1JEUA

Oligo-peptide binding protein (oppa) complexed with kek
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (peptide transport/peptide)
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title The role of water in sequence-independent ligand binding by an oligopeptide transporter protein.
pubmed doi rcsb
total genus 180
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1996-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1jeuA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jeuA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1jeuA02
4OTEA 2CMOA 4N13A 4NF6A 4X48A 4NF8A 2XXHA 4F29A 2IEEA 1A8EA 1LFHA 2RF1A 3K6XA 1B0HA 2ESNA 4O3BA 3CFZA 4RA1A 1GGGA 3TAJA 3SETA 1KWHA 4KYEA 4RPNA 1II5A 2WKYA 4E0XA 4YKIA 3FUZA 1B40A 3E4RA 3ZKLA 3DRJA 5ELVA 4PFYA 3ILTB 3CSGA 1I6BA 3FJMA 1P1WA 4F1VA 1B32A 3DRHA 3BBRA 4BDQA 1OQHA 5HM4B 2RINA 5A5XB 4FJPA 1XT8A 3K1NA 3M3LA 2DE3A 1MXYA 1NKXA 3PUXE 4U2RA 4EDPA 1ATGA 2ZNUA 3L6HA 1MQGA 3PAMA 1FTOA 3IO4A 3K00A 1ZJLA 3LSLA 1UIUA 3N6UA 2Q2CA 5I56A 3HPIA 4PETA 2O6AA 4H0WA 1GVCA 3TODA 1MPCA 1UTBA 3K1PA 5DVFA 1AOVA 1FQCA 2F36A 2XX8A 4ELOA 4GLIA 4JSOA 4LUBA 2XXVA 4BDLA 4ZEBA 4QFKA 5KCJB 5HPQA 1LAFE 1NH7A 4R6YA 1I6QA 3MVZA 3H6UA 1LBBA 4QF9A 1OIBA 2XXIA 1BKAA 1MY0A 5H8HB 2DYXA 1YTVA 4ZE9A 1MRPA 2E1SA 4M1VA 4Q30B 4MF3A 3OENA 1FQAA 3S9EA 4GD5A 2ONSA 4TQUQ 2HZLA 4YB5A 4R73A 2VOZA 4C1UA 3VLVA 3FVOA 3I6VA 2O1MA 3U92A 4IY6A 4RNSA 3UN6A 5BUUA 3FV1A 3E13X 3QUJA 5TPAA 2O1LA 1JNFA 3CHGA 1P1UA 1XVYA 5AA2A 1JEUA 2O69A 1FTKA 3SEXA 3TTKA 2R71A 1N84A 3B7DA 4GVOA 3Q25A 4G68B 3OXNA 3S4UA 2DS9A 3USDA 1QW0A 3K02A 3FXQA 5ITOA 5F1QA 3SEYA 2E0SA 3FJGA 3TZAA 4FAJA 3PPOA 4M4GA 4UA8A 5FHMA 1EZ9A 4L17A 3DRGA 3KZGA 2ZMBA 4Q8RA 5KCJA 5CMKA 2V84A 2QS1A 1IQ7A 1US4A 4Z7EA 1IITA 4NEDA 3G3FA 4KFQA 3RYAA 4JWOA 1TFAA 3MZBA 3T66A 3N94A 3VE1B 3CRBA 3RTWB 5CMMA 2ZYNA 3MW0A 3T9VA 1LAGE 1MQHA 5I58B 3LSXA 2Z8EA 2G29A 4OFOA 1MXUA 3I5OA 5AA4B 1VR5A 2ALUA 3Q26A 3LR1A 3OO7A 1QUJA 1FCKA 1FTJA 1QUKA 2OZZA 2ABHA 2D21A 5H8FB 3MVXA 1LFIA 1N3XA 1N76A 4GOTA 5DEXB 4AQ4A 2B3FA 2F8DA 2OCUA 3E3KA 4OFLA 4IGRA 1Q1KA 3BFUA 2HFBA 1LSTA 1Y3QA 1D4NA 5FHNA 3IL1B 1EU8A 4ND9A 2F7AA 3BKIB 3PPPA 3V89B 4ZDMA 4Q5TA 3CI8A 3FXRA 1ELJA 4NF5A 3SERA 3M3FA 4G8NA 5I2NB 5CMBA 1SVXB 2F6PA 2ONKE 4U23A 3VVFA 5I58A 4NWCA 3N26A 3IB2A 4JB7A 5AA4A 1B2HA 3HV1A 3TCFA 3Q29A 1B7UA 3CG1A 1R1NA 4G8HA 1IXGA 4F1YA 2D3IA 3VXBA 2VD3A 3K6VA 3V5AA 3RT8A 1NH8A 2DXRA 2AL4A 2H99A 5I59A 1ZIUA 4RK2A 4EUOA 4DZ1A 4OWDA 4PFWA 3RYBA 1PB8A 4ISUA 3SEWA 4R9GA 1PEBA 4IY5A 3U1OA 2I4BA 1SBPA 4NMYA 1MY1A 1MM6A 3SESA 2QMWA 3PUVE 4EF1A 1DPPA 1ZLQA 3B6TA 1VSOA 4NTLA 3B6QA 3C32A 1IZ1A 2DSFA 2XXPA 1US5A 2XXYA 1UQWA 2KLFA 5L9SA 1QJMA 5TP9B 3C36A 1B1XA 1URGA 2F6GA 3WAEA 4YKKA 5FTIA 4OMBA 5I2KB 1SYIA 4OZ9A 4ONYA 3LVUA 4I9DA 3OO8A 2XXRA 5CBRA 4HTGA 1LLSA 2I6EA 3K4UA 2QS2A 3U72A 3LBSA 1Y3PA 4QHQA 3DELB 2V3TA 2DWHA 4QFNA 3UGWA 4KPTA 3H4ZA 2UVJA 5FTHA 1YPNA 3KFMA 3T9HB 3U94A 2UYFA 1OLCA 3MAMA 2O68A 1ZMGA 4FEDA 2QL3A 1OVTA 2REGA 2QS4A 3RPWA 2I58A 5CC2A 5IKBA 4BLAA 3FD3A 5CRYA 4R9FA 2PBWA 5I84A 3FJ7A 2ZNSA 1SI0A 3UK4A 3EHSA 3DP4A 4EF2A 3FATA 1D9YA 3EQ1A 2GHBA 5I57B 1SD3A 3VLWA 4DE8A 2Z23A 1XHYA 4LQ5A 4RJZA 5DTBA 4QSDA 1MS7A 3HN0A 3VV5A 3OOAA 1UTHA 4FIMA 5I2KA 2NVUB 3MPLA 3KN7A 4XKNA 3MP8A 1FW0A 3IB1A 3OSRA 3TTNA 5JK4A 1JVYA 4PFTA 1H43A 4U22A 3KSJA 3P7IA 3LSFB 2RC8A 3M8UA 3KSXA 1O7TA 4WEPA 3GBBA 4GRKA 2R6GE 2V3QA 3IR1A 3MZ1A 1DMBA 5ICTA 4H5FA 5H8NA 3KJTA 4WKMA 1URSA 3VVEA 4GIZA 3DP8A 2G93A 3PGFA 2Y7KA 3OMBA 4ZEFA 1H44A 2Y7WA 2B3BA 3DLNA 3KJ7A 3RGYA 1A7LA 4XKQA 2XX9A 2A5TB 3THIA 2FA7A 1MQDA 4OEUA 3T93B 1QKAA 1IUDA 4POXA 1FQEA 3W9WA 4ZZAA 2Q9TA 3FV2A 4ZE8A 3KBRA 3RTFB 4KD5A 3O2AA 4F18A 1M5FA 1Z7ME 2ZNTA 1GR2A 1AMFA 2RC7A 3KEIA 1MDQA 3LSWA 3PD9A 2Q89A 1LFGA 3OO6A 2OWSA 1B4ZA 3SDFA 3KG2A 1URDA 4YAHX 1JW5A 1MM7A 4YB6A 1MY2A 2NUVA 2QMXA 2YLNA 2PT1A 2RCBA 5A5XA 2BJJX 4F3PA 2DXYA 1A40A 2B4LA 1PBQA 4X1DA 3RY3A 1B52A 5HBCA 3ILUB 3CFXA 3IB0A 3R7XA 1PC3A 4EQBA 1D3KA 3IX1A 3CVGA 1ZTYA 1SDXA 2AIXA 2AL5A 2Q8JA 1QKBA 1XC1A 2ZXTA 3TTRA 1JEVA 1BTJA 1NNKA 1PDAA 3TTMA 3TCGA 4C1TA 5CM6A 4ELRA 5JTYB 1OQGA 2HCAA 1B4HA 3MZ9A 4BDRA 5AA1A 1NFTA 3C34A 2V93A 3Q28A 4KI0E 3K6WA 4KR5A 2I4CA 3O6HA 3SEVA 4OERA 4R75A 1RYOA 1R9QA 1UIVA 2WOKA 1QUIA 4PFUA 3ZS6A 3FVGA 2H5YA 1SW1A 2PX1A 4YZZA 1R6ZA 2OK2A 2M8CA 5H8HA 5B70A 4O3CA 4LZ7A 1AH5A 3QIMA 3PV0E 3ONMA 5AA2D 3G7WA 4EQ9A 3MWBA 4X9TA 4FORA 4AB6A 1DSNA 2RKMA 3CSBA 3DP6A 1RKMA 3UA8A 4DIGA 2I3VA 5J1DA 4XTCQ 4HCWA 5K2XA 3K1MA 1SW5A 1YCJA 4ZEDA 4F39A 3GLBA 1M5BA 3ZSFA 4BDNA 1LCTA 4G68A 4LP2B 2P0SA 5KZTA 1YAEA 3RLFE 4ESXA 3IJXB 1B51A 3H06B 1XOCA 3TDJA 4I62A 3T9XB 3IO6A 3S2VA 1CB6A 4EXLA 1POTA 4OESA 4OYVA 3G3JA 1LAHE 4C0RA 4EXKA 2FYIA 4KHZE 2X7QA 3GZGA 1I6AA 3CFLA 2VP1A 4F1UA 1NL5A 3W15C 2XX7A 1DOTA 1SW2A 4O3AA 1N3WA 1VFEA 2DQVA 2IA4A 1H76A 4LZ5A 4MLQA 2GRVA 1B5JA 1Y9UA 3A3UA 4FEBA 4GF8A 2I0BA 5DVJA 3OSQA 5F7VA 2P2AA 3FASA 4THIA 2HAUA 4DCYA 3MUQA 5AE4A 1DPEA 3EPEA 3HCQA 4KYDA 2DP8A 3FIRA 3V83A 5LOMA 4QRZA 3I3VA 5H8FA 3U93A 1IXHA 5KDTB 4KYSA 4N6PA 1SI1A 2V25A 1P1QA 4YU0A 1USYE 4OXVA 1Y1MA 1MXVA 3M3KA 3RUMA 5DEXA 4U4XA 3MJNA 3MC2A 3U8QA 2F34A 1VE4A 4LVQA 2HXWA 4ECFA 2UXAA 4XIGQ 4ZECA 4PE5B 1XS5A 3RNNA 2H9BA 2HQ0A 1B3FA 2HZKA 1R9LA 1Y20A 4F3GA 2F7CA 1PBPA 4GXAA 1TT1A 1PB7A 1USYH 3MBPA 4ZEKA 4ELQA 3TPAA 4KCCA 1IXIA 2UVHA 3EN3A 2LAOA 3FVKA 3TMGA 3H7MA 4F19A 5I2NA 4QSEA 4DDDA 3IAZA 2QPQA 2DWIA 5L8DA 1NNFA 2R9JA 1HSJA 2DVZA 2Y7RA 1QULA 4NF6B 4F31B 4NF8B 3T96B 2GH9A 4YMAA 4H67A 1GTKA 1ANFA 3R26A 5EYFA 1MPDA 4MLVA 2O51A 1Y4CA 3O29A 3TTLA 2F78A 5ITPA 4OHNA 2XXUA 2I0CA 1ZBMA 1I69A 4TLMB 1QVSA 1MQIA 1MQJA 1JQFA 3BFTA 3C9HA 2Z8DA 2ANJA 5L9MA 2I3WA 4KQPA 4WXJA 2H98A 2Z8FA 2GFEA 2HEUA 4ZZEA 5ISUA 2UVGA 1M5CA 3TFLA 1MH3A 4FECA 1JETA 4U21A 1DTZA 4LATA 1IXCA 3C35A 2FNCA 2THIA 1POY1 3K01A 1OLAA 4JWXA 3HHGA 4QFOA 4OETA 2O7IA 3GBAA 4GQOA 5IAIA 3PD8A 1Y1ZA 3IK6B 4KCDA 4GL8A 1P99A 1IIWA 2XXTA 4NE4A 5I56B 4H8IA 5TP9A 4NF4B 1LGBC 1FQFA 3JYRA 3N6TA 3PUZE 1A54A 4QFLA 1S9TA 3KN3A 2UYEA 3PU5A 4YKPA 1MH4A 2X26A 2VD2A 5BWJA 1UTBB 2P1SA 2ZYOA 1B1HA 4R6HA 2XXQA 4XKPA 1B3GA 3A09A 3O6PA 1LAXA 3R6UA 2F97A 2REJA 4XXUA 1D9VA 1JVXA 3ZKKA 5ICQA 4RXLA 3UP9A 4H65A 2DWAA 3UIFA 2WOLA 4G4PA 3G3GA 3PPRA 3OELA 4R6KA 3K0VA 4IO6A 4H6DA 3EF7A 4GFRA 2OBGA 3T9UA 2O7UA 3KOTA 1HSEA 2B65A 4GWOA 3MP1A 3RT6B 2Y84A 4HW8A 4OVJA 3EHUA 5DYHA 4F2QA 2GHAA 1B5IA 5B7DA 3H03A 4IO3A 3TQLA 4F2OA 3WAFA 1MG1A 2QSXA 5TPAB 1B9JA 3SEUA 1WDNA 3L6GA 3HO7A 3ODBA 3H6TA 4DLDA 4AB5A 3D4CA 5AA2B 3MPKA 3K2DA 1IEJA 4RK9A 1BIYA 5FHOA 5I57A 2PT2A 4DXCA 2PVUA 4NF4A 3VDFA 2NOOA 3RN8A 1BLFA 4H1XA 1MY3A 2DWJA 3OEKA 2XD3A 1ZKBA 1EZPA 1OMPA 1CE2A 1B6HA 3DRFA 1VFDA 4I8CA 5H8QB 3O9PA 3PUWE 1O63A 2DE2A 1MPBA 4JSDA 3FVNA 2O84X 3PPQA 3S9MC 2YPNA 3H3GA 1NMUA 1Y4TA 4IO7A 3DRKA 2W7YA 1MXZA 4TOZA 3HSTA 2H25A 2QS3A 4NWDA 3S9NC 3C33A 4MFIA 5AA3A 1A99A 3CG3A 4F3SA 3O28A 1LCFA 3IOWA 4DXUA 4UACA 2A5TA 1H45A 4H8JA 3VXCA 3AXFA 1Z7NE 3QSLA 3LUYA 2Q2AA 4E0WA 2QJEA 2ZYMA 3B6WA 1N0TA 4ZEIA 3H6WA 3KOSA 3TYHA 2V3UA 1SYHA 3VFJA 4YMBA 1O64A 2WOPA 3V8XB 4WEDA 1XVXA 3UORA 2VGQA 1B3LA 1FTLA 3QK6A 1TXFA 1S7YA 3FTOA 4P11A 2OWTA 1N7WA 5CMCA 5CBSA 5H8QA 3CR9A 4ESWA 4QFPA 3F11A 2VHAA 3H6VA 4JDFA 4TLLB 2HAVA 4LONB 2H4IA 3OEMA 1OVBA 4Z0IA 3D4GA 3DM0A 3CIJA 4QSCA 3HHFA 1GV8A 1MY4A 4FE8A 1EH3A 1B0LA 4PQJA 4NF5B 1Q35A 2XXWA 2ZYKA 2I48A 1TFDA 1B7HA 3IORA 4G77A 4Q0CA 1EZOA 3OO9A 3C31A 2F35A 1A8FA 5EHMA 1PB9A 3Q27A 4G68C 4IO4A 1FQDA 3RQTA 3O6GA 3IOUA 5JTYA 4OQOA 4GL0A 3QAXA 1ZU0A 2B4MA 4P0IA 4K3FA 4MH5A 2RCAA 3FGSA 1M5DA 3PUYE 4JWYA 3C4MA 2NWJA 1RYXA 2NXOA 3QUFA 5H8SA 2XD2A 1N7XA 3FZVA 3TKDA 1M5EA 1B46A 2OLBA 3MVYA 1MDP1 1LB9A 1N04A 5JEIA 1MXXA 4ZS9A 1AL3A 3TQWA 1S50A 3O97A 1J1NA 4U1OA 5I59B 1HSLA 1B3HA 2Q88A 2Y7IA 2QRYA 4MBPA 3VLUA 1NNPA 4LQ2A 2Z22A 1B5HA 3E9XA 4ELPA 1WVJA 5CI5A 2PYYA 3PPNA 3K6UA 1BP5A 3FXUA 3IJOB 3PMXA 1MXWA 3PMWA 4X1BA 1L5TA 4I1DA 5K2YA 5L9OA 4RY1A 2XHDA 2A5SA 3EHTA 3TUSA 2PMSA 4R74A 4OENA 3MVWA 4R2FA 4DCXA 4G8MA 1T0KA 4EQ7A 2XXXA 4OEVA 3TEPA 2I49A 5TU0A 2F7BA 1F9BA 3T22A 1LBCA 4RPOA 4IO5A 3JV9A 3VVDA 4PP0A 3G3HA 4GXSB 4YB7A 1B58A 3S9LC 3LC8A 3GXAA 2F5XA 1AIVA 4RYAA 4YICA 4IB2A 2ONRA 4P0GA 1TWYA 4BDOA 3IOVA 3W9VA 4LA9A 2CZLA 4POWA 2UVIA 1FTMA 1SQYA 4R72A 2DOJA 4OFJA 2DVCA 4F22A 2DE4A 1LB8A 5EHSA 1SW4A 5DVIA 5M2VA 4XKRA 3DRIA 1A55A 1B3EA 4YKJA 4U4SA 3MQ9A 3KGCA 4HCYA 3MP6A 5KDTA 4N07A 3G3KA 3N5LA 1UTHB 3ECRA 2RC9A 1JW1A 1P1OA 3TELA 4G2ZA 1P1NA 3A3CA 4LZ8A 3TCHA 4DXBA 4JXIA 1NNTA 2X7PA 2YJPA 3O6IA 4JBZA 4R2BA 2Y7PA 3PMVA 3QYTA 3OD7A 3JZJA 3SKPA 4F3BA 1B05A 4IGTA 4U1ZA 2OJTA 2AYSA 4BDMA 1JW4A 4HS7A 3KN8A 2D5WA 3QXMA 5DT6A 3O66A 3G3IA 5H8NB 4H5GA 1H3DA 4IO2A 1DTGA 1B7ZA 1Y3NA 3IOTA 4FATA 1FQBA 1WODA
chains in the Genus database with same CATH superfamily
4OTEA 4P1EA 4HE1A 1FPFA 2CMOA 4N13A 4NF6A 4X48A 4NF8A 5I5PA 2XXHA 4F29A 2IEEA 1A8EA 1LFHA 2RF1A 3K6XA 1B0HA 2ESNA 1LBWA 4O3BA 3CFZA 4RA1A 1GGGA 3TAJA 3SETA 5F24A 1KWHA 4KYEA 4P3LA 1II5A 4RPNA 1NUYA 2WKYA 4E0XA 4YKIA 3FUZA 1B40A 3E4RA 2Y5KA 3ZKLA 3DRJA 2HPGA 5ELVA 4PFYA 3ILTB 3CSGA 4N6KA 2FBPA 1FBCA 1I6BA 4PAFA 3FJMA 1P1WA 4F1VA 1B32A 3DRHA 3BBRA 4BDQA 1OQHA 5HM4B 2RINA 5A5XB 4FJPA 1XT8A 3K1NA 3M3LA 2DE3A 1MXYA 1NKXA 4X8RA 1FBPA 3PUXE 4U2RA 4EDPA 1ATGA 2ZNUA 3L6HA 1FBHA 1MQGA 3PAMA 1FTOA 4HXVA 3IO4A 3K00A 1ZJLA 3B8BA 3LSLA 1UIUA 3N6UA 2Q2CA 5I56A 3HPIA 4PETA 4N81A 2O6AA 2FIEA 4H0WA 5T3JA 1FBDA 1GVCA 2CZIA 3A29A 3TODA 1MPCA 1UTBA 3K1PA 5DVFA 1AOVA 1FQCA 2F36A 2XX8A 4ELOA 4PTKA 4GLIA 2F3BA 4JSOA 4N17A 3FXBA 4LUBA 2XXVA 4BDLA 4ZEBA 4QFKA 5KCJB 5HPQA 1LAFE 1NH7A 4R6YA 1I6QA 3MVZA 3H6UA 1LBBA 4QF9A 1OIBA 2XWOA 2XXIA 1BKAA 1MY0A 2V4CA 5H8HB 4UABA 2DYXA 1YTVA 5EYGA 4ZE9A 1BK4A 1MRPA 5ET7A 2E1SA 2DDKA 4M1VA 4Q30B 4MF3A 3OENA 1FQAA 2XXKA 3S9EA 4GD5A 2ONSA 2XWKA 4TQUQ 2HZLA 4YB5A 4R73A 2VOZA 4C1UA 3VLVA 3FVOA 2WYKA 3I6VA 2O1MA 3U92A 4IY6A 4RNSA 3UN6A 5BUUA 3FV1A 3E13X 3QUJA 5TPAA 2O1LA 3U65A 1JNFA 3CHGA 1P1UA 1XVYA 5AA2A 1JEUA 2O69A 1IMEA 1FTKA 3SEXA 3TTKA 2R71A 1N84A 3B7DA 4GVOA 3Q25A 4G68B 3OXNA 3S4UA 2DS9A 3USDA 4JVIA 1QW0A 3K02A 3FXQA 5ITOA 5F1QA 3SEYA 2E0SA 3FJGA 5IZ1A 1IMAA 3TZAA 4OANA 4FAJA 3PPOA 4M4GA 4UA8A 5FHMA 1EZ9A 2MKZA 4L17A 3DRGA 3KZGA 2ZMBA 4Q8RA 5KCJA 5CMKA 2V84A 2KR0A 1IQ7A 2QS1A 1US4A 4Z7EA 1XI6A 1IITA 4NEDA 2XWVA 3G3FA 4KFQA 3RYAA 4JWOA 1TFAA 3MZBA 3T66A 3N94A 3VE1B 2GQ1A 3CRBA 5ET8A 3RTWB 4H45A 5CMMA 2ZYNA 3MW0A 3T9VA 1LAGE 2CEYA 1MQHA 5I58B 3LSXA 2Z8EA 2G29A 4OFOA 1MXUA 3I5OA 5AA4B 1VR5A 4FBPA 2ALUA 3Q26A 3LR1A 3OO7A 1QUJA 1FCKA 1FTJA 1QUKA 2OZZA 2ABHA 2D21A 5H8FB 1FBFA 3MVXA 4P9KA 1LFIA 4NQ8A 1N3XA 2VPOA 2WEFA 4MJOA 4N6DA 1N76A 4GOTA 5DEXB 4AQ4A 2B3FA 2F8DA 2OCUA 3E3KA 4OFLA 4IGRA 1Q1KA 3FBPA 3BFUA 2HFBA 1LSTA 1YZ0A 1Y3QA 1D4NA 5FHNA 3IL1B 1EU8A 4DI3D 4ND9A 1NI9A 2F7AA 3BKIB 3PPPA 3V89B 1NV2A 4ZDMA 4Q5TA 1RDXA 4NAPA 3CI8A 3FXRA 1ELJA 4NF0A 4NF5A 3SERA 3M3FA 4NN3A 4G8NA 5I2NB 1FPJA 5CMBA 1SVXB 2F6PA 2ONKE 4U23A 3VVFA 5I58A 4NWCA 3N26A 2ZZVA 3IB2A 4JB7A 4X04A 5AA4A 1B2HA 3HV1A 4GWSA 3TCFA 5EQ8A 1LBYA 3Q29A 2PFZA 1B7UA 3CG1A 1R1NA 4G8HA 1IXGA 5A5LA 4F1YA 2D3IA 3VXBA 2VD3A 3K6VA 3MSTA 3V5AA 3RT8A 1NH8A 2DXRA 2AL4A 2H99A 5I59A 1ZIUA 4G61A 4RK2A 4EUOA 4DZ1A 4OWDA 4PFWA 3RYBA 3MYUA 1PB8A 4KXPA 1YXIA 4ISUA 3SEWA 4PCDA 4R9GA 1PEBA 4IY5A 3U1OA 2I4BA 1SBPA 4NMYA 1MY1A 1MM6A 3SESA 2QMWA 2QVRA 3PUVE 4EF1A 1DPPA 1ZLQA 3B6TA 4NX1A 1VSOA 4NTLA 3HFUA 3B6QA 3C32A 1IZ1A 2DSFA 2XXPA 1US5A 2XXYA 1UQWA 2KLFA 5L9SA 1QJMA 2L5VA 5TP9B 3C36A 1B1XA 1URGA 2F6GA 4P56A 3WAEA 4YKKA 5FTIA 4OMBA 5I2KB 4O94A 1SYIA 4OZ9A 4ONYA 3LVUA 4I9DA 3OO8A 2XXRA 5CBRA 4HTGA 1LLSA 2I6EA 3K4UA 4O7IA 2QS2A 3U72A 3LBSA 4AS5A 1Y3PA 4QHQA 3DELB 2V3TA 2DWHA 4QFNA 3ISPA 3UGWA 4KPTA 3H4ZA 3E79A 1AWBA 2UVJA 3BIGA 5FTHA 1YPNA 3KFMA 3T9HB 2WX9A 3U94A 2UYFA 1OLCA 3MAMA 2O68A 1ZMGA 4FEDA 2QL3A 1OVTA 2REGA 2QS4A 3RPWA 2I58A 4OVQA 1FPIA 5CC2A 5IKBA 4BLAA 4OVSA 5ET6A 1IMDA 3FD3A 5CRYA 4R9FA 2PBWA 1RDZA 5I84A 3FJ7A 1FPEA 4OVPA 2ZNSA 1SI0A 5EQ7A 3UK4A 3EHSA 3DP4A 4EF2A 3FATA 1D9YA 3EQ1A 2OWZA 2GHBA 5I57B 1SD3A 3VLWA 4DE8A 2Z23A 1XHYA 4LQ5A 4RJZA 5DTBA 4QSDA 1MS7A 3KC0A 3HN0A 3VV5A 3OOAA 1UTHA 1LEVA 4FIMA 5I2KA 4OVTA 2BJIA 2NVUB 3MPLA 3KN7A 4XKNA 4P1LA 3MP8A 1FW0A 3IB1A 2XA5A 3OSRA 3TTNA 5JK4A 1JVYA 4PFTA 3T0JA 1H43A 4U22A 3KSJA 3P7IA 3LSFB 2RC8A 3M8UA 3KSXA 1O7TA 4WEPA 3GBBA 4I40A 1FPKA 4GRKA 2R6GE 2V3QA 3IR1A 3MZ1A 1DMBA 4HE0A 5ICTA 4H5FA 5H8NA 3KJTA 1KA1A 4WKMA 1URSA 3VVEA 4GIZA 4LN5A 3DP8A 2G93A 3PGFA 2Y7KA 3OMBA 4ZEFA 1H44A 2Y7WA 2B3BA 3DLNA 3KJ7A 3RGYA 1A7LA 4XKQA 2XX9A 4PAKA 2A5TB 3THIA 2FA7A 1MQDA 4OEUA 3T93B 1QKAA 1IUDA 4POXA 1FQEA 3W9WA 4ZZAA 4GWUA 2Q9TA 3FV2A 4ZE8A 3KBRA 3RTFB 4KD5A 3O2AA 4F18A 1M5FA 1Z7ME 2ZNTA 1GR2A 4MHFA 1AMFA 2RC7A 3KEIA 5I3SA 1MDQA 3LSWA 1EYJA 3PD9A 2Q89A 4PFBA 4MMPA 1LFGA 4GX3A 3OO6A 2OWSA 1B4ZA 3SDFA 3KG2A 1URDA 4YAHX 1JW5A 1MM7A 4NHBA 4YB6A 3QMFA 1MY2A 2NUVA 2QMXA 2YLNA 2PT1A 2JJKA 2RCBA 5A5XA 2BJJX 4F3PA 2DXYA 1A40A 2B4LA 1PBQA 4GBWA 4X1DA 3RY3A 1B52A 2WBBA 5HBCA 3ILUB 3CFXA 3IB0A 3R7XA 1PC3A 4EQBA 1D3KA 4GWWA 3IX1A 3CVGA 1ZTYA 1SDXA 2AIXA 2AL5A 2Q8JA 1QKBA 1XC1A 4DI4B 4OA4A 2ZXTA 3TTRA 1JEVA 3SZPA 1BTJA 1NNKA 1PDAA 4N8GA 3TTMA 3TCGA 4C1TA 5CM6A 1DK4A 4ELRA 5JTYB 1OQGA 4IR8A 2HCAA 1B4HA 3MZ9A 5EYHA 4BDRA 5AA1A 1NFTA 3C34A 2V93A 3Q28A 3E78A 3LV0A 4N4UA 4KI0E 3K6WA 4KR5A 2I4CA 3O6HA 3SEVA 4OERA 4R75A 1RYOA 1R9QA 1UIVA 2WOKA 1QUIA 4PFUA 3ZS6A 1G0IA 3FVGA 2H5YA 1SW1A 2PX1A 4YZZA 1R6ZA 2OK2A 2M8CA 5H8HA 5B70A 4O3CA 4LZ7A 1AH5A 3QIMA 3PV0E 3ONMA 5AA2D 3G7WA 4EQ9A 3MWBA 4X9TA 4FORA 4AB6A 1DSNA 2RKMA 3CSBA 4P47A 3DP6A 4PBQA 1CNQA 1RKMA 3UA8A 4DIGA 2I3VA 5J1DA 4XTCQ 4HCWA 5K2XA 3K1MA 1SW5A 1FJ9A 1YCJA 4ZEDA 4F39A 1QGXA 3GLBA 2P3VA 4N15A 1M5BA 3ZSFA 4BDNA 1LCTA 4G68A 4LP2B 2P0SA 1FJ6A 5KZTA 5IZ3B 1YAEA 3RLFE 4ESXA 3IJXB 1B51A 3H06B 1K9ZA 1XOCA 3TDJA 4I62A 3T9XB 3IO6A 3S2VA 1CB6A 4EXLA 1POTA 4OESA 4OYVA 2Q8MA 4P8BA 3G3JA 1LAHE 4C0RA 4EXKA 2FYIA 4KHZE 2X7QA 3GZGA 1I6AA 3CFLA 4PE3A 2VP1A 4F1UA 1NL5A 3IFAA 1YYZA 4PBHA 3W15C 2XX7A 1DOTA 1SW2A 4O3AA 1N3WA 1VFEA 2DQVA 3KC1A 2IA4A 1H76A 4LZ5A 4MLQA 3NOHA 2GRVA 1NV4A 1B5JA 1Y9UA 3A3UA 4FEBA 4GF8A 2I0BA 1LBZA 1NUWA 5DVJA 3OSQA 5F7VA 2P2AA 3FASA 4THIA 2HAUA 4DCYA 3MUQA 5AE4A 1DPEA 3EPEA 3HCQA 4KYDA 2DP8A 3FIRA 1NV0A 4PDHA 4PC9A 3V83A 5LOMA 4QRZA 3I3VA 1NV6A 5H8FA 3U93A 1IXHA 5KDTB 4KYSA 4N6PA 1SI1A 5ESYA 2V25A 1P1QA 4YU0A 1USYE 4OXVA 1Y1MA 1MXVA 3M3KA 3RUMA 5DEXA 4U4XA 3MJNA 3MC2A 3U8QA 2F34A 1VE4A 4LVQA 2HXWA 2UXAA 4MEVA 4ECFA 4XIGQ 4ZECA 4PE5B 1XS5A 4JVCA 3RNNA 2H9BA 3RPLB 1IMFA 2HQ0A 1B3FA 2HZKA 1R9LA 1Y20A 4F3GA 2F7CA 1PBPA 4GXAA 1TT1A 5IGAA 1PB7A 4I3EA 1USYH 4PDDA 3MBPA 4ZEKA 1VDWA 4ELQA 3TPAA 4KCCA 1IXIA 1LBVA 2UVHA 3EN3A 2LAOA 3FVKA 1SPIA 1D9QA 3TMGA 3H7MA 4F19A 5I2NA 4QSEA 4DDDA 3IAZA 2QPQA 2DWIA 5L8DA 1NNFA 2R9JA 1HSJA 4NGUA 2DVZA 3B50A 2Y7RA 1QULA 4NF6B 4F31B 4NF8B 3T96B 2GH9A 4YMAA 4H67A 1GTKA 1ANFA 3R26A 5EYFA 1MPDA 4MLVA 2O51A 1Y4CA 3O29A 3TTLA 2F78A 5ITPA 4OHNA 2HHMA 2XXUA 2I0CA 1ZBMA 1I69A 1FRPA 1FPGA 4TLMB 1QVSA 1MQIA 4GWYA 1MQJA 1JQFA 3BFTA 5LDZA 3C9HA 2Z8DA 2ANJA 4XEQA 5L9MA 2P3NA 4PGNA 1DBZA 2I3WA 4KQPA 4WXJA 2H98A 1G0HA 2Z8FA 2GFEA 5I7IA 2HEUA 4ZZEA 5ISUA 2UVGA 1M5CA 1JP4A 3TFLA 1MH3A 4FECA 1JETA 4U21A 1DTZA 4LATA 1IXCA 3C35A 2FNCA 2THIA 1POY1 3K01A 1OLAA 4JWXA 3HHGA 4QFOA 4OETA 2O7IA 3GBAA 4GQOA 4PFRA 5IAIA 3PD8A 1Y1ZA 3IK6B 4KCDA 4GL8A 1P99A 2KQZA 1IIWA 2PCRA 2XXTA 4NE4A 5I56B 4H8IA 5TP9A 4OVRA 4NF4B 1RDYA 1LGBC 1FQFA 5IZZA 1NUZA 3JYRA 3N6TA 3PUZE 1A54A 4QFLA 1S9TA 4PAIA 3KN3A 2UYEA 3PU5A 4YKPA 1MH4A 2X26A 3IFCA 2VD2A 5BWJA 1UTBB 2VT5A 2P1SA 2ZYOA 1B1HA 4MNIA 1FTAA 4R6HA 2XXQA 4XKPA 1NV3A 1K9YA 1B3GA 3A09A 3O6PA 1LAXA 3R6UA 2F97A 2REJA 4XXUA 1D9VA 1JVXA 3ZKKA 5ICQA 3BIHA 4RXLA 3UP9A 4H65A 2DWAA 3UIFA 2WOLA 4G4PA 3G3GA 3PPRA 3OELA 4R6KA 3K0VA 4IO6A 4H6DA 3EF7A 4GFRA 1IMBA 2OBGA 3T9UA 2O7UA 3KOTA 1HSEA 2B65A 2CEXA 4GWOA 3MP1A 3RT6B 2Y84A 4HW8A 4OVJA 3EHUA 5DYHA 4F2QA 2GHAA 1B5IA 5B7DA 3H03A 4IO3A 3TQLA 4F2OA 3WAFA 1MG1A 2QSXA 5TPAB 1B9JA 3SEUA 1WDNA 3L6GA 3HO7A 3ODBA 3H6TA 4DLDA 4AB5A 3D4CA 5AA2B 3MPKA 3K2DA 1IEJA 4RK9A 1BIYA 5FHOA 5I57A 2PT2A 4DXCA 2PVUA 4NF4A 2WYPA 1FPDA 3VDFA 2NOOA 3RN8A 1BLFA 4H1XA 1MY3A 2DWJA 3OEKA 2XD3A 1ZKBA 2ZZWA 3KBZA 1EZPA 1OMPA 1CE2A 1B6HA 3DRFA 1VFDA 4I8CA 5H8QB 2QFLA 3O9PA 3PUWE 1O63A 2DE2A 4N91A 4NG7A 1MPBA 4JSDA 3FVNA 2FIXA 2O84X 3PPQA 3S9MC 2YPNA 4PF8A 3H3GA 1NMUA 1Y4TA 4IO7A 3DRKA 2W7YA 1MXZA 4TOZA 3HSTA 5EQ9A 2ZZXA 2H25A 2QS3A 4XF5A 4NWDA 3S9NC 3C33A 4MFIA 5AA3A 1A99A 3CG3A 3T1BA 4F3SA 3O28A 4PGPA 1IMCA 1LCFA 3IOWA 4DXUA 4UACA 2A5TA 1H45A 4H8JA 1KA0A 3VXCA 3AXFA 1Z7NE 3QSLA 3LUYA 1FSAA 2Q2AA 4E0WA 1KZ8A 2QJEA 2ZYMA 3B6WA 1N0TA 5DW8A 4ZEIA 3H6WA 3KOSA 3TYHA 2V3UA 1SYHA 3VFJA 4YMBA 1O64A 2WOPA 3V8XB 4WEDA 1XVXA 4JVDA 3UORA 2PFYA 2VGQA 1B3LA 1FTLA 3QK6A 1TXFA 4MNCA 1S7YA 3FTOA 4P11A 2OWTA 1N7WA 3ROJA 5CMCA 1FPLA 5CBSA 1FBEA 1NV5A 5H8QA 3CR9A 4ESWA 4QFPA 3F11A 2VHAA 3H6VA 4JDFA 4TLLB 2HAVA 4LONB 5J16A 2H4IA 3OEMA 1OVBA 4I3YA 4Z0IA 3D4GA 3DM0A 3CIJA 4QSCA 3HHFA 4MIJA 1GV8A 1MY4A 4FE8A 1EH3A 1B0LA 4PQJA 1EYKA 1NUXA 4NF5B 1Q35A 2XXWA 2ZYKA 2I48A 5EQAA 1TFDA 2CZHA 2OX3A 1B7HA 3IORA 4G77A 4Q0CA 1EZOA 2HXRA 3OO9A 3C31A 2F35A 1A8FA 5EHMA 1PB9A 3Q27A 4G68C 4GX6A 4IO4A 1FQDA 3RQTA 3O6GA 3IOUA 4PFIA 5JTYA 4OQOA 1Q9DA 2FHYA 4GL0A 3QAXA 1ZU0A 2B4MA 5LTCA 4P0IA 5IM2A 4K3FA 4MH5A 2RCAA 1FBGA 3FGSA 1M5DA 3PUYE 4JWYA 3C4MA 2NWJA 4PF6A 1RYXA 2NXOA 3QUFA 5H8SA 2XD2A 1N7XA 3FZVA 3TKDA 4H46A 1M5EA 1B46A 2OLBA 3MVYA 1MDP1 1LB9A 1N04A 5JEIA 4HE2A 4AS4A 1MXXA 4ZS9A 1AL3A 3TQWA 1S50A 3O97A 1J1NA 2XWIA 4U1OA 2Q74A 5I59B 1HSLA 1B3HA 2Q88A 2Y7IA 2QRYA 4MBPA 3PTYA 3VLUA 1NNPA 4LQ2A 3RYDA 2Z22A 1B5HA 3E9XA 4ELPA 1WVJA 5CI5A 2PYYA 4QXDA 3PPNA 1DCUA 3K6UA 1BP5A 4GWZA 3FXUA 3IJOB 3PMXA 2QVVA 1MXWA 3PMWA 4GBVA 4X1BA 1L5TA 4I1DA 5K2YA 5L9OA 1FPBA 4RY1A 2F3DA 2XHDA 2A5SA 3EHTA 3TUSA 2PMSA 1NV7A 4R74A 4OENA 3MVWA 4R2FA 4DCXA 4G8MA 1T0KA 4EQ7A 2XXXA 4OEVA 4GX4A 3TEPA 2I49A 5IZ3A 5TU0A 1EYIA 2F7BA 1F9BA 3T22A 2CZKA 1LBCA 4RPOA 2FVZA 4IO5A 4QBAA 3D1RA 3JV9A 3LUZA 3VVDA 4PP0A 3G3HA 4GXSB 4XFEA 4YB7A 1B58A 3S9LC 3LC8A 1INPA 3GXAA 1NV1A 2R8TA 2F5XA 1AIVA 4RYAA 4YICA 4O7MA 4IB2A 2ONRA 4P0GA 1TWYA 4BDOA 4O8MA 3IOVA 3W9VA 4LA9A 2CZLA 4MNPA 4POWA 2UVIA 1FTMA 1SQYA 4R72A 2DOJA 4N8YA 1LBXA 4OFJA 2DVCA 4F22A 4MX6A 2DE4A 1LB8A 5EHSA 1SW4A 5DVIA 5M2VA 4XKRA 3DRIA 1A55A 1B3EA 4YKJA 4U4SA 3MQ9A 3KGCA 4HCYA 2Y5LA 3MP6A 5KDTA 4N07A 3G3KA 5ET5A 3N5LA 1UTHB 3ECRA 2VPNA 2RC9A 1JW1A 1P1OA 3TELA 4G2ZA 1P1NA 5FBPA 3A3CA 4LZ8A 3TCHA 4DXBA 4JXIA 1NNTA 2X7PA 2YJPA 3O6IA 4JBZA 4R2BA 2Y7PA 3PMVA 3QYTA 3OD7A 3RPLA 3JZJA 3SKPA 4F3BA 1B05A 4IGTA 4U1ZA 2OJTA 4MCOA 2AYSA 2QVUA 2WBDA 4BDMA 1JW4A 4HS7A 3KN8A 2D5WA 3QXMA 5DT6A 3O66A 4GWXA 3G3IA 5H8NB 4H5GA 1H3DA 4IO2A 1DTGA 1B7ZA 1Y3NA 3IOTA 3GYYA 4FATA 4MAGA 1FQBA 1WODA 3EKIA
chains in the Genus database with same CATH topology
4OTEA 2CMOA 4N13A 4NF6A 4X48A 4NF8A 2XXHA 4F29A 2IEEA 1A8EA 1LFHA 2RF1A 3K6XA 1B0HA 2ESNA 4O3BA 3CFZA 4RA1A 1GGGA 3TAJA 3SETA 1KWHA 4KYEA 4RPNA 1II5A 2WKYA 4E0XA 4YKIA 3FUZA 1B40A 3E4RA 3ZKLA 3DRJA 5ELVA 4PFYA 3ILTB 3CSGA 1I6BA 3FJMA 1P1WA 4F1VA 1B32A 3DRHA 3BBRA 4BDQA 1OQHA 5HM4B 2RINA 5A5XB 4FJPA 1XT8A 3K1NA 3M3LA 2DE3A 1MXYA 1NKXA 3PUXE 4U2RA 4EDPA 1ATGA 2ZNUA 3L6HA 1MQGA 3PAMA 1FTOA 3IO4A 3K00A 1ZJLA 3LSLA 1UIUA 3N6UA 2Q2CA 5I56A 3HPIA 4PETA 2O6AA 4H0WA 1GVCA 3TODA 1MPCA 1UTBA 3K1PA 5DVFA 1AOVA 1FQCA 2F36A 2XX8A 4ELOA 4GLIA 4JSOA 4LUBA 2XXVA 4BDLA 4ZEBA 4QFKA 5KCJB 5HPQA 1LAFE 1NH7A 4R6YA 1I6QA 3MVZA 3H6UA 1LBBA 4QF9A 1OIBA 2XXIA 1BKAA 1MY0A 5H8HB 2DYXA 1YTVA 4ZE9A 1MRPA 2E1SA 4M1VA 4Q30B 4MF3A 3OENA 1FQAA 3S9EA 4GD5A 2ONSA 4TQUQ 2HZLA 4YB5A 4R73A 2VOZA 4C1UA 3VLVA 3FVOA 3I6VA 2O1MA 3U92A 4IY6A 4RNSA 3UN6A 5BUUA 3FV1A 3E13X 3QUJA 5TPAA 2O1LA 1JNFA 3CHGA 1P1UA 1XVYA 5AA2A 1JEUA 2O69A 1FTKA 3SEXA 3TTKA 2R71A 1N84A 3B7DA 4GVOA 3Q25A 4G68B 3OXNA 3S4UA 2DS9A 3USDA 1QW0A 3K02A 3FXQA 5ITOA 5F1QA 3SEYA 2E0SA 3FJGA 3TZAA 4FAJA 3PPOA 4M4GA 4UA8A 5FHMA 1EZ9A 4L17A 3DRGA 3KZGA 2ZMBA 4Q8RA 5KCJA 5CMKA 2V84A 2QS1A 1IQ7A 1US4A 4Z7EA 1IITA 4NEDA 3G3FA 4KFQA 3RYAA 4JWOA 1TFAA 3MZBA 3T66A 3N94A 3VE1B 3CRBA 3RTWB 5CMMA 2ZYNA 3MW0A 3T9VA 1LAGE 1MQHA 5I58B 3LSXA 2Z8EA 2G29A 4OFOA 1MXUA 3I5OA 5AA4B 1VR5A 2ALUA 3Q26A 3LR1A 3OO7A 1QUJA 1FCKA 1FTJA 1QUKA 2OZZA 2ABHA 2D21A 5H8FB 3MVXA 1LFIA 1N3XA 1N76A 4GOTA 5DEXB 4AQ4A 2B3FA 2F8DA 2OCUA 3E3KA 4OFLA 4IGRA 1Q1KA 3BFUA 2HFBA 1LSTA 1Y3QA 1D4NA 5FHNA 3IL1B 1EU8A 4ND9A 2F7AA 3BKIB 3PPPA 3V89B 4ZDMA 4Q5TA 3CI8A 3FXRA 1ELJA 4NF5A 3SERA 3M3FA 4G8NA 5I2NB 5CMBA 1SVXB 2F6PA 2ONKE 4U23A 3VVFA 5I58A 4NWCA 3N26A 3IB2A 4JB7A 5AA4A 1B2HA 3HV1A 3TCFA 3Q29A 1B7UA 3CG1A 1R1NA 4G8HA 1IXGA 4F1YA 2D3IA 3VXBA 2VD3A 3K6VA 3V5AA 3RT8A 1NH8A 2DXRA 2AL4A 2H99A 5I59A 1ZIUA 4RK2A 4EUOA 4DZ1A 4OWDA 4PFWA 3RYBA 1PB8A 4ISUA 3SEWA 4R9GA 1PEBA 4IY5A 3U1OA 2I4BA 1SBPA 4NMYA 1MY1A 1MM6A 3SESA 2QMWA 3PUVE 4EF1A 1DPPA 1ZLQA 3B6TA 1VSOA 4NTLA 3B6QA 3C32A 1IZ1A 2DSFA 2XXPA 1US5A 2XXYA 1UQWA 2KLFA 5L9SA 1QJMA 5TP9B 3C36A 1B1XA 1URGA 2F6GA 3WAEA 4YKKA 5FTIA 4OMBA 5I2KB 1SYIA 4OZ9A 4ONYA 3LVUA 4I9DA 3OO8A 2XXRA 5CBRA 4HTGA 1LLSA 2I6EA 3K4UA 2QS2A 3U72A 3LBSA 1Y3PA 4QHQA 3DELB 2V3TA 2DWHA 4QFNA 3UGWA 4KPTA 3H4ZA 2UVJA 5FTHA 1YPNA 3KFMA 3T9HB 3U94A 2UYFA 1OLCA 3MAMA 2O68A 1ZMGA 4FEDA 2QL3A 1OVTA 2REGA 2QS4A 3RPWA 2I58A 5CC2A 5IKBA 4BLAA 3FD3A 5CRYA 4R9FA 2PBWA 5I84A 3FJ7A 2ZNSA 1SI0A 3UK4A 3EHSA 3DP4A 4EF2A 3FATA 1D9YA 3EQ1A 2GHBA 5I57B 1SD3A 3VLWA 4DE8A 2Z23A 1XHYA 4LQ5A 4RJZA 5DTBA 4QSDA 1MS7A 3HN0A 3VV5A 3OOAA 1UTHA 4FIMA 5I2KA 2NVUB 3MPLA 3KN7A 4XKNA 3MP8A 1FW0A 3IB1A 3OSRA 3TTNA 5JK4A 1JVYA 4PFTA 1H43A 4U22A 3KSJA 3P7IA 3LSFB 2RC8A 3M8UA 3KSXA 1O7TA 4WEPA 3GBBA 4GRKA 2R6GE 2V3QA 3IR1A 3MZ1A 1DMBA 5ICTA 4H5FA 5H8NA 3KJTA 4WKMA 1URSA 3VVEA 4GIZA 3DP8A 2G93A 3PGFA 2Y7KA 3OMBA 4ZEFA 1H44A 2Y7WA 2B3BA 3DLNA 3KJ7A 3RGYA 1A7LA 4XKQA 2XX9A 2A5TB 3THIA 2FA7A 1MQDA 4OEUA 3T93B 1QKAA 1IUDA 4POXA 1FQEA 3W9WA 4ZZAA 2Q9TA 3FV2A 4ZE8A 3KBRA 3RTFB 4KD5A 3O2AA 4F18A 1M5FA 1Z7ME 2ZNTA 1GR2A 1AMFA 2RC7A 3KEIA 1MDQA 3LSWA 3PD9A 2Q89A 1LFGA 3OO6A 2OWSA 1B4ZA 3SDFA 3KG2A 1URDA 4YAHX 1JW5A 1MM7A 4YB6A 1MY2A 2NUVA 2QMXA 2YLNA 2PT1A 2RCBA 5A5XA 2BJJX 4F3PA 2DXYA 1A40A 2B4LA 1PBQA 4X1DA 3RY3A 1B52A 5HBCA 3ILUB 3CFXA 3IB0A 3R7XA 1PC3A 4EQBA 1D3KA 3IX1A 3CVGA 1ZTYA 1SDXA 2AIXA 2AL5A 2Q8JA 1QKBA 1XC1A 2ZXTA 3TTRA 1JEVA 1BTJA 1NNKA 1PDAA 3TTMA 3TCGA 4C1TA 5CM6A 4ELRA 5JTYB 1OQGA 2HCAA 1B4HA 3MZ9A 4BDRA 5AA1A 1NFTA 3C34A 2V93A 3Q28A 4KI0E 3K6WA 4KR5A 2I4CA 3O6HA 3SEVA 4OERA 4R75A 1RYOA 1R9QA 1UIVA 2WOKA 1QUIA 4PFUA 3ZS6A 3FVGA 2H5YA 1SW1A 2PX1A 4YZZA 1R6ZA 2OK2A 2M8CA 5H8HA 5B70A 4O3CA 4LZ7A 1AH5A 3QIMA 3PV0E 3ONMA 5AA2D 3G7WA 4EQ9A 3MWBA 4X9TA 4FORA 4AB6A 1DSNA 2RKMA 3CSBA 3DP6A 1RKMA 3UA8A 4DIGA 2I3VA 5J1DA 4XTCQ 4HCWA 5K2XA 3K1MA 1SW5A 1YCJA 4ZEDA 4F39A 3GLBA 1M5BA 3ZSFA 4BDNA 1LCTA 4G68A 4LP2B 2P0SA 5KZTA 1YAEA 3RLFE 4ESXA 3IJXB 1B51A 3H06B 1XOCA 3TDJA 4I62A 3T9XB 3IO6A 3S2VA 1CB6A 4EXLA 1POTA 4OESA 4OYVA 3G3JA 1LAHE 4C0RA 4EXKA 2FYIA 4KHZE 2X7QA 3GZGA 1I6AA 3CFLA 2VP1A 4F1UA 1NL5A 3W15C 2XX7A 1DOTA 1SW2A 4O3AA 1N3WA 1VFEA 2DQVA 2IA4A 1H76A 4LZ5A 4MLQA 2GRVA 1B5JA 1Y9UA 3A3UA 4FEBA 4GF8A 2I0BA 5DVJA 3OSQA 5F7VA 2P2AA 3FASA 4THIA 2HAUA 4DCYA 3MUQA 5AE4A 1DPEA 3EPEA 3HCQA 4KYDA 2DP8A 3FIRA 3V83A 5LOMA 4QRZA 3I3VA 5H8FA 3U93A 1IXHA 5KDTB 4KYSA 4N6PA 1SI1A 2V25A 1P1QA 4YU0A 1USYE 4OXVA 1Y1MA 1MXVA 3M3KA 3RUMA 5DEXA 4U4XA 3MJNA 3MC2A 3U8QA 2F34A 1VE4A 4LVQA 2HXWA 4ECFA 2UXAA 4XIGQ 4ZECA 4PE5B 1XS5A 3RNNA 2H9BA 2HQ0A 1B3FA 2HZKA 1R9LA 1Y20A 4F3GA 2F7CA 1PBPA 4GXAA 1TT1A 1PB7A 1USYH 3MBPA 4ZEKA 4ELQA 3TPAA 4KCCA 1IXIA 2UVHA 3EN3A 2LAOA 3FVKA 3TMGA 3H7MA 4F19A 5I2NA 4QSEA 4DDDA 3IAZA 2QPQA 2DWIA 5L8DA 1NNFA 2R9JA 1HSJA 2DVZA 2Y7RA 1QULA 4NF6B 4F31B 4NF8B 3T96B 2GH9A 4YMAA 4H67A 1GTKA 1ANFA 3R26A 5EYFA 1MPDA 4MLVA 2O51A 1Y4CA 3O29A 3TTLA 2F78A 5ITPA 4OHNA 2XXUA 2I0CA 1ZBMA 1I69A 4TLMB 1QVSA 1MQIA 1MQJA 1JQFA 3BFTA 3C9HA 2Z8DA 2ANJA 5L9MA 2I3WA 4KQPA 4WXJA 2H98A 2Z8FA 2GFEA 2HEUA 4ZZEA 5ISUA 2UVGA 1M5CA 3TFLA 1MH3A 4FECA 1JETA 4U21A 1DTZA 4LATA 1IXCA 3C35A 2FNCA 2THIA 1POY1 3K01A 1OLAA 4JWXA 3HHGA 4QFOA 4OETA 2O7IA 3GBAA 4GQOA 5IAIA 3PD8A 1Y1ZA 3IK6B 4KCDA 4GL8A 1P99A 1IIWA 2XXTA 4NE4A 5I56B 4H8IA 5TP9A 4NF4B 1LGBC 1FQFA 3JYRA 3N6TA 3PUZE 1A54A 4QFLA 1S9TA 3KN3A 2UYEA 3PU5A 4YKPA 1MH4A 2X26A 2VD2A 5BWJA 1UTBB 2P1SA 2ZYOA 1B1HA 4R6HA 2XXQA 4XKPA 1B3GA 3A09A 3O6PA 1LAXA 3R6UA 2F97A 2REJA 4XXUA 1D9VA 1JVXA 3ZKKA 5ICQA 4RXLA 3UP9A 4H65A 2DWAA 3UIFA 2WOLA 4G4PA 3G3GA 3PPRA 3OELA 4R6KA 3K0VA 4IO6A 4H6DA 3EF7A 4GFRA 2OBGA 3T9UA 2O7UA 3KOTA 1HSEA 2B65A 4GWOA 3MP1A 3RT6B 2Y84A 4HW8A 4OVJA 3EHUA 5DYHA 4F2QA 2GHAA 1B5IA 5B7DA 3H03A 4IO3A 3TQLA 4F2OA 3WAFA 1MG1A 2QSXA 5TPAB 1B9JA 3SEUA 1WDNA 3L6GA 3HO7A 3ODBA 3H6TA 4DLDA 4AB5A 3D4CA 5AA2B 3MPKA 3K2DA 1IEJA 4RK9A 1BIYA 5FHOA 5I57A 2PT2A 4DXCA 2PVUA 4NF4A 3VDFA 2NOOA 3RN8A 1BLFA 4H1XA 1MY3A 2DWJA 3OEKA 2XD3A 1ZKBA 1EZPA 1OMPA 1CE2A 1B6HA 3DRFA 1VFDA 4I8CA 5H8QB 3O9PA 3PUWE 1O63A 2DE2A 1MPBA 4JSDA 3FVNA 2O84X 3PPQA 3S9MC 2YPNA 3H3GA 1NMUA 1Y4TA 4IO7A 3DRKA 2W7YA 1MXZA 4TOZA 3HSTA 2H25A 2QS3A 4NWDA 3S9NC 3C33A 4MFIA 5AA3A 1A99A 3CG3A 4F3SA 3O28A 1LCFA 3IOWA 4DXUA 4UACA 2A5TA 1H45A 4H8JA 3VXCA 3AXFA 1Z7NE 3QSLA 3LUYA 2Q2AA 4E0WA 2QJEA 2ZYMA 3B6WA 1N0TA 4ZEIA 3H6WA 3KOSA 3TYHA 2V3UA 1SYHA 3VFJA 4YMBA 1O64A 2WOPA 3V8XB 4WEDA 1XVXA 3UORA 2VGQA 1B3LA 1FTLA 3QK6A 1TXFA 1S7YA 3FTOA 4P11A 2OWTA 1N7WA 5CMCA 5CBSA 5H8QA 3CR9A 4ESWA 4QFPA 3F11A 2VHAA 3H6VA 4JDFA 4TLLB 2HAVA 4LONB 2H4IA 3OEMA 1OVBA 4Z0IA 3D4GA 3DM0A 3CIJA 4QSCA 3HHFA 1GV8A 1MY4A 4FE8A 1EH3A 1B0LA 4PQJA 4NF5B 1Q35A 2XXWA 2ZYKA 2I48A 1TFDA 1B7HA 3IORA 4G77A 4Q0CA 1EZOA 3OO9A 3C31A 2F35A 1A8FA 5EHMA 1PB9A 3Q27A 4G68C 4IO4A 1FQDA 3RQTA 3O6GA 3IOUA 5JTYA 4OQOA 4GL0A 3QAXA 1ZU0A 2B4MA 4P0IA 4K3FA 4MH5A 2RCAA 3FGSA 1M5DA 3PUYE 4JWYA 3C4MA 2NWJA 1RYXA 2NXOA 3QUFA 5H8SA 2XD2A 1N7XA 3FZVA 3TKDA 1M5EA 1B46A 2OLBA 3MVYA 1MDP1 1LB9A 1N04A 5JEIA 1MXXA 4ZS9A 1AL3A 3TQWA 1S50A 3O97A 1J1NA 4U1OA 5I59B 1HSLA 1B3HA 2Q88A 2Y7IA 2QRYA 4MBPA 3VLUA 1NNPA 4LQ2A 2Z22A 1B5HA 3E9XA 4ELPA 1WVJA 5CI5A 2PYYA 3PPNA 3K6UA 1BP5A 3FXUA 3IJOB 3PMXA 1MXWA 3PMWA 4X1BA 1L5TA 4I1DA 5K2YA 5L9OA 4RY1A 2XHDA 2A5SA 3EHTA 3TUSA 2PMSA 4R74A 4OENA 3MVWA 4R2FA 4DCXA 4G8MA 1T0KA 4EQ7A 2XXXA 4OEVA 3TEPA 2I49A 5TU0A 2F7BA 1F9BA 3T22A 1LBCA 4RPOA 4IO5A 3JV9A 3VVDA 4PP0A 3G3HA 4GXSB 4YB7A 1B58A 3S9LC 3LC8A 3GXAA 2F5XA 1AIVA 4RYAA 4YICA 4IB2A 2ONRA 4P0GA 1TWYA 4BDOA 3IOVA 3W9VA 4LA9A 2CZLA 4POWA 2UVIA 1FTMA 1SQYA 4R72A 2DOJA 4OFJA 2DVCA 4F22A 2DE4A 1LB8A 5EHSA 1SW4A 5DVIA 5M2VA 4XKRA 3DRIA 1A55A 1B3EA 4YKJA 4U4SA 3MQ9A 3KGCA 4HCYA 3MP6A 5KDTA 4N07A 3G3KA 3N5LA 1UTHB 3ECRA 2RC9A 1JW1A 1P1OA 3TELA 4G2ZA 1P1NA 3A3CA 4LZ8A 3TCHA 4DXBA 4JXIA 1NNTA 2X7PA 2YJPA 3O6IA 4JBZA 4R2BA 2Y7PA 3PMVA 3QYTA 3OD7A 3JZJA 3SKPA 4F3BA 1B05A 4IGTA 4U1ZA 2OJTA 2AYSA 4BDMA 1JW4A 4HS7A 3KN8A 2D5WA 3QXMA 5DT6A 3O66A 3G3IA 5H8NB 4H5GA 1H3DA 4IO2A 1DTGA 1B7ZA 1Y3NA 3IOTA 4FATA 1FQBA 1WODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OTE A;  2CMO A;  4N13 A;  4NF6 A;  4X48 A;  4NF8 A;  2XXH A;  4F29 A;  2IEE A;  1A8E A;  1LFH A;  2RF1 A;  3K6X A;  1B0H A;  2ESN A;  4O3B A;  3CFZ A;  4RA1 A;  1GGG A;  3TAJ A;  3SET A;  1KWH A;  4KYE A;  4RPN A;  1II5 A;  2WKY A;  4E0X A;  4YKI A;  3FUZ A;  1B40 A;  3E4R A;  3ZKL A;  3DRJ A;  5ELV A;  4PFY A;  3ILT B;  3CSG A;  1I6B A;  3FJM A;  1P1W A;  4F1V A;  1B32 A;  3DRH A;  3BBR A;  4BDQ A;  1OQH A;  5HM4 B;  2RIN A;  5A5X B;  4FJP A;  1XT8 A;  3K1N A;  3M3L A;  2DE3 A;  1MXY A;  1NKX A;  3PUX E;  4U2R A;  4EDP A;  1ATG A;  2ZNU A;  3L6H A;  1MQG A;  3PAM A;  1FTO A;  3IO4 A;  3K00 A;  1ZJL A;  3LSL A;  1UIU A;  3N6U A;  2Q2C A;  5I56 A;  3HPI A;  4PET A;  2O6A A;  4H0W A;  1GVC A;  3TOD A;  1MPC A;  1UTB A;  3K1P A;  5DVF A;  1AOV A;  1FQC A;  2F36 A;  2XX8 A;  4ELO A;  4GLI A;  4JSO A;  4LUB A;  2XXV A;  4BDL A;  4ZEB A;  4QFK A;  5KCJ B;  5HPQ A;  1LAF E;  1NH7 A;  4R6Y A;  1I6Q A;  3MVZ A;  3H6U A;  1LBB A;  4QF9 A;  1OIB A;  2XXI A;  1BKA A;  1MY0 A;  5H8H B;  2DYX A;  1YTV A;  4ZE9 A;  1MRP A;  2E1S A;  4M1V A;  4Q30 B;  4MF3 A;  3OEN A;  1FQA A;  3S9E A;  4GD5 A;  2ONS A;  4TQU Q;  2HZL A;  4YB5 A;  4R73 A;  2VOZ A;  4C1U A;  3VLV A;  3FVO A;  3I6V A;  2O1M A;  3U92 A;  4IY6 A;  4RNS A;  3UN6 A;  5BUU A;  3FV1 A;  3E13 X;  3QUJ A;  5TPA A;  2O1L A;  1JNF A;  3CHG A;  1P1U A;  1XVY A;  5AA2 A;  1JEU A;  2O69 A;  1FTK A;  3SEX A;  3TTK A;  2R71 A;  1N84 A;  3B7D A;  4GVO A;  3Q25 A;  4G68 B;  3OXN A;  3S4U A;  2DS9 A;  3USD A;  1QW0 A;  3K02 A;  3FXQ A;  5ITO A;  5F1Q A;  3SEY A;  2E0S A;  3FJG A;  3TZA A;  4FAJ A;  3PPO A;  4M4G A;  4UA8 A;  5FHM A;  1EZ9 A;  4L17 A;  3DRG A;  3KZG A;  2ZMB A;  4Q8R A;  5KCJ A;  5CMK A;  2V84 A;  2QS1 A;  1IQ7 A;  1US4 A;  4Z7E A;  1IIT A;  4NED A;  3G3F A;  4KFQ A;  3RYA A;  4JWO A;  1TFA A;  3MZB A;  3T66 A;  3N94 A;  3VE1 B;  3CRB A;  3RTW B;  5CMM A;  2ZYN A;  3MW0 A;  3T9V A;  1LAG E;  1MQH A;  5I58 B;  3LSX A;  2Z8E A;  2G29 A;  4OFO A;  1MXU A;  3I5O A;  5AA4 B;  1VR5 A;  2ALU A;  3Q26 A;  3LR1 A;  3OO7 A;  1QUJ A;  1FCK A;  1FTJ A;  1QUK A;  2OZZ A;  2ABH A;  2D21 A;  5H8F B;  3MVX A;  1LFI A;  1N3X A;  1N76 A;  4GOT A;  5DEX B;  4AQ4 A;  2B3F A;  2F8D A;  2OCU A;  3E3K A;  4OFL A;  4IGR A;  1Q1K A;  3BFU A;  2HFB A;  1LST A;  1Y3Q A;  1D4N A;  5FHN A;  3IL1 B;  1EU8 A;  4ND9 A;  2F7A A;  3BKI B;  3PPP A;  3V89 B;  4ZDM A;  4Q5T A;  3CI8 A;  3FXR A;  1ELJ A;  4NF5 A;  3SER A;  3M3F A;  4G8N A;  5I2N B;  5CMB A;  1SVX B;  2F6P A;  2ONK E;  4U23 A;  3VVF A;  5I58 A;  4NWC A;  3N26 A;  3IB2 A;  4JB7 A;  5AA4 A;  1B2H A;  3HV1 A;  3TCF A;  3Q29 A;  1B7U A;  3CG1 A;  1R1N A;  4G8H A;  1IXG A;  4F1Y A;  2D3I A;  3VXB A;  2VD3 A;  3K6V A;  3V5A A;  3RT8 A;  1NH8 A;  2DXR A;  2AL4 A;  2H99 A;  5I59 A;  1ZIU A;  4RK2 A;  4EUO A;  4DZ1 A;  4OWD A;  4PFW A;  3RYB A;  1PB8 A;  4ISU A;  3SEW A;  4R9G A;  1PEB A;  4IY5 A;  3U1O A;  2I4B A;  1SBP A;  4NMY A;  1MY1 A;  1MM6 A;  3SES A;  2QMW A;  3PUV E;  4EF1 A;  1DPP A;  1ZLQ A;  3B6T A;  1VSO A;  4NTL A;  3B6Q A;  3C32 A;  1IZ1 A;  2DSF A;  2XXP A;  1US5 A;  2XXY A;  1UQW A;  2KLF A;  5L9S A;  1QJM A;  5TP9 B;  3C36 A;  1B1X A;  1URG A;  2F6G A;  3WAE A;  4YKK A;  5FTI A;  4OMB A;  5I2K B;  1SYI A;  4OZ9 A;  4ONY A;  3LVU A;  4I9D A;  3OO8 A;  2XXR A;  5CBR A;  4HTG A;  1LLS A;  2I6E A;  3K4U A;  2QS2 A;  3U72 A;  3LBS A;  1Y3P A;  4QHQ A;  3DEL B;  2V3T A;  2DWH A;  4QFN A;  3UGW A;  4KPT A;  3H4Z A;  2UVJ A;  5FTH A;  1YPN A;  3KFM A;  3T9H B;  3U94 A;  2UYF A;  1OLC A;  3MAM A;  2O68 A;  1ZMG A;  4FED A;  2QL3 A;  1OVT A;  2REG A;  2QS4 A;  3RPW A;  2I58 A;  5CC2 A;  5IKB A;  4BLA A;  3FD3 A;  5CRY A;  4R9F A;  2PBW A;  5I84 A;  3FJ7 A;  2ZNS A;  1SI0 A;  3UK4 A;  3EHS A;  3DP4 A;  4EF2 A;  3FAT A;  1D9Y A;  3EQ1 A;  2GHB A;  5I57 B;  1SD3 A;  3VLW A;  4DE8 A;  2Z23 A;  1XHY A;  4LQ5 A;  4RJZ A;  5DTB A;  4QSD A;  1MS7 A;  3HN0 A;  3VV5 A;  3OOA A;  1UTH A;  4FIM A;  5I2K A;  2NVU B;  3MPL A;  3KN7 A;  4XKN A;  3MP8 A;  1FW0 A;  3IB1 A;  3OSR A;  3TTN A;  5JK4 A;  1JVY A;  4PFT A;  1H43 A;  4U22 A;  3KSJ A;  3P7I A;  3LSF B;  2RC8 A;  3M8U A;  3KSX A;  1O7T A;  4WEP A;  3GBB A;  4GRK A;  2R6G E;  2V3Q A;  3IR1 A;  3MZ1 A;  1DMB A;  5ICT A;  4H5F A;  5H8N A;  3KJT A;  4WKM A;  1URS A;  3VVE A;  4GIZ A;  3DP8 A;  2G93 A;  3PGF A;  2Y7K A;  3OMB A;  4ZEF A;  1H44 A;  2Y7W A;  2B3B A;  3DLN A;  3KJ7 A;  3RGY A;  1A7L A;  4XKQ A;  2XX9 A;  2A5T B;  3THI A;  2FA7 A;  1MQD A;  4OEU A;  3T93 B;  1QKA A;  1IUD A;  4POX A;  1FQE A;  3W9W A;  4ZZA A;  2Q9T A;  3FV2 A;  4ZE8 A;  3KBR A;  3RTF B;  4KD5 A;  3O2A A;  4F18 A;  1M5F A;  1Z7M E;  2ZNT A;  1GR2 A;  1AMF A;  2RC7 A;  3KEI A;  1MDQ A;  3LSW A;  3PD9 A;  2Q89 A;  1LFG A;  3OO6 A;  2OWS A;  1B4Z A;  3SDF A;  3KG2 A;  1URD A;  4YAH X;  1JW5 A;  1MM7 A;  4YB6 A;  1MY2 A;  2NUV A;  2QMX A;  2YLN A;  2PT1 A;  2RCB A;  5A5X A;  2BJJ X;  4F3P A;  2DXY A;  1A40 A;  2B4L A;  1PBQ A;  4X1D A;  3RY3 A;  1B52 A;  5HBC A;  3ILU B;  3CFX A;  3IB0 A;  3R7X A;  1PC3 A;  4EQB A;  1D3K A;  3IX1 A;  3CVG A;  1ZTY A;  1SDX A;  2AIX A;  2AL5 A;  2Q8J A;  1QKB A;  1XC1 A;  2ZXT A;  3TTR A;  1JEV A;  1BTJ A;  1NNK A;  1PDA A;  3TTM A;  3TCG A;  4C1T A;  5CM6 A;  4ELR A;  5JTY B;  1OQG A;  2HCA A;  1B4H A;  3MZ9 A;  4BDR A;  5AA1 A;  1NFT A;  3C34 A;  2V93 A;  3Q28 A;  4KI0 E;  3K6W A;  4KR5 A;  2I4C A;  3O6H A;  3SEV A;  4OER A;  4R75 A;  1RYO A;  1R9Q A;  1UIV A;  2WOK A;  1QUI A;  4PFU A;  3ZS6 A;  3FVG A;  2H5Y A;  1SW1 A;  2PX1 A;  4YZZ A;  1R6Z A;  2OK2 A;  2M8C A;  5H8H A;  5B70 A;  4O3C A;  4LZ7 A;  1AH5 A;  3QIM A;  3PV0 E;  3ONM A;  5AA2 D;  3G7W A;  4EQ9 A;  3MWB A;  4X9T A;  4FOR A;  4AB6 A;  1DSN A;  2RKM A;  3CSB A;  3DP6 A;  1RKM A;  3UA8 A;  4DIG A;  2I3V A;  5J1D A;  4XTC Q;  4HCW A;  5K2X A;  3K1M A;  1SW5 A;  1YCJ A;  4ZED A;  4F39 A;  3GLB A;  1M5B A;  3ZSF A;  4BDN A;  1LCT A;  4G68 A;  4LP2 B;  2P0S A;  5KZT A;  1YAE A;  3RLF E;  4ESX A;  3IJX B;  1B51 A;  3H06 B;  1XOC A;  3TDJ A;  4I62 A;  3T9X B;  3IO6 A;  3S2V A;  1CB6 A;  4EXL A;  1POT A;  4OES A;  4OYV A;  3G3J A;  1LAH E;  4C0R A;  4EXK A;  2FYI A;  4KHZ E;  2X7Q A;  3GZG A;  1I6A A;  3CFL A;  2VP1 A;  4F1U A;  1NL5 A;  3W15 C;  2XX7 A;  1DOT A;  1SW2 A;  4O3A A;  1N3W A;  1VFE A;  2DQV A;  2IA4 A;  1H76 A;  4LZ5 A;  4MLQ A;  2GRV A;  1B5J A;  1Y9U A;  3A3U A;  4FEB A;  4GF8 A;  2I0B A;  5DVJ A;  3OSQ A;  5F7V A;  2P2A A;  3FAS A;  4THI A;  2HAU A;  4DCY A;  3MUQ A;  5AE4 A;  1DPE A;  3EPE A;  3HCQ A;  4KYD A;  2DP8 A;  3FIR A;  3V83 A;  5LOM A;  4QRZ A;  3I3V A;  5H8F A;  3U93 A;  1IXH A;  5KDT B;  4KYS A;  4N6P A;  1SI1 A;  2V25 A;  1P1Q A;  4YU0 A;  1USY E;  4OXV A;  1Y1M A;  1MXV A;  3M3K A;  3RUM A;  5DEX A;  4U4X A;  3MJN A;  3MC2 A;  3U8Q A;  2F34 A;  1VE4 A;  4LVQ A;  2HXW A;  4ECF A;  2UXA A;  4XIG Q;  4ZEC A;  4PE5 B;  1XS5 A;  3RNN A;  2H9B A;  2HQ0 A;  1B3F A;  2HZK A;  1R9L A;  1Y20 A;  4F3G A;  2F7C A;  1PBP A;  4GXA A;  1TT1 A;  1PB7 A;  1USY H;  3MBP A;  4ZEK A;  4ELQ A;  3TPA A;  4KCC A;  1IXI A;  2UVH A;  3EN3 A;  2LAO A;  3FVK A;  3TMG A;  3H7M A;  4F19 A;  5I2N A;  4QSE A;  4DDD A;  3IAZ A;  2QPQ A;  2DWI A;  5L8D A;  1NNF A;  2R9J A;  1HSJ A;  2DVZ A;  2Y7R A;  1QUL A;  4NF6 B;  4F31 B;  4NF8 B;  3T96 B;  2GH9 A;  4YMA A;  4H67 A;  1GTK A;  1ANF A;  3R26 A;  5EYF A;  1MPD A;  4MLV A;  2O51 A;  1Y4C A;  3O29 A;  3TTL A;  2F78 A;  5ITP A;  4OHN A;  2XXU A;  2I0C A;  1ZBM A;  1I69 A;  4TLM B;  1QVS A;  1MQI A;  1MQJ A;  1JQF A;  3BFT A;  3C9H A;  2Z8D A;  2ANJ A;  5L9M A;  2I3W A;  4KQP A;  4WXJ A;  2H98 A;  2Z8F A;  2GFE A;  2HEU A;  4ZZE A;  5ISU A;  2UVG A;  1M5C A;  3TFL A;  1MH3 A;  4FEC A;  1JET A;  4U21 A;  1DTZ A;  4LAT A;  1IXC A;  3C35 A;  2FNC A;  2THI A;  1POY 1;  3K01 A;  1OLA A;  4JWX A;  3HHG A;  4QFO A;  4OET A;  2O7I A;  3GBA A;  4GQO A;  5IAI A;  3PD8 A;  1Y1Z A;  3IK6 B;  4KCD A;  4GL8 A;  1P99 A;  1IIW A;  2XXT A;  4NE4 A;  5I56 B;  4H8I A;  5TP9 A;  4NF4 B;  1LGB C;  1FQF A;  3JYR A;  3N6T A;  3PUZ E;  1A54 A;  4QFL A;  1S9T A;  3KN3 A;  2UYE A;  3PU5 A;  4YKP A;  1MH4 A;  2X26 A;  2VD2 A;  5BWJ A;  1UTB B;  2P1S A;  2ZYO A;  1B1H A;  4R6H A;  2XXQ A;  4XKP A;  1B3G A;  3A09 A;  3O6P A;  1LAX A;  3R6U A;  2F97 A;  2REJ A;  4XXU A;  1D9V A;  1JVX A;  3ZKK A;  5ICQ A;  4RXL A;  3UP9 A;  4H65 A;  2DWA A;  3UIF A;  2WOL A;  4G4P A;  3G3G A;  3PPR A;  3OEL A;  4R6K A;  3K0V A;  4IO6 A;  4H6D A;  3EF7 A;  4GFR A;  2OBG A;  3T9U A;  2O7U A;  3KOT A;  1HSE A;  2B65 A;  4GWO A;  3MP1 A;  3RT6 B;  2Y84 A;  4HW8 A;  4OVJ A;  3EHU A;  5DYH A;  4F2Q A;  2GHA A;  1B5I A;  5B7D A;  3H03 A;  4IO3 A;  3TQL A;  4F2O A;  3WAF A;  1MG1 A;  2QSX A;  5TPA B;  1B9J A;  3SEU A;  1WDN A;  3L6G A;  3HO7 A;  3ODB A;  3H6T A;  4DLD A;  4AB5 A;  3D4C A;  5AA2 B;  3MPK A;  3K2D A;  1IEJ A;  4RK9 A;  1BIY A;  5FHO A;  5I57 A;  2PT2 A;  4DXC A;  2PVU A;  4NF4 A;  3VDF A;  2NOO A;  3RN8 A;  1BLF A;  4H1X A;  1MY3 A;  2DWJ A;  3OEK A;  2XD3 A;  1ZKB A;  1EZP A;  1OMP A;  1CE2 A;  1B6H A;  3DRF A;  1VFD A;  4I8C A;  5H8Q B;  3O9P A;  3PUW E;  1O63 A;  2DE2 A;  1MPB A;  4JSD A;  3FVN A;  2O84 X;  3PPQ A;  3S9M C;  2YPN A;  3H3G A;  1NMU A;  1Y4T A;  4IO7 A;  3DRK A;  2W7Y A;  1MXZ A;  4TOZ A;  3HST A;  2H25 A;  2QS3 A;  4NWD A;  3S9N C;  3C33 A;  4MFI A;  5AA3 A;  1A99 A;  3CG3 A;  4F3S A;  3O28 A;  1LCF A;  3IOW A;  4DXU A;  4UAC A;  2A5T A;  1H45 A;  4H8J A;  3VXC A;  3AXF A;  1Z7N E;  3QSL A;  3LUY A;  2Q2A A;  4E0W A;  2QJE A;  2ZYM A;  3B6W A;  1N0T A;  4ZEI A;  3H6W A;  3KOS A;  3TYH A;  2V3U A;  1SYH A;  3VFJ A;  4YMB A;  1O64 A;  2WOP A;  3V8X B;  4WED A;  1XVX A;  3UOR A;  2VGQ A;  1B3L A;  1FTL A;  3QK6 A;  1TXF A;  1S7Y A;  3FTO A;  4P11 A;  2OWT A;  1N7W A;  5CMC A;  5CBS A;  5H8Q A;  3CR9 A;  4ESW A;  4QFP A;  3F11 A;  2VHA A;  3H6V A;  4JDF A;  4TLL B;  2HAV A;  4LON B;  2H4I A;  3OEM A;  1OVB A;  4Z0I A;  3D4G A;  3DM0 A;  3CIJ A;  4QSC A;  3HHF A;  1GV8 A;  1MY4 A;  4FE8 A;  1EH3 A;  1B0L A;  4PQJ A;  4NF5 B;  1Q35 A;  2XXW A;  2ZYK A;  2I48 A;  1TFD A;  1B7H A;  3IOR A;  4G77 A;  4Q0C A;  1EZO A;  3OO9 A;  3C31 A;  2F35 A;  1A8F A;  5EHM A;  1PB9 A;  3Q27 A;  4G68 C;  4IO4 A;  1FQD A;  3RQT A;  3O6G A;  3IOU A;  5JTY A;  4OQO A;  4GL0 A;  3QAX A;  1ZU0 A;  2B4M A;  4P0I A;  4K3F A;  4MH5 A;  2RCA A;  3FGS A;  1M5D A;  3PUY E;  4JWY A;  3C4M A;  2NWJ A;  1RYX A;  2NXO A;  3QUF A;  5H8S A;  2XD2 A;  1N7X A;  3FZV A;  3TKD A;  1M5E A;  1B46 A;  2OLB A;  3MVY A;  1MDP 1;  1LB9 A;  1N04 A;  5JEI A;  1MXX A;  4ZS9 A;  1AL3 A;  3TQW A;  1S50 A;  3O97 A;  1J1N A;  4U1O A;  5I59 B;  1HSL A;  1B3H A;  2Q88 A;  2Y7I A;  2QRY A;  4MBP A;  3VLU A;  1NNP A;  4LQ2 A;  2Z22 A;  1B5H A;  3E9X A;  4ELP A;  1WVJ A;  5CI5 A;  2PYY A;  3PPN A;  3K6U A;  1BP5 A;  3FXU A;  3IJO B;  3PMX A;  1MXW A;  3PMW A;  4X1B A;  1L5T A;  4I1D A;  5K2Y A;  5L9O A;  4RY1 A;  2XHD A;  2A5S A;  3EHT A;  3TUS A;  2PMS A;  4R74 A;  4OEN A;  3MVW A;  4R2F A;  4DCX A;  4G8M A;  1T0K A;  4EQ7 A;  2XXX A;  4OEV A;  3TEP A;  2I49 A;  5TU0 A;  2F7B A;  1F9B A;  3T22 A;  1LBC A;  4RPO A;  4IO5 A;  3JV9 A;  3VVD A;  4PP0 A;  3G3H A;  4GXS B;  4YB7 A;  1B58 A;  3S9L C;  3LC8 A;  3GXA A;  2F5X A;  1AIV A;  4RYA A;  4YIC A;  4IB2 A;  2ONR A;  4P0G A;  1TWY A;  4BDO A;  3IOV A;  3W9V A;  4LA9 A;  2CZL A;  4POW A;  2UVI A;  1FTM A;  1SQY A;  4R72 A;  2DOJ A;  4OFJ A;  2DVC A;  4F22 A;  2DE4 A;  1LB8 A;  5EHS A;  1SW4 A;  5DVI A;  5M2V A;  4XKR A;  3DRI A;  1A55 A;  1B3E A;  4YKJ A;  4U4S A;  3MQ9 A;  3KGC A;  4HCY A;  3MP6 A;  5KDT A;  4N07 A;  3G3K A;  3N5L A;  1UTH B;  3ECR A;  2RC9 A;  1JW1 A;  1P1O A;  3TEL A;  4G2Z A;  1P1N A;  3A3C A;  4LZ8 A;  3TCH A;  4DXB A;  4JXI A;  1NNT A;  2X7P A;  2YJP A;  3O6I A;  4JBZ A;  4R2B A;  2Y7P A;  3PMV A;  3QYT A;  3OD7 A;  3JZJ A;  3SKP A;  4F3B A;  1B05 A;  4IGT A;  4U1Z A;  2OJT A;  2AYS A;  4BDM A;  1JW4 A;  4HS7 A;  3KN8 A;  2D5W A;  3QXM A;  5DT6 A;  3O66 A;  3G3I A;  5H8N B;  4H5G A;  1H3D A;  4IO2 A;  1DTG A;  1B7Z A;  1Y3N A;  3IOT A;  4FAT A;  1FQB A;  1WOD A; 
#chains in the Genus database with same CATH topology
 4OTE A;  4P1E A;  4HE1 A;  1FPF A;  2CMO A;  4N13 A;  4NF6 A;  4X48 A;  4NF8 A;  5I5P A;  2XXH A;  4F29 A;  2IEE A;  1A8E A;  1LFH A;  2RF1 A;  3K6X A;  1B0H A;  2ESN A;  1LBW A;  4O3B A;  3CFZ A;  4RA1 A;  1GGG A;  3TAJ A;  3SET A;  5F24 A;  1KWH A;  4KYE A;  4P3L A;  1II5 A;  4RPN A;  1NUY A;  2WKY A;  4E0X A;  4YKI A;  3FUZ A;  1B40 A;  3E4R A;  2Y5K A;  3ZKL A;  3DRJ A;  2HPG A;  5ELV A;  4PFY A;  3ILT B;  3CSG A;  4N6K A;  2FBP A;  1FBC A;  1I6B A;  4PAF A;  3FJM A;  1P1W A;  4F1V A;  1B32 A;  3DRH A;  3BBR A;  4BDQ A;  1OQH A;  5HM4 B;  2RIN A;  5A5X B;  4FJP A;  1XT8 A;  3K1N A;  3M3L A;  2DE3 A;  1MXY A;  1NKX A;  4X8R A;  1FBP A;  3PUX E;  4U2R A;  4EDP A;  1ATG A;  2ZNU A;  3L6H A;  1FBH A;  1MQG A;  3PAM A;  1FTO A;  4HXV A;  3IO4 A;  3K00 A;  1ZJL A;  3B8B A;  3LSL A;  1UIU A;  3N6U A;  2Q2C A;  5I56 A;  3HPI A;  4PET A;  4N81 A;  2O6A A;  2FIE A;  4H0W A;  5T3J A;  1FBD A;  1GVC A;  2CZI A;  3A29 A;  3TOD A;  1MPC A;  1UTB A;  3K1P A;  5DVF A;  1AOV A;  1FQC A;  2F36 A;  2XX8 A;  4ELO A;  4PTK A;  4GLI A;  2F3B A;  4JSO A;  4N17 A;  3FXB A;  4LUB A;  2XXV A;  4BDL A;  4ZEB A;  4QFK A;  5KCJ B;  5HPQ A;  1LAF E;  1NH7 A;  4R6Y A;  1I6Q A;  3MVZ A;  3H6U A;  1LBB A;  4QF9 A;  1OIB A;  2XWO A;  2XXI A;  1BKA A;  1MY0 A;  2V4C A;  5H8H B;  4UAB A;  2DYX A;  1YTV A;  5EYG A;  4ZE9 A;  1BK4 A;  1MRP A;  5ET7 A;  2E1S A;  2DDK A;  4M1V A;  4Q30 B;  4MF3 A;  3OEN A;  1FQA A;  2XXK A;  3S9E A;  4GD5 A;  2ONS A;  2XWK A;  4TQU Q;  2HZL A;  4YB5 A;  4R73 A;  2VOZ A;  4C1U A;  3VLV A;  3FVO A;  2WYK A;  3I6V A;  2O1M A;  3U92 A;  4IY6 A;  4RNS A;  3UN6 A;  5BUU A;  3FV1 A;  3E13 X;  3QUJ A;  5TPA A;  2O1L A;  3U65 A;  1JNF A;  3CHG A;  1P1U A;  1XVY A;  5AA2 A;  1JEU A;  2O69 A;  1IME A;  1FTK A;  3SEX A;  3TTK A;  2R71 A;  1N84 A;  3B7D A;  4GVO A;  3Q25 A;  4G68 B;  3OXN A;  3S4U A;  2DS9 A;  3USD A;  4JVI A;  1QW0 A;  3K02 A;  3FXQ A;  5ITO A;  5F1Q A;  3SEY A;  2E0S A;  3FJG A;  5IZ1 A;  1IMA A;  3TZA A;  4OAN A;  4FAJ A;  3PPO A;  4M4G A;  4UA8 A;  5FHM A;  1EZ9 A;  2MKZ A;  4L17 A;  3DRG A;  3KZG A;  2ZMB A;  4Q8R A;  5KCJ A;  5CMK A;  2V84 A;  2KR0 A;  1IQ7 A;  2QS1 A;  1US4 A;  4Z7E A;  1XI6 A;  1IIT A;  4NED A;  2XWV A;  3G3F A;  4KFQ A;  3RYA A;  4JWO A;  1TFA A;  3MZB A;  3T66 A;  3N94 A;  3VE1 B;  2GQ1 A;  3CRB A;  5ET8 A;  3RTW B;  4H45 A;  5CMM A;  2ZYN A;  3MW0 A;  3T9V A;  1LAG E;  2CEY A;  1MQH A;  5I58 B;  3LSX A;  2Z8E A;  2G29 A;  4OFO A;  1MXU A;  3I5O A;  5AA4 B;  1VR5 A;  4FBP A;  2ALU A;  3Q26 A;  3LR1 A;  3OO7 A;  1QUJ A;  1FCK A;  1FTJ A;  1QUK A;  2OZZ A;  2ABH A;  2D21 A;  5H8F B;  1FBF A;  3MVX A;  4P9K A;  1LFI A;  4NQ8 A;  1N3X A;  2VPO A;  2WEF A;  4MJO A;  4N6D A;  1N76 A;  4GOT A;  5DEX B;  4AQ4 A;  2B3F A;  2F8D A;  2OCU A;  3E3K A;  4OFL A;  4IGR A;  1Q1K A;  3FBP A;  3BFU A;  2HFB A;  1LST A;  1YZ0 A;  1Y3Q A;  1D4N A;  5FHN A;  3IL1 B;  1EU8 A;  4DI3 D;  4ND9 A;  1NI9 A;  2F7A A;  3BKI B;  3PPP A;  3V89 B;  1NV2 A;  4ZDM A;  4Q5T A;  1RDX A;  4NAP A;  3CI8 A;  3FXR A;  1ELJ A;  4NF0 A;  4NF5 A;  3SER A;  3M3F A;  4NN3 A;  4G8N A;  5I2N B;  1FPJ A;  5CMB A;  1SVX B;  2F6P A;  2ONK E;  4U23 A;  3VVF A;  5I58 A;  4NWC A;  3N26 A;  2ZZV A;  3IB2 A;  4JB7 A;  4X04 A;  5AA4 A;  1B2H A;  3HV1 A;  4GWS A;  3TCF A;  5EQ8 A;  1LBY A;  3Q29 A;  2PFZ A;  1B7U A;  3CG1 A;  1R1N A;  4G8H A;  1IXG A;  5A5L A;  4F1Y A;  2D3I A;  3VXB A;  2VD3 A;  3K6V A;  3MST A;  3V5A A;  3RT8 A;  1NH8 A;  2DXR A;  2AL4 A;  2H99 A;  5I59 A;  1ZIU A;  4G61 A;  4RK2 A;  4EUO A;  4DZ1 A;  4OWD A;  4PFW A;  3RYB A;  3MYU A;  1PB8 A;  4KXP A;  1YXI A;  4ISU A;  3SEW A;  4PCD A;  4R9G A;  1PEB A;  4IY5 A;  3U1O A;  2I4B A;  1SBP A;  4NMY A;  1MY1 A;  1MM6 A;  3SES A;  2QMW A;  2QVR A;  3PUV E;  4EF1 A;  1DPP A;  1ZLQ A;  3B6T A;  4NX1 A;  1VSO A;  4NTL A;  3HFU A;  3B6Q A;  3C32 A;  1IZ1 A;  2DSF A;  2XXP A;  1US5 A;  2XXY A;  1UQW A;  2KLF A;  5L9S A;  1QJM A;  2L5V A;  5TP9 B;  3C36 A;  1B1X A;  1URG A;  2F6G A;  4P56 A;  3WAE A;  4YKK A;  5FTI A;  4OMB A;  5I2K B;  4O94 A;  1SYI A;  4OZ9 A;  4ONY A;  3LVU A;  4I9D A;  3OO8 A;  2XXR A;  5CBR A;  4HTG A;  1LLS A;  2I6E A;  3K4U A;  4O7I A;  2QS2 A;  3U72 A;  3LBS A;  4AS5 A;  1Y3P A;  4QHQ A;  3DEL B;  2V3T A;  2DWH A;  4QFN A;  3ISP A;  3UGW A;  4KPT A;  3H4Z A;  3E79 A;  1AWB A;  2UVJ A;  3BIG A;  5FTH A;  1YPN A;  3KFM A;  3T9H B;  2WX9 A;  3U94 A;  2UYF A;  1OLC A;  3MAM A;  2O68 A;  1ZMG A;  4FED A;  2QL3 A;  1OVT A;  2REG A;  2QS4 A;  3RPW A;  2I58 A;  4OVQ A;  1FPI A;  5CC2 A;  5IKB A;  4BLA A;  4OVS A;  5ET6 A;  1IMD A;  3FD3 A;  5CRY A;  4R9F A;  2PBW A;  1RDZ A;  5I84 A;  3FJ7 A;  1FPE A;  4OVP A;  2ZNS A;  1SI0 A;  5EQ7 A;  3UK4 A;  3EHS A;  3DP4 A;  4EF2 A;  3FAT A;  1D9Y A;  3EQ1 A;  2OWZ A;  2GHB A;  5I57 B;  1SD3 A;  3VLW A;  4DE8 A;  2Z23 A;  1XHY A;  4LQ5 A;  4RJZ A;  5DTB A;  4QSD A;  1MS7 A;  3KC0 A;  3HN0 A;  3VV5 A;  3OOA A;  1UTH A;  1LEV A;  4FIM A;  5I2K A;  4OVT A;  2BJI A;  2NVU B;  3MPL A;  3KN7 A;  4XKN A;  4P1L A;  3MP8 A;  1FW0 A;  3IB1 A;  2XA5 A;  3OSR A;  3TTN A;  5JK4 A;  1JVY A;  4PFT A;  3T0J A;  1H43 A;  4U22 A;  3KSJ A;  3P7I A;  3LSF B;  2RC8 A;  3M8U A;  3KSX A;  1O7T A;  4WEP A;  3GBB A;  4I40 A;  1FPK A;  4GRK A;  2R6G E;  2V3Q A;  3IR1 A;  3MZ1 A;  1DMB A;  4HE0 A;  5ICT A;  4H5F A;  5H8N A;  3KJT A;  1KA1 A;  4WKM A;  1URS A;  3VVE A;  4GIZ A;  4LN5 A;  3DP8 A;  2G93 A;  3PGF A;  2Y7K A;  3OMB A;  4ZEF A;  1H44 A;  2Y7W A;  2B3B A;  3DLN A;  3KJ7 A;  3RGY A;  1A7L A;  4XKQ A;  2XX9 A;  4PAK A;  2A5T B;  3THI A;  2FA7 A;  1MQD A;  4OEU A;  3T93 B;  1QKA A;  1IUD A;  4POX A;  1FQE A;  3W9W A;  4ZZA A;  4GWU A;  2Q9T A;  3FV2 A;  4ZE8 A;  3KBR A;  3RTF B;  4KD5 A;  3O2A A;  4F18 A;  1M5F A;  1Z7M E;  2ZNT A;  1GR2 A;  4MHF A;  1AMF A;  2RC7 A;  3KEI A;  5I3S A;  1MDQ A;  3LSW A;  1EYJ A;  3PD9 A;  2Q89 A;  4PFB A;  4MMP A;  1LFG A;  4GX3 A;  3OO6 A;  2OWS A;  1B4Z A;  3SDF A;  3KG2 A;  1URD A;  4YAH X;  1JW5 A;  1MM7 A;  4NHB A;  4YB6 A;  3QMF A;  1MY2 A;  2NUV A;  2QMX A;  2YLN A;  2PT1 A;  2JJK A;  2RCB A;  5A5X A;  2BJJ X;  4F3P A;  2DXY A;  1A40 A;  2B4L A;  1PBQ A;  4GBW A;  4X1D A;  3RY3 A;  1B52 A;  2WBB A;  5HBC A;  3ILU B;  3CFX A;  3IB0 A;  3R7X A;  1PC3 A;  4EQB A;  1D3K A;  4GWW A;  3IX1 A;  3CVG A;  1ZTY A;  1SDX A;  2AIX A;  2AL5 A;  2Q8J A;  1QKB A;  1XC1 A;  4DI4 B;  4OA4 A;  2ZXT A;  3TTR A;  1JEV A;  3SZP A;  1BTJ A;  1NNK A;  1PDA A;  4N8G A;  3TTM A;  3TCG A;  4C1T A;  5CM6 A;  1DK4 A;  4ELR A;  5JTY B;  1OQG A;  4IR8 A;  2HCA A;  1B4H A;  3MZ9 A;  5EYH A;  4BDR A;  5AA1 A;  1NFT A;  3C34 A;  2V93 A;  3Q28 A;  3E78 A;  3LV0 A;  4N4U A;  4KI0 E;  3K6W A;  4KR5 A;  2I4C A;  3O6H A;  3SEV A;  4OER A;  4R75 A;  1RYO A;  1R9Q A;  1UIV A;  2WOK A;  1QUI A;  4PFU A;  3ZS6 A;  1G0I A;  3FVG A;  2H5Y A;  1SW1 A;  2PX1 A;  4YZZ A;  1R6Z A;  2OK2 A;  2M8C A;  5H8H A;  5B70 A;  4O3C A;  4LZ7 A;  1AH5 A;  3QIM A;  3PV0 E;  3ONM A;  5AA2 D;  3G7W A;  4EQ9 A;  3MWB A;  4X9T A;  4FOR A;  4AB6 A;  1DSN A;  2RKM A;  3CSB A;  4P47 A;  3DP6 A;  4PBQ A;  1CNQ A;  1RKM A;  3UA8 A;  4DIG A;  2I3V A;  5J1D A;  4XTC Q;  4HCW A;  5K2X A;  3K1M A;  1SW5 A;  1FJ9 A;  1YCJ A;  4ZED A;  4F39 A;  1QGX A;  3GLB A;  2P3V A;  4N15 A;  1M5B A;  3ZSF A;  4BDN A;  1LCT A;  4G68 A;  4LP2 B;  2P0S A;  1FJ6 A;  5KZT A;  5IZ3 B;  1YAE A;  3RLF E;  4ESX A;  3IJX B;  1B51 A;  3H06 B;  1K9Z A;  1XOC A;  3TDJ A;  4I62 A;  3T9X B;  3IO6 A;  3S2V A;  1CB6 A;  4EXL A;  1POT A;  4OES A;  4OYV A;  2Q8M A;  4P8B A;  3G3J A;  1LAH E;  4C0R A;  4EXK A;  2FYI A;  4KHZ E;  2X7Q A;  3GZG A;  1I6A A;  3CFL A;  4PE3 A;  2VP1 A;  4F1U A;  1NL5 A;  3IFA A;  1YYZ A;  4PBH A;  3W15 C;  2XX7 A;  1DOT A;  1SW2 A;  4O3A A;  1N3W A;  1VFE A;  2DQV A;  3KC1 A;  2IA4 A;  1H76 A;  4LZ5 A;  4MLQ A;  3NOH A;  2GRV A;  1NV4 A;  1B5J A;  1Y9U A;  3A3U A;  4FEB A;  4GF8 A;  2I0B A;  1LBZ A;  1NUW A;  5DVJ A;  3OSQ A;  5F7V A;  2P2A A;  3FAS A;  4THI A;  2HAU A;  4DCY A;  3MUQ A;  5AE4 A;  1DPE A;  3EPE A;  3HCQ A;  4KYD A;  2DP8 A;  3FIR A;  1NV0 A;  4PDH A;  4PC9 A;  3V83 A;  5LOM A;  4QRZ A;  3I3V A;  1NV6 A;  5H8F A;  3U93 A;  1IXH A;  5KDT B;  4KYS A;  4N6P A;  1SI1 A;  5ESY A;  2V25 A;  1P1Q A;  4YU0 A;  1USY E;  4OXV A;  1Y1M A;  1MXV A;  3M3K A;  3RUM A;  5DEX A;  4U4X A;  3MJN A;  3MC2 A;  3U8Q A;  2F34 A;  1VE4 A;  4LVQ A;  2HXW A;  2UXA A;  4MEV A;  4ECF A;  4XIG Q;  4ZEC A;  4PE5 B;  1XS5 A;  4JVC A;  3RNN A;  2H9B A;  3RPL B;  1IMF A;  2HQ0 A;  1B3F A;  2HZK A;  1R9L A;  1Y20 A;  4F3G A;  2F7C A;  1PBP A;  4GXA A;  1TT1 A;  5IGA A;  1PB7 A;  4I3E A;  1USY H;  4PDD A;  3MBP A;  4ZEK A;  1VDW A;  4ELQ A;  3TPA A;  4KCC A;  1IXI A;  1LBV A;  2UVH A;  3EN3 A;  2LAO A;  3FVK A;  1SPI A;  1D9Q A;  3TMG A;  3H7M A;  4F19 A;  5I2N A;  4QSE A;  4DDD A;  3IAZ A;  2QPQ A;  2DWI A;  5L8D A;  1NNF A;  2R9J A;  1HSJ A;  4NGU A;  2DVZ A;  3B50 A;  2Y7R A;  1QUL A;  4NF6 B;  4F31 B;  4NF8 B;  3T96 B;  2GH9 A;  4YMA A;  4H67 A;  1GTK A;  1ANF A;  3R26 A;  5EYF A;  1MPD A;  4MLV A;  2O51 A;  1Y4C A;  3O29 A;  3TTL A;  2F78 A;  5ITP A;  4OHN A;  2HHM A;  2XXU A;  2I0C A;  1ZBM A;  1I69 A;  1FRP A;  1FPG A;  4TLM B;  1QVS A;  1MQI A;  4GWY A;  1MQJ A;  1JQF A;  3BFT A;  5LDZ A;  3C9H A;  2Z8D A;  2ANJ A;  4XEQ A;  5L9M A;  2P3N A;  4PGN A;  1DBZ A;  2I3W A;  4KQP A;  4WXJ A;  2H98 A;  1G0H A;  2Z8F A;  2GFE A;  5I7I A;  2HEU A;  4ZZE A;  5ISU A;  2UVG A;  1M5C A;  1JP4 A;  3TFL A;  1MH3 A;  4FEC A;  1JET A;  4U21 A;  1DTZ A;  4LAT A;  1IXC A;  3C35 A;  2FNC A;  2THI A;  1POY 1;  3K01 A;  1OLA A;  4JWX A;  3HHG A;  4QFO A;  4OET A;  2O7I A;  3GBA A;  4GQO A;  4PFR A;  5IAI A;  3PD8 A;  1Y1Z A;  3IK6 B;  4KCD A;  4GL8 A;  1P99 A;  2KQZ A;  1IIW A;  2PCR A;  2XXT A;  4NE4 A;  5I56 B;  4H8I A;  5TP9 A;  4OVR A;  4NF4 B;  1RDY A;  1LGB C;  1FQF A;  5IZZ A;  1NUZ A;  3JYR A;  3N6T A;  3PUZ E;  1A54 A;  4QFL A;  1S9T A;  4PAI A;  3KN3 A;  2UYE A;  3PU5 A;  4YKP A;  1MH4 A;  2X26 A;  3IFC A;  2VD2 A;  5BWJ A;  1UTB B;  2VT5 A;  2P1S A;  2ZYO A;  1B1H A;  4MNI A;  1FTA A;  4R6H A;  2XXQ A;  4XKP A;  1NV3 A;  1K9Y A;  1B3G A;  3A09 A;  3O6P A;  1LAX A;  3R6U A;  2F97 A;  2REJ A;  4XXU A;  1D9V A;  1JVX A;  3ZKK A;  5ICQ A;  3BIH A;  4RXL A;  3UP9 A;  4H65 A;  2DWA A;  3UIF A;  2WOL A;  4G4P A;  3G3G A;  3PPR A;  3OEL A;  4R6K A;  3K0V A;  4IO6 A;  4H6D A;  3EF7 A;  4GFR A;  1IMB A;  2OBG A;  3T9U A;  2O7U A;  3KOT A;  1HSE A;  2B65 A;  2CEX A;  4GWO A;  3MP1 A;  3RT6 B;  2Y84 A;  4HW8 A;  4OVJ A;  3EHU A;  5DYH A;  4F2Q A;  2GHA A;  1B5I A;  5B7D A;  3H03 A;  4IO3 A;  3TQL A;  4F2O A;  3WAF A;  1MG1 A;  2QSX A;  5TPA B;  1B9J A;  3SEU A;  1WDN A;  3L6G A;  3HO7 A;  3ODB A;  3H6T A;  4DLD A;  4AB5 A;  3D4C A;  5AA2 B;  3MPK A;  3K2D A;  1IEJ A;  4RK9 A;  1BIY A;  5FHO A;  5I57 A;  2PT2 A;  4DXC A;  2PVU A;  4NF4 A;  2WYP A;  1FPD A;  3VDF A;  2NOO A;  3RN8 A;  1BLF A;  4H1X A;  1MY3 A;  2DWJ A;  3OEK A;  2XD3 A;  1ZKB A;  2ZZW A;  3KBZ A;  1EZP A;  1OMP A;  1CE2 A;  1B6H A;  3DRF A;  1VFD A;  4I8C A;  5H8Q B;  2QFL A;  3O9P A;  3PUW E;  1O63 A;  2DE2 A;  4N91 A;  4NG7 A;  1MPB A;  4JSD A;  3FVN A;  2FIX A;  2O84 X;  3PPQ A;  3S9M C;  2YPN A;  4PF8 A;  3H3G A;  1NMU A;  1Y4T A;  4IO7 A;  3DRK A;  2W7Y A;  1MXZ A;  4TOZ A;  3HST A;  5EQ9 A;  2ZZX A;  2H25 A;  2QS3 A;  4XF5 A;  4NWD A;  3S9N C;  3C33 A;  4MFI A;  5AA3 A;  1A99 A;  3CG3 A;  3T1B A;  4F3S A;  3O28 A;  4PGP A;  1IMC A;  1LCF A;  3IOW A;  4DXU A;  4UAC A;  2A5T A;  1H45 A;  4H8J A;  1KA0 A;  3VXC A;  3AXF A;  1Z7N E;  3QSL A;  3LUY A;  1FSA A;  2Q2A A;  4E0W A;  1KZ8 A;  2QJE A;  2ZYM A;  3B6W A;  1N0T A;  5DW8 A;  4ZEI A;  3H6W A;  3KOS A;  3TYH A;  2V3U A;  1SYH A;  3VFJ A;  4YMB A;  1O64 A;  2WOP A;  3V8X B;  4WED A;  1XVX A;  4JVD A;  3UOR A;  2PFY A;  2VGQ A;  1B3L A;  1FTL A;  3QK6 A;  1TXF A;  4MNC A;  1S7Y A;  3FTO A;  4P11 A;  2OWT A;  1N7W A;  3ROJ A;  5CMC A;  1FPL A;  5CBS A;  1FBE A;  1NV5 A;  5H8Q A;  3CR9 A;  4ESW A;  4QFP A;  3F11 A;  2VHA A;  3H6V A;  4JDF A;  4TLL B;  2HAV A;  4LON B;  5J16 A;  2H4I A;  3OEM A;  1OVB A;  4I3Y A;  4Z0I A;  3D4G A;  3DM0 A;  3CIJ A;  4QSC A;  3HHF A;  4MIJ A;  1GV8 A;  1MY4 A;  4FE8 A;  1EH3 A;  1B0L A;  4PQJ A;  1EYK A;  1NUX A;  4NF5 B;  1Q35 A;  2XXW A;  2ZYK A;  2I48 A;  5EQA A;  1TFD A;  2CZH A;  2OX3 A;  1B7H A;  3IOR A;  4G77 A;  4Q0C A;  1EZO A;  2HXR A;  3OO9 A;  3C31 A;  2F35 A;  1A8F A;  5EHM A;  1PB9 A;  3Q27 A;  4G68 C;  4GX6 A;  4IO4 A;  1FQD A;  3RQT A;  3O6G A;  3IOU A;  4PFI A;  5JTY A;  4OQO A;  1Q9D A;  2FHY A;  4GL0 A;  3QAX A;  1ZU0 A;  2B4M A;  5LTC A;  4P0I A;  5IM2 A;  4K3F A;  4MH5 A;  2RCA A;  1FBG A;  3FGS A;  1M5D A;  3PUY E;  4JWY A;  3C4M A;  2NWJ A;  4PF6 A;  1RYX A;  2NXO A;  3QUF A;  5H8S A;  2XD2 A;  1N7X A;  3FZV A;  3TKD A;  4H46 A;  1M5E A;  1B46 A;  2OLB A;  3MVY A;  1MDP 1;  1LB9 A;  1N04 A;  5JEI A;  4HE2 A;  4AS4 A;  1MXX A;  4ZS9 A;  1AL3 A;  3TQW A;  1S50 A;  3O97 A;  1J1N A;  2XWI A;  4U1O A;  2Q74 A;  5I59 B;  1HSL A;  1B3H A;  2Q88 A;  2Y7I A;  2QRY A;  4MBP A;  3PTY A;  3VLU A;  1NNP A;  4LQ2 A;  3RYD A;  2Z22 A;  1B5H A;  3E9X A;  4ELP A;  1WVJ A;  5CI5 A;  2PYY A;  4QXD A;  3PPN A;  1DCU A;  3K6U A;  1BP5 A;  4GWZ A;  3FXU A;  3IJO B;  3PMX A;  2QVV A;  1MXW A;  3PMW A;  4GBV A;  4X1B A;  1L5T A;  4I1D A;  5K2Y A;  5L9O A;  1FPB A;  4RY1 A;  2F3D A;  2XHD A;  2A5S A;  3EHT A;  3TUS A;  2PMS A;  1NV7 A;  4R74 A;  4OEN A;  3MVW A;  4R2F A;  4DCX A;  4G8M A;  1T0K A;  4EQ7 A;  2XXX A;  4OEV A;  4GX4 A;  3TEP A;  2I49 A;  5IZ3 A;  5TU0 A;  1EYI A;  2F7B A;  1F9B A;  3T22 A;  2CZK A;  1LBC A;  4RPO A;  2FVZ A;  4IO5 A;  4QBA A;  3D1R A;  3JV9 A;  3LUZ A;  3VVD A;  4PP0 A;  3G3H A;  4GXS B;  4XFE A;  4YB7 A;  1B58 A;  3S9L C;  3LC8 A;  1INP A;  3GXA A;  1NV1 A;  2R8T A;  2F5X A;  1AIV A;  4RYA A;  4YIC A;  4O7M A;  4IB2 A;  2ONR A;  4P0G A;  1TWY A;  4BDO A;  4O8M A;  3IOV A;  3W9V A;  4LA9 A;  2CZL A;  4MNP A;  4POW A;  2UVI A;  1FTM A;  1SQY A;  4R72 A;  2DOJ A;  4N8Y A;  1LBX A;  4OFJ A;  2DVC A;  4F22 A;  4MX6 A;  2DE4 A;  1LB8 A;  5EHS A;  1SW4 A;  5DVI A;  5M2V A;  4XKR A;  3DRI A;  1A55 A;  1B3E A;  4YKJ A;  4U4S A;  3MQ9 A;  3KGC A;  4HCY A;  2Y5L A;  3MP6 A;  5KDT A;  4N07 A;  3G3K A;  5ET5 A;  3N5L A;  1UTH B;  3ECR A;  2VPN A;  2RC9 A;  1JW1 A;  1P1O A;  3TEL A;  4G2Z A;  1P1N A;  5FBP A;  3A3C A;  4LZ8 A;  3TCH A;  4DXB A;  4JXI A;  1NNT A;  2X7P A;  2YJP A;  3O6I A;  4JBZ A;  4R2B A;  2Y7P A;  3PMV A;  3QYT A;  3OD7 A;  3RPL A;  3JZJ A;  3SKP A;  4F3B A;  1B05 A;  4IGT A;  4U1Z A;  2OJT A;  4MCO A;  2AYS A;  2QVU A;  2WBD A;  4BDM A;  1JW4 A;  4HS7 A;  3KN8 A;  2D5W A;  3QXM A;  5DT6 A;  3O66 A;  4GWX A;  3G3I A;  5H8N B;  4H5G A;  1H3D A;  4IO2 A;  1DTG A;  1B7Z A;  1Y3N A;  3IOT A;  3GYY A;  4FAT A;  4MAG A;  1FQB A;  1WOD A;  3EKI A; 
#chains in the Genus database with same CATH homology
 4OTE A;  2CMO A;  4N13 A;  4NF6 A;  4X48 A;  4NF8 A;  2XXH A;  4F29 A;  2IEE A;  1A8E A;  1LFH A;  2RF1 A;  3K6X A;  1B0H A;  2ESN A;  4O3B A;  3CFZ A;  4RA1 A;  1GGG A;  3TAJ A;  3SET A;  1KWH A;  4KYE A;  4RPN A;  1II5 A;  2WKY A;  4E0X A;  4YKI A;  3FUZ A;  1B40 A;  3E4R A;  3ZKL A;  3DRJ A;  5ELV A;  4PFY A;  3ILT B;  3CSG A;  1I6B A;  3FJM A;  1P1W A;  4F1V A;  1B32 A;  3DRH A;  3BBR A;  4BDQ A;  1OQH A;  5HM4 B;  2RIN A;  5A5X B;  4FJP A;  1XT8 A;  3K1N A;  3M3L A;  2DE3 A;  1MXY A;  1NKX A;  3PUX E;  4U2R A;  4EDP A;  1ATG A;  2ZNU A;  3L6H A;  1MQG A;  3PAM A;  1FTO A;  3IO4 A;  3K00 A;  1ZJL A;  3LSL A;  1UIU A;  3N6U A;  2Q2C A;  5I56 A;  3HPI A;  4PET A;  2O6A A;  4H0W A;  1GVC A;  3TOD A;  1MPC A;  1UTB A;  3K1P A;  5DVF A;  1AOV A;  1FQC A;  2F36 A;  2XX8 A;  4ELO A;  4GLI A;  4JSO A;  4LUB A;  2XXV A;  4BDL A;  4ZEB A;  4QFK A;  5KCJ B;  5HPQ A;  1LAF E;  1NH7 A;  4R6Y A;  1I6Q A;  3MVZ A;  3H6U A;  1LBB A;  4QF9 A;  1OIB A;  2XXI A;  1BKA A;  1MY0 A;  5H8H B;  2DYX A;  1YTV A;  4ZE9 A;  1MRP A;  2E1S A;  4M1V A;  4Q30 B;  4MF3 A;  3OEN A;  1FQA A;  3S9E A;  4GD5 A;  2ONS A;  4TQU Q;  2HZL A;  4YB5 A;  4R73 A;  2VOZ A;  4C1U A;  3VLV A;  3FVO A;  3I6V A;  2O1M A;  3U92 A;  4IY6 A;  4RNS A;  3UN6 A;  5BUU A;  3FV1 A;  3E13 X;  3QUJ A;  5TPA A;  2O1L A;  1JNF A;  3CHG A;  1P1U A;  1XVY A;  5AA2 A;  1JEU A;  2O69 A;  1FTK A;  3SEX A;  3TTK A;  2R71 A;  1N84 A;  3B7D A;  4GVO A;  3Q25 A;  4G68 B;  3OXN A;  3S4U A;  2DS9 A;  3USD A;  1QW0 A;  3K02 A;  3FXQ A;  5ITO A;  5F1Q A;  3SEY A;  2E0S A;  3FJG A;  3TZA A;  4FAJ A;  3PPO A;  4M4G A;  4UA8 A;  5FHM A;  1EZ9 A;  4L17 A;  3DRG A;  3KZG A;  2ZMB A;  4Q8R A;  5KCJ A;  5CMK A;  2V84 A;  2QS1 A;  1IQ7 A;  1US4 A;  4Z7E A;  1IIT A;  4NED A;  3G3F A;  4KFQ A;  3RYA A;  4JWO A;  1TFA A;  3MZB A;  3T66 A;  3N94 A;  3VE1 B;  3CRB A;  3RTW B;  5CMM A;  2ZYN A;  3MW0 A;  3T9V A;  1LAG E;  1MQH A;  5I58 B;  3LSX A;  2Z8E A;  2G29 A;  4OFO A;  1MXU A;  3I5O A;  5AA4 B;  1VR5 A;  2ALU A;  3Q26 A;  3LR1 A;  3OO7 A;  1QUJ A;  1FCK A;  1FTJ A;  1QUK A;  2OZZ A;  2ABH A;  2D21 A;  5H8F B;  3MVX A;  1LFI A;  1N3X A;  1N76 A;  4GOT A;  5DEX B;  4AQ4 A;  2B3F A;  2F8D A;  2OCU A;  3E3K A;  4OFL A;  4IGR A;  1Q1K A;  3BFU A;  2HFB A;  1LST A;  1Y3Q A;  1D4N A;  5FHN A;  3IL1 B;  1EU8 A;  4ND9 A;  2F7A A;  3BKI B;  3PPP A;  3V89 B;  4ZDM A;  4Q5T A;  3CI8 A;  3FXR A;  1ELJ A;  4NF5 A;  3SER A;  3M3F A;  4G8N A;  5I2N B;  5CMB A;  1SVX B;  2F6P A;  2ONK E;  4U23 A;  3VVF A;  5I58 A;  4NWC A;  3N26 A;  3IB2 A;  4JB7 A;  5AA4 A;  1B2H A;  3HV1 A;  3TCF A;  3Q29 A;  1B7U A;  3CG1 A;  1R1N A;  4G8H A;  1IXG A;  4F1Y A;  2D3I A;  3VXB A;  2VD3 A;  3K6V A;  3V5A A;  3RT8 A;  1NH8 A;  2DXR A;  2AL4 A;  2H99 A;  5I59 A;  1ZIU A;  4RK2 A;  4EUO A;  4DZ1 A;  4OWD A;  4PFW A;  3RYB A;  1PB8 A;  4ISU A;  3SEW A;  4R9G A;  1PEB A;  4IY5 A;  3U1O A;  2I4B A;  1SBP A;  4NMY A;  1MY1 A;  1MM6 A;  3SES A;  2QMW A;  3PUV E;  4EF1 A;  1DPP A;  1ZLQ A;  3B6T A;  1VSO A;  4NTL A;  3B6Q A;  3C32 A;  1IZ1 A;  2DSF A;  2XXP A;  1US5 A;  2XXY A;  1UQW A;  2KLF A;  5L9S A;  1QJM A;  5TP9 B;  3C36 A;  1B1X A;  1URG A;  2F6G A;  3WAE A;  4YKK A;  5FTI A;  4OMB A;  5I2K B;  1SYI A;  4OZ9 A;  4ONY A;  3LVU A;  4I9D A;  3OO8 A;  2XXR A;  5CBR A;  4HTG A;  1LLS A;  2I6E A;  3K4U A;  2QS2 A;  3U72 A;  3LBS A;  1Y3P A;  4QHQ A;  3DEL B;  2V3T A;  2DWH A;  4QFN A;  3UGW A;  4KPT A;  3H4Z A;  2UVJ A;  5FTH A;  1YPN A;  3KFM A;  3T9H B;  3U94 A;  2UYF A;  1OLC A;  3MAM A;  2O68 A;  1ZMG A;  4FED A;  2QL3 A;  1OVT A;  2REG A;  2QS4 A;  3RPW A;  2I58 A;  5CC2 A;  5IKB A;  4BLA A;  3FD3 A;  5CRY A;  4R9F A;  2PBW A;  5I84 A;  3FJ7 A;  2ZNS A;  1SI0 A;  3UK4 A;  3EHS A;  3DP4 A;  4EF2 A;  3FAT A;  1D9Y A;  3EQ1 A;  2GHB A;  5I57 B;  1SD3 A;  3VLW A;  4DE8 A;  2Z23 A;  1XHY A;  4LQ5 A;  4RJZ A;  5DTB A;  4QSD A;  1MS7 A;  3HN0 A;  3VV5 A;  3OOA A;  1UTH A;  4FIM A;  5I2K A;  2NVU B;  3MPL A;  3KN7 A;  4XKN A;  3MP8 A;  1FW0 A;  3IB1 A;  3OSR A;  3TTN A;  5JK4 A;  1JVY A;  4PFT A;  1H43 A;  4U22 A;  3KSJ A;  3P7I A;  3LSF B;  2RC8 A;  3M8U A;  3KSX A;  1O7T A;  4WEP A;  3GBB A;  4GRK A;  2R6G E;  2V3Q A;  3IR1 A;  3MZ1 A;  1DMB A;  5ICT A;  4H5F A;  5H8N A;  3KJT A;  4WKM A;  1URS A;  3VVE A;  4GIZ A;  3DP8 A;  2G93 A;  3PGF A;  2Y7K A;  3OMB A;  4ZEF A;  1H44 A;  2Y7W A;  2B3B A;  3DLN A;  3KJ7 A;  3RGY A;  1A7L A;  4XKQ A;  2XX9 A;  2A5T B;  3THI A;  2FA7 A;  1MQD A;  4OEU A;  3T93 B;  1QKA A;  1IUD A;  4POX A;  1FQE A;  3W9W A;  4ZZA A;  2Q9T A;  3FV2 A;  4ZE8 A;  3KBR A;  3RTF B;  4KD5 A;  3O2A A;  4F18 A;  1M5F A;  1Z7M E;  2ZNT A;  1GR2 A;  1AMF A;  2RC7 A;  3KEI A;  1MDQ A;  3LSW A;  3PD9 A;  2Q89 A;  1LFG A;  3OO6 A;  2OWS A;  1B4Z A;  3SDF A;  3KG2 A;  1URD A;  4YAH X;  1JW5 A;  1MM7 A;  4YB6 A;  1MY2 A;  2NUV A;  2QMX A;  2YLN A;  2PT1 A;  2RCB A;  5A5X A;  2BJJ X;  4F3P A;  2DXY A;  1A40 A;  2B4L A;  1PBQ A;  4X1D A;  3RY3 A;  1B52 A;  5HBC A;  3ILU B;  3CFX A;  3IB0 A;  3R7X A;  1PC3 A;  4EQB A;  1D3K A;  3IX1 A;  3CVG A;  1ZTY A;  1SDX A;  2AIX A;  2AL5 A;  2Q8J A;  1QKB A;  1XC1 A;  2ZXT A;  3TTR A;  1JEV A;  1BTJ A;  1NNK A;  1PDA A;  3TTM A;  3TCG A;  4C1T A;  5CM6 A;  4ELR A;  5JTY B;  1OQG A;  2HCA A;  1B4H A;  3MZ9 A;  4BDR A;  5AA1 A;  1NFT A;  3C34 A;  2V93 A;  3Q28 A;  4KI0 E;  3K6W A;  4KR5 A;  2I4C A;  3O6H A;  3SEV A;  4OER A;  4R75 A;  1RYO A;  1R9Q A;  1UIV A;  2WOK A;  1QUI A;  4PFU A;  3ZS6 A;  3FVG A;  2H5Y A;  1SW1 A;  2PX1 A;  4YZZ A;  1R6Z A;  2OK2 A;  2M8C A;  5H8H A;  5B70 A;  4O3C A;  4LZ7 A;  1AH5 A;  3QIM A;  3PV0 E;  3ONM A;  5AA2 D;  3G7W A;  4EQ9 A;  3MWB A;  4X9T A;  4FOR A;  4AB6 A;  1DSN A;  2RKM A;  3CSB A;  3DP6 A;  1RKM A;  3UA8 A;  4DIG A;  2I3V A;  5J1D A;  4XTC Q;  4HCW A;  5K2X A;  3K1M A;  1SW5 A;  1YCJ A;  4ZED A;  4F39 A;  3GLB A;  1M5B A;  3ZSF A;  4BDN A;  1LCT A;  4G68 A;  4LP2 B;  2P0S A;  5KZT A;  1YAE A;  3RLF E;  4ESX A;  3IJX B;  1B51 A;  3H06 B;  1XOC A;  3TDJ A;  4I62 A;  3T9X B;  3IO6 A;  3S2V A;  1CB6 A;  4EXL A;  1POT A;  4OES A;  4OYV A;  3G3J A;  1LAH E;  4C0R A;  4EXK A;  2FYI A;  4KHZ E;  2X7Q A;  3GZG A;  1I6A A;  3CFL A;  2VP1 A;  4F1U A;  1NL5 A;  3W15 C;  2XX7 A;  1DOT A;  1SW2 A;  4O3A A;  1N3W A;  1VFE A;  2DQV A;  2IA4 A;  1H76 A;  4LZ5 A;  4MLQ A;  2GRV A;  1B5J A;  1Y9U A;  3A3U A;  4FEB A;  4GF8 A;  2I0B A;  5DVJ A;  3OSQ A;  5F7V A;  2P2A A;  3FAS A;  4THI A;  2HAU A;  4DCY A;  3MUQ A;  5AE4 A;  1DPE A;  3EPE A;  3HCQ A;  4KYD A;  2DP8 A;  3FIR A;  3V83 A;  5LOM A;  4QRZ A;  3I3V A;  5H8F A;  3U93 A;  1IXH A;  5KDT B;  4KYS A;  4N6P A;  1SI1 A;  2V25 A;  1P1Q A;  4YU0 A;  1USY E;  4OXV A;  1Y1M A;  1MXV A;  3M3K A;  3RUM A;  5DEX A;  4U4X A;  3MJN A;  3MC2 A;  3U8Q A;  2F34 A;  1VE4 A;  4LVQ A;  2HXW A;  4ECF A;  2UXA A;  4XIG Q;  4ZEC A;  4PE5 B;  1XS5 A;  3RNN A;  2H9B A;  2HQ0 A;  1B3F A;  2HZK A;  1R9L A;  1Y20 A;  4F3G A;  2F7C A;  1PBP A;  4GXA A;  1TT1 A;  1PB7 A;  1USY H;  3MBP A;  4ZEK A;  4ELQ A;  3TPA A;  4KCC A;  1IXI A;  2UVH A;  3EN3 A;  2LAO A;  3FVK A;  3TMG A;  3H7M A;  4F19 A;  5I2N A;  4QSE A;  4DDD A;  3IAZ A;  2QPQ A;  2DWI A;  5L8D A;  1NNF A;  2R9J A;  1HSJ A;  2DVZ A;  2Y7R A;  1QUL A;  4NF6 B;  4F31 B;  4NF8 B;  3T96 B;  2GH9 A;  4YMA A;  4H67 A;  1GTK A;  1ANF A;  3R26 A;  5EYF A;  1MPD A;  4MLV A;  2O51 A;  1Y4C A;  3O29 A;  3TTL A;  2F78 A;  5ITP A;  4OHN A;  2XXU A;  2I0C A;  1ZBM A;  1I69 A;  4TLM B;  1QVS A;  1MQI A;  1MQJ A;  1JQF A;  3BFT A;  3C9H A;  2Z8D A;  2ANJ A;  5L9M A;  2I3W A;  4KQP A;  4WXJ A;  2H98 A;  2Z8F A;  2GFE A;  2HEU A;  4ZZE A;  5ISU A;  2UVG A;  1M5C A;  3TFL A;  1MH3 A;  4FEC A;  1JET A;  4U21 A;  1DTZ A;  4LAT A;  1IXC A;  3C35 A;  2FNC A;  2THI A;  1POY 1;  3K01 A;  1OLA A;  4JWX A;  3HHG A;  4QFO A;  4OET A;  2O7I A;  3GBA A;  4GQO A;  5IAI A;  3PD8 A;  1Y1Z A;  3IK6 B;  4KCD A;  4GL8 A;  1P99 A;  1IIW A;  2XXT A;  4NE4 A;  5I56 B;  4H8I A;  5TP9 A;  4NF4 B;  1LGB C;  1FQF A;  3JYR A;  3N6T A;  3PUZ E;  1A54 A;  4QFL A;  1S9T A;  3KN3 A;  2UYE A;  3PU5 A;  4YKP A;  1MH4 A;  2X26 A;  2VD2 A;  5BWJ A;  1UTB B;  2P1S A;  2ZYO A;  1B1H A;  4R6H A;  2XXQ A;  4XKP A;  1B3G A;  3A09 A;  3O6P A;  1LAX A;  3R6U A;  2F97 A;  2REJ A;  4XXU A;  1D9V A;  1JVX A;  3ZKK A;  5ICQ A;  4RXL A;  3UP9 A;  4H65 A;  2DWA A;  3UIF A;  2WOL A;  4G4P A;  3G3G A;  3PPR A;  3OEL A;  4R6K A;  3K0V A;  4IO6 A;  4H6D A;  3EF7 A;  4GFR A;  2OBG A;  3T9U A;  2O7U A;  3KOT A;  1HSE A;  2B65 A;  4GWO A;  3MP1 A;  3RT6 B;  2Y84 A;  4HW8 A;  4OVJ A;  3EHU A;  5DYH A;  4F2Q A;  2GHA A;  1B5I A;  5B7D A;  3H03 A;  4IO3 A;  3TQL A;  4F2O A;  3WAF A;  1MG1 A;  2QSX A;  5TPA B;  1B9J A;  3SEU A;  1WDN A;  3L6G A;  3HO7 A;  3ODB A;  3H6T A;  4DLD A;  4AB5 A;  3D4C A;  5AA2 B;  3MPK A;  3K2D A;  1IEJ A;  4RK9 A;  1BIY A;  5FHO A;  5I57 A;  2PT2 A;  4DXC A;  2PVU A;  4NF4 A;  3VDF A;  2NOO A;  3RN8 A;  1BLF A;  4H1X A;  1MY3 A;  2DWJ A;  3OEK A;  2XD3 A;  1ZKB A;  1EZP A;  1OMP A;  1CE2 A;  1B6H A;  3DRF A;  1VFD A;  4I8C A;  5H8Q B;  3O9P A;  3PUW E;  1O63 A;  2DE2 A;  1MPB A;  4JSD A;  3FVN A;  2O84 X;  3PPQ A;  3S9M C;  2YPN A;  3H3G A;  1NMU A;  1Y4T A;  4IO7 A;  3DRK A;  2W7Y A;  1MXZ A;  4TOZ A;  3HST A;  2H25 A;  2QS3 A;  4NWD A;  3S9N C;  3C33 A;  4MFI A;  5AA3 A;  1A99 A;  3CG3 A;  4F3S A;  3O28 A;  1LCF A;  3IOW A;  4DXU A;  4UAC A;  2A5T A;  1H45 A;  4H8J A;  3VXC A;  3AXF A;  1Z7N E;  3QSL A;  3LUY A;  2Q2A A;  4E0W A;  2QJE A;  2ZYM A;  3B6W A;  1N0T A;  4ZEI A;  3H6W A;  3KOS A;  3TYH A;  2V3U A;  1SYH A;  3VFJ A;  4YMB A;  1O64 A;  2WOP A;  3V8X B;  4WED A;  1XVX A;  3UOR A;  2VGQ A;  1B3L A;  1FTL A;  3QK6 A;  1TXF A;  1S7Y A;  3FTO A;  4P11 A;  2OWT A;  1N7W A;  5CMC A;  5CBS A;  5H8Q A;  3CR9 A;  4ESW A;  4QFP A;  3F11 A;  2VHA A;  3H6V A;  4JDF A;  4TLL B;  2HAV A;  4LON B;  2H4I A;  3OEM A;  1OVB A;  4Z0I A;  3D4G A;  3DM0 A;  3CIJ A;  4QSC A;  3HHF A;  1GV8 A;  1MY4 A;  4FE8 A;  1EH3 A;  1B0L A;  4PQJ A;  4NF5 B;  1Q35 A;  2XXW A;  2ZYK A;  2I48 A;  1TFD A;  1B7H A;  3IOR A;  4G77 A;  4Q0C A;  1EZO A;  3OO9 A;  3C31 A;  2F35 A;  1A8F A;  5EHM A;  1PB9 A;  3Q27 A;  4G68 C;  4IO4 A;  1FQD A;  3RQT A;  3O6G A;  3IOU A;  5JTY A;  4OQO A;  4GL0 A;  3QAX A;  1ZU0 A;  2B4M A;  4P0I A;  4K3F A;  4MH5 A;  2RCA A;  3FGS A;  1M5D A;  3PUY E;  4JWY A;  3C4M A;  2NWJ A;  1RYX A;  2NXO A;  3QUF A;  5H8S A;  2XD2 A;  1N7X A;  3FZV A;  3TKD A;  1M5E A;  1B46 A;  2OLB A;  3MVY A;  1MDP 1;  1LB9 A;  1N04 A;  5JEI A;  1MXX A;  4ZS9 A;  1AL3 A;  3TQW A;  1S50 A;  3O97 A;  1J1N A;  4U1O A;  5I59 B;  1HSL A;  1B3H A;  2Q88 A;  2Y7I A;  2QRY A;  4MBP A;  3VLU A;  1NNP A;  4LQ2 A;  2Z22 A;  1B5H A;  3E9X A;  4ELP A;  1WVJ A;  5CI5 A;  2PYY A;  3PPN A;  3K6U A;  1BP5 A;  3FXU A;  3IJO B;  3PMX A;  1MXW A;  3PMW A;  4X1B A;  1L5T A;  4I1D A;  5K2Y A;  5L9O A;  4RY1 A;  2XHD A;  2A5S A;  3EHT A;  3TUS A;  2PMS A;  4R74 A;  4OEN A;  3MVW A;  4R2F A;  4DCX A;  4G8M A;  1T0K A;  4EQ7 A;  2XXX A;  4OEV A;  3TEP A;  2I49 A;  5TU0 A;  2F7B A;  1F9B A;  3T22 A;  1LBC A;  4RPO A;  4IO5 A;  3JV9 A;  3VVD A;  4PP0 A;  3G3H A;  4GXS B;  4YB7 A;  1B58 A;  3S9L C;  3LC8 A;  3GXA A;  2F5X A;  1AIV A;  4RYA A;  4YIC A;  4IB2 A;  2ONR A;  4P0G A;  1TWY A;  4BDO A;  3IOV A;  3W9V A;  4LA9 A;  2CZL A;  4POW A;  2UVI A;  1FTM A;  1SQY A;  4R72 A;  2DOJ A;  4OFJ A;  2DVC A;  4F22 A;  2DE4 A;  1LB8 A;  5EHS A;  1SW4 A;  5DVI A;  5M2V A;  4XKR A;  3DRI A;  1A55 A;  1B3E A;  4YKJ A;  4U4S A;  3MQ9 A;  3KGC A;  4HCY A;  3MP6 A;  5KDT A;  4N07 A;  3G3K A;  3N5L A;  1UTH B;  3ECR A;  2RC9 A;  1JW1 A;  1P1O A;  3TEL A;  4G2Z A;  1P1N A;  3A3C A;  4LZ8 A;  3TCH A;  4DXB A;  4JXI A;  1NNT A;  2X7P A;  2YJP A;  3O6I A;  4JBZ A;  4R2B A;  2Y7P A;  3PMV A;  3QYT A;  3OD7 A;  3JZJ A;  3SKP A;  4F3B A;  1B05 A;  4IGT A;  4U1Z A;  2OJT A;  2AYS A;  4BDM A;  1JW4 A;  4HS7 A;  3KN8 A;  2D5W A;  3QXM A;  5DT6 A;  3O66 A;  3G3I A;  5H8N B;  4H5G A;  1H3D A;  4IO2 A;  1DTG A;  1B7Z A;  1Y3N A;  3IOT A;  4FAT A;  1FQB A;  1WOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...