A 5L9OA 4OHNA 3SEXA 3ILTB 4FE8A 5I84A 3IB0A 3A09A 3FGSA 1IIWA 4DE8A 4Q8RA 4XKNA 4GWOA 3HN0A 5CRYA 2Q2CA 1GV8A 3MPLA 4UACA 1S50A 1MPDA 3CVGA 4QRZA 4O3CA 3V89B 3OOAA 3KZGA 3E4RA 3ZSFA 3FJGA 1PB8A 2X7QA 2FYIA 2RCBA 1OQGA 3K6WA 4ZECA 2HCAA 3E3KA 2B4MA 1B40A 1LAFE 3UORA 2I4CA 3I6VA 1MPCA 4XKPA 3K0VA 4HW8A 2F78A 5DEXA 2QS1A 4POXA 1JVYA 4ZEDA 4HCWA 1B7HA 3T22A 4R74A 3PAMA 3U1OA 5DYHA 3VLUA 2F6GA 2XXRA 1LAHE 3N6TA 2ONKE 5ITOA 3A3CA 1MY3A 4TLMB 3VVFA 3TTRA 2IEEA 4M1VA 4C1UA 2XXQA 4H5FA 2E1SA 4EXKA 4G68B 1NKXA 1P1OA 4LZ7A 4YKPA 2GRVA 1JW4A 3M3FA 1XVYA 2GFEA 3SEWA 5KDTA 3DRJA 2F7AA 2I0CA 3ODBA 4HTGA 2YLNA 4EDPA 1N0TA 4E0WA 4DXCA 2GHBA 1FTMA 4BDLA 3MW0A 3DLNA 1US4A 3BKIB 4YKKA 4GF8A 4OVJA 5CMBA 2Q9TA 3JZJA 4F39A 3C9HA 1MQGA 2R6GE 3PPOA 1MQHA 2HFBA 3GXAA 5K2XA 1VR5A 1QUKA 4WKMA 3RUMA 1B3GA 3OSQA 3VLVA 1B58A 1FQEA 1N7WA 3KGCA 1ZKBA 3M8UA 1CE2A 2DSFA 4GVOA 5FHOA 1MDP1 1N3WA 3C35A 3TELA 2XXVA 2QMWA 4F31B 3O6PA 1P1NA 5DVFA 4H8IA 5ISUA 3LR1A 4PFTA 4LUBA 5H8FA 1FW0A 3FVGA 2XXHA 1EZOA 3DRFA 5CC2A 1JEUA 3EHSA 3A3UA 4ELOA 5EHMA 3IOVA 2H9BA 4GLIA 4R72A 2WOKA 1QVSA 3JYRA 5TPAA 4F18A 2Y7PA 3OO9A 3FASA 3H06B 1IUDA 1JQFA 5JTYB 1B4ZA 4Z0IA 5DTBA 3CFXA 3MP8A 3MPKA 1B1HA 3CFLA 1LBBA 1MRPA 3RY3A 5I57B 5F7VA 2B3BA 4C1TA 4ZE9A 3G3FA 4YKIA 3OO8A 1Y3PA 3OO6A 1NNKA 1Y1ZA 3S4UA 5KCJB 2QJEA 1EZ9A 3KOSA 3L6GA 4FATA 5M2VA 3H6UA 3U72A 1SW2A 3C32A 3KN8A 1B6HA 3VVDA 1IXIA 3LSLA 3O97A 1MXXA 1RYXA 3MAMA 1FQFA 1F9BA 4LATA 1A8EA 3DP6A 5EYFA 3RYBA 4OFLA 3ILUB 4PE5B 1QKBA 4OYVA 4G8NA 5LOMA 1N04A 3CSGA 4NTLA 3KOTA 2D21A 1MH3A 1Y4CA 4DCXA 3TMGA 5DVJA 1URDA
chains in the Genus database with same CATH superfamily
4GWXA 4NF6B 2F36A 3K00A 3KN3A 2Y7KA 5H8HB 3V8XB 2UXAA 3CIJA 4PQJA 1IMEA 4X1DA 1O63A 1UTBB 2OZZA 3BIGA 1Y3QA 4NN3A 4PFIA 3N6UA 2QSXA 3RGYA 4OERA 4I3YA 3FXQA 2ZXTA 1B5JA 4O8MA 3K02A 1BLFA 1D9VA 5J16A 2AIXA 2Y5LA 5EYGA 4LVQA 3RTWB 2XXIA 3M3LA 4FEDA 2I49A 1BTJA 4IY5A 1NH8A 3BBRA 2XD3A 5I56B 1AOVA 4AQ4A 1M5DA 1DK4A 1NL5A 3SDFA 2ZMBA 2XHDA 2R71A 2ZNUA 4RY1A 1FPDA 3HSTA 3RLFE 1ATGA 1R6ZA 1OIBA 3PMVA 3OSRA 4JB7A 3S9LC 3TEPA 4I3EA 4MX6A 4YAHX 1I6BA 2PFZA 3TCGA 3UP9A 4F3PA 2JJKA 3IX1A 1QKAA 4OEUA 4N8GA 4GBWA 4N13A 3PPQA 3ISPA 3SEVA 4MIJA 3PD8A 4TLLB 5B70A 1YZ0A 1BP5A 1Q1KA 5I5PA 3DELB 1XI6A 4KCDA 1DTGA 1SW5A 4F1YA 4I8CA 3KFMA 4GFRA 1QW0A 4KYSA 5IGAA 5ET7A 1OLAA 3TDJA 1FCKA 1MM6A 3FZVA 4E0XA 3JV9A 1M5EA 2H98A 4MF3A 1RDZA 3N5LA 4DIGA 4EUOA 4I1DA 4YKJA 4F2QA 3MWBA 4YB7A 3N94A 1S9TA 1R9QA 3FXRA 1D3KA 2XXPA 1HSEA 2B4LA 3CG3A 3L6HA 4R6HA 4AB5A 3HPIA 1AIVA 1KA1A 1TFDA 1A8FA 3O9PA 3CSBA 1FBGA 3GYYA 4LQ5A 2O51A 4MNCA 4I62A 3O28A 2ZZXA 5LDZA 4YU0A 4F3SA 4RK2A 2O7UA 3IK6B 3IR1A 3KEIA 1FQDA 4IB2A 4XXUA 4PFUA 1IEJA 4NF8B 4MBPA 3PMXA 3RN8A 4X04A 4BDRA 3PUXE 1B0LA 1O7TA 3RYAA 3TTMA 1SYIA 2GH9A 4LP2B 3W15C 5JTYA 5IKBA 4F1UA 1P1QA 2AL5A 2I3WA 3D4GA 3DRGA 2F34A 2B65A 1AMFA 2D3IA 4MH5A 4ONYA 3LSWA 4F19A 4NWCA 5JK4A 1GR2A 1I69A 2WOPA 3VDFA 5I57A 3Q28A 4GWUA 3QMFA 3BFTA 4RYAA 3Q29A 2F97A 4TOZA 3TTNA 3TTLA 2V4CA 1KZ8A 1PBPA 1KA0A 4GBVA 2CMOA 4PBQA 5KZTA 2H99A 5KCJA 3MQ9A 4O3AA 5AA2D 1MS7A 4ISUA 4QHQA 4O7IA 2D5WA 2P2AA 2UYFA 2XXWA 3QXMA 1OMPA 5AA4B 2PT2A 3S9MC 4KCCA 4OESA 3S2VA 1FBHA 3K1MA 1B5IA 4MFIA 1FJ6A 3CI8A 4QFKA 2VD2A 1LBZA 1DPEA 4GWWA 3IO6A 3KJTA 1MQJA 4YZZA 4NAPA 2AL4A 4IO2A 3G3JA 5I59B 1FTJA 2PMSA 3PUVE 2Y5KA 3SERA 3KG2A 5TP9B 1JNFA 4RPNA 2RCAA 4NF6A 2WYPA 2BJIA 4XIGQ 3SETA 3DP4A 4GXSB 4N81A 1MXYA 5H8HA 4U23A 4G4PA 4H67A 4PE3A 4JWOA 4OVSA 2E0SA 1UTBA 1GTKA 1SDXA 1MXZA 4JVIA 1JVXA 2DDKA 4OVPA 1VFEA 5DT6A 1NV0A 4FJPA 5CMCA 3OEKA 4GX6A 1QUJA 2V93A 1WDNA 3RYDA 1G0IA 4JVDA 1DPPA 4GXAA 3ZKKA 2FIEA 4NF4B 3O6GA 2F7BA 3NOHA 3CRBA 4NE4A 3GZGA 5I56A 3FTOA 1FPGA 4IO7A 2ZYNA 4OZ9A 1SYHA 1INPA 4FORA 1SI1A 3OXNA 3UA8A 3C33A 3S9NC 5IM2A 2P1SA 3HHGA 4BDNA 1MQIA 4P11A 4H65A 5IZZA 5EQ7A 3Q26A 3TFLA 1B7UA 4KFQA 3H6WA 1POY1 4NQ8A 4ELPA 3O66A 4R2FA 4N6PA 2CZLA 2DE3A 3MP1A 3A29A 5ESYA 1LFIA 1PBQA 1NNTA 2O7IA 4DI4B 3O29A 4I40A 2WBBA 2R9JA 3PMWA 4OQOA 4DXUA 3I5OA 2DE2A 2G29A 3B6WA 3MVWA 1TT1A 1S7YA 4KXPA 4MLVA 5T3JA 2Z8EA 3T93B 3O2AA 3IB1A 1B05A 4N17A 4H5GA 4Q5TA 1N3XA 4GL0A 5FHMA 4ESWA 1LBXA 4OXVA 5H8SA 2O68A 2Q2AA 1XHYA 1SVXB 1YTVA 1POTA 2KLFA 4HS7A 1QULA 4R75A 4G8HA 3PPPA 1I6AA 2I0BA 3MC2A 3DM0A 4NG7A 3CHGA 1A7LA 3H6TA 2QS3A 2DP8A 5AA2B 2ONRA 4ELQA 3QUFA 2WYKA 3C31A 3VVEA 5HPQA 3IORA 3GBBA 1L5TA 3SESA 4JVCA 4P0GA 5L9SA 2Q8JA 2FNCA 1B5HA 5FTHA 3QSLA 4NF8A 3C4MA 4N15A 1D4NA 3K4UA 2Q8MA 2BJJX 3OENA 3IFCA 3UK4A 4OVTA 1MY0A 2ABHA 4BLAA 4EF1A 1LAGE 4PDHA 1DOTA 1LSTA 4MCOA 4GL8A 4RA1A 1SD3A 2PBWA 4FAJA 1IMAA 1LBVA 1LGBC 4P1EA 1D9QA 3TKDA 3BIHA 1HSJA 5EHSA 1XVXA 2RC9A 1VFDA 3SZPA 3TZAA 1YCJA 5BUUA 4PFWA 1Y1MA 4ZZEA 3G3KA 3G3GA 4KYEA 1MXUA 3M3KA 2GQ1A 2L5VA 2CEYA 1ZBMA 2ZZVA 2DWIA 2VOZA 2XXYA 3R7XA 3ZKLA 4EQ7A 5AA4A 4IR8A 2GHAA 4PF8A 4U2RA 1FTKA 5F1QA 4AB6A 2O1LA 3CFZA 1B3FA 1O64A 1M5CA 2DWJA 3QUJA 2OLBA 2A5TB 2V84A 3PUZE 3HCQA 3TODA 1MQDA 2XXTA 1FPFA 1QJMA 1MG1A 2NUVA 3MJNA 2HAVA 4LZ5A 2I4BA 4QXDA 5I59A 3OMBA 1MY1A 2Y84A 4PCDA 1FQAA 4R6KA 5TP9A 3EQ1A 3QIMA 1UIUA 4IGRA 3TQWA 2QVVA 2QS4A 1Y9UA 1Q9DA 2WBDA 2X26A 2V3QA 1RKMA 4R2BA 3G3HA 1QGXA 2MKZA 1NUXA 4GWSA 1M5BA 1WVJA 2WX9A 3T9HB 5B7DA 4OETA 2F35A 3CG1A 3E9XA 4NF0A 3I3VA 4LN5A 4YB6A 3SEUA 4MLQA 3IB2A 2QPQA 4NF4A 4KR5A 2ZYMA 4H45A 2PCRA 2O69A 3IJXB 3LC8A 5IZ3B 2DXYA 2RKMA 3TCHA 2DQVA 2I3VA 4JWYA 4IO5A 2O1MA 4ZEKA 1ZU0A 3LSXA 1LB9A 2QS2A 2PVUA 1B3HA 2O84X 3SKPA 4H46A 4ZZAA 1DMBA 1EZPA 2REJA 2PX1A 1JW5A 3PUYE 2H25A 2HEUA 1P1WA 4GIZA 2I48A 5ET8A 4OTEA 5CMMA 3RT8A 1B51A 1K9YA 2HAUA 2ZYOA 4Q30B 4FBPA 1MY4A 2DXRA 5H8QA 2ZZWA 4QBAA 4LZ8A 4MNPA 1PB7A 4RNSA 3R26A 2ZNTA 2Y7RA 4BDMA 4LQ2A 4OA4A 4ZEFA 2LAOA 3K6VA 4F3GA 4F29A 3MVXA 2QMXA 5I2KB 2Q74A 1PB9A 2G93A 3VXBA 3N26A 4IGTA 4QSDA 1NUYA 2A5SA 4GRKA 1XS5A 1H43A 3ZS6A 4ESXA 1SW4A 4BDOA 3K01A 3U93A 1AL3A 2VPOA 2OCUA 1FTOA 3EF7A 4FECA 1M5FA 3KSXA 4EQ9A 5A5XB 4MHFA 4P1LA 4QFNA 1QUIA 5I3SA 3VXCA 4PP0A 4H6DA 3FVKA 2QRYA 4DDDA 5AA2A 4NX1A 2RC8A 5AA3A 1HSLA 3K6UA 1FJ9A 3IFAA 4KYDA 5L8DA 1NV1A 3AXFA 3V5AA 1G0HA 1ZMGA 3TQLA 2OK2A 1FPKA 3B6QA 2V25A 2YPNA 4H0WA 2QFLA 4MEVA 1YYZA 4AS5A 2UVGA 2Z23A 2Y7IA 4DCYA 1PC3A 2ESNA 2NVUB 4POWA 2I58A 2DWAA 3PPNA 4MMPA 1Z7NE 1LCFA 1DSNA 4DLDA 3KBZA 4PFBA 4KHZE 2OJTA 4NGUA 3MZBA 2F8DA 2Z8DA 5DW8A 1B7ZA 1EYJA 3Q27A 1FPLA 5FHNA 2OWTA 1N7XA 4JWXA 1LFGA 4YICA 5ICTA 3HO7A 4F3BA 3TTKA 3H6VA 1NI9A 4F22A 1NFTA 4OVQA 2F7CA 3LVUA 1US5A 2ZNSA 3RPWA 1FQCA 3DRHA 3E79A 3OEMA 1TXFA 1P99A 3WAEA 2VD3A 4OENA 3R6UA 2X7PA 3CR9A 3VLWA 1PDAA 2B3FA 1NV6A 2A5TA 2UVJA 1VE4A 4FIMA 4UA8A 4EF2A 1DCUA 3WAFA 1GGGA 2F5XA 4QFPA 3OD7A 3G3IA 3T9UA 1BIYA 3RPLA 2WOLA 3K1NA 4F1VA 1LCTA 1A55A 1OVTA 5ITPA 1DBZA 3LBSA 3MVYA 2HZLA 2DOJA 2DE4A 4ZDMA 4DZ1A 5BWJA 3QAXA 3MZ9A 4X9TA 3RQTA 2NWJA 1CNQA 5CI5A 3T66A 2XX7A 2H5YA 2VHAA 4XF5A 3H03A 2H4IA 4XKRA 1OQHA 4ZEIA 3MZ1A 2XWOA 3T96B 3W9VA 4PETA 4DI3D 1II5A 2PYYA 2HQ0A 4G61A 3MYUA 3EKIA 1XC1A 1GVCA 4YMBA 4THIA 4RJZA 2Q89A 4G2ZA 4GWYA 5J1DA 4ZEBA 5F24A 3IAZA 1JP4A 4GX4A 1JW1A 1FSAA 4N8YA 3FVOA 2Z22A 1SPIA 5IZ3A 4QSCA 2DVCA 4WXJA 4EQBA 2AYSA 1IMBA 1NMUA 2UVHA 3HHFA 1SW1A 1OLCA 1B46A 4IO6A 1B32A 3G7WA 4O3BA 2VP1A 2HHMA 1Y4TA 4LONB 3PV0E 1B3LA 1XT8A 4GQOA 4U4SA 1UTHB 4KD5A 1H45A 2OWSA 5CM6A 1EYKA 3LUYA 5H8QB 1URSA 5A5LA 2DYXA 1YAEA 4ZE8A 4OEVA 1RDXA 2HXRA 1CB6A 3ONMA 1RYOA 3D4CA 5I58B 4PGNA 2XX8A 5JEIA 1TWYA 3MSTA 2XXUA 2OX3A 1B52A 1BKAA 3VFJA 1D9YA 4ZS9A 4N07A 2VGQA 5FTIA 5CMKA 3FXBA 1MY2A 3V83A 4P56A 4K3FA 3FV2A 5I2KA 2ONSA 5AA1A 2DWHA 1IXCA 1LLSA 2XWKA 4NWDA 4NF5B 3U8QA 4KI0E 2F6PA 2P3NA 3H4ZA 1SI0A 4RK9A 2XXKA 4L17A 3K2DA 1K9ZA 2FHYA 4XTCQ 1R1NA 1LBYA 5I2NB 3PUWE 3KJ7A 2XD2A 4PF6A 3DRIA 1T0KA 5IZ1A 5A5XA 3MUQA 1NV3A 4PFYA 5H8NB 2FBPA 1FPJA 3GBAA 3C36A 3FIRA 3P7IA 4WEPA 5K2YA 3O6HA 4G68C 3S9EA 1IZ1A 4FEBA 4JXIA 1FQBA 2ALUA 1EYIA 5ICQA 3HFUA 2V3TA 2V3UA 3VE1B 1B2HA 1NV7A 1DTZA 3IJOB 5ELVA 1IXGA 1J1NA 4QFOA 2OWZA 3LSFB 4PBHA 1LB8A 3D1RA 4IO4A 4OFJA 1IMFA 1SBPA 4Q0CA 2F3DA 3Q25A 1B3EA 3UN6A 3ROJA 1USYE 1R9LA 5CBRA 3PD9A 4PC9A 2REGA 2HZKA 2ZYKA 2DS9A 1P1UA 4JSOA 1URGA 1N84A 4R9GA 1IQ7A 2FIXA 4H8JA 3UIFA 1N76A 3KBRA 2KR0A 2OBGA 1LBCA 4PFRA 3EHUA 4IO3A 4KQPA 4H1XA 4WEDA 2P0SA 3UGWA 3RTFB 4NMYA 2ANJA 1JEVA 3EPEA 3PPRA 1SQYA 2QVRA 5AE4A 1MH4A 4JBZA 1RDYA 2O6AA 2Q88A 1MM7A 2W7YA 1Y3NA 1FTLA 2M8CA 3TUSA 4MAGA 3H7MA 3KSJA 1LBWA 1FPEA 4BDQA 1ANFA 4XKQA 3RPLB 3SEYA 2RC7A 3IOWA 3O6IA 2QL3A 5HM4B 3T9VA 4P9KA 4YB5A 1JETA 1USYH 3IOTA 5ET6A 4NEDA 2THIA 3EHTA 4GOTA 2NOOA 5DEXB 4LA9A 4R9FA 3FUZA 2PT1A 1MXWA 3FVNA 2XX9A 1ZLQA 1AH5A 1TFAA 3T9XB 1B0HA 1IITA 1IXHA 3EN3A 4QFLA 4U1OA 2UVIA 1Q35A 3FXUA 2XXXA 3QYTA 1A40A 1A99A 4OFOA 2HXWA 2VT5A 3E13X 1VSOA 3QK6A 4ND9A 2YJPA 1KWHA 3GLBA 4M4GA 4F2OA 4HE1A 4OWDA 5CBSA 4YMAA 2CZKA 3U92A 4R6YA 3T1BA 3K1PA 1ELJA 1ZTYA 4G77A 5I7IA 1NV5A 3BFUA 3DRKA 2P3VA 4R73A 4G68A 5KDTB 3TCFA 1PEBA 2RF1A 4O7MA 4X1BA 1ZIUA 4KPTA 1B4HA 3FJMA 1LAXA 4PDDA 4EXLA 5TU0A 4HCYA 3FJ7A 4HE0A 4JSDA 4C0RA 1UTHA 4U1ZA 3HV1A 1NNFA 3W9WA 4I9DA 3RNNA 4P47A 3IOUA 1NUWA 1XOCA 1NNPA 3PGFA 3MVZA 5I58A 4TQUQ 4OMBA 3B7DA 1FPIA 3TPAA 2Y7WA 4RXLA 4RPOA 1FBEA 1ZJLA 3F11A 1MDQA 3OO7A 1A54A 4ELRA 1I6QA 1EH3A 1Z7ME 1UIVA 1FBDA 5EQ8A 3B6TA 3KN7A 3OELA 4HXVA 4GX3A 1Y20A 4GD5A 3FD3A 2NXOA 3U94A 4NF5A 3RT6B 2XA5A 3B8BA 2I6EA 5H8FB 4N91A 2UYEA 5I2NA 4X48A 2IA4A 1B1XA 4U21A 3ECRA 4DXBA 2CZHA 4PAIA 1NH7A 2Z8FA 4Z7EA 5HBCA 3H3GA 2WKYA 3MP6A 5H8NA 1H44A 1B9JA 3TAJA 4QSEA 4U4XA 1YPNA 4IY6A 3THIA 5TPAB 1EU8A 5EYHA 4PAFA 2R8TA 5EQAA 3MBPA 2CEXA 2QVUA 5DVIA 3K6XA 4AS4A 2CZIA 4QF9A 3DP8A 1LFHA 3IL1B 1H3DA 1UQWA 3IO4A 3USDA 3PTYA 4JDFA 1MXVA 2DVZA 5LTCA 3VV5A 1FRPA 1MPBA 5IAIA 1OVBA 3C34A 2RINA 4G8MA 3FATA 3FV1A 3E78A 1H76A 2F3BA 4U22A 4ECFA 4P0IA 3TYHA 1FPBA 1WODA 5L9MA 3U65A 2FA7A 3PU5A 5L9OA 4OHNA 3SEXA 3ILTB 4FE8A 5I84A 2XWIA 3IB0A 3A09A 3FGSA 2VPNA 1IIWA 4DE8A 4XEQA 4Q8RA 4XKNA 4GWOA 3KC1A 3HN0A 5CRYA 2Q2CA 1GV8A 3MPLA 4UACA 4GWZA 1S50A 1MPDA 3CVGA 4QRZA 4O3CA 3V89B 3OOAA 3KZGA 1FBPA 3E4RA 3ZSFA 3FJGA 1PB8A 2X7QA 2FYIA 2RCBA 1OQGA 3K6WA 4ZECA 2HCAA 3E3KA 3B50A 2B4MA 1B40A 1LAFE 3UORA 1NUZA 2FVZA 2I4CA 3I6VA 1MPCA 4XKPA 3K0VA 4PGPA 4HW8A 2F78A 5DEXA 2QS1A 4POXA 1JVYA 4ZEDA 4HCWA 1B7HA 3T22A 4R74A 3PAMA 3U1OA 5DYHA 3VLUA 4MNIA 1FBCA 2F6GA 2XXRA 1LAHE 3N6TA 2ONKE 5ITOA 3A3CA 4NHBA 1MY3A 4TLMB 3VVFA 3TTRA 2IEEA 4M1VA 4C1UA 2XXQA 4PTKA 3LUZA 4H5FA 1BK4A 2E1SA 4EXKA 4G68B 1NKXA 1P1OA 4LZ7A 4YKPA 2GRVA 1JW4A 3M3FA 1XVYA 2GFEA 3SEWA 5KDTA 3DRJA 2F7AA 2I0CA 3ODBA 1FTAA 4HTGA 2YLNA 4EDPA 1YXIA 1N0TA 4E0WA 4DXCA 2GHBA 3KC0A 1FTMA 4HE2A 4BDLA 3MW0A 3DLNA 5FBPA 1US4A 3LV0A 3BKIB 4YKKA 2WEFA 4GF8A 4OVJA 5CMBA 2Q9TA 3JZJA 1IMDA 4F39A 3C9HA 1MQGA 2R6GE 3PPOA 1MQHA 2HFBA 3GXAA 5K2XA 1VR5A 1QUKA 4WKMA 3RUMA 1B3GA 3OSQA 3VLVA 1B58A 1FQEA 1N7WA 3KGCA 1ZKBA 3M8UA 1CE2A 2PFYA 2DSFA 4GVOA 5FHOA 1MDP1 1FBFA 1N3WA 4P3LA 3C35A 3TELA 2XXVA 2QMWA 4F31B 3O6PA 4O94A 1P1NA 5DVFA 4H8IA 5ISUA 3LR1A 4PFTA 4LUBA 5H8FA 1FW0A 3FVGA 2XXHA 1EZOA 2XWVA 3DRFA 4MJOA 5CC2A 1JEUA 3EHSA 3A3UA 4ELOA 5EHMA 3IOVA 2H9BA 4GLIA 1VDWA 4R72A 2WOKA 1QVSA 3JYRA 5TPAA 4F18A 5ET5A 2Y7PA 4OVRA 3OO9A 4P8BA 3FASA 3H06B 1IUDA 4N6KA 1JQFA 5JTYB 1B4ZA 4Z0IA 4PAKA 5DTBA 3CFXA 3MP8A 3MPKA 4N6DA 1B1HA 3CFLA 5EQ9A 1LBBA 1MRPA 3RY3A 2HPGA 1LEVA 4X8RA 3T0JA 5I57B 5F7VA 2B3BA 4C1TA 4ZE9A 4UABA 3G3FA 4YKIA 3OO8A 1Y3PA 3OO6A 1AWBA 1NV4A 1NNKA 1Y1ZA 3S4UA 5KCJB 2QJEA 4N4UA 1EZ9A 3KOSA 3L6GA 4FATA 5M2VA 3H6UA 3U72A 1SW2A 3C32A 3KN8A 1B6HA 3VVDA 1IXIA 3LSLA 3O97A 1NV2A 1MXXA 1RYXA 3MAMA 2KQZA 1FQFA 1F9BA 4LATA 1A8EA 3DP6A 5EYFA 3RYBA 4OFLA 3ILUB 4PE5B 1QKBA 4OYVA 4G8NA 1IMCA 4OANA 5LOMA 1N04A 3CSGA 4NTLA 3KOTA 2D21A 1MH3A 1Y4CA 4DCXA 3TMGA 3FBPA 5DVJA 4XFEA 1URDA
chains in the Genus database with same CATH topology
4NF6B 2F36A 3K00A 3KN3A 2Y7KA 5H8HB 3V8XB 2UXAA 3CIJA 4PQJA 4X1DA 1O63A 1UTBB 2OZZA 1Y3QA 3N6UA 2QSXA 3RGYA 4OERA 3FXQA 2ZXTA 1B5JA 3K02A 1BLFA 1D9VA 2AIXA 4LVQA 3RTWB 2XXIA 3M3LA 4FEDA 2I49A 1BTJA 4IY5A 1NH8A 3BBRA 2XD3A 5I56B 1AOVA 4AQ4A 1M5DA 1NL5A 3SDFA 2ZMBA 2XHDA 2R71A 2ZNUA 4RY1A 3HSTA 3RLFE 1ATGA 1R6ZA 1OIBA 3PMVA 3OSRA 4JB7A 3S9LC 3TEPA 4YAHX 1I6BA 3TCGA 3UP9A 4F3PA 3IX1A 1QKAA 4OEUA 4N13A 3PPQA 3SEVA 3PD8A 4TLLB 5B70A 1BP5A 1Q1KA 3DELB 4KCDA 1DTGA 1SW5A 4F1YA 4I8CA 3KFMA 4GFRA 1QW0A 4KYSA 1OLAA 3TDJA 1FCKA 1MM6A 3FZVA 4E0XA 3JV9A 1M5EA 2H98A 4MF3A 3N5LA 4EUOA 4DIGA 4I1DA 4YKJA 4F2QA 3MWBA 4YB7A 3N94A 1S9TA 1R9QA 3FXRA 1D3KA 2XXPA 1HSEA 2B4LA 3CG3A 3L6HA 4R6HA 4AB5A 3HPIA 1AIVA 1TFDA 1A8FA 3O9PA 3CSBA 4LQ5A 2O51A 4I62A 3O28A 4YU0A 4F3SA 4RK2A 2O7UA 3IK6B 3IR1A 3KEIA 1FQDA 4IB2A 4XXUA 4PFUA 1IEJA 4NF8B 4MBPA 3PMXA 3RN8A 4BDRA 3PUXE 1B0LA 1O7TA 3RYAA 3TTMA 1SYIA 2GH9A 4LP2B 3W15C 5JTYA 5IKBA 4F1UA 1P1QA 2AL5A 2I3WA 3D4GA 3DRGA 2F34A 2B65A 1AMFA 2D3IA 4MH5A 4ONYA 3LSWA 4F19A 4NWCA 5JK4A 1GR2A 1I69A 2WOPA 3VDFA 5I57A 3Q28A 4RYAA 3BFTA 3Q29A 2F97A 4TOZA 3TTNA 3TTLA 1PBPA 2CMOA 5KZTA 2H99A 5KCJA 3MQ9A 4O3AA 5AA2D 1MS7A 4ISUA 4QHQA 2D5WA 2P2AA 2UYFA 2XXWA 3QXMA 1OMPA 5AA4B 2PT2A 3S9MC 4KCCA 4OESA 3S2VA 3K1MA 1B5IA 4MFIA 3CI8A 4QFKA 2VD2A 1DPEA 3IO6A 3KJTA 1MQJA 4YZZA 2AL4A 4IO2A 3G3JA 5I59B 1FTJA 2PMSA 3PUVE 3SERA 3KG2A 5TP9B 1JNFA 4RPNA 2RCAA 4NF6A 4XIGQ 3SETA 3DP4A 4GXSB 1MXYA 5H8HA 4U23A 4G4PA 4H67A 4JWOA 2E0SA 1UTBA 1GTKA 1SDXA 1MXZA 1JVXA 1VFEA 5DT6A 4FJPA 5CMCA 3OEKA 1QUJA 2V93A 1WDNA 1DPPA 4GXAA 3ZKKA 4NF4B 3O6GA 2F7BA 3CRBA 4NE4A 3GZGA 5I56A 3FTOA 4IO7A 2ZYNA 4OZ9A 1SYHA 4FORA 1SI1A 3OXNA 3UA8A 3C33A 3S9NC 2P1SA 3HHGA 4BDNA 1MQIA 4P11A 4H65A 3Q26A 3TFLA 1B7UA 4KFQA 3H6WA 1POY1 4ELPA 3O66A 4R2FA 4N6PA 2CZLA 2DE3A 3MP1A 1LFIA 1PBQA 1NNTA 2O7IA 3O29A 2R9JA 3PMWA 4OQOA 4DXUA 3I5OA 2DE2A 2G29A 3B6WA 3MVWA 1TT1A 1S7YA 4MLVA 3T93B 2Z8EA 3O2AA 3IB1A 1B05A 4H5GA 4Q5TA 1N3XA 4GL0A 5FHMA 4ESWA 5H8SA 4OXVA 2O68A 2Q2AA 1XHYA 1SVXB 1YTVA 1POTA 2KLFA 4HS7A 1QULA 4R75A 4G8HA 3PPPA 1I6AA 2I0BA 3MC2A 3DM0A 3CHGA 1A7LA 3H6TA 2QS3A 2DP8A 5AA2B 2ONRA 4ELQA 3QUFA 3C31A 3VVEA 5HPQA 3IORA 3GBBA 1L5TA 3SESA 4P0GA 5L9SA 2Q8JA 2FNCA 1B5HA 5FTHA 3QSLA 4NF8A 3C4MA 1D4NA 3K4UA 2BJJX 3OENA 3UK4A 1MY0A 2ABHA 4BLAA 4EF1A 1LAGE 1DOTA 1LSTA 4GL8A 4RA1A 1SD3A 2PBWA 4FAJA 1LGBC 3TKDA 1HSJA 5EHSA 1XVXA 2RC9A 1VFDA 3TZAA 1YCJA 5BUUA 4PFWA 1Y1MA 4ZZEA 3G3KA 3G3GA 4KYEA 1MXUA 3M3KA 1ZBMA 2DWIA 2VOZA 2XXYA 3R7XA 3ZKLA 4EQ7A 5AA4A 2GHAA 4U2RA 1FTKA 5F1QA 4AB6A 2O1LA 3CFZA 1B3FA 1O64A 1M5CA 2DWJA 3QUJA 2OLBA 2A5TB 2V84A 3PUZE 3HCQA 3TODA 1MQDA 2XXTA 1QJMA 1MG1A 2NUVA 3MJNA 2HAVA 4LZ5A 2I4BA 5I59A 3OMBA 1MY1A 2Y84A 1FQAA 4R6KA 5TP9A 3EQ1A 3QIMA 1UIUA 4IGRA 3TQWA 2QS4A 1Y9UA 2X26A 2V3QA 1RKMA 4R2BA 3G3HA 1M5BA 1WVJA 3T9HB 5B7DA 4OETA 2F35A 3CG1A 3E9XA 3I3VA 4YB6A 3SEUA 4MLQA 3IB2A 2QPQA 4NF4A 4KR5A 2ZYMA 2O69A 3IJXB 3LC8A 2DXYA 2RKMA 3TCHA 2DQVA 2I3VA 4JWYA 4IO5A 2O1MA 4ZEKA 1ZU0A 3LSXA 1LB9A 2QS2A 2PVUA 1B3HA 2O84X 3SKPA 4ZZAA 1DMBA 1EZPA 2REJA 2PX1A 1JW5A 3PUYE 2H25A 2HEUA 1P1WA 4GIZA 2I48A 4OTEA 5CMMA 3RT8A 1B51A 2HAUA 2ZYOA 4Q30B 5H8QA 1MY4A 2DXRA 4LZ8A 1PB7A 4RNSA 3R26A 2ZNTA 2Y7RA 4BDMA 4LQ2A 4ZEFA 2LAOA 3K6VA 4F3GA 4F29A 3MVXA 2QMXA 5I2KB 1PB9A 2G93A 3VXBA 3N26A 4IGTA 4QSDA 2A5SA 4GRKA 1XS5A 1H43A 3ZS6A 4ESXA 1SW4A 4BDOA 3K01A 3U93A 1AL3A 2OCUA 1FTOA 3EF7A 4FECA 1M5FA 3KSXA 4EQ9A 5A5XB 4QFNA 1QUIA 3VXCA 4PP0A 4H6DA 3FVKA 2QRYA 4DDDA 5AA2A 2RC8A 5AA3A 1HSLA 3K6UA 4KYDA 5L8DA 3AXFA 3V5AA 1ZMGA 3TQLA 2OK2A 3B6QA 2V25A 2YPNA 4H0WA 2UVGA 2Z23A 2Y7IA 4DCYA 1PC3A 2ESNA 2NVUB 4POWA 2I58A 2DWAA 3PPNA 1Z7NE 1LCFA 1DSNA 4DLDA 4KHZE 2OJTA 3MZBA 2F8DA 2Z8DA 1B7ZA 3Q27A 5FHNA 2OWTA 1N7XA 4JWXA 1LFGA 4YICA 5ICTA 3HO7A 4F3BA 3TTKA 3H6VA 4F22A 1NFTA 2F7CA 3LVUA 1US5A 2ZNSA 3RPWA 1FQCA 3DRHA 3OEMA 1TXFA 1P99A 3WAEA 2VD3A 4OENA 3R6UA 2X7PA 3CR9A 3VLWA 1PDAA 2B3FA 2A5TA 2UVJA 1VE4A 4FIMA 4UA8A 4EF2A 3WAFA 1GGGA 2F5XA 4QFPA 3OD7A 3G3IA 3T9UA 1BIYA 2WOLA 3K1NA 4F1VA 1LCTA 1A55A 1OVTA 5ITPA 3LBSA 3MVYA 2HZLA 2DOJA 2DE4A 4ZDMA 4DZ1A 5BWJA 3QAXA 3MZ9A 4X9TA 3RQTA 2NWJA 5CI5A 3T66A 2XX7A 2H5YA 2VHAA 3H03A 2H4IA 4XKRA 1OQHA 4ZEIA 3MZ1A 3T96B 3W9VA 4PETA 1II5A 2PYYA 2HQ0A 1XC1A 1GVCA 4YMBA 4THIA 4RJZA 2Q89A 4G2ZA 5J1DA 4ZEBA 3IAZA 1JW1A 3FVOA 2Z22A 4QSCA 2DVCA 4WXJA 4EQBA 2AYSA 1NMUA 2UVHA 3HHFA 1SW1A 1OLCA 1B46A 4IO6A 1B32A 3G7WA 4O3BA 2VP1A 1Y4TA 4LONB 3PV0E 1B3LA 1XT8A 4GQOA 4U4SA 1UTHB 4KD5A 1H45A 2OWSA 5CM6A 3LUYA 5H8QB 1URSA 2DYXA 1YAEA 4ZE8A 4OEVA 1CB6A 3ONMA 1RYOA 3D4CA 5I58B 2XX8A 5JEIA 1TWYA 2XXUA 1B52A 1BKAA 3VFJA 1D9YA 4ZS9A 4N07A 2VGQA 5FTIA 5CMKA 1MY2A 3V83A 4K3FA 3FV2A 5I2KA 2ONSA 5AA1A 2DWHA 1IXCA 1LLSA 4NWDA 4NF5B 3U8QA 4KI0E 2F6PA 3H4ZA 1SI0A 4RK9A 4L17A 3K2DA 4XTCQ 1R1NA 5I2NB 3PUWE 3KJ7A 2XD2A 3DRIA 1T0KA 5A5XA 3MUQA 4PFYA 5H8NB 3GBAA 3C36A 3FIRA 3P7IA 4WEPA 5K2YA 3O6HA 4G68C 3S9EA 1IZ1A 4FEBA 4JXIA 1FQBA 2ALUA 5ICQA 2V3TA 2V3UA 3VE1B 1B2HA 1DTZA 3IJOB 5ELVA 1IXGA 1J1NA 4QFOA 3LSFB 1LB8A 4IO4A 4OFJA 1SBPA 4Q0CA 3Q25A 1B3EA 3UN6A 1USYE 1R9LA 5CBRA 3PD9A 2REGA 2HZKA 2ZYKA 2DS9A 1P1UA 4JSOA 1URGA 1N84A 4R9GA 1IQ7A 4H8JA 3UIFA 1N76A 3KBRA 2OBGA 1LBCA 3EHUA 4IO3A 4KQPA 4H1XA 4WEDA 2P0SA 3UGWA 3RTFB 4NMYA 2ANJA 1JEVA 3EPEA 3PPRA 1SQYA 5AE4A 1MH4A 4JBZA 2O6AA 2Q88A 1MM7A 2W7YA 1Y3NA 1FTLA 2M8CA 3TUSA 3H7MA 3KSJA 4BDQA 1ANFA 4XKQA 3SEYA 2RC7A 3IOWA 3O6IA 2QL3A 5HM4B 3T9VA 4YB5A 1JETA 1USYH 3IOTA 4NEDA 2THIA 3EHTA 4GOTA 2NOOA 5DEXB 4LA9A 4R9FA 3FUZA 2PT1A 1MXWA 3FVNA 2XX9A 1ZLQA 1AH5A 1TFAA 3T9XB 1B0HA 1IITA 1IXHA 3EN3A 4QFLA 4U1OA 2UVIA 1Q35A 3FXUA 2XXXA 3QYTA 1A40A 1A99A 4OFOA 2HXWA 3E13X 1VSOA 3QK6A 4ND9A 2YJPA 1KWHA 3GLBA 4M4GA 4F2OA 4OWDA 5CBSA 4YMAA 3U92A 4R6YA 3K1PA 1ELJA 1ZTYA 4G77A 3BFUA 3DRKA 4R73A 4G68A 5KDTB 3TCFA 1PEBA 2RF1A 4X1BA 1ZIUA 4KPTA 1B4HA 3FJMA 1LAXA 4EXLA 5TU0A 4HCYA 3FJ7A 4JSDA 4C0RA 1UTHA 4U1ZA 3HV1A 1NNFA 3W9WA 4I9DA 3RNNA 3IOUA 1XOCA 1NNPA 3PGFA 3MVZA 5I58A 4TQUQ 4OMBA 3B7DA 3TPAA 2Y7WA 4RXLA 4RPOA 1ZJLA 3F11A 1MDQA 3OO7A 1A54A 4ELRA 1I6QA 1EH3A 1Z7ME 1UIVA 3B6TA 3KN7A 3OELA 1Y20A 4GD5A 3FD3A 2NXOA 3U94A 4NF5A 3RT6B 2I6EA 5H8FB 2UYEA 5I2NA 4X48A 2IA4A 1B1XA 4U21A 3ECRA 4DXBA 1NH7A 2Z8FA 4Z7EA 5HBCA 3H3GA 2WKYA 3MP6A 5H8NA 1H44A 1B9JA 3TAJA 4QSEA 4U4XA 1YPNA 4IY6A 3THIA 5TPAB 1EU8A 3MBPA 5DVIA 3K6XA 4QF9A 3DP8A 1LFHA 3IL1B 1H3DA 1UQWA 3IO4A 3USDA 4JDFA 1MXVA 2DVZA 3VV5A 1MPBA 5IAIA 1OVBA 3C34A 2RINA 4G8MA 3FATA 3FV1A 1H76A 4U22A 4ECFA 4P0IA 3TYHA 1WODA 5L9MA 2FA7A 3PU5A 5L9OA 4OHNA 3SEXA 3ILTB 4FE8A 5I84A 3IB0A 3A09A 3FGSA 1IIWA 4DE8A 4Q8RA 4XKNA 4GWOA 3HN0A 5CRYA 2Q2CA 1GV8A 3MPLA 4UACA 1S50A 1MPDA 3CVGA 4QRZA 4O3CA 3V89B 3OOAA 3KZGA 3E4RA 3ZSFA 3FJGA 1PB8A 2X7QA 2FYIA 2RCBA 1OQGA 3K6WA 4ZECA 2HCAA 3E3KA 2B4MA 1B40A 1LAFE 3UORA 2I4CA 3I6VA 1MPCA 4XKPA 3K0VA 4HW8A 2F78A 5DEXA 2QS1A 4POXA 1JVYA 4ZEDA 4HCWA 1B7HA 3T22A 4R74A 3PAMA 3U1OA 5DYHA 3VLUA 2F6GA 2XXRA 1LAHE 3N6TA 2ONKE 5ITOA 3A3CA 1MY3A 4TLMB 3VVFA 3TTRA 2IEEA 4M1VA 4C1UA 2XXQA 4H5FA 2E1SA 4EXKA 4G68B 1NKXA 1P1OA 4LZ7A 4YKPA 2GRVA 1JW4A 3M3FA 1XVYA 2GFEA 3SEWA 5KDTA 3DRJA 2F7AA 2I0CA 3ODBA 4HTGA 2YLNA 4EDPA 1N0TA 4E0WA 4DXCA 2GHBA 1FTMA 4BDLA 3MW0A 3DLNA 1US4A 3BKIB 4YKKA 4GF8A 4OVJA 5CMBA 2Q9TA 3JZJA 4F39A 3C9HA 1MQGA 2R6GE 3PPOA 1MQHA 2HFBA 3GXAA 5K2XA 1VR5A 1QUKA 4WKMA 3RUMA 1B3GA 3OSQA 3VLVA 1B58A 1FQEA 1N7WA 3KGCA 1ZKBA 3M8UA 1CE2A 2DSFA 4GVOA 5FHOA 1MDP1 1N3WA 3C35A 3TELA 2XXVA 2QMWA 4F31B 3O6PA 1P1NA 5DVFA 4H8IA 5ISUA 3LR1A 4PFTA 4LUBA 5H8FA 1FW0A 3FVGA 2XXHA 1EZOA 3DRFA 5CC2A 1JEUA 3EHSA 3A3UA 4ELOA 5EHMA 3IOVA 2H9BA 4GLIA 4R72A 2WOKA 1QVSA 3JYRA 5TPAA 4F18A 2Y7PA 3OO9A 3FASA 3H06B 1IUDA 1JQFA 5JTYB 1B4ZA 4Z0IA 5DTBA 3CFXA 3MP8A 3MPKA 1B1HA 3CFLA 1LBBA 1MRPA 3RY3A 5I57B 5F7VA 2B3BA 4C1TA 4ZE9A 3G3FA 4YKIA 3OO8A 1Y3PA 3OO6A 1NNKA 1Y1ZA 3S4UA 5KCJB 2QJEA 1EZ9A 3KOSA 3L6GA 4FATA 5M2VA 3H6UA 3U72A 1SW2A 3C32A 3KN8A 1B6HA 3VVDA 1IXIA 3LSLA 3O97A 1MXXA 1RYXA 3MAMA 1FQFA 1F9BA 4LATA 1A8EA 3DP6A 5EYFA 3RYBA 4OFLA 3ILUB 4PE5B 1QKBA 4OYVA 4G8NA 5LOMA 1N04A 3CSGA 4NTLA 3KOTA 2D21A 1MH3A 1Y4CA 4DCXA 3TMGA 5DVJA 1URDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NF6 B;  2F36 A;  3K00 A;  3KN3 A;  2Y7K A;  5H8H B;  3V8X B;  2UXA A;  3CIJ A;  4PQJ A;  4X1D A;  1O63 A;  1UTB B;  2OZZ A;  1Y3Q A;  3N6U A;  2QSX A;  3RGY A;  4OER A;  3FXQ A;  2ZXT A;  1B5J A;  3K02 A;  1BLF A;  1D9V A;  2AIX A;  4LVQ A;  3RTW B;  2XXI A;  3M3L A;  4FED A;  2I49 A;  1BTJ A;  4IY5 A;  1NH8 A;  3BBR A;  2XD3 A;  5I56 B;  1AOV A;  4AQ4 A;  1M5D A;  1NL5 A;  3SDF A;  2ZMB A;  2XHD A;  2R71 A;  2ZNU A;  4RY1 A;  3HST A;  3RLF E;  1ATG A;  1R6Z A;  1OIB A;  3PMV A;  3OSR A;  4JB7 A;  3S9L C;  3TEP A;  4YAH X;  1I6B A;  3TCG A;  3UP9 A;  4F3P A;  3IX1 A;  1QKA A;  4OEU A;  4N13 A;  3PPQ A;  3SEV A;  3PD8 A;  4TLL B;  5B70 A;  1BP5 A;  1Q1K A;  3DEL B;  4KCD A;  1DTG A;  1SW5 A;  4F1Y A;  4I8C A;  3KFM A;  4GFR A;  1QW0 A;  4KYS A;  1OLA A;  3TDJ A;  1FCK A;  1MM6 A;  3FZV A;  4E0X A;  3JV9 A;  1M5E A;  2H98 A;  4MF3 A;  3N5L A;  4EUO A;  4DIG A;  4I1D A;  4YKJ A;  4F2Q A;  3MWB A;  4YB7 A;  3N94 A;  1S9T A;  1R9Q A;  3FXR A;  1D3K A;  2XXP A;  1HSE A;  2B4L A;  3CG3 A;  3L6H A;  4R6H A;  4AB5 A;  3HPI A;  1AIV A;  1TFD A;  1A8F A;  3O9P A;  3CSB A;  4LQ5 A;  2O51 A;  4I62 A;  3O28 A;  4YU0 A;  4F3S A;  4RK2 A;  2O7U A;  3IK6 B;  3IR1 A;  3KEI A;  1FQD A;  4IB2 A;  4XXU A;  4PFU A;  1IEJ A;  4NF8 B;  4MBP A;  3PMX A;  3RN8 A;  4BDR A;  3PUX E;  1B0L A;  1O7T A;  3RYA A;  3TTM A;  1SYI A;  2GH9 A;  4LP2 B;  3W15 C;  5JTY A;  5IKB A;  4F1U A;  1P1Q A;  2AL5 A;  2I3W A;  3D4G A;  3DRG A;  2F34 A;  2B65 A;  1AMF A;  2D3I A;  4MH5 A;  4ONY A;  3LSW A;  4F19 A;  4NWC A;  5JK4 A;  1GR2 A;  1I69 A;  2WOP A;  3VDF A;  5I57 A;  3Q28 A;  4RYA A;  3BFT A;  3Q29 A;  2F97 A;  4TOZ A;  3TTN A;  3TTL A;  1PBP A;  2CMO A;  5KZT A;  2H99 A;  5KCJ A;  3MQ9 A;  4O3A A;  5AA2 D;  1MS7 A;  4ISU A;  4QHQ A;  2D5W A;  2P2A A;  2UYF A;  2XXW A;  3QXM A;  1OMP A;  5AA4 B;  2PT2 A;  3S9M C;  4KCC A;  4OES A;  3S2V A;  3K1M A;  1B5I A;  4MFI A;  3CI8 A;  4QFK A;  2VD2 A;  1DPE A;  3IO6 A;  3KJT A;  1MQJ A;  4YZZ A;  2AL4 A;  4IO2 A;  3G3J A;  5I59 B;  1FTJ A;  2PMS A;  3PUV E;  3SER A;  3KG2 A;  5TP9 B;  1JNF A;  4RPN A;  2RCA A;  4NF6 A;  4XIG Q;  3SET A;  3DP4 A;  4GXS B;  1MXY A;  5H8H A;  4U23 A;  4G4P A;  4H67 A;  4JWO A;  2E0S A;  1UTB A;  1GTK A;  1SDX A;  1MXZ A;  1JVX A;  1VFE A;  5DT6 A;  4FJP A;  5CMC A;  3OEK A;  1QUJ A;  2V93 A;  1WDN A;  1DPP A;  4GXA A;  3ZKK A;  4NF4 B;  3O6G A;  2F7B A;  3CRB A;  4NE4 A;  3GZG A;  5I56 A;  3FTO A;  4IO7 A;  2ZYN A;  4OZ9 A;  1SYH A;  4FOR A;  1SI1 A;  3OXN A;  3UA8 A;  3C33 A;  3S9N C;  2P1S A;  3HHG A;  4BDN A;  1MQI A;  4P11 A;  4H65 A;  3Q26 A;  3TFL A;  1B7U A;  4KFQ A;  3H6W A;  1POY 1;  4ELP A;  3O66 A;  4R2F A;  4N6P A;  2CZL A;  2DE3 A;  3MP1 A;  1LFI A;  1PBQ A;  1NNT A;  2O7I A;  3O29 A;  2R9J A;  3PMW A;  4OQO A;  4DXU A;  3I5O A;  2DE2 A;  2G29 A;  3B6W A;  3MVW A;  1TT1 A;  1S7Y A;  4MLV A;  3T93 B;  2Z8E A;  3O2A A;  3IB1 A;  1B05 A;  4H5G A;  4Q5T A;  1N3X A;  4GL0 A;  5FHM A;  4ESW A;  5H8S A;  4OXV A;  2O68 A;  2Q2A A;  1XHY A;  1SVX B;  1YTV A;  1POT A;  2KLF A;  4HS7 A;  1QUL A;  4R75 A;  4G8H A;  3PPP A;  1I6A A;  2I0B A;  3MC2 A;  3DM0 A;  3CHG A;  1A7L A;  3H6T A;  2QS3 A;  2DP8 A;  5AA2 B;  2ONR A;  4ELQ A;  3QUF A;  3C31 A;  3VVE A;  5HPQ A;  3IOR A;  3GBB A;  1L5T A;  3SES A;  4P0G A;  5L9S A;  2Q8J A;  2FNC A;  1B5H A;  5FTH A;  3QSL A;  4NF8 A;  3C4M A;  1D4N A;  3K4U A;  2BJJ X;  3OEN A;  3UK4 A;  1MY0 A;  2ABH A;  4BLA A;  4EF1 A;  1LAG E;  1DOT A;  1LST A;  4GL8 A;  4RA1 A;  1SD3 A;  2PBW A;  4FAJ A;  1LGB C;  3TKD A;  1HSJ A;  5EHS A;  1XVX A;  2RC9 A;  1VFD A;  3TZA A;  1YCJ A;  5BUU A;  4PFW A;  1Y1M A;  4ZZE A;  3G3K A;  3G3G A;  4KYE A;  1MXU A;  3M3K A;  1ZBM A;  2DWI A;  2VOZ A;  2XXY A;  3R7X A;  3ZKL A;  4EQ7 A;  5AA4 A;  2GHA A;  4U2R A;  1FTK A;  5F1Q A;  4AB6 A;  2O1L A;  3CFZ A;  1B3F A;  1O64 A;  1M5C A;  2DWJ A;  3QUJ A;  2OLB A;  2A5T B;  2V84 A;  3PUZ E;  3HCQ A;  3TOD A;  1MQD A;  2XXT A;  1QJM A;  1MG1 A;  2NUV A;  3MJN A;  2HAV A;  4LZ5 A;  2I4B A;  5I59 A;  3OMB A;  1MY1 A;  2Y84 A;  1FQA A;  4R6K A;  5TP9 A;  3EQ1 A;  3QIM A;  1UIU A;  4IGR A;  3TQW A;  2QS4 A;  1Y9U A;  2X26 A;  2V3Q A;  1RKM A;  4R2B A;  3G3H A;  1M5B A;  1WVJ A;  3T9H B;  5B7D A;  4OET A;  2F35 A;  3CG1 A;  3E9X A;  3I3V A;  4YB6 A;  3SEU A;  4MLQ A;  3IB2 A;  2QPQ A;  4NF4 A;  4KR5 A;  2ZYM A;  2O69 A;  3IJX B;  3LC8 A;  2DXY A;  2RKM A;  3TCH A;  2DQV A;  2I3V A;  4JWY A;  4IO5 A;  2O1M A;  4ZEK A;  1ZU0 A;  3LSX A;  1LB9 A;  2QS2 A;  2PVU A;  1B3H A;  2O84 X;  3SKP A;  4ZZA A;  1DMB A;  1EZP A;  2REJ A;  2PX1 A;  1JW5 A;  3PUY E;  2H25 A;  2HEU A;  1P1W A;  4GIZ A;  2I48 A;  4OTE A;  5CMM A;  3RT8 A;  1B51 A;  2HAU A;  2ZYO A;  4Q30 B;  5H8Q A;  1MY4 A;  2DXR A;  4LZ8 A;  1PB7 A;  4RNS A;  3R26 A;  2ZNT A;  2Y7R A;  4BDM A;  4LQ2 A;  4ZEF A;  2LAO A;  3K6V A;  4F3G A;  4F29 A;  3MVX A;  2QMX A;  5I2K B;  1PB9 A;  2G93 A;  3VXB A;  3N26 A;  4IGT A;  4QSD A;  2A5S A;  4GRK A;  1XS5 A;  1H43 A;  3ZS6 A;  4ESX A;  1SW4 A;  4BDO A;  3K01 A;  3U93 A;  1AL3 A;  2OCU A;  1FTO A;  3EF7 A;  4FEC A;  1M5F A;  3KSX A;  4EQ9 A;  5A5X B;  4QFN A;  1QUI A;  3VXC A;  4PP0 A;  4H6D A;  3FVK A;  2QRY A;  4DDD A;  5AA2 A;  2RC8 A;  5AA3 A;  1HSL A;  3K6U A;  4KYD A;  5L8D A;  3AXF A;  3V5A A;  1ZMG A;  3TQL A;  2OK2 A;  3B6Q A;  2V25 A;  2YPN A;  4H0W A;  2UVG A;  2Z23 A;  2Y7I A;  4DCY A;  1PC3 A;  2ESN A;  2NVU B;  4POW A;  2I58 A;  2DWA A;  3PPN A;  1Z7N E;  1LCF A;  1DSN A;  4DLD A;  4KHZ E;  2OJT A;  3MZB A;  2F8D A;  2Z8D A;  1B7Z A;  3Q27 A;  5FHN A;  2OWT A;  1N7X A;  4JWX A;  1LFG A;  4YIC A;  5ICT A;  3HO7 A;  4F3B A;  3TTK A;  3H6V A;  4F22 A;  1NFT A;  2F7C A;  3LVU A;  1US5 A;  2ZNS A;  3RPW A;  1FQC A;  3DRH A;  3OEM A;  1TXF A;  1P99 A;  3WAE A;  2VD3 A;  4OEN A;  3R6U A;  2X7P A;  3CR9 A;  3VLW A;  1PDA A;  2B3F A;  2A5T A;  2UVJ A;  1VE4 A;  4FIM A;  4UA8 A;  4EF2 A;  3WAF A;  1GGG A;  2F5X A;  4QFP A;  3OD7 A;  3G3I A;  3T9U A;  1BIY A;  2WOL A;  3K1N A;  4F1V A;  1LCT A;  1A55 A;  1OVT A;  5ITP A;  3LBS A;  3MVY A;  2HZL A;  2DOJ A;  2DE4 A;  4ZDM A;  4DZ1 A;  5BWJ A;  3QAX A;  3MZ9 A;  4X9T A;  3RQT A;  2NWJ A;  5CI5 A;  3T66 A;  2XX7 A;  2H5Y A;  2VHA A;  3H03 A;  2H4I A;  4XKR A;  1OQH A;  4ZEI A;  3MZ1 A;  3T96 B;  3W9V A;  4PET A;  1II5 A;  2PYY A;  2HQ0 A;  1XC1 A;  1GVC A;  4YMB A;  4THI A;  4RJZ A;  2Q89 A;  4G2Z A;  5J1D A;  4ZEB A;  3IAZ A;  1JW1 A;  3FVO A;  2Z22 A;  4QSC A;  2DVC A;  4WXJ A;  4EQB A;  2AYS A;  1NMU A;  2UVH A;  3HHF A;  1SW1 A;  1OLC A;  1B46 A;  4IO6 A;  1B32 A;  3G7W A;  4O3B A;  2VP1 A;  1Y4T A;  4LON B;  3PV0 E;  1B3L A;  1XT8 A;  4GQO A;  4U4S A;  1UTH B;  4KD5 A;  1H45 A;  2OWS A;  5CM6 A;  3LUY A;  5H8Q B;  1URS A;  2DYX A;  1YAE A;  4ZE8 A;  4OEV A;  1CB6 A;  3ONM A;  1RYO A;  3D4C A;  5I58 B;  2XX8 A;  5JEI A;  1TWY A;  2XXU A;  1B52 A;  1BKA A;  3VFJ A;  1D9Y A;  4ZS9 A;  4N07 A;  2VGQ A;  5FTI A;  5CMK A;  1MY2 A;  3V83 A;  4K3F A;  3FV2 A;  5I2K A;  2ONS A;  5AA1 A;  2DWH A;  1IXC A;  1LLS A;  4NWD A;  4NF5 B;  3U8Q A;  4KI0 E;  2F6P A;  3H4Z A;  1SI0 A;  4RK9 A;  4L17 A;  3K2D A;  4XTC Q;  1R1N A;  5I2N B;  3PUW E;  3KJ7 A;  2XD2 A;  3DRI A;  1T0K A;  5A5X A;  3MUQ A;  4PFY A;  5H8N B;  3GBA A;  3C36 A;  3FIR A;  3P7I A;  4WEP A;  5K2Y A;  3O6H A;  4G68 C;  3S9E A;  1IZ1 A;  4FEB A;  4JXI A;  1FQB A;  2ALU A;  5ICQ A;  2V3T A;  2V3U A;  3VE1 B;  1B2H A;  1DTZ A;  3IJO B;  5ELV A;  1IXG A;  1J1N A;  4QFO A;  3LSF B;  1LB8 A;  4IO4 A;  4OFJ A;  1SBP A;  4Q0C A;  3Q25 A;  1B3E A;  3UN6 A;  1USY E;  1R9L A;  5CBR A;  3PD9 A;  2REG A;  2HZK A;  2ZYK A;  2DS9 A;  1P1U A;  4JSO A;  1URG A;  1N84 A;  4R9G A;  1IQ7 A;  4H8J A;  3UIF A;  1N76 A;  3KBR A;  2OBG A;  1LBC A;  3EHU A;  4IO3 A;  4KQP A;  4H1X A;  4WED A;  2P0S A;  3UGW A;  3RTF B;  4NMY A;  2ANJ A;  1JEV A;  3EPE A;  3PPR A;  1SQY A;  5AE4 A;  1MH4 A;  4JBZ A;  2O6A A;  2Q88 A;  1MM7 A;  2W7Y A;  1Y3N A;  1FTL A;  2M8C A;  3TUS A;  3H7M A;  3KSJ A;  4BDQ A;  1ANF A;  4XKQ A;  3SEY A;  2RC7 A;  3IOW A;  3O6I A;  2QL3 A;  5HM4 B;  3T9V A;  4YB5 A;  1JET A;  1USY H;  3IOT A;  4NED A;  2THI A;  3EHT A;  4GOT A;  2NOO A;  5DEX B;  4LA9 A;  4R9F A;  3FUZ A;  2PT1 A;  1MXW A;  3FVN A;  2XX9 A;  1ZLQ A;  1AH5 A;  1TFA A;  3T9X B;  1B0H A;  1IIT A;  1IXH A;  3EN3 A;  4QFL A;  4U1O A;  2UVI A;  1Q35 A;  3FXU A;  2XXX A;  3QYT A;  1A40 A;  1A99 A;  4OFO A;  2HXW A;  3E13 X;  1VSO A;  3QK6 A;  4ND9 A;  2YJP A;  1KWH A;  3GLB A;  4M4G A;  4F2O A;  4OWD A;  5CBS A;  4YMA A;  3U92 A;  4R6Y A;  3K1P A;  1ELJ A;  1ZTY A;  4G77 A;  3BFU A;  3DRK A;  4R73 A;  4G68 A;  5KDT B;  3TCF A;  1PEB A;  2RF1 A;  4X1B A;  1ZIU A;  4KPT A;  1B4H A;  3FJM A;  1LAX A;  4EXL A;  5TU0 A;  4HCY A;  3FJ7 A;  4JSD A;  4C0R A;  1UTH A;  4U1Z A;  3HV1 A;  1NNF A;  3W9W A;  4I9D A;  3RNN A;  3IOU A;  1XOC A;  1NNP A;  3PGF A;  3MVZ A;  5I58 A;  4TQU Q;  4OMB A;  3B7D A;  3TPA A;  2Y7W A;  4RXL A;  4RPO A;  1ZJL A;  3F11 A;  1MDQ A;  3OO7 A;  1A54 A;  4ELR A;  1I6Q A;  1EH3 A;  1Z7M E;  1UIV A;  3B6T A;  3KN7 A;  3OEL A;  1Y20 A;  4GD5 A;  3FD3 A;  2NXO A;  3U94 A;  4NF5 A;  3RT6 B;  2I6E A;  5H8F B;  2UYE A;  5I2N A;  4X48 A;  2IA4 A;  1B1X A;  4U21 A;  3ECR A;  4DXB A;  1NH7 A;  2Z8F A;  4Z7E A;  5HBC A;  3H3G A;  2WKY A;  3MP6 A;  5H8N A;  1H44 A;  1B9J A;  3TAJ A;  4QSE A;  4U4X A;  1YPN A;  4IY6 A;  3THI A;  5TPA B;  1EU8 A;  3MBP A;  5DVI A;  3K6X A;  4QF9 A;  3DP8 A;  1LFH A;  3IL1 B;  1H3D A;  1UQW A;  3IO4 A;  3USD A;  4JDF A;  1MXV A;  2DVZ A;  3VV5 A;  1MPB A;  5IAI A;  1OVB A;  3C34 A;  2RIN A;  4G8M A;  3FAT A;  3FV1 A;  1H76 A;  4U22 A;  4ECF A;  4P0I A;  3TYH A;  1WOD A;  5L9M A;  2FA7 A;  3PU5 A;  5L9O A;  4OHN A;  3SEX A;  3ILT B;  4FE8 A;  5I84 A;  3IB0 A;  3A09 A;  3FGS A;  1IIW A;  4DE8 A;  4Q8R A;  4XKN A;  4GWO A;  3HN0 A;  5CRY A;  2Q2C A;  1GV8 A;  3MPL A;  4UAC A;  1S50 A;  1MPD A;  3CVG A;  4QRZ A;  4O3C A;  3V89 B;  3OOA A;  3KZG A;  3E4R A;  3ZSF A;  3FJG A;  1PB8 A;  2X7Q A;  2FYI A;  2RCB A;  1OQG A;  3K6W A;  4ZEC A;  2HCA A;  3E3K A;  2B4M A;  1B40 A;  1LAF E;  3UOR A;  2I4C A;  3I6V A;  1MPC A;  4XKP A;  3K0V A;  4HW8 A;  2F78 A;  5DEX A;  2QS1 A;  4POX A;  1JVY A;  4ZED A;  4HCW A;  1B7H A;  3T22 A;  4R74 A;  3PAM A;  3U1O A;  5DYH A;  3VLU A;  2F6G A;  2XXR A;  1LAH E;  3N6T A;  2ONK E;  5ITO A;  3A3C A;  1MY3 A;  4TLM B;  3VVF A;  3TTR A;  2IEE A;  4M1V A;  4C1U A;  2XXQ A;  4H5F A;  2E1S A;  4EXK A;  4G68 B;  1NKX A;  1P1O A;  4LZ7 A;  4YKP A;  2GRV A;  1JW4 A;  3M3F A;  1XVY A;  2GFE A;  3SEW A;  5KDT A;  3DRJ A;  2F7A A;  2I0C A;  3ODB A;  4HTG A;  2YLN A;  4EDP A;  1N0T A;  4E0W A;  4DXC A;  2GHB A;  1FTM A;  4BDL A;  3MW0 A;  3DLN A;  1US4 A;  3BKI B;  4YKK A;  4GF8 A;  4OVJ A;  5CMB A;  2Q9T A;  3JZJ A;  4F39 A;  3C9H A;  1MQG A;  2R6G E;  3PPO A;  1MQH A;  2HFB A;  3GXA A;  5K2X A;  1VR5 A;  1QUK A;  4WKM A;  3RUM A;  1B3G A;  3OSQ A;  3VLV A;  1B58 A;  1FQE A;  1N7W A;  3KGC A;  1ZKB A;  3M8U A;  1CE2 A;  2DSF A;  4GVO A;  5FHO A;  1MDP 1;  1N3W A;  3C35 A;  3TEL A;  2XXV A;  2QMW A;  4F31 B;  3O6P A;  1P1N A;  5DVF A;  4H8I A;  5ISU A;  3LR1 A;  4PFT A;  4LUB A;  5H8F A;  1FW0 A;  3FVG A;  2XXH A;  1EZO A;  3DRF A;  5CC2 A;  1JEU A;  3EHS A;  3A3U A;  4ELO A;  5EHM A;  3IOV A;  2H9B A;  4GLI A;  4R72 A;  2WOK A;  1QVS A;  3JYR A;  5TPA A;  4F18 A;  2Y7P A;  3OO9 A;  3FAS A;  3H06 B;  1IUD A;  1JQF A;  5JTY B;  1B4Z A;  4Z0I A;  5DTB A;  3CFX A;  3MP8 A;  3MPK A;  1B1H A;  3CFL A;  1LBB A;  1MRP A;  3RY3 A;  5I57 B;  5F7V A;  2B3B A;  4C1T A;  4ZE9 A;  3G3F A;  4YKI A;  3OO8 A;  1Y3P A;  3OO6 A;  1NNK A;  1Y1Z A;  3S4U A;  5KCJ B;  2QJE A;  1EZ9 A;  3KOS A;  3L6G A;  4FAT A;  5M2V A;  3H6U A;  3U72 A;  1SW2 A;  3C32 A;  3KN8 A;  1B6H A;  3VVD A;  1IXI A;  3LSL A;  3O97 A;  1MXX A;  1RYX A;  3MAM A;  1FQF A;  1F9B A;  4LAT A;  1A8E A;  3DP6 A;  5EYF A;  3RYB A;  4OFL A;  3ILU B;  4PE5 B;  1QKB A;  4OYV A;  4G8N A;  5LOM A;  1N04 A;  3CSG A;  4NTL A;  3KOT A;  2D21 A;  1MH3 A;  1Y4C A;  4DCX A;  3TMG A;  5DVJ A;  1URD A; 
#chains in the Genus database with same CATH topology
 4GWX A;  4NF6 B;  2F36 A;  3K00 A;  3KN3 A;  2Y7K A;  5H8H B;  3V8X B;  2UXA A;  3CIJ A;  4PQJ A;  1IME A;  4X1D A;  1O63 A;  1UTB B;  2OZZ A;  3BIG A;  1Y3Q A;  4NN3 A;  4PFI A;  3N6U A;  2QSX A;  3RGY A;  4OER A;  4I3Y A;  3FXQ A;  2ZXT A;  1B5J A;  4O8M A;  3K02 A;  1BLF A;  1D9V A;  5J16 A;  2AIX A;  2Y5L A;  5EYG A;  4LVQ A;  3RTW B;  2XXI A;  3M3L A;  4FED A;  2I49 A;  1BTJ A;  4IY5 A;  1NH8 A;  3BBR A;  2XD3 A;  5I56 B;  1AOV A;  4AQ4 A;  1M5D A;  1DK4 A;  1NL5 A;  3SDF A;  2ZMB A;  2XHD A;  2R71 A;  2ZNU A;  4RY1 A;  1FPD A;  3HST A;  3RLF E;  1ATG A;  1R6Z A;  1OIB A;  3PMV A;  3OSR A;  4JB7 A;  3S9L C;  3TEP A;  4I3E A;  4MX6 A;  4YAH X;  1I6B A;  2PFZ A;  3TCG A;  3UP9 A;  4F3P A;  2JJK A;  3IX1 A;  1QKA A;  4OEU A;  4N8G A;  4GBW A;  4N13 A;  3PPQ A;  3ISP A;  3SEV A;  4MIJ A;  3PD8 A;  4TLL B;  5B70 A;  1YZ0 A;  1BP5 A;  1Q1K A;  5I5P A;  3DEL B;  1XI6 A;  4KCD A;  1DTG A;  1SW5 A;  4F1Y A;  4I8C A;  3KFM A;  4GFR A;  1QW0 A;  4KYS A;  5IGA A;  5ET7 A;  1OLA A;  3TDJ A;  1FCK A;  1MM6 A;  3FZV A;  4E0X A;  3JV9 A;  1M5E A;  2H98 A;  4MF3 A;  1RDZ A;  3N5L A;  4DIG A;  4EUO A;  4I1D A;  4YKJ A;  4F2Q A;  3MWB A;  4YB7 A;  3N94 A;  1S9T A;  1R9Q A;  3FXR A;  1D3K A;  2XXP A;  1HSE A;  2B4L A;  3CG3 A;  3L6H A;  4R6H A;  4AB5 A;  3HPI A;  1AIV A;  1KA1 A;  1TFD A;  1A8F A;  3O9P A;  3CSB A;  1FBG A;  3GYY A;  4LQ5 A;  2O51 A;  4MNC A;  4I62 A;  3O28 A;  2ZZX A;  5LDZ A;  4YU0 A;  4F3S A;  4RK2 A;  2O7U A;  3IK6 B;  3IR1 A;  3KEI A;  1FQD A;  4IB2 A;  4XXU A;  4PFU A;  1IEJ A;  4NF8 B;  4MBP A;  3PMX A;  3RN8 A;  4X04 A;  4BDR A;  3PUX E;  1B0L A;  1O7T A;  3RYA A;  3TTM A;  1SYI A;  2GH9 A;  4LP2 B;  3W15 C;  5JTY A;  5IKB A;  4F1U A;  1P1Q A;  2AL5 A;  2I3W A;  3D4G A;  3DRG A;  2F34 A;  2B65 A;  1AMF A;  2D3I A;  4MH5 A;  4ONY A;  3LSW A;  4F19 A;  4NWC A;  5JK4 A;  1GR2 A;  1I69 A;  2WOP A;  3VDF A;  5I57 A;  3Q28 A;  4GWU A;  3QMF A;  3BFT A;  4RYA A;  3Q29 A;  2F97 A;  4TOZ A;  3TTN A;  3TTL A;  2V4C A;  1KZ8 A;  1PBP A;  1KA0 A;  4GBV A;  2CMO A;  4PBQ A;  5KZT A;  2H99 A;  5KCJ A;  3MQ9 A;  4O3A A;  5AA2 D;  1MS7 A;  4ISU A;  4QHQ A;  4O7I A;  2D5W A;  2P2A A;  2UYF A;  2XXW A;  3QXM A;  1OMP A;  5AA4 B;  2PT2 A;  3S9M C;  4KCC A;  4OES A;  3S2V A;  1FBH A;  3K1M A;  1B5I A;  4MFI A;  1FJ6 A;  3CI8 A;  4QFK A;  2VD2 A;  1LBZ A;  1DPE A;  4GWW A;  3IO6 A;  3KJT A;  1MQJ A;  4YZZ A;  4NAP A;  2AL4 A;  4IO2 A;  3G3J A;  5I59 B;  1FTJ A;  2PMS A;  3PUV E;  2Y5K A;  3SER A;  3KG2 A;  5TP9 B;  1JNF A;  4RPN A;  2RCA A;  4NF6 A;  2WYP A;  2BJI A;  4XIG Q;  3SET A;  3DP4 A;  4GXS B;  4N81 A;  1MXY A;  5H8H A;  4U23 A;  4G4P A;  4H67 A;  4PE3 A;  4JWO A;  4OVS A;  2E0S A;  1UTB A;  1GTK A;  1SDX A;  1MXZ A;  4JVI A;  1JVX A;  2DDK A;  4OVP A;  1VFE A;  5DT6 A;  1NV0 A;  4FJP A;  5CMC A;  3OEK A;  4GX6 A;  1QUJ A;  2V93 A;  1WDN A;  3RYD A;  1G0I A;  4JVD A;  1DPP A;  4GXA A;  3ZKK A;  2FIE A;  4NF4 B;  3O6G A;  2F7B A;  3NOH A;  3CRB A;  4NE4 A;  3GZG A;  5I56 A;  3FTO A;  1FPG A;  4IO7 A;  2ZYN A;  4OZ9 A;  1SYH A;  1INP A;  4FOR A;  1SI1 A;  3OXN A;  3UA8 A;  3C33 A;  3S9N C;  5IM2 A;  2P1S A;  3HHG A;  4BDN A;  1MQI A;  4P11 A;  4H65 A;  5IZZ A;  5EQ7 A;  3Q26 A;  3TFL A;  1B7U A;  4KFQ A;  3H6W A;  1POY 1;  4NQ8 A;  4ELP A;  3O66 A;  4R2F A;  4N6P A;  2CZL A;  2DE3 A;  3MP1 A;  3A29 A;  5ESY A;  1LFI A;  1PBQ A;  1NNT A;  2O7I A;  4DI4 B;  3O29 A;  4I40 A;  2WBB A;  2R9J A;  3PMW A;  4OQO A;  4DXU A;  3I5O A;  2DE2 A;  2G29 A;  3B6W A;  3MVW A;  1TT1 A;  1S7Y A;  4KXP A;  4MLV A;  5T3J A;  2Z8E A;  3T93 B;  3O2A A;  3IB1 A;  1B05 A;  4N17 A;  4H5G A;  4Q5T A;  1N3X A;  4GL0 A;  5FHM A;  4ESW A;  1LBX A;  4OXV A;  5H8S A;  2O68 A;  2Q2A A;  1XHY A;  1SVX B;  1YTV A;  1POT A;  2KLF A;  4HS7 A;  1QUL A;  4R75 A;  4G8H A;  3PPP A;  1I6A A;  2I0B A;  3MC2 A;  3DM0 A;  4NG7 A;  3CHG A;  1A7L A;  3H6T A;  2QS3 A;  2DP8 A;  5AA2 B;  2ONR A;  4ELQ A;  3QUF A;  2WYK A;  3C31 A;  3VVE A;  5HPQ A;  3IOR A;  3GBB A;  1L5T A;  3SES A;  4JVC A;  4P0G A;  5L9S A;  2Q8J A;  2FNC A;  1B5H A;  5FTH A;  3QSL A;  4NF8 A;  3C4M A;  4N15 A;  1D4N A;  3K4U A;  2Q8M A;  2BJJ X;  3OEN A;  3IFC A;  3UK4 A;  4OVT A;  1MY0 A;  2ABH A;  4BLA A;  4EF1 A;  1LAG E;  4PDH A;  1DOT A;  1LST A;  4MCO A;  4GL8 A;  4RA1 A;  1SD3 A;  2PBW A;  4FAJ A;  1IMA A;  1LBV A;  1LGB C;  4P1E A;  1D9Q A;  3TKD A;  3BIH A;  1HSJ A;  5EHS A;  1XVX A;  2RC9 A;  1VFD A;  3SZP A;  3TZA A;  1YCJ A;  5BUU A;  4PFW A;  1Y1M A;  4ZZE A;  3G3K A;  3G3G A;  4KYE A;  1MXU A;  3M3K A;  2GQ1 A;  2L5V A;  2CEY A;  1ZBM A;  2ZZV A;  2DWI A;  2VOZ A;  2XXY A;  3R7X A;  3ZKL A;  4EQ7 A;  5AA4 A;  4IR8 A;  2GHA A;  4PF8 A;  4U2R A;  1FTK A;  5F1Q A;  4AB6 A;  2O1L A;  3CFZ A;  1B3F A;  1O64 A;  1M5C A;  2DWJ A;  3QUJ A;  2OLB A;  2A5T B;  2V84 A;  3PUZ E;  3HCQ A;  3TOD A;  1MQD A;  2XXT A;  1FPF A;  1QJM A;  1MG1 A;  2NUV A;  3MJN A;  2HAV A;  4LZ5 A;  2I4B A;  4QXD A;  5I59 A;  3OMB A;  1MY1 A;  2Y84 A;  4PCD A;  1FQA A;  4R6K A;  5TP9 A;  3EQ1 A;  3QIM A;  1UIU A;  4IGR A;  3TQW A;  2QVV A;  2QS4 A;  1Y9U A;  1Q9D A;  2WBD A;  2X26 A;  2V3Q A;  1RKM A;  4R2B A;  3G3H A;  1QGX A;  2MKZ A;  1NUX A;  4GWS A;  1M5B A;  1WVJ A;  2WX9 A;  3T9H B;  5B7D A;  4OET A;  2F35 A;  3CG1 A;  3E9X A;  4NF0 A;  3I3V A;  4LN5 A;  4YB6 A;  3SEU A;  4MLQ A;  3IB2 A;  2QPQ A;  4NF4 A;  4KR5 A;  2ZYM A;  4H45 A;  2PCR A;  2O69 A;  3IJX B;  3LC8 A;  5IZ3 B;  2DXY A;  2RKM A;  3TCH A;  2DQV A;  2I3V A;  4JWY A;  4IO5 A;  2O1M A;  4ZEK A;  1ZU0 A;  3LSX A;  1LB9 A;  2QS2 A;  2PVU A;  1B3H A;  2O84 X;  3SKP A;  4H46 A;  4ZZA A;  1DMB A;  1EZP A;  2REJ A;  2PX1 A;  1JW5 A;  3PUY E;  2H25 A;  2HEU A;  1P1W A;  4GIZ A;  2I48 A;  5ET8 A;  4OTE A;  5CMM A;  3RT8 A;  1B51 A;  1K9Y A;  2HAU A;  2ZYO A;  4Q30 B;  4FBP A;  1MY4 A;  2DXR A;  5H8Q A;  2ZZW A;  4QBA A;  4LZ8 A;  4MNP A;  1PB7 A;  4RNS A;  3R26 A;  2ZNT A;  2Y7R A;  4BDM A;  4LQ2 A;  4OA4 A;  4ZEF A;  2LAO A;  3K6V A;  4F3G A;  4F29 A;  3MVX A;  2QMX A;  5I2K B;  2Q74 A;  1PB9 A;  2G93 A;  3VXB A;  3N26 A;  4IGT A;  4QSD A;  1NUY A;  2A5S A;  4GRK A;  1XS5 A;  1H43 A;  3ZS6 A;  4ESX A;  1SW4 A;  4BDO A;  3K01 A;  3U93 A;  1AL3 A;  2VPO A;  2OCU A;  1FTO A;  3EF7 A;  4FEC A;  1M5F A;  3KSX A;  4EQ9 A;  5A5X B;  4MHF A;  4P1L A;  4QFN A;  1QUI A;  5I3S A;  3VXC A;  4PP0 A;  4H6D A;  3FVK A;  2QRY A;  4DDD A;  5AA2 A;  4NX1 A;  2RC8 A;  5AA3 A;  1HSL A;  3K6U A;  1FJ9 A;  3IFA A;  4KYD A;  5L8D A;  1NV1 A;  3AXF A;  3V5A A;  1G0H A;  1ZMG A;  3TQL A;  2OK2 A;  1FPK A;  3B6Q A;  2V25 A;  2YPN A;  4H0W A;  2QFL A;  4MEV A;  1YYZ A;  4AS5 A;  2UVG A;  2Z23 A;  2Y7I A;  4DCY A;  1PC3 A;  2ESN A;  2NVU B;  4POW A;  2I58 A;  2DWA A;  3PPN A;  4MMP A;  1Z7N E;  1LCF A;  1DSN A;  4DLD A;  3KBZ A;  4PFB A;  4KHZ E;  2OJT A;  4NGU A;  3MZB A;  2F8D A;  2Z8D A;  5DW8 A;  1B7Z A;  1EYJ A;  3Q27 A;  1FPL A;  5FHN A;  2OWT A;  1N7X A;  4JWX A;  1LFG A;  4YIC A;  5ICT A;  3HO7 A;  4F3B A;  3TTK A;  3H6V A;  1NI9 A;  4F22 A;  1NFT A;  4OVQ A;  2F7C A;  3LVU A;  1US5 A;  2ZNS A;  3RPW A;  1FQC A;  3DRH A;  3E79 A;  3OEM A;  1TXF A;  1P99 A;  3WAE A;  2VD3 A;  4OEN A;  3R6U A;  2X7P A;  3CR9 A;  3VLW A;  1PDA A;  2B3F A;  1NV6 A;  2A5T A;  2UVJ A;  1VE4 A;  4FIM A;  4UA8 A;  4EF2 A;  1DCU A;  3WAF A;  1GGG A;  2F5X A;  4QFP A;  3OD7 A;  3G3I A;  3T9U A;  1BIY A;  3RPL A;  2WOL A;  3K1N A;  4F1V A;  1LCT A;  1A55 A;  1OVT A;  5ITP A;  1DBZ A;  3LBS A;  3MVY A;  2HZL A;  2DOJ A;  2DE4 A;  4ZDM A;  4DZ1 A;  5BWJ A;  3QAX A;  3MZ9 A;  4X9T A;  3RQT A;  2NWJ A;  1CNQ A;  5CI5 A;  3T66 A;  2XX7 A;  2H5Y A;  2VHA A;  4XF5 A;  3H03 A;  2H4I A;  4XKR A;  1OQH A;  4ZEI A;  3MZ1 A;  2XWO A;  3T96 B;  3W9V A;  4PET A;  4DI3 D;  1II5 A;  2PYY A;  2HQ0 A;  4G61 A;  3MYU A;  3EKI A;  1XC1 A;  1GVC A;  4YMB A;  4THI A;  4RJZ A;  2Q89 A;  4G2Z A;  4GWY A;  5J1D A;  4ZEB A;  5F24 A;  3IAZ A;  1JP4 A;  4GX4 A;  1JW1 A;  1FSA A;  4N8Y A;  3FVO A;  2Z22 A;  1SPI A;  5IZ3 A;  4QSC A;  2DVC A;  4WXJ A;  4EQB A;  2AYS A;  1IMB A;  1NMU A;  2UVH A;  3HHF A;  1SW1 A;  1OLC A;  1B46 A;  4IO6 A;  1B32 A;  3G7W A;  4O3B A;  2VP1 A;  2HHM A;  1Y4T A;  4LON B;  3PV0 E;  1B3L A;  1XT8 A;  4GQO A;  4U4S A;  1UTH B;  4KD5 A;  1H45 A;  2OWS A;  5CM6 A;  1EYK A;  3LUY A;  5H8Q B;  1URS A;  5A5L A;  2DYX A;  1YAE A;  4ZE8 A;  4OEV A;  1RDX A;  2HXR A;  1CB6 A;  3ONM A;  1RYO A;  3D4C A;  5I58 B;  4PGN A;  2XX8 A;  5JEI A;  1TWY A;  3MST A;  2XXU A;  2OX3 A;  1B52 A;  1BKA A;  3VFJ A;  1D9Y A;  4ZS9 A;  4N07 A;  2VGQ A;  5FTI A;  5CMK A;  3FXB A;  1MY2 A;  3V83 A;  4P56 A;  4K3F A;  3FV2 A;  5I2K A;  2ONS A;  5AA1 A;  2DWH A;  1IXC A;  1LLS A;  2XWK A;  4NWD A;  4NF5 B;  3U8Q A;  4KI0 E;  2F6P A;  2P3N A;  3H4Z A;  1SI0 A;  4RK9 A;  2XXK A;  4L17 A;  3K2D A;  1K9Z A;  2FHY A;  4XTC Q;  1R1N A;  1LBY A;  5I2N B;  3PUW E;  3KJ7 A;  2XD2 A;  4PF6 A;  3DRI A;  1T0K A;  5IZ1 A;  5A5X A;  3MUQ A;  1NV3 A;  4PFY A;  5H8N B;  2FBP A;  1FPJ A;  3GBA A;  3C36 A;  3FIR A;  3P7I A;  4WEP A;  5K2Y A;  3O6H A;  4G68 C;  3S9E A;  1IZ1 A;  4FEB A;  4JXI A;  1FQB A;  2ALU A;  1EYI A;  5ICQ A;  3HFU A;  2V3T A;  2V3U A;  3VE1 B;  1B2H A;  1NV7 A;  1DTZ A;  3IJO B;  5ELV A;  1IXG A;  1J1N A;  4QFO A;  2OWZ A;  3LSF B;  4PBH A;  1LB8 A;  3D1R A;  4IO4 A;  4OFJ A;  1IMF A;  1SBP A;  4Q0C A;  2F3D A;  3Q25 A;  1B3E A;  3UN6 A;  3ROJ A;  1USY E;  1R9L A;  5CBR A;  3PD9 A;  4PC9 A;  2REG A;  2HZK A;  2ZYK A;  2DS9 A;  1P1U A;  4JSO A;  1URG A;  1N84 A;  4R9G A;  1IQ7 A;  2FIX A;  4H8J A;  3UIF A;  1N76 A;  3KBR A;  2KR0 A;  2OBG A;  1LBC A;  4PFR A;  3EHU A;  4IO3 A;  4KQP A;  4H1X A;  4WED A;  2P0S A;  3UGW A;  3RTF B;  4NMY A;  2ANJ A;  1JEV A;  3EPE A;  3PPR A;  1SQY A;  2QVR A;  5AE4 A;  1MH4 A;  4JBZ A;  1RDY A;  2O6A A;  2Q88 A;  1MM7 A;  2W7Y A;  1Y3N A;  1FTL A;  2M8C A;  3TUS A;  4MAG A;  3H7M A;  3KSJ A;  1LBW A;  1FPE A;  4BDQ A;  1ANF A;  4XKQ A;  3RPL B;  3SEY A;  2RC7 A;  3IOW A;  3O6I A;  2QL3 A;  5HM4 B;  3T9V A;  4P9K A;  4YB5 A;  1JET A;  1USY H;  3IOT A;  5ET6 A;  4NED A;  2THI A;  3EHT A;  4GOT A;  2NOO A;  5DEX B;  4LA9 A;  4R9F A;  3FUZ A;  2PT1 A;  1MXW A;  3FVN A;  2XX9 A;  1ZLQ A;  1AH5 A;  1TFA A;  3T9X B;  1B0H A;  1IIT A;  1IXH A;  3EN3 A;  4QFL A;  4U1O A;  2UVI A;  1Q35 A;  3FXU A;  2XXX A;  3QYT A;  1A40 A;  1A99 A;  4OFO A;  2HXW A;  2VT5 A;  3E13 X;  1VSO A;  3QK6 A;  4ND9 A;  2YJP A;  1KWH A;  3GLB A;  4M4G A;  4F2O A;  4HE1 A;  4OWD A;  5CBS A;  4YMA A;  2CZK A;  3U92 A;  4R6Y A;  3T1B A;  3K1P A;  1ELJ A;  1ZTY A;  4G77 A;  5I7I A;  1NV5 A;  3BFU A;  3DRK A;  2P3V A;  4R73 A;  4G68 A;  5KDT B;  3TCF A;  1PEB A;  2RF1 A;  4O7M A;  4X1B A;  1ZIU A;  4KPT A;  1B4H A;  3FJM A;  1LAX A;  4PDD A;  4EXL A;  5TU0 A;  4HCY A;  3FJ7 A;  4HE0 A;  4JSD A;  4C0R A;  1UTH A;  4U1Z A;  3HV1 A;  1NNF A;  3W9W A;  4I9D A;  3RNN A;  4P47 A;  3IOU A;  1NUW A;  1XOC A;  1NNP A;  3PGF A;  3MVZ A;  5I58 A;  4TQU Q;  4OMB A;  3B7D A;  1FPI A;  3TPA A;  2Y7W A;  4RXL A;  4RPO A;  1FBE A;  1ZJL A;  3F11 A;  1MDQ A;  3OO7 A;  1A54 A;  4ELR A;  1I6Q A;  1EH3 A;  1Z7M E;  1UIV A;  1FBD A;  5EQ8 A;  3B6T A;  3KN7 A;  3OEL A;  4HXV A;  4GX3 A;  1Y20 A;  4GD5 A;  3FD3 A;  2NXO A;  3U94 A;  4NF5 A;  3RT6 B;  2XA5 A;  3B8B A;  2I6E A;  5H8F B;  4N91 A;  2UYE A;  5I2N A;  4X48 A;  2IA4 A;  1B1X A;  4U21 A;  3ECR A;  4DXB A;  2CZH A;  4PAI A;  1NH7 A;  2Z8F A;  4Z7E A;  5HBC A;  3H3G A;  2WKY A;  3MP6 A;  5H8N A;  1H44 A;  1B9J A;  3TAJ A;  4QSE A;  4U4X A;  1YPN A;  4IY6 A;  3THI A;  5TPA B;  1EU8 A;  5EYH A;  4PAF A;  2R8T A;  5EQA A;  3MBP A;  2CEX A;  2QVU A;  5DVI A;  3K6X A;  4AS4 A;  2CZI A;  4QF9 A;  3DP8 A;  1LFH A;  3IL1 B;  1H3D A;  1UQW A;  3IO4 A;  3USD A;  3PTY A;  4JDF A;  1MXV A;  2DVZ A;  5LTC A;  3VV5 A;  1FRP A;  1MPB A;  5IAI A;  1OVB A;  3C34 A;  2RIN A;  4G8M A;  3FAT A;  3FV1 A;  3E78 A;  1H76 A;  2F3B A;  4U22 A;  4ECF A;  4P0I A;  3TYH A;  1FPB A;  1WOD A;  5L9M A;  3U65 A;  2FA7 A;  3PU5 A;  5L9O A;  4OHN A;  3SEX A;  3ILT B;  4FE8 A;  5I84 A;  2XWI A;  3IB0 A;  3A09 A;  3FGS A;  2VPN A;  1IIW A;  4DE8 A;  4XEQ A;  4Q8R A;  4XKN A;  4GWO A;  3KC1 A;  3HN0 A;  5CRY A;  2Q2C A;  1GV8 A;  3MPL A;  4UAC A;  4GWZ A;  1S50 A;  1MPD A;  3CVG A;  4QRZ A;  4O3C A;  3V89 B;  3OOA A;  3KZG A;  1FBP A;  3E4R A;  3ZSF A;  3FJG A;  1PB8 A;  2X7Q A;  2FYI A;  2RCB A;  1OQG A;  3K6W A;  4ZEC A;  2HCA A;  3E3K A;  3B50 A;  2B4M A;  1B40 A;  1LAF E;  3UOR A;  1NUZ A;  2FVZ A;  2I4C A;  3I6V A;  1MPC A;  4XKP A;  3K0V A;  4PGP A;  4HW8 A;  2F78 A;  5DEX A;  2QS1 A;  4POX A;  1JVY A;  4ZED A;  4HCW A;  1B7H A;  3T22 A;  4R74 A;  3PAM A;  3U1O A;  5DYH A;  3VLU A;  4MNI A;  1FBC A;  2F6G A;  2XXR A;  1LAH E;  3N6T A;  2ONK E;  5ITO A;  3A3C A;  4NHB A;  1MY3 A;  4TLM B;  3VVF A;  3TTR A;  2IEE A;  4M1V A;  4C1U A;  2XXQ A;  4PTK A;  3LUZ A;  4H5F A;  1BK4 A;  2E1S A;  4EXK A;  4G68 B;  1NKX A;  1P1O A;  4LZ7 A;  4YKP A;  2GRV A;  1JW4 A;  3M3F A;  1XVY A;  2GFE A;  3SEW A;  5KDT A;  3DRJ A;  2F7A A;  2I0C A;  3ODB A;  1FTA A;  4HTG A;  2YLN A;  4EDP A;  1YXI A;  1N0T A;  4E0W A;  4DXC A;  2GHB A;  3KC0 A;  1FTM A;  4HE2 A;  4BDL A;  3MW0 A;  3DLN A;  5FBP A;  1US4 A;  3LV0 A;  3BKI B;  4YKK A;  2WEF A;  4GF8 A;  4OVJ A;  5CMB A;  2Q9T A;  3JZJ A;  1IMD A;  4F39 A;  3C9H A;  1MQG A;  2R6G E;  3PPO A;  1MQH A;  2HFB A;  3GXA A;  5K2X A;  1VR5 A;  1QUK A;  4WKM A;  3RUM A;  1B3G A;  3OSQ A;  3VLV A;  1B58 A;  1FQE A;  1N7W A;  3KGC A;  1ZKB A;  3M8U A;  1CE2 A;  2PFY A;  2DSF A;  4GVO A;  5FHO A;  1MDP 1;  1FBF A;  1N3W A;  4P3L A;  3C35 A;  3TEL A;  2XXV A;  2QMW A;  4F31 B;  3O6P A;  4O94 A;  1P1N A;  5DVF A;  4H8I A;  5ISU A;  3LR1 A;  4PFT A;  4LUB A;  5H8F A;  1FW0 A;  3FVG A;  2XXH A;  1EZO A;  2XWV A;  3DRF A;  4MJO A;  5CC2 A;  1JEU A;  3EHS A;  3A3U A;  4ELO A;  5EHM A;  3IOV A;  2H9B A;  4GLI A;  1VDW A;  4R72 A;  2WOK A;  1QVS A;  3JYR A;  5TPA A;  4F18 A;  5ET5 A;  2Y7P A;  4OVR A;  3OO9 A;  4P8B A;  3FAS A;  3H06 B;  1IUD A;  4N6K A;  1JQF A;  5JTY B;  1B4Z A;  4Z0I A;  4PAK A;  5DTB A;  3CFX A;  3MP8 A;  3MPK A;  4N6D A;  1B1H A;  3CFL A;  5EQ9 A;  1LBB A;  1MRP A;  3RY3 A;  2HPG A;  1LEV A;  4X8R A;  3T0J A;  5I57 B;  5F7V A;  2B3B A;  4C1T A;  4ZE9 A;  4UAB A;  3G3F A;  4YKI A;  3OO8 A;  1Y3P A;  3OO6 A;  1AWB A;  1NV4 A;  1NNK A;  1Y1Z A;  3S4U A;  5KCJ B;  2QJE A;  4N4U A;  1EZ9 A;  3KOS A;  3L6G A;  4FAT A;  5M2V A;  3H6U A;  3U72 A;  1SW2 A;  3C32 A;  3KN8 A;  1B6H A;  3VVD A;  1IXI A;  3LSL A;  3O97 A;  1NV2 A;  1MXX A;  1RYX A;  3MAM A;  2KQZ A;  1FQF A;  1F9B A;  4LAT A;  1A8E A;  3DP6 A;  5EYF A;  3RYB A;  4OFL A;  3ILU B;  4PE5 B;  1QKB A;  4OYV A;  4G8N A;  1IMC A;  4OAN A;  5LOM A;  1N04 A;  3CSG A;  4NTL A;  3KOT A;  2D21 A;  1MH3 A;  1Y4C A;  4DCX A;  3TMG A;  3FBP A;  5DVJ A;  4XFE A;  1URD A; 
#chains in the Genus database with same CATH homology
 4NF6 B;  2F36 A;  3K00 A;  3KN3 A;  2Y7K A;  5H8H B;  3V8X B;  2UXA A;  3CIJ A;  4PQJ A;  4X1D A;  1O63 A;  1UTB B;  2OZZ A;  1Y3Q A;  3N6U A;  2QSX A;  3RGY A;  4OER A;  3FXQ A;  2ZXT A;  1B5J A;  3K02 A;  1BLF A;  1D9V A;  2AIX A;  4LVQ A;  3RTW B;  2XXI A;  3M3L A;  4FED A;  2I49 A;  1BTJ A;  4IY5 A;  1NH8 A;  3BBR A;  2XD3 A;  5I56 B;  1AOV A;  4AQ4 A;  1M5D A;  1NL5 A;  3SDF A;  2ZMB A;  2XHD A;  2R71 A;  2ZNU A;  4RY1 A;  3HST A;  3RLF E;  1ATG A;  1R6Z A;  1OIB A;  3PMV A;  3OSR A;  4JB7 A;  3S9L C;  3TEP A;  4YAH X;  1I6B A;  3TCG A;  3UP9 A;  4F3P A;  3IX1 A;  1QKA A;  4OEU A;  4N13 A;  3PPQ A;  3SEV A;  3PD8 A;  4TLL B;  5B70 A;  1BP5 A;  1Q1K A;  3DEL B;  4KCD A;  1DTG A;  1SW5 A;  4F1Y A;  4I8C A;  3KFM A;  4GFR A;  1QW0 A;  4KYS A;  1OLA A;  3TDJ A;  1FCK A;  1MM6 A;  3FZV A;  4E0X A;  3JV9 A;  1M5E A;  2H98 A;  4MF3 A;  3N5L A;  4EUO A;  4DIG A;  4I1D A;  4YKJ A;  4F2Q A;  3MWB A;  4YB7 A;  3N94 A;  1S9T A;  1R9Q A;  3FXR A;  1D3K A;  2XXP A;  1HSE A;  2B4L A;  3CG3 A;  3L6H A;  4R6H A;  4AB5 A;  3HPI A;  1AIV A;  1TFD A;  1A8F A;  3O9P A;  3CSB A;  4LQ5 A;  2O51 A;  4I62 A;  3O28 A;  4YU0 A;  4F3S A;  4RK2 A;  2O7U A;  3IK6 B;  3IR1 A;  3KEI A;  1FQD A;  4IB2 A;  4XXU A;  4PFU A;  1IEJ A;  4NF8 B;  4MBP A;  3PMX A;  3RN8 A;  4BDR A;  3PUX E;  1B0L A;  1O7T A;  3RYA A;  3TTM A;  1SYI A;  2GH9 A;  4LP2 B;  3W15 C;  5JTY A;  5IKB A;  4F1U A;  1P1Q A;  2AL5 A;  2I3W A;  3D4G A;  3DRG A;  2F34 A;  2B65 A;  1AMF A;  2D3I A;  4MH5 A;  4ONY A;  3LSW A;  4F19 A;  4NWC A;  5JK4 A;  1GR2 A;  1I69 A;  2WOP A;  3VDF A;  5I57 A;  3Q28 A;  4RYA A;  3BFT A;  3Q29 A;  2F97 A;  4TOZ A;  3TTN A;  3TTL A;  1PBP A;  2CMO A;  5KZT A;  2H99 A;  5KCJ A;  3MQ9 A;  4O3A A;  5AA2 D;  1MS7 A;  4ISU A;  4QHQ A;  2D5W A;  2P2A A;  2UYF A;  2XXW A;  3QXM A;  1OMP A;  5AA4 B;  2PT2 A;  3S9M C;  4KCC A;  4OES A;  3S2V A;  3K1M A;  1B5I A;  4MFI A;  3CI8 A;  4QFK A;  2VD2 A;  1DPE A;  3IO6 A;  3KJT A;  1MQJ A;  4YZZ A;  2AL4 A;  4IO2 A;  3G3J A;  5I59 B;  1FTJ A;  2PMS A;  3PUV E;  3SER A;  3KG2 A;  5TP9 B;  1JNF A;  4RPN A;  2RCA A;  4NF6 A;  4XIG Q;  3SET A;  3DP4 A;  4GXS B;  1MXY A;  5H8H A;  4U23 A;  4G4P A;  4H67 A;  4JWO A;  2E0S A;  1UTB A;  1GTK A;  1SDX A;  1MXZ A;  1JVX A;  1VFE A;  5DT6 A;  4FJP A;  5CMC A;  3OEK A;  1QUJ A;  2V93 A;  1WDN A;  1DPP A;  4GXA A;  3ZKK A;  4NF4 B;  3O6G A;  2F7B A;  3CRB A;  4NE4 A;  3GZG A;  5I56 A;  3FTO A;  4IO7 A;  2ZYN A;  4OZ9 A;  1SYH A;  4FOR A;  1SI1 A;  3OXN A;  3UA8 A;  3C33 A;  3S9N C;  2P1S A;  3HHG A;  4BDN A;  1MQI A;  4P11 A;  4H65 A;  3Q26 A;  3TFL A;  1B7U A;  4KFQ A;  3H6W A;  1POY 1;  4ELP A;  3O66 A;  4R2F A;  4N6P A;  2CZL A;  2DE3 A;  3MP1 A;  1LFI A;  1PBQ A;  1NNT A;  2O7I A;  3O29 A;  2R9J A;  3PMW A;  4OQO A;  4DXU A;  3I5O A;  2DE2 A;  2G29 A;  3B6W A;  3MVW A;  1TT1 A;  1S7Y A;  4MLV A;  3T93 B;  2Z8E A;  3O2A A;  3IB1 A;  1B05 A;  4H5G A;  4Q5T A;  1N3X A;  4GL0 A;  5FHM A;  4ESW A;  5H8S A;  4OXV A;  2O68 A;  2Q2A A;  1XHY A;  1SVX B;  1YTV A;  1POT A;  2KLF A;  4HS7 A;  1QUL A;  4R75 A;  4G8H A;  3PPP A;  1I6A A;  2I0B A;  3MC2 A;  3DM0 A;  3CHG A;  1A7L A;  3H6T A;  2QS3 A;  2DP8 A;  5AA2 B;  2ONR A;  4ELQ A;  3QUF A;  3C31 A;  3VVE A;  5HPQ A;  3IOR A;  3GBB A;  1L5T A;  3SES A;  4P0G A;  5L9S A;  2Q8J A;  2FNC A;  1B5H A;  5FTH A;  3QSL A;  4NF8 A;  3C4M A;  1D4N A;  3K4U A;  2BJJ X;  3OEN A;  3UK4 A;  1MY0 A;  2ABH A;  4BLA A;  4EF1 A;  1LAG E;  1DOT A;  1LST A;  4GL8 A;  4RA1 A;  1SD3 A;  2PBW A;  4FAJ A;  1LGB C;  3TKD A;  1HSJ A;  5EHS A;  1XVX A;  2RC9 A;  1VFD A;  3TZA A;  1YCJ A;  5BUU A;  4PFW A;  1Y1M A;  4ZZE A;  3G3K A;  3G3G A;  4KYE A;  1MXU A;  3M3K A;  1ZBM A;  2DWI A;  2VOZ A;  2XXY A;  3R7X A;  3ZKL A;  4EQ7 A;  5AA4 A;  2GHA A;  4U2R A;  1FTK A;  5F1Q A;  4AB6 A;  2O1L A;  3CFZ A;  1B3F A;  1O64 A;  1M5C A;  2DWJ A;  3QUJ A;  2OLB A;  2A5T B;  2V84 A;  3PUZ E;  3HCQ A;  3TOD A;  1MQD A;  2XXT A;  1QJM A;  1MG1 A;  2NUV A;  3MJN A;  2HAV A;  4LZ5 A;  2I4B A;  5I59 A;  3OMB A;  1MY1 A;  2Y84 A;  1FQA A;  4R6K A;  5TP9 A;  3EQ1 A;  3QIM A;  1UIU A;  4IGR A;  3TQW A;  2QS4 A;  1Y9U A;  2X26 A;  2V3Q A;  1RKM A;  4R2B A;  3G3H A;  1M5B A;  1WVJ A;  3T9H B;  5B7D A;  4OET A;  2F35 A;  3CG1 A;  3E9X A;  3I3V A;  4YB6 A;  3SEU A;  4MLQ A;  3IB2 A;  2QPQ A;  4NF4 A;  4KR5 A;  2ZYM A;  2O69 A;  3IJX B;  3LC8 A;  2DXY A;  2RKM A;  3TCH A;  2DQV A;  2I3V A;  4JWY A;  4IO5 A;  2O1M A;  4ZEK A;  1ZU0 A;  3LSX A;  1LB9 A;  2QS2 A;  2PVU A;  1B3H A;  2O84 X;  3SKP A;  4ZZA A;  1DMB A;  1EZP A;  2REJ A;  2PX1 A;  1JW5 A;  3PUY E;  2H25 A;  2HEU A;  1P1W A;  4GIZ A;  2I48 A;  4OTE A;  5CMM A;  3RT8 A;  1B51 A;  2HAU A;  2ZYO A;  4Q30 B;  5H8Q A;  1MY4 A;  2DXR A;  4LZ8 A;  1PB7 A;  4RNS A;  3R26 A;  2ZNT A;  2Y7R A;  4BDM A;  4LQ2 A;  4ZEF A;  2LAO A;  3K6V A;  4F3G A;  4F29 A;  3MVX A;  2QMX A;  5I2K B;  1PB9 A;  2G93 A;  3VXB A;  3N26 A;  4IGT A;  4QSD A;  2A5S A;  4GRK A;  1XS5 A;  1H43 A;  3ZS6 A;  4ESX A;  1SW4 A;  4BDO A;  3K01 A;  3U93 A;  1AL3 A;  2OCU A;  1FTO A;  3EF7 A;  4FEC A;  1M5F A;  3KSX A;  4EQ9 A;  5A5X B;  4QFN A;  1QUI A;  3VXC A;  4PP0 A;  4H6D A;  3FVK A;  2QRY A;  4DDD A;  5AA2 A;  2RC8 A;  5AA3 A;  1HSL A;  3K6U A;  4KYD A;  5L8D A;  3AXF A;  3V5A A;  1ZMG A;  3TQL A;  2OK2 A;  3B6Q A;  2V25 A;  2YPN A;  4H0W A;  2UVG A;  2Z23 A;  2Y7I A;  4DCY A;  1PC3 A;  2ESN A;  2NVU B;  4POW A;  2I58 A;  2DWA A;  3PPN A;  1Z7N E;  1LCF A;  1DSN A;  4DLD A;  4KHZ E;  2OJT A;  3MZB A;  2F8D A;  2Z8D A;  1B7Z A;  3Q27 A;  5FHN A;  2OWT A;  1N7X A;  4JWX A;  1LFG A;  4YIC A;  5ICT A;  3HO7 A;  4F3B A;  3TTK A;  3H6V A;  4F22 A;  1NFT A;  2F7C A;  3LVU A;  1US5 A;  2ZNS A;  3RPW A;  1FQC A;  3DRH A;  3OEM A;  1TXF A;  1P99 A;  3WAE A;  2VD3 A;  4OEN A;  3R6U A;  2X7P A;  3CR9 A;  3VLW A;  1PDA A;  2B3F A;  2A5T A;  2UVJ A;  1VE4 A;  4FIM A;  4UA8 A;  4EF2 A;  3WAF A;  1GGG A;  2F5X A;  4QFP A;  3OD7 A;  3G3I A;  3T9U A;  1BIY A;  2WOL A;  3K1N A;  4F1V A;  1LCT A;  1A55 A;  1OVT A;  5ITP A;  3LBS A;  3MVY A;  2HZL A;  2DOJ A;  2DE4 A;  4ZDM A;  4DZ1 A;  5BWJ A;  3QAX A;  3MZ9 A;  4X9T A;  3RQT A;  2NWJ A;  5CI5 A;  3T66 A;  2XX7 A;  2H5Y A;  2VHA A;  3H03 A;  2H4I A;  4XKR A;  1OQH A;  4ZEI A;  3MZ1 A;  3T96 B;  3W9V A;  4PET A;  1II5 A;  2PYY A;  2HQ0 A;  1XC1 A;  1GVC A;  4YMB A;  4THI A;  4RJZ A;  2Q89 A;  4G2Z A;  5J1D A;  4ZEB A;  3IAZ A;  1JW1 A;  3FVO A;  2Z22 A;  4QSC A;  2DVC A;  4WXJ A;  4EQB A;  2AYS A;  1NMU A;  2UVH A;  3HHF A;  1SW1 A;  1OLC A;  1B46 A;  4IO6 A;  1B32 A;  3G7W A;  4O3B A;  2VP1 A;  1Y4T A;  4LON B;  3PV0 E;  1B3L A;  1XT8 A;  4GQO A;  4U4S A;  1UTH B;  4KD5 A;  1H45 A;  2OWS A;  5CM6 A;  3LUY A;  5H8Q B;  1URS A;  2DYX A;  1YAE A;  4ZE8 A;  4OEV A;  1CB6 A;  3ONM A;  1RYO A;  3D4C A;  5I58 B;  2XX8 A;  5JEI A;  1TWY A;  2XXU A;  1B52 A;  1BKA A;  3VFJ A;  1D9Y A;  4ZS9 A;  4N07 A;  2VGQ A;  5FTI A;  5CMK A;  1MY2 A;  3V83 A;  4K3F A;  3FV2 A;  5I2K A;  2ONS A;  5AA1 A;  2DWH A;  1IXC A;  1LLS A;  4NWD A;  4NF5 B;  3U8Q A;  4KI0 E;  2F6P A;  3H4Z A;  1SI0 A;  4RK9 A;  4L17 A;  3K2D A;  4XTC Q;  1R1N A;  5I2N B;  3PUW E;  3KJ7 A;  2XD2 A;  3DRI A;  1T0K A;  5A5X A;  3MUQ A;  4PFY A;  5H8N B;  3GBA A;  3C36 A;  3FIR A;  3P7I A;  4WEP A;  5K2Y A;  3O6H A;  4G68 C;  3S9E A;  1IZ1 A;  4FEB A;  4JXI A;  1FQB A;  2ALU A;  5ICQ A;  2V3T A;  2V3U A;  3VE1 B;  1B2H A;  1DTZ A;  3IJO B;  5ELV A;  1IXG A;  1J1N A;  4QFO A;  3LSF B;  1LB8 A;  4IO4 A;  4OFJ A;  1SBP A;  4Q0C A;  3Q25 A;  1B3E A;  3UN6 A;  1USY E;  1R9L A;  5CBR A;  3PD9 A;  2REG A;  2HZK A;  2ZYK A;  2DS9 A;  1P1U A;  4JSO A;  1URG A;  1N84 A;  4R9G A;  1IQ7 A;  4H8J A;  3UIF A;  1N76 A;  3KBR A;  2OBG A;  1LBC A;  3EHU A;  4IO3 A;  4KQP A;  4H1X A;  4WED A;  2P0S A;  3UGW A;  3RTF B;  4NMY A;  2ANJ A;  1JEV A;  3EPE A;  3PPR A;  1SQY A;  5AE4 A;  1MH4 A;  4JBZ A;  2O6A A;  2Q88 A;  1MM7 A;  2W7Y A;  1Y3N A;  1FTL A;  2M8C A;  3TUS A;  3H7M A;  3KSJ A;  4BDQ A;  1ANF A;  4XKQ A;  3SEY A;  2RC7 A;  3IOW A;  3O6I A;  2QL3 A;  5HM4 B;  3T9V A;  4YB5 A;  1JET A;  1USY H;  3IOT A;  4NED A;  2THI A;  3EHT A;  4GOT A;  2NOO A;  5DEX B;  4LA9 A;  4R9F A;  3FUZ A;  2PT1 A;  1MXW A;  3FVN A;  2XX9 A;  1ZLQ A;  1AH5 A;  1TFA A;  3T9X B;  1B0H A;  1IIT A;  1IXH A;  3EN3 A;  4QFL A;  4U1O A;  2UVI A;  1Q35 A;  3FXU A;  2XXX A;  3QYT A;  1A40 A;  1A99 A;  4OFO A;  2HXW A;  3E13 X;  1VSO A;  3QK6 A;  4ND9 A;  2YJP A;  1KWH A;  3GLB A;  4M4G A;  4F2O A;  4OWD A;  5CBS A;  4YMA A;  3U92 A;  4R6Y A;  3K1P A;  1ELJ A;  1ZTY A;  4G77 A;  3BFU A;  3DRK A;  4R73 A;  4G68 A;  5KDT B;  3TCF A;  1PEB A;  2RF1 A;  4X1B A;  1ZIU A;  4KPT A;  1B4H A;  3FJM A;  1LAX A;  4EXL A;  5TU0 A;  4HCY A;  3FJ7 A;  4JSD A;  4C0R A;  1UTH A;  4U1Z A;  3HV1 A;  1NNF A;  3W9W A;  4I9D A;  3RNN A;  3IOU A;  1XOC A;  1NNP A;  3PGF A;  3MVZ A;  5I58 A;  4TQU Q;  4OMB A;  3B7D A;  3TPA A;  2Y7W A;  4RXL A;  4RPO A;  1ZJL A;  3F11 A;  1MDQ A;  3OO7 A;  1A54 A;  4ELR A;  1I6Q A;  1EH3 A;  1Z7M E;  1UIV A;  3B6T A;  3KN7 A;  3OEL A;  1Y20 A;  4GD5 A;  3FD3 A;  2NXO A;  3U94 A;  4NF5 A;  3RT6 B;  2I6E A;  5H8F B;  2UYE A;  5I2N A;  4X48 A;  2IA4 A;  1B1X A;  4U21 A;  3ECR A;  4DXB A;  1NH7 A;  2Z8F A;  4Z7E A;  5HBC A;  3H3G A;  2WKY A;  3MP6 A;  5H8N A;  1H44 A;  1B9J A;  3TAJ A;  4QSE A;  4U4X A;  1YPN A;  4IY6 A;  3THI A;  5TPA B;  1EU8 A;  3MBP A;  5DVI A;  3K6X A;  4QF9 A;  3DP8 A;  1LFH A;  3IL1 B;  1H3D A;  1UQW A;  3IO4 A;  3USD A;  4JDF A;  1MXV A;  2DVZ A;  3VV5 A;  1MPB A;  5IAI A;  1OVB A;  3C34 A;  2RIN A;  4G8M A;  3FAT A;  3FV1 A;  1H76 A;  4U22 A;  4ECF A;  4P0I A;  3TYH A;  1WOD A;  5L9M A;  2FA7 A;  3PU5 A;  5L9O A;  4OHN A;  3SEX A;  3ILT B;  4FE8 A;  5I84 A;  3IB0 A;  3A09 A;  3FGS A;  1IIW A;  4DE8 A;  4Q8R A;  4XKN A;  4GWO A;  3HN0 A;  5CRY A;  2Q2C A;  1GV8 A;  3MPL A;  4UAC A;  1S50 A;  1MPD A;  3CVG A;  4QRZ A;  4O3C A;  3V89 B;  3OOA A;  3KZG A;  3E4R A;  3ZSF A;  3FJG A;  1PB8 A;  2X7Q A;  2FYI A;  2RCB A;  1OQG A;  3K6W A;  4ZEC A;  2HCA A;  3E3K A;  2B4M A;  1B40 A;  1LAF E;  3UOR A;  2I4C A;  3I6V A;  1MPC A;  4XKP A;  3K0V A;  4HW8 A;  2F78 A;  5DEX A;  2QS1 A;  4POX A;  1JVY A;  4ZED A;  4HCW A;  1B7H A;  3T22 A;  4R74 A;  3PAM A;  3U1O A;  5DYH A;  3VLU A;  2F6G A;  2XXR A;  1LAH E;  3N6T A;  2ONK E;  5ITO A;  3A3C A;  1MY3 A;  4TLM B;  3VVF A;  3TTR A;  2IEE A;  4M1V A;  4C1U A;  2XXQ A;  4H5F A;  2E1S A;  4EXK A;  4G68 B;  1NKX A;  1P1O A;  4LZ7 A;  4YKP A;  2GRV A;  1JW4 A;  3M3F A;  1XVY A;  2GFE A;  3SEW A;  5KDT A;  3DRJ A;  2F7A A;  2I0C A;  3ODB A;  4HTG A;  2YLN A;  4EDP A;  1N0T A;  4E0W A;  4DXC A;  2GHB A;  1FTM A;  4BDL A;  3MW0 A;  3DLN A;  1US4 A;  3BKI B;  4YKK A;  4GF8 A;  4OVJ A;  5CMB A;  2Q9T A;  3JZJ A;  4F39 A;  3C9H A;  1MQG A;  2R6G E;  3PPO A;  1MQH A;  2HFB A;  3GXA A;  5K2X A;  1VR5 A;  1QUK A;  4WKM A;  3RUM A;  1B3G A;  3OSQ A;  3VLV A;  1B58 A;  1FQE A;  1N7W A;  3KGC A;  1ZKB A;  3M8U A;  1CE2 A;  2DSF A;  4GVO A;  5FHO A;  1MDP 1;  1N3W A;  3C35 A;  3TEL A;  2XXV A;  2QMW A;  4F31 B;  3O6P A;  1P1N A;  5DVF A;  4H8I A;  5ISU A;  3LR1 A;  4PFT A;  4LUB A;  5H8F A;  1FW0 A;  3FVG A;  2XXH A;  1EZO A;  3DRF A;  5CC2 A;  1JEU A;  3EHS A;  3A3U A;  4ELO A;  5EHM A;  3IOV A;  2H9B A;  4GLI A;  4R72 A;  2WOK A;  1QVS A;  3JYR A;  5TPA A;  4F18 A;  2Y7P A;  3OO9 A;  3FAS A;  3H06 B;  1IUD A;  1JQF A;  5JTY B;  1B4Z A;  4Z0I A;  5DTB A;  3CFX A;  3MP8 A;  3MPK A;  1B1H A;  3CFL A;  1LBB A;  1MRP A;  3RY3 A;  5I57 B;  5F7V A;  2B3B A;  4C1T A;  4ZE9 A;  3G3F A;  4YKI A;  3OO8 A;  1Y3P A;  3OO6 A;  1NNK A;  1Y1Z A;  3S4U A;  5KCJ B;  2QJE A;  1EZ9 A;  3KOS A;  3L6G A;  4FAT A;  5M2V A;  3H6U A;  3U72 A;  1SW2 A;  3C32 A;  3KN8 A;  1B6H A;  3VVD A;  1IXI A;  3LSL A;  3O97 A;  1MXX A;  1RYX A;  3MAM A;  1FQF A;  1F9B A;  4LAT A;  1A8E A;  3DP6 A;  5EYF A;  3RYB A;  4OFL A;  3ILU B;  4PE5 B;  1QKB A;  4OYV A;  4G8N A;  5LOM A;  1N04 A;  3CSG A;  4NTL A;  3KOT A;  2D21 A;  1MH3 A;  1Y4C A;  4DCX A;  3TMG A;  5DVJ A;  1URD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...