1OLCA

Oligo-peptide binding protein (oppa) complexed with lys-lys-lys-ala
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (binding protein/peptide)
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title The crystal structures of the oligopeptide-binding protein OppA complexed with tripeptide and tetrapeptide ligands.
pubmed doi rcsb
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1995-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1olcA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1olcA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1olcA02
4RA1A 4WKMA 3OEKA 1IUDA 4OWDA 5TP9B 3FD3A 1GVCA 1NMUA 4R2BA 4DE8A 5H8FA 3TQLA 3E3KA 2NWJA 3E4RA 2GFEA 5EYFA 1VSOA 3V83A 1JEVA 1SVXB 4F29A 2FNCA 5FTHA 1H76A 5HM4B 1IIWA 4F1YA 3R7XA 2UVHA 1JW4A 4YB5A 5A5XB 5I56A 3H6TA 2AYSA 1SW1A 1URGA 1URDA 3FZVA 2O6AA 3B6QA 4FECA 2P1SA 4RNSA 3LC8A 5EHSA 4IO7A 1Y1ZA 1MXWA 1UTBA 1LCFA 1MM7A 3USDA 2QS2A 3LSLA 4G68A 3IJOB 3U92A 4N13A 3ZS6A 5H8SA 2W7YA 3O29A 4GL0A 4KHZE 3CFXA 2ZYMA 1XT8A 3IOWA 1MXUA 4MLQA 2ZYKA 3T9UA 4ND9A 2A5SA 2B65A 3PPQA 1B9JA 4I1DA 3HN0A 3GBAA 3DLNA 1MS7A 4OTEA 1QW0A 4G8HA 1NFTA 3MVXA 2P2AA 1ELJA 2Z8DA 4JDFA 4IO4A 4JWOA 2OWSA 3K1MA 3TCGA 4NF5A 1MY0A 1BP5A 1JW5A 1B1XA 2OBGA 3IORA 4OHNA 3IB2A 1GGGA 2VP1A 4BLAA 3FVOA 1OQGA 1IEJA 4XXUA 1N3XA 1LB8A 1FTLA 3FJGA 1VFDA 3VLVA 1AH5A 5HPQA 4F3SA 1A54A 1B3LA 4F18A 1LFIA 2F5XA 3MVWA 2HCAA 1GR2A 3FASA 4ESXA 4RJZA 2HXWA 3QAXA 3SKPA 2AL5A 3W15C 3TFLA 3Q27A 2QRYA 2QMWA 3CVGA 2OJTA 3M8UA 5I58B 3SEWA 5DTBA 3R6UA 2O68A 1B0HA 3G3JA 3VDFA 4ELPA 4OYVA 4YICA 3KOTA 1FQFA 4MFIA 4OZ9A 2G93A 1A55A 4U1ZA 3HPIA 2Y7WA 1ATGA 3U1OA 1M5EA 2GH9A 3RN8A 2VOZA 4GQOA 5FHNA 4M1VA 2XXWA 1R9LA 3VVDA 1D3KA 3K6UA 1B2HA 3OENA 3LSWA 4U2RA 5H8FB 2H9BA 1WVJA 3DELB 1NNTA 3EPEA 4QRZA 4KYEA 2I0BA 4LZ7A 4EF1A 1RYXA 4GIZA 4ZEIA 3CG1A 4LZ8A 3W9VA 3H6UA 2M8CA 3A09A 5FTIA 1B5IA 2Z8EA 3HV1A 4F3PA 3FUZA 1R6ZA 4KFQA 3HSTA 2V3UA 1BKAA 3IOTA 3FXQA 1UTBB 2WOKA 2DXRA 1ZKBA 4F31B 2OLBA 4G68B 2O7IA 1B0LA 2QS4A 1WDNA 2DYXA 1EU8A 5L9MA 4IO5A 2CMOA 4DXUA 3DRKA 5LOMA 3KGCA 2ESNA 1A8EA 4F1VA 4GF8A 1Y1MA 3CR9A 3MPKA 4PQJA 1QJMA 2RC9A 1URSA 4YU0A 3QXMA 5TP9A 2QS3A 3G3KA 3RTFB 1MXYA 1Q35A 2XXXA 3DRGA 4R74A 2VHAA 3OSRA 5DYHA 4BDQA 5H8QB 1S9TA 4NF5B 4EDPA 1PC3A 4TLLB 2V25A 3BFUA 3C4MA 2LAOA 2UVJA 3S9LC 4XKQA 3V89B 2H98A 4IO6A 3CIJA 1PBQA 4YKIA 1SI1A 3TTMA 2XXQA 3MP6A 4BDRA 4FORA 1ZTYA 5IKBA 1DPPA 3ODBA 2Z8FA 5J1DA 3HCQA 3ZKLA 3RNNA 3QIMA 4AB5A 1Y9UA 5AE4A 1MRPA 4G8MA 2UYEA 3FJ7A 2DE2A 2F7AA 1T0KA 3THIA 4RYAA 4JSOA 5ITPA 1H44A 4FEDA 3IK6B 4IB2A 3PGFA 5ISUA 1VE4A 1JVXA 1SYHA 3C36A 4XTCQ 5L9SA 3KEIA 1FTOA 3OO8A 5M2VA 4QFOA 3B6WA 4LA9A 2ALUA 2ANJA 4RK9A 2E0SA 2O1MA 4DDDA 2QPQA 1MG1A 2XX8A 1NH8A 4RY1A 3DM0A 4JBZA 4ZEFA 4Z7EA 1LBCA 5DEXA 1SD3A 4X48A 2I0CA 3TCHA 3M3LA 4RK2A 3G3IA 4MF3A 4FJPA 3Q26A 2PMSA 3PUWE 3O6PA 3VV5A 3TQWA 1FQAA 1FTMA 2F78A 4H5GA 4GFRA 1P99A 2RCBA 4H1XA 4Q0CA 3G3FA 3TAJA 2PBWA 3A3CA 2PT2A 3T9XB 4P0GA 3MZ9A 3CFZA 3SETA 5ICQA 3DRJA 5AA2D 1N3WA 2O69A 4KYSA 1N84A 3TYHA 3LBSA 2F7BA 5I58A 5DT6A 3PAMA 2B4MA 4DXBA 1AL3A 1D9YA 4YKPA 1QUIA 4OFOA 1XVXA 1EH3A 1MY1A 2QMXA 3K1PA 1B5JA 3PUVE 2V93A 5AA2A 1LAGE 4BDLA 4XKPA 3RTWB 4O3BA 4I9DA 4Q5TA 3SDFA 3I3VA 3CI8A 4PFTA 2IA4A 3KSJA 1B46A 3EN3A 5CMCA 1OVBA 4G4PA 5AA4A 4F3BA 4NF8B 2QJEA 3O97A 4WXJA 2REJA 4EXLA 3VXCA 3K0VA 1LFGA 4EQBA 3C35A 2OZZA 1HSEA 3MP1A 1IXCA 2XXYA 4QFLA 4L17A 3ZKKA 5CI5A 4M4GA 3PMVA 4HS7A 3S9MC 3MWBA 2YPNA 1LGBC 3JYRA 4NTLA 1MPCA 4ZE9A 3MBPA 2DE3A 5JEIA 4ZZAA 2XHDA 2WKYA 1B32A 2A5TB 2XXHA 1HSLA 2HZLA 5H8NA 2NUVA 2ZNUA 3SEYA 1UTHB 1TWYA 2R71A 3OO9A 1ANFA 1B58A 4LVQA 1Z7ME 3K00A 3K1NA 1B52A 3OELA 1SYIA 1FTJA 3L6GA 3K6XA 3DP8A 3PMXA 1SW2A 3RPWA 3IL1B 1CE2A 3RLFE 3TDJA 3T9HB 3SERA 4LP2B 1QULA 5L8DA 4OEVA 2H5YA 1PB9A 2Y7IA 4R75A 3V8XB 1A99A 2Q88A 5DEXB 4IO2A 3VVFA 4LATA 3ILTB 2I3VA 3IO6A 4LUBA 5H8QA 4F2QA 2O84X 3LSFB 2Q8JA 1DTZA 1MQHA 4WEDA 3TUSA 5CBSA 4U23A 5I57A 2R9JA 1IZ1A 3MZ1A 2O7UA 4FIMA 3UK4A 2F7CA 2CZLA 1B3EA 4GXAA 3SEVA 2DOJA 1JQFA 5CMMA 2DWJA 5JTYA 1O63A 1Y3QA 2WOPA 1B6HA 1NL5A 1H43A 1DSNA 3O6HA 3IO4A 3PD8A 4R2FA 3VFJA 4RPOA 3U94A 3E9XA 3S9NC 4H6DA 1QUKA 3FV2A 4IGRA 3KOSA 3UIFA 1D4NA 3FVKA 4YMBA 3FIRA 4NWCA 2HFBA 4FE8A 3TTKA 1A8FA 3KZGA 5AA2B 3U8QA 3VE1B 4ZZEA 1SW5A 2XX7A 3KJ7A 2BJJX 3RT8A 1F9BA 3H3GA 4EXKA 1NH7A 1OMPA 1WODA 3S9EA 1QUJA 4EQ9A 3TTLA 4QSEA 4U4SA 3IJXB 1PDAA 2OK2A 5TPAA 4PP0A 5AA4B 1FTKA 3OO7A 3C33A 3P7IA 4AQ4A 2I58A 3PPNA 3Q28A 3C32A 3FVGA 3O9PA 1I69A 2XXPA 3ZSFA 3OD7A 3HHGA 4X1DA 1GTKA 2F35A 2Z22A 3PUZE 3ILUB 1Z7NE 3MJNA 2Z23A 1IXHA 3IOVA 4KQPA 3I5OA 1YTVA 5FHMA 4AB6A 3MVYA 3D4GA 1USYE 2XD3A 2AIXA 1S7YA 2XXIA 4ECFA 4OQOA 3OEMA 3RYBA 4YZZA 2ZNSA 1EZ9A 5H8NB 3B7DA 2F6GA 4JWXA 4YMAA 1HSJA 2F6PA 5B7DA 5H8HB 4GVOA 4H65A 4EF2A 2GHAA 3GLBA 1TT1A 1Q1KA 3UGWA 3O2AA 2UVGA 4KD5A 1B3FA 1FW0A 2XD2A 4MBPA 3QK6A 3N6UA 3CRBA 4OENA 3ONMA 1TFAA 3IAZA 1ZJLA 1I6QA 2OWTA 1B7ZA 2I6EA 4GOTA 3IR1A 3H6WA 1GV8A 2THIA 4NF8A 3PD9A 4POWA 3RGYA 4PE5B 1MQDA 3UORA 4BDNA 4BDMA 1XS5A 2V3QA 2DWHA 1JVYA 1QVSA 1AOVA 4JSDA 2HEUA 4DCYA 5I57B 1LLSA 3L6HA 2FA7A 3CHGA 2WOLA 1D9VA 5JTYB 5K2YA 1N0TA 2QS1A 2XXRA 4R6KA 2A5TA 3G7WA 2Y7KA 1MH3A 4XIGQ 4EQ7A 4MH5A 3KN7A 4LQ5A 1UTHA 4ZS9A 1B51A 3M3FA 3WAEA 1H3DA 1FQBA 2UYFA 4NMYA 5ITOA 2G29A 3O6IA 4O3AA 1FQEA 4KR5A 3MVZA 1Y4CA 4YB7A 4QHQA 1PB8A 1R1NA 4TQUQ 5DVFA 2RF1A 1DTGA 4ESWA 1B05A 4P0IA 1JEUA 1LAFE 4ELQA 4OFJA 1AIVA 1N76A 2IEEA 1PBPA 2DVCA 2Y7PA 1MQGA 4OEUA 1Y3PA 3K6WA 3CFLA 1Y3NA 5TPAB 2ZNTA 3GXAA 5BUUA 3MUQA 4ZEDA 4LZ5A 2OCUA 4QSDA 1ZMGA 1Y4TA 4OFLA 2PT1A 4HTGA 4R6YA 4ZE8A 3VXBA 3SESA 4THIA 3OMBA 5KCJA 3VVEA 2HQ0A 4Q30B 4HCYA 3KN8A 3IB0A 2I48A 1MPBA 4KCCA 4YKJA 4G68C 2Q2AA 2KLFA 3DRHA 3UA8A 3MQ9A 3A3UA 3N94A 2X26A 4DCXA 4YB6A 5KZTA 4E0XA 5L9OA 4ISUA 3FXRA 4OESA 4IGTA 1IXIA 4POXA 3RY3A 3M3KA 1RKMA 1EZPA 4LONB 1N04A 3T22A 4NF4B 3FXUA 4H5FA 1NNFA 5I2KB 2X7PA 4C1TA 4U21A 3ECRA 3RQTA 2VGQA 1RYOA 3O28A 2Q2CA 5F1QA 5AA1A 3MW0A 3H6VA 4NWDA 4Q8RA 1II5A 2X7QA 3T93B 1O7TA 3BFTA 3MZBA 3OOAA 1JETA 3TTRA 1QKBA 4DIGA 1SW4A 1MPDA 5HBCA 1MH4A 5KDTB 2ONSA 1NNPA 5EHMA 3EQ1A 4YAHX 4E0WA 3DP4A 2D3IA 2D21A 5DVJA 3FV1A 1LAXA 4XKRA 1MXZA 4H0WA 3PUYE 4FATA 1N7XA 4JXIA 1P1OA 2FYIA 3D4CA 3GBBA 3MPLA 2I3WA 1B3HA 1XC1A 3RUMA 1NNKA 1MY2A 1I6BA 5ICTA 2YLNA 1ZBMA 3TCFA 4YKKA 2ZMBA 4LQ2A 1R9QA 4KI0E 3KBRA 5H8HA 1SBPA 1LCTA 1OIBA 4Z0IA 3N6TA 4OETA 5I84A 3KFMA 3TELA 4F19A 3OXNA 4F1UA 2D5WA 3O66A 3K01A 2UVIA 4X1BA 1XOCA 4K3FA 2Q9TA 4IY6A 1IXGA 3QSLA 2DE4A 1P1WA 3I6VA 1UQWA 1ZLQA 2I4CA 2VD2A 1MDQA 1LFHA 1FQCA 5F7VA 4EUOA 5CMBA 1UIUA 3PPRA 4R73A 3TKDA 1B40A 4I8CA 1M5CA 1NKXA 3PPPA 1B3GA 2R6GE 5JK4A 2E1SA 2B3FA 4U1OA 3OO6A 4OVJA 4JB7A 4G2ZA 1FQDA 4ZECA 3BBRA 4N07A 5BWJA 3MC2A 1A40A 1M5FA 4GLIA 5KCJB 3TTNA 1KWHA 4KCDA 3LVUA 2ZYNA 2GRVA 1MXXA 1LAHE 1S50A 4UA8A 3EHTA 4GXSB 3K2DA 1SQYA 2I4BA 1P1UA 2PX1A 2AL4A 3V5AA 4FEBA 2NXOA 1BLFA 1DPEA 2V84A 3RYAA 3Q29A 4HCWA 1L5TA 3MAMA 3H4ZA 4G8NA 1M5DA 3CSGA 1N7WA 3K6VA 4H8JA 3F11A 3TODA 1QKAA 3O6GA 1SDXA 1POY1 1OQHA 2ONRA 4IY5A 1US4A 2F97A 1USYH 3PMWA 2DWAA 1OVTA 1ZU0A 3WAFA 2DVZA 2HZKA 1BTJA 3FTOA 4DZ1A 2F8DA 4NF6B 2RC7A 2O51A 1A7LA 3C31A 3PPOA 1I6AA 2GHBA 4ZDMA 4PFUA 4U4XA 2DWIA 4RXLA 4PFYA 2VD3A 3FATA 3Q25A 4R9GA 1VR5A 4PFWA 2HAUA 4QF9A 3C34A 5IAIA 3TPAA 2XXTA 2ZXTA 3FVNA 4X9TA 3G3GA 3PV0E 3PU5A 3U72A 1MQJA 1POTA 3VLWA 1AMFA 1CB6A 5CM6A 1ZIUA 4R6HA 2DXYA 3IOUA 4RPNA 3UN6A 4QSCA 1XHYA 1BIYA 5I2NA 1MY3A 2B3BA 4QFNA 2Y7RA 4GRKA 4P11A 3H03A 5DVIA 3KSXA 3N26A 3HHFA 1YCJA 4F22A 4OERA 2HAVA 5I56B 5B70A 4QFPA 3C9HA 3T9VA 2H99A 5CC2A 3CSBA 2Y84A 4TOZA 4GWOA 4NF4A 2DSFA 2P0SA 1PB7A 3KG2A 1P1NA 1UIVA 5I2KA 1B4HA 2NOOA 3K4UA 1PEBA 1FCKA 3TZAA 1JW1A 2QL3A 3DRFA 3EF7A 4KPTA 5I59A 4U22A 1P1QA 3QYTA 3VLUA 3KJTA 3W9WA 2DP8A 5KDTA 3K02A 5TU0A 4H67A 4F3GA 3RT6B 1IITA 1MDP1 2DS9A 1H45A 4QFKA 1US5A 4ELRA 1DOTA 3TEPA 3H06B 3FGSA 3DP6A 1B5HA 4MLVA 1M5BA 2F36A 2NVUB 1J1NA 3N5LA 4GL8A 2RKMA 3B6TA 3E13X 1B7HA 2YJPA 5A5XA 4WEPA 4R72A 4O3CA 1B4ZA 5K2XA 3S4UA 1O64A 1TFDA 3KN3A 1LSTA 2O1LA 4H8IA 3LSXA 2H25A 5FHOA 1OLCA 4DLDA 3T66A 2PYYA 3JV9A 1YPNA 3T96B 2Q89A 3QUFA 1EZOA 3FJMA 3BKIB 4PETA 4GD5A 4N6PA 3OSQA 4DXCA 1DMBA 2RC8A 1IQ7A 2PVUA 2XXUA 3MP8A 4NE4A 3H7MA 3GZGA 2DQVA 3R26A 4KYDA 5ELVA 5CMKA 3EHUA 4ELOA 3QUJA 3EHSA 2XXVA 2ABHA 2F34A 2RCAA 1XVYA 3PUXE 1B7UA 1SI0A 4G77A 4ZEBA 5AA3A 4NEDA 4XKNA 1MM6A 3UP9A 3AXFA 3DRIA 3IX1A 4C1UA 3CG3A 3G3HA 5I2NB 3LR1A 3TMGA 4OMBA 4BDOA 2UXAA 4ONYA 1MY4A 2XX9A 2ONKE 2RINA 1B1HA 4IO3A 4F2OA 4HW8A 4TLMB 3SEUA 1VFEA 4F39A 2H4IA 3HO7A 4FAJA 1MXVA 1OLAA 1LBBA 5CBRA 4R9FA 4C0RA 3SEXA 4UACA 2B4LA 2ZYOA 4NF6A 1LB9A 2I49A 3LUYA 5CRYA 3JZJA 5I59B 1Y20A 2QSXA 4I62A 3U93A 1MQIA 2REGA 4OXVA 4ZEKA 1JNFA 4JWYA 1YAEA 3S2VA 3IB1A 1TXFA 2V3TA
chains in the Genus database with same CATH superfamily
4RA1A 5I3SA 3ROJA 4WKMA 3OEKA 1IUDA 4MEVA 4OWDA 5TP9B 3FD3A 1GVCA 1NMUA 4R2BA 4DE8A 5H8FA 3TQLA 3E3KA 2NWJA 3E4RA 2GFEA 5EYFA 1VSOA 3V83A 1JEVA 1SVXB 4F29A 2FNCA 5FTHA 4OVSA 1H76A 5HM4B 1IIWA 4F1YA 3R7XA 2OX3A 2UVHA 1JW4A 4YB5A 5A5XB 5I56A 3H6TA 2AYSA 1SW1A 1URGA 1URDA 3FZVA 1LBYA 2O6AA 3B6QA 4FECA 2P1SA 3KC1A 4RNSA 3LC8A 5EHSA 3B8BA 3E78A 4IO7A 1Q9DA 1Y1ZA 4PBHA 1MXWA 4PDDA 1UTBA 1LCFA 4HE0A 1MM7A 3USDA 2QS2A 3LSLA 4G68A 3IJOB 3U92A 4JVIA 3ZS6A 4N13A 5H8SA 2W7YA 4OVTA 3O29A 4GL0A 4KHZE 3CFXA 2ZYMA 1XT8A 3IOWA 1MXUA 4MLQA 2ZYKA 3T9UA 4ND9A 2A5SA 2B65A 3PPQA 1B9JA 4I1DA 3HN0A 3GBAA 3DLNA 4XEQA 4PGNA 1NV4A 1MS7A 4OTEA 1QW0A 4G8HA 1NFTA 3MVXA 2P2AA 1ELJA 2Z8DA 2WYKA 4JDFA 1NUXA 4IO4A 4JWOA 2OWSA 4N4UA 2KR0A 3K1MA 3TCGA 4GX3A 4NF5A 1MY0A 1BP5A 1JW5A 1B1XA 2OBGA 3IORA 4OHNA 3IB2A 1GGGA 2VP1A 4BLAA 3FVOA 1OQGA 1IEJA 4XXUA 1N3XA 1LB8A 2BJIA 1FTLA 3FJGA 1VFDA 3VLVA 1AH5A 5HPQA 4F3SA 4N81A 1A54A 5IZ1A 1B3LA 4F18A 1LFIA 2F5XA 3MVWA 4H46A 2HCAA 1GR2A 3FASA 2PFYA 4RJZA 4ESXA 2HXWA 3QAXA 3SKPA 2AL5A 3W15C 3TFLA 3Q27A 2QRYA 2QMWA 3CVGA 2OJTA 3M8UA 5I58B 2FBPA 3SEWA 5DTBA 3R6UA 5IZZA 2O68A 1B0HA 3G3JA 3VDFA 4ELPA 4OYVA 4YICA 3KOTA 1FQFA 4MFIA 4OZ9A 2G93A 1A55A 4U1ZA 3HPIA 4LN5A 2Y7WA 1ATGA 3U1OA 1M5EA 2HHMA 2GH9A 3RN8A 3PTYA 4OVQA 2VOZA 4GQOA 5FHNA 4M1VA 2XXWA 1R9LA 3VVDA 1D3KA 1NV2A 3K6UA 1B2HA 3OENA 3HFUA 3LSWA 4U2RA 5H8FB 2H9BA 1WVJA 3DELB 1NNTA 3EPEA 4QRZA 4KYEA 4OANA 2I0BA 3FXBA 4LZ7A 3GYYA 4EF1A 4P1EA 3BIHA 1AWBA 4X8RA 1RYXA 4GIZA 4ZEIA 3CG1A 4LZ8A 3W9VA 3H6UA 2M8CA 3A09A 5FTIA 1B5IA 2Z8EA 3HV1A 4F3PA 4KXPA 3FUZA 4X04A 1R6ZA 4PFBA 4KFQA 3HSTA 2V3UA 1FPDA 1BKAA 3IOTA 3FXQA 1UTBB 2WOKA 2DXRA 1ZKBA 4F31B 2OLBA 4G68B 2O7IA 1B0LA 2QS4A 1WDNA 2DYXA 1EU8A 1NV6A 5L9MA 4IO5A 2CMOA 4DXUA 3DRKA 2Q8MA 5LOMA 3KGCA 3D1RA 2ESNA 2WBDA 1A8EA 4F1VA 4GF8A 1Y1MA 3CR9A 4PFIA 4JVDA 3MPKA 4GX4A 4PQJA 1QJMA 2RC9A 1URSA 4YU0A 3QXMA 1IMEA 5TP9A 2QS3A 3G3KA 3RTFB 1MXYA 2FIEA 1Q35A 2XXXA 3DRGA 4R74A 3MSTA 2VHAA 3OSRA 5DYHA 4BDQA 5H8QB 1S9TA 4NF5B 4EDPA 4MNIA 1PC3A 4TLLB 2V25A 3BFUA 3C4MA 2LAOA 2UVJA 5EQ7A 4I40A 5DW8A 3S9LC 4XKQA 3V89B 2H98A 4IO6A 4GBWA 2GQ1A 3CIJA 1PBQA 4YKIA 1SI1A 3TTMA 2XXQA 3MP6A 4BDRA 4FORA 1ZTYA 5IKBA 1DPPA 3ODBA 2CEXA 2XWIA 2Z8FA 5J1DA 3HCQA 3ZKLA 3RNNA 3QIMA 4AB5A 2DDKA 1Y9UA 5AE4A 1MRPA 4G8MA 2ZZXA 2UYEA 3FJ7A 2DE2A 2F7AA 1T0KA 4PAFA 3THIA 4MNCA 4RYAA 4JSOA 5ITPA 5LTCA 1H44A 4FEDA 4OVRA 3IK6B 4IB2A 3PGFA 4NF0A 5ISUA 1VE4A 1JVXA 1SYHA 1LBWA 3C36A 4XTCQ 5L9SA 1INPA 3KEIA 1FTOA 3OO8A 1IMCA 5M2VA 4QFOA 3B6WA 2V4CA 4LA9A 2ALUA 1NV1A 2ANJA 4RK9A 2E0SA 2O1MA 4DDDA 4AS5A 2QPQA 1MG1A 2XX8A 1NH8A 4RY1A 2VPOA 3DM0A 4JBZA 4ZEFA 4Z7EA 1LBCA 5DEXA 1SD3A 4X48A 2I0CA 3TCHA 3M3LA 4P3LA 4RK2A 3G3IA 2P3VA 4MF3A 4FJPA 3IFAA 3Q26A 2PMSA 3PUWE 3O6PA 3VV5A 3NOHA 3TQWA 1FQAA 5F24A 1FTMA 2F78A 4H5GA 4AS4A 4GFRA 1P99A 2RCBA 4H1XA 4Q0CA 4O7MA 3G3FA 4N91A 3TAJA 2PBWA 3A3CA 2PT2A 3T9XB 4P0GA 3MZ9A 3CFZA 3B50A 3SETA 5ICQA 1SPIA 3DRJA 5AA2D 1N3WA 2O69A 5EQ9A 1NUYA 4KYSA 1N84A 3TYHA 1IMDA 3LBSA 2F7BA 5I58A 5DT6A 3PAMA 2B4MA 4DXBA 1AL3A 1D9YA 4YKPA 1QUIA 4OFOA 1XVXA 1EH3A 1MY1A 2F3DA 2QMXA 3K1PA 1B5JA 3PUVE 2V93A 5AA2A 1LAGE 4BDLA 4XKPA 5I7IA 3RTWB 4O3BA 4I9DA 4Q5TA 3SDFA 3I3VA 3CI8A 4PFTA 2IA4A 3KSJA 1B46A 3EN3A 4NAPA 2CZIA 5CMCA 4N6DA 4O7IA 1NV0A 1OVBA 4G4PA 5AA4A 4F3BA 4NF8B 2QJEA 3O97A 4P47A 4WXJA 2REJA 4EXLA 4NG7A 3VXCA 3K0VA 1LFGA 4EQBA 4MMPA 1FJ6A 3C35A 2OZZA 1HSEA 3MP1A 1IXCA 2XXYA 4QFLA 4L17A 3ZKKA 5CI5A 3T1BA 2XWOA 3PMVA 4M4GA 4PF6A 4HS7A 3S9MC 3MWBA 2YPNA 1LGBC 3JYRA 4NTLA 1MPCA 4N8GA 4ZE9A 3KBZA 2DE3A 3MBPA 5JEIA 4ZZAA 2XHDA 1NV7A 1RDYA 2WKYA 1B32A 2PFZA 2A5TB 2XXHA 1HSLA 2P3NA 2HZLA 5H8NA 2NUVA 2ZNUA 3SEYA 1UTHB 1TWYA 2R71A 5IZ3A 3OO9A 1ANFA 2QVRA 2FVZA 1K9ZA 4XF5A 1B58A 1FPEA 4LVQA 1Z7ME 3K00A 3K1NA 1B52A 3OELA 1SYIA 5I5PA 1FTJA 3L6GA 3K6XA 3DP8A 1FPGA 3PMXA 3FBPA 1SW2A 3RPWA 4MCOA 3IL1B 4MX6A 1CE2A 3RLFE 3TDJA 3T9HB 3SERA 4LP2B 1QULA 5L8DA 4OEVA 2H5YA 1PB9A 2Y7IA 4R75A 3V8XB 1A99A 2Q88A 5DEXB 4IO2A 3VVFA 4LATA 4DI4B 3ILTB 2I3VA 3IO6A 4LUBA 5EQ8A 5H8QA 4F2QA 2O84X 3LSFB 2Q8JA 1DTZA 1MQHA 4WEDA 3TUSA 5CBSA 4U23A 4N17A 5I57A 2R9JA 1IZ1A 1FSAA 3E79A 3MZ1A 1YXIA 2O7UA 4FIMA 3UK4A 2F7CA 4MNPA 1FBDA 2CZLA 1B3EA 4GXAA 1NUZA 3SEVA 2DOJA 1JQFA 4PFRA 5CMMA 2DWJA 5JTYA 1O63A 1Y3QA 2WOPA 1B6HA 1NL5A 1H43A 1DSNA 3O6HA 3IO4A 3PD8A 4R2FA 3VFJA 4RPOA 3U94A 1DBZA 3E9XA 3S9NC 4H6DA 1QUKA 3FV2A 4IGRA 3KOSA 3UIFA 1D4NA 3FVKA 4YMBA 3FIRA 4NWCA 2HFBA 4FE8A 3TTKA 1A8FA 3SZPA 4P1LA 3KZGA 5AA2B 3U8QA 3VE1B 4ZZEA 1SW5A 3BIGA 2XX7A 3KJ7A 2BJJX 3RT8A 1F9BA 3H3GA 4EXKA 1NH7A 1OMPA 1WODA 3S9EA 4GWUA 2XXKA 1QUJA 4EQ9A 3TTLA 4QSEA 4U4SA 3IJXB 5T3JA 1PDAA 2OK2A 5TPAA 4NHBA 4PP0A 5AA4B 1FTKA 4MIJA 3OO7A 3C33A 3P7IA 4AQ4A 2I58A 1EYKA 3PPNA 3Q28A 3C32A 2QFLA 4PF8A 3FVGA 3O9PA 1I69A 2XXPA 3ZSFA 3OD7A 3HHGA 4X1DA 1GTKA 2F35A 4UABA 2Z22A 4FBPA 3PUZE 3ILUB 1Z7NE 3MJNA 2Z23A 4P9KA 1IXHA 3IOVA 4KQPA 3I5OA 1YTVA 5FHMA 4AB6A 3MVYA 3D4GA 1USYE 2XD3A 2AIXA 1NV5A 1S7YA 2XXIA 4ECFA 4OQOA 3OEMA 3RYBA 4YZZA 2ZNSA 1EZ9A 5H8NB 3B7DA 2F6GA 1FJ9A 4JWXA 4YMAA 1FBGA 1HSJA 2F6PA 5IZ3B 5B7DA 5H8HB 4GVOA 4H65A 4EF2A 2GHAA 3GLBA 1TT1A 1Q1KA 3UGWA 4DI3D 3O2AA 2UVGA 4HXVA 4KD5A 1B3FA 1FW0A 2XD2A 4MBPA 3QK6A 3N6UA 3CRBA 5A5LA 4OENA 3ONMA 1TFAA 3IAZA 1ZJLA 1I6QA 2OWTA 1B7ZA 2I6EA 4GOTA 3IR1A 3H6WA 1GV8A 2THIA 4NF8A 3PD9A 4POWA 3RGYA 2CZHA 4PE5B 1IMBA 1MQDA 3UORA 4BDNA 4BDMA 1XS5A 2V3QA 2DWHA 4I3YA 3LV0A 1JVYA 1QVSA 1AOVA 4JSDA 2XWKA 2HEUA 4DCYA 5I57B 1LLSA 3L6HA 1LBVA 2FA7A 3CHGA 2WOLA 3ISPA 1D9VA 5JTYB 5K2YA 1N0TA 2QS1A 2WBBA 2XXRA 4GX6A 4R6KA 2A5TA 3G7WA 2Y7KA 1LEVA 1MH3A 4XIGQ 4EQ7A 2OWZA 4MH5A 3KN7A 1LBZA 4LQ5A 1UTHA 4ZS9A 1B51A 2HPGA 3M3FA 3WAEA 1H3DA 1FQBA 2UYFA 4NMYA 5ITOA 2G29A 3O6IA 4O3AA 1FQEA 4KR5A 1IMFA 3MVZA 1Y4CA 4YB7A 4QHQA 1PB8A 1R1NA 4TQUQ 5DVFA 3RPLA 2RF1A 1IMAA 1DTGA 4ESWA 1B05A 5J16A 4P0IA 1JEUA 1LAFE 4ELQA 4OFJA 1AIVA 1N76A 2IEEA 1PBPA 2DVCA 5EQAA 2Y7PA 1MQGA 4OEUA 1Y3PA 4N6KA 3K6WA 3CFLA 1Y3NA 5TPAB 2ZNTA 3GXAA 5BUUA 3MUQA 4I3EA 4ZEDA 4LZ5A 1LBXA 2OCUA 4QSDA 1ZMGA 1Y4TA 4OFLA 2PT1A 4HTGA 4O8MA 4R6YA 4ZE8A 3VXBA 3SESA 4THIA 3OMBA 5KCJA 3VVEA 2HQ0A 4Q30B 4P56A 4QXDA 4HCYA 3KN8A 3IB0A 2I48A 1MPBA 4KCCA 2ZZVA 4YKJA 4G68C 2Q2AA 2KLFA 3DRHA 3UA8A 3MQ9A 3A3UA 3N94A 2X26A 1FPFA 4DCXA 4YB6A 5KZTA 4E0XA 5L9OA 4ISUA 3FXRA 1FBCA 4OESA 4IGTA 1IXIA 4POXA 3QMFA 3RY3A 3M3KA 4MJOA 1RKMA 1EZPA 4LONB 1N04A 5IGAA 3T22A 4NF4B 3FXUA 4H5FA 4HE2A 2WX9A 1NNFA 5I2KB 2X7PA 4C1TA 4U21A 3ECRA 3RQTA 2VGQA 1RYOA 3O28A 2Y5LA 2Q2CA 4NQ8A 5F1QA 5AA1A 3MW0A 3H6VA 4NWDA 4OVPA 4Q8RA 1II5A 2X7QA 3T93B 4MAGA 1O7TA 3BFTA 3MZBA 3OOAA 1JETA 3TTRA 1QKBA 4DIGA 1SW4A 1MPDA 5HBCA 1MH4A 5KDTB 1FPBA 2ONSA 1NNPA 5EHMA 1FBEA 3EQ1A 5IM2A 1CNQA 4YAHX 2FHYA 4E0WA 1G0HA 4NGUA 3DP4A 2D3IA 2D21A 5DVJA 3FV1A 1LAXA 4XKRA 1MXZA 4H0WA 5ESYA 3PUYE 2Y5KA 2XA5A 4FATA 1N7XA 4JXIA 1P1OA 2FYIA 3D4CA 3GBBA 3MPLA 2I3WA 1B3HA 1XC1A 1XI6A 3RUMA 1NNKA 1MY2A 1I6BA 5ICTA 2YLNA 1ZBMA 3TCFA 4YKKA 2ZMBA 4LQ2A 1R9QA 4KI0E 3KBRA 4PDHA 5H8HA 1SBPA 1LCTA 1OIBA 4Z0IA 4H45A 3N6TA 4OETA 5I84A 3KFMA 3TELA 4F19A 3OXNA 3RPLB 4F1UA 4GWXA 2D5WA 3O66A 3K01A 2UVIA 2ZZWA 4X1BA 1XOCA 1RDXA 2L5VA 4P8BA 4K3FA 2Q9TA 2CZKA 4IY6A 1IXGA 3QSLA 4GBVA 2DE4A 1P1WA 3I6VA 5FBPA 1UQWA 1ZLQA 2I4CA 4GWSA 5ET6A 2VD2A 1MDQA 1LFHA 1FQCA 5F7VA 4EUOA 5CMBA 1UIUA 3PPRA 4R73A 3TKDA 4PE3A 4HE1A 1B40A 4I8CA 1M5CA 1NKXA 3PPPA 1JP4A 1B3GA 2R6GE 5JK4A 2E1SA 2B3FA 4U1OA 3OO6A 4OVJA 4JB7A 4G2ZA 1FQDA 4ZECA 3BBRA 4N07A 5BWJA 3MC2A 1A40A 1M5FA 4GLIA 5KCJB 3TTNA 1KWHA 4KCDA 3LVUA 1EYIA 2ZYNA 2GRVA 1MXXA 1LAHE 1S50A 4UA8A 3EHTA 2HXRA 3K2DA 4GXSB 5EYGA 1SQYA 2I4BA 1P1UA 4QBAA 2PX1A 2AL4A 3V5AA 4FEBA 2NXOA 5LDZA 1BLFA 1DPEA 2V84A 4GWZA 3RYAA 3Q29A 4HCWA 1L5TA 3MAMA 3H4ZA 4G8NA 1M5DA 4PCDA 3CSGA 2MKZA 1N7WA 3K6VA 4H8JA 3F11A 1D9QA 3MYUA 3KC0A 3TODA 1QKAA 3O6GA 1SDXA 1POY1 1OQHA 2ONRA 4IY5A 2CEYA 1US4A 2QVVA 2F97A 1USYH 3PMWA 2DWAA 1OVTA 1ZU0A 3WAFA 2DVZA 2HZKA 1BTJA 3FTOA 4DZ1A 2F8DA 1VDWA 4NF6B 2RC7A 2F3BA 2O51A 1A7LA 3C31A 3PPOA 1I6AA 2GHBA 2JJKA 1FPKA 4ZDMA 4PFUA 4U4XA 2DWIA 4RXLA 4PFYA 2VD3A 3FATA 3Q25A 4R9GA 1VR5A 4PFWA 2HAUA 4QF9A 3C34A 5IAIA 3TPAA 1FRPA 2XXTA 2ZXTA 3FVNA 4X9TA 3G3GA 3PV0E 3PU5A 3U72A 1MQJA 1POTA 3VLWA 1AMFA 1CB6A 5CM6A 1ZIUA 4R6HA 2DXYA 3IOUA 4RPNA 1G0IA 1KZ8A 3UN6A 4QSCA 1XHYA 1BIYA 1NI9A 5I2NA 1YYZA 4PTKA 1MY3A 2B3BA 4QFNA 2Y7RA 4GRKA 4P11A 3H03A 5DVIA 3KSXA 2QVUA 3N26A 3HHFA 1YCJA 1FPIA 3EKIA 1NUWA 4F22A 1KA0A 4OERA 4MHFA 2HAVA 5I56B 1FBFA 5B70A 4QFPA 4PC9A 3C9HA 3T9VA 2H99A 5CC2A 3CSBA 2Y84A 4TOZA 4GWOA 4OA4A 4NF4A 3RYDA 2DSFA 2P0SA 1PB7A 1K9YA 4PAIA 3KG2A 1P1NA 1UIVA 5I2KA 1B4HA 2NOOA 1YZ0A 3K4UA 1PEBA 1FCKA 3TZAA 1JW1A 1FBPA 3A29A 2R8TA 2PCRA 4XFEA 2QL3A 4GWYA 1RDZA 3DRFA 3EF7A 3LUZA 4KPTA 5I59A 4U22A 1P1QA 3QYTA 3VLUA 3KJTA 3W9WA 2DP8A 5KDTA 2VPNA 3K02A 5TU0A 4H67A 4F3GA 3RT6B 4N8YA 1IITA 1MDP1 2DS9A 5ET7A 1H45A 2KQZA 4QFKA 2WEFA 1US5A 1NV3A 4G61A 4ELRA 1DOTA 3TEPA 2XWVA 3H06B 3FGSA 3DP6A 1FPLA 1B5HA 4MLVA 1M5BA 2F36A 2NVUB 1J1NA 3N5LA 4GL8A 2RKMA 3B6TA 3E13X 1B7HA 2YJPA 1FBHA 5A5XA 4WEPA 4R72A 4O3CA 1B4ZA 5K2XA 3S4UA 1O64A 1TFDA 3KN3A 1LSTA 2O1LA 4PAKA 4H8IA 2VT5A 1KA1A 3LSXA 2H25A 5FHOA 1OLCA 4DLDA 1FPJA 3T66A 1BK4A 2PYYA 3JV9A 1YPNA 3T96B 2Q89A 3QUFA 4JVCA 1EZOA 3FJMA 3BKIB 4PETA 4GD5A 4N6PA 3OSQA 4DXCA 1DMBA 2WYPA 2RC8A 1IQ7A 2PVUA 2XXUA 3MP8A 4NE4A 3H7MA 1QGXA 3GZGA 2DQVA 3R26A 4KYDA 5ELVA 5CMKA 3EHUA 4ELOA 3QUJA 4GWWA 3EHSA 5ET5A 1DK4A 2XXVA 2ABHA 2F34A 2RCAA 1XVYA 3PUXE 4O94A 1B7UA 1SI0A 4G77A 4ZEBA 5EYHA 5AA3A 4NEDA 4XKNA 1MM6A 3UP9A 4NN3A 3AXFA 3DRIA 3IX1A 4C1UA 3CG3A 3G3HA 5I2NB 3LR1A 3TMGA 4OMBA 4BDOA 2UXAA 4ONYA 4NX1A 1MY4A 2XX9A 2ONKE 2RINA 1B1HA 4IO3A 4IR8A 4F2OA 4HW8A 4TLMB 3T0JA 3SEUA 1VFEA 4F39A 2H4IA 3HO7A 1DCUA 4FAJA 1MXVA 4PGPA 1OLAA 1LBBA 5CBRA 2Q74A 4R9FA 4C0RA 4PBQA 3SEXA 4UACA 2B4LA 2ZYOA 4NF6A 1LB9A 4N15A 2I49A 3LUYA 5CRYA 1FTAA 3JZJA 5I59B 1Y20A 2QSXA 4I62A 3U93A 1MQIA 2FIXA 2REGA 5ET8A 4OXVA 4ZEKA 1EYJA 1JNFA 3IFCA 4JWYA 1YAEA 3U65A 3S2VA 3IB1A 1TXFA 2V3TA
chains in the Genus database with same CATH topology
4RA1A 4WKMA 3OEKA 1IUDA 4OWDA 5TP9B 3FD3A 1GVCA 1NMUA 4R2BA 4DE8A 5H8FA 3TQLA 3E3KA 2NWJA 3E4RA 2GFEA 5EYFA 1VSOA 3V83A 1JEVA 1SVXB 4F29A 2FNCA 5FTHA 1H76A 5HM4B 1IIWA 4F1YA 3R7XA 2UVHA 1JW4A 4YB5A 5A5XB 5I56A 3H6TA 2AYSA 1SW1A 1URGA 1URDA 3FZVA 2O6AA 3B6QA 4FECA 2P1SA 4RNSA 3LC8A 5EHSA 4IO7A 1Y1ZA 1MXWA 1UTBA 1LCFA 1MM7A 3USDA 2QS2A 3LSLA 4G68A 3IJOB 3U92A 4N13A 3ZS6A 5H8SA 2W7YA 3O29A 4GL0A 4KHZE 3CFXA 2ZYMA 1XT8A 3IOWA 1MXUA 4MLQA 2ZYKA 3T9UA 4ND9A 2A5SA 2B65A 3PPQA 1B9JA 4I1DA 3HN0A 3GBAA 3DLNA 1MS7A 4OTEA 1QW0A 4G8HA 1NFTA 3MVXA 2P2AA 1ELJA 2Z8DA 4JDFA 4IO4A 4JWOA 2OWSA 3K1MA 3TCGA 4NF5A 1MY0A 1BP5A 1JW5A 1B1XA 2OBGA 3IORA 4OHNA 3IB2A 1GGGA 2VP1A 4BLAA 3FVOA 1OQGA 1IEJA 4XXUA 1N3XA 1LB8A 1FTLA 3FJGA 1VFDA 3VLVA 1AH5A 5HPQA 4F3SA 1A54A 1B3LA 4F18A 1LFIA 2F5XA 3MVWA 2HCAA 1GR2A 3FASA 4ESXA 4RJZA 2HXWA 3QAXA 3SKPA 2AL5A 3W15C 3TFLA 3Q27A 2QRYA 2QMWA 3CVGA 2OJTA 3M8UA 5I58B 3SEWA 5DTBA 3R6UA 2O68A 1B0HA 3G3JA 3VDFA 4ELPA 4OYVA 4YICA 3KOTA 1FQFA 4MFIA 4OZ9A 2G93A 1A55A 4U1ZA 3HPIA 2Y7WA 1ATGA 3U1OA 1M5EA 2GH9A 3RN8A 2VOZA 4GQOA 5FHNA 4M1VA 2XXWA 1R9LA 3VVDA 1D3KA 3K6UA 1B2HA 3OENA 3LSWA 4U2RA 5H8FB 2H9BA 1WVJA 3DELB 1NNTA 3EPEA 4QRZA 4KYEA 2I0BA 4LZ7A 4EF1A 1RYXA 4GIZA 4ZEIA 3CG1A 4LZ8A 3W9VA 3H6UA 2M8CA 3A09A 5FTIA 1B5IA 2Z8EA 3HV1A 4F3PA 3FUZA 1R6ZA 4KFQA 3HSTA 2V3UA 1BKAA 3IOTA 3FXQA 1UTBB 2WOKA 2DXRA 1ZKBA 4F31B 2OLBA 4G68B 2O7IA 1B0LA 2QS4A 1WDNA 2DYXA 1EU8A 5L9MA 4IO5A 2CMOA 4DXUA 3DRKA 5LOMA 3KGCA 2ESNA 1A8EA 4F1VA 4GF8A 1Y1MA 3CR9A 3MPKA 4PQJA 1QJMA 2RC9A 1URSA 4YU0A 3QXMA 5TP9A 2QS3A 3G3KA 3RTFB 1MXYA 1Q35A 2XXXA 3DRGA 4R74A 2VHAA 3OSRA 5DYHA 4BDQA 5H8QB 1S9TA 4NF5B 4EDPA 1PC3A 4TLLB 2V25A 3BFUA 3C4MA 2LAOA 2UVJA 3S9LC 4XKQA 3V89B 2H98A 4IO6A 3CIJA 1PBQA 4YKIA 1SI1A 3TTMA 2XXQA 3MP6A 4BDRA 4FORA 1ZTYA 5IKBA 1DPPA 3ODBA 2Z8FA 5J1DA 3HCQA 3ZKLA 3RNNA 3QIMA 4AB5A 1Y9UA 5AE4A 1MRPA 4G8MA 2UYEA 3FJ7A 2DE2A 2F7AA 1T0KA 3THIA 4RYAA 4JSOA 5ITPA 1H44A 4FEDA 3IK6B 4IB2A 3PGFA 5ISUA 1VE4A 1JVXA 1SYHA 3C36A 4XTCQ 5L9SA 3KEIA 1FTOA 3OO8A 5M2VA 4QFOA 3B6WA 4LA9A 2ALUA 2ANJA 4RK9A 2E0SA 2O1MA 4DDDA 2QPQA 1MG1A 2XX8A 1NH8A 4RY1A 3DM0A 4JBZA 4ZEFA 4Z7EA 1LBCA 5DEXA 1SD3A 4X48A 2I0CA 3TCHA 3M3LA 4RK2A 3G3IA 4MF3A 4FJPA 3Q26A 2PMSA 3PUWE 3O6PA 3VV5A 3TQWA 1FQAA 1FTMA 2F78A 4H5GA 4GFRA 1P99A 2RCBA 4H1XA 4Q0CA 3G3FA 3TAJA 2PBWA 3A3CA 2PT2A 3T9XB 4P0GA 3MZ9A 3CFZA 3SETA 5ICQA 3DRJA 5AA2D 1N3WA 2O69A 4KYSA 1N84A 3TYHA 3LBSA 2F7BA 5I58A 5DT6A 3PAMA 2B4MA 4DXBA 1AL3A 1D9YA 4YKPA 1QUIA 4OFOA 1XVXA 1EH3A 1MY1A 2QMXA 3K1PA 1B5JA 3PUVE 2V93A 5AA2A 1LAGE 4BDLA 4XKPA 3RTWB 4O3BA 4I9DA 4Q5TA 3SDFA 3I3VA 3CI8A 4PFTA 2IA4A 3KSJA 1B46A 3EN3A 5CMCA 1OVBA 4G4PA 5AA4A 4F3BA 4NF8B 2QJEA 3O97A 4WXJA 2REJA 4EXLA 3VXCA 3K0VA 1LFGA 4EQBA 3C35A 2OZZA 1HSEA 3MP1A 1IXCA 2XXYA 4QFLA 4L17A 3ZKKA 5CI5A 4M4GA 3PMVA 4HS7A 3S9MC 3MWBA 2YPNA 1LGBC 3JYRA 4NTLA 1MPCA 4ZE9A 3MBPA 2DE3A 5JEIA 4ZZAA 2XHDA 2WKYA 1B32A 2A5TB 2XXHA 1HSLA 2HZLA 5H8NA 2NUVA 2ZNUA 3SEYA 1UTHB 1TWYA 2R71A 3OO9A 1ANFA 1B58A 4LVQA 1Z7ME 3K00A 3K1NA 1B52A 3OELA 1SYIA 1FTJA 3L6GA 3K6XA 3DP8A 3PMXA 1SW2A 3RPWA 3IL1B 1CE2A 3RLFE 3TDJA 3T9HB 3SERA 4LP2B 1QULA 5L8DA 4OEVA 2H5YA 1PB9A 2Y7IA 4R75A 3V8XB 1A99A 2Q88A 5DEXB 4IO2A 3VVFA 4LATA 3ILTB 2I3VA 3IO6A 4LUBA 5H8QA 4F2QA 2O84X 3LSFB 2Q8JA 1DTZA 1MQHA 4WEDA 3TUSA 5CBSA 4U23A 5I57A 2R9JA 1IZ1A 3MZ1A 2O7UA 4FIMA 3UK4A 2F7CA 2CZLA 1B3EA 4GXAA 3SEVA 2DOJA 1JQFA 5CMMA 2DWJA 5JTYA 1O63A 1Y3QA 2WOPA 1B6HA 1NL5A 1H43A 1DSNA 3O6HA 3IO4A 3PD8A 4R2FA 3VFJA 4RPOA 3U94A 3E9XA 3S9NC 4H6DA 1QUKA 3FV2A 4IGRA 3KOSA 3UIFA 1D4NA 3FVKA 4YMBA 3FIRA 4NWCA 2HFBA 4FE8A 3TTKA 1A8FA 3KZGA 5AA2B 3U8QA 3VE1B 4ZZEA 1SW5A 2XX7A 3KJ7A 2BJJX 3RT8A 1F9BA 3H3GA 4EXKA 1NH7A 1OMPA 1WODA 3S9EA 1QUJA 4EQ9A 3TTLA 4QSEA 4U4SA 3IJXB 1PDAA 2OK2A 5TPAA 4PP0A 5AA4B 1FTKA 3OO7A 3C33A 3P7IA 4AQ4A 2I58A 3PPNA 3Q28A 3C32A 3FVGA 3O9PA 1I69A 2XXPA 3ZSFA 3OD7A 3HHGA 4X1DA 1GTKA 2F35A 2Z22A 3PUZE 3ILUB 1Z7NE 3MJNA 2Z23A 1IXHA 3IOVA 4KQPA 3I5OA 1YTVA 5FHMA 4AB6A 3MVYA 3D4GA 1USYE 2XD3A 2AIXA 1S7YA 2XXIA 4ECFA 4OQOA 3OEMA 3RYBA 4YZZA 2ZNSA 1EZ9A 5H8NB 3B7DA 2F6GA 4JWXA 4YMAA 1HSJA 2F6PA 5B7DA 5H8HB 4GVOA 4H65A 4EF2A 2GHAA 3GLBA 1TT1A 1Q1KA 3UGWA 3O2AA 2UVGA 4KD5A 1B3FA 1FW0A 2XD2A 4MBPA 3QK6A 3N6UA 3CRBA 4OENA 3ONMA 1TFAA 3IAZA 1ZJLA 1I6QA 2OWTA 1B7ZA 2I6EA 4GOTA 3IR1A 3H6WA 1GV8A 2THIA 4NF8A 3PD9A 4POWA 3RGYA 4PE5B 1MQDA 3UORA 4BDNA 4BDMA 1XS5A 2V3QA 2DWHA 1JVYA 1QVSA 1AOVA 4JSDA 2HEUA 4DCYA 5I57B 1LLSA 3L6HA 2FA7A 3CHGA 2WOLA 1D9VA 5JTYB 5K2YA 1N0TA 2QS1A 2XXRA 4R6KA 2A5TA 3G7WA 2Y7KA 1MH3A 4XIGQ 4EQ7A 4MH5A 3KN7A 4LQ5A 1UTHA 4ZS9A 1B51A 3M3FA 3WAEA 1H3DA 1FQBA 2UYFA 4NMYA 5ITOA 2G29A 3O6IA 4O3AA 1FQEA 4KR5A 3MVZA 1Y4CA 4YB7A 4QHQA 1PB8A 1R1NA 4TQUQ 5DVFA 2RF1A 1DTGA 4ESWA 1B05A 4P0IA 1JEUA 1LAFE 4ELQA 4OFJA 1AIVA 1N76A 2IEEA 1PBPA 2DVCA 2Y7PA 1MQGA 4OEUA 1Y3PA 3K6WA 3CFLA 1Y3NA 5TPAB 2ZNTA 3GXAA 5BUUA 3MUQA 4ZEDA 4LZ5A 2OCUA 4QSDA 1ZMGA 1Y4TA 4OFLA 2PT1A 4HTGA 4R6YA 4ZE8A 3VXBA 3SESA 4THIA 3OMBA 5KCJA 3VVEA 2HQ0A 4Q30B 4HCYA 3KN8A 3IB0A 2I48A 1MPBA 4KCCA 4YKJA 4G68C 2Q2AA 2KLFA 3DRHA 3UA8A 3MQ9A 3A3UA 3N94A 2X26A 4DCXA 4YB6A 5KZTA 4E0XA 5L9OA 4ISUA 3FXRA 4OESA 4IGTA 1IXIA 4POXA 3RY3A 3M3KA 1RKMA 1EZPA 4LONB 1N04A 3T22A 4NF4B 3FXUA 4H5FA 1NNFA 5I2KB 2X7PA 4C1TA 4U21A 3ECRA 3RQTA 2VGQA 1RYOA 3O28A 2Q2CA 5F1QA 5AA1A 3MW0A 3H6VA 4NWDA 4Q8RA 1II5A 2X7QA 3T93B 1O7TA 3BFTA 3MZBA 3OOAA 1JETA 3TTRA 1QKBA 4DIGA 1SW4A 1MPDA 5HBCA 1MH4A 5KDTB 2ONSA 1NNPA 5EHMA 3EQ1A 4YAHX 4E0WA 3DP4A 2D3IA 2D21A 5DVJA 3FV1A 1LAXA 4XKRA 1MXZA 4H0WA 3PUYE 4FATA 1N7XA 4JXIA 1P1OA 2FYIA 3D4CA 3GBBA 3MPLA 2I3WA 1B3HA 1XC1A 3RUMA 1NNKA 1MY2A 1I6BA 5ICTA 2YLNA 1ZBMA 3TCFA 4YKKA 2ZMBA 4LQ2A 1R9QA 4KI0E 3KBRA 5H8HA 1SBPA 1LCTA 1OIBA 4Z0IA 3N6TA 4OETA 5I84A 3KFMA 3TELA 4F19A 3OXNA 4F1UA 2D5WA 3O66A 3K01A 2UVIA 4X1BA 1XOCA 4K3FA 2Q9TA 4IY6A 1IXGA 3QSLA 2DE4A 1P1WA 3I6VA 1UQWA 1ZLQA 2I4CA 2VD2A 1MDQA 1LFHA 1FQCA 5F7VA 4EUOA 5CMBA 1UIUA 3PPRA 4R73A 3TKDA 1B40A 4I8CA 1M5CA 1NKXA 3PPPA 1B3GA 2R6GE 5JK4A 2E1SA 2B3FA 4U1OA 3OO6A 4OVJA 4JB7A 4G2ZA 1FQDA 4ZECA 3BBRA 4N07A 5BWJA 3MC2A 1A40A 1M5FA 4GLIA 5KCJB 3TTNA 1KWHA 4KCDA 3LVUA 2ZYNA 2GRVA 1MXXA 1LAHE 1S50A 4UA8A 3EHTA 4GXSB 3K2DA 1SQYA 2I4BA 1P1UA 2PX1A 2AL4A 3V5AA 4FEBA 2NXOA 1BLFA 1DPEA 2V84A 3RYAA 3Q29A 4HCWA 1L5TA 3MAMA 3H4ZA 4G8NA 1M5DA 3CSGA 1N7WA 3K6VA 4H8JA 3F11A 3TODA 1QKAA 3O6GA 1SDXA 1POY1 1OQHA 2ONRA 4IY5A 1US4A 2F97A 1USYH 3PMWA 2DWAA 1OVTA 1ZU0A 3WAFA 2DVZA 2HZKA 1BTJA 3FTOA 4DZ1A 2F8DA 4NF6B 2RC7A 2O51A 1A7LA 3C31A 3PPOA 1I6AA 2GHBA 4ZDMA 4PFUA 4U4XA 2DWIA 4RXLA 4PFYA 2VD3A 3FATA 3Q25A 4R9GA 1VR5A 4PFWA 2HAUA 4QF9A 3C34A 5IAIA 3TPAA 2XXTA 2ZXTA 3FVNA 4X9TA 3G3GA 3PV0E 3PU5A 3U72A 1MQJA 1POTA 3VLWA 1AMFA 1CB6A 5CM6A 1ZIUA 4R6HA 2DXYA 3IOUA 4RPNA 3UN6A 4QSCA 1XHYA 1BIYA 5I2NA 1MY3A 2B3BA 4QFNA 2Y7RA 4GRKA 4P11A 3H03A 5DVIA 3KSXA 3N26A 3HHFA 1YCJA 4F22A 4OERA 2HAVA 5I56B 5B70A 4QFPA 3C9HA 3T9VA 2H99A 5CC2A 3CSBA 2Y84A 4TOZA 4GWOA 4NF4A 2DSFA 2P0SA 1PB7A 3KG2A 1P1NA 1UIVA 5I2KA 1B4HA 2NOOA 3K4UA 1PEBA 1FCKA 3TZAA 1JW1A 2QL3A 3DRFA 3EF7A 4KPTA 5I59A 4U22A 1P1QA 3QYTA 3VLUA 3KJTA 3W9WA 2DP8A 5KDTA 3K02A 5TU0A 4H67A 4F3GA 3RT6B 1IITA 1MDP1 2DS9A 1H45A 4QFKA 1US5A 4ELRA 1DOTA 3TEPA 3H06B 3FGSA 3DP6A 1B5HA 4MLVA 1M5BA 2F36A 2NVUB 1J1NA 3N5LA 4GL8A 2RKMA 3B6TA 3E13X 1B7HA 2YJPA 5A5XA 4WEPA 4R72A 4O3CA 1B4ZA 5K2XA 3S4UA 1O64A 1TFDA 3KN3A 1LSTA 2O1LA 4H8IA 3LSXA 2H25A 5FHOA 1OLCA 4DLDA 3T66A 2PYYA 3JV9A 1YPNA 3T96B 2Q89A 3QUFA 1EZOA 3FJMA 3BKIB 4PETA 4GD5A 4N6PA 3OSQA 4DXCA 1DMBA 2RC8A 1IQ7A 2PVUA 2XXUA 3MP8A 4NE4A 3H7MA 3GZGA 2DQVA 3R26A 4KYDA 5ELVA 5CMKA 3EHUA 4ELOA 3QUJA 3EHSA 2XXVA 2ABHA 2F34A 2RCAA 1XVYA 3PUXE 1B7UA 1SI0A 4G77A 4ZEBA 5AA3A 4NEDA 4XKNA 1MM6A 3UP9A 3AXFA 3DRIA 3IX1A 4C1UA 3CG3A 3G3HA 5I2NB 3LR1A 3TMGA 4OMBA 4BDOA 2UXAA 4ONYA 1MY4A 2XX9A 2ONKE 2RINA 1B1HA 4IO3A 4F2OA 4HW8A 4TLMB 3SEUA 1VFEA 4F39A 2H4IA 3HO7A 4FAJA 1MXVA 1OLAA 1LBBA 5CBRA 4R9FA 4C0RA 3SEXA 4UACA 2B4LA 2ZYOA 4NF6A 1LB9A 2I49A 3LUYA 5CRYA 3JZJA 5I59B 1Y20A 2QSXA 4I62A 3U93A 1MQIA 2REGA 4OXVA 4ZEKA 1JNFA 4JWYA 1YAEA 3S2VA 3IB1A 1TXFA 2V3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RA1 A;  4WKM A;  3OEK A;  1IUD A;  4OWD A;  5TP9 B;  3FD3 A;  1GVC A;  1NMU A;  4R2B A;  4DE8 A;  5H8F A;  3TQL A;  3E3K A;  2NWJ A;  3E4R A;  2GFE A;  5EYF A;  1VSO A;  3V83 A;  1JEV A;  1SVX B;  4F29 A;  2FNC A;  5FTH A;  1H76 A;  5HM4 B;  1IIW A;  4F1Y A;  3R7X A;  2UVH A;  1JW4 A;  4YB5 A;  5A5X B;  5I56 A;  3H6T A;  2AYS A;  1SW1 A;  1URG A;  1URD A;  3FZV A;  2O6A A;  3B6Q A;  4FEC A;  2P1S A;  4RNS A;  3LC8 A;  5EHS A;  4IO7 A;  1Y1Z A;  1MXW A;  1UTB A;  1LCF A;  1MM7 A;  3USD A;  2QS2 A;  3LSL A;  4G68 A;  3IJO B;  3U92 A;  4N13 A;  3ZS6 A;  5H8S A;  2W7Y A;  3O29 A;  4GL0 A;  4KHZ E;  3CFX A;  2ZYM A;  1XT8 A;  3IOW A;  1MXU A;  4MLQ A;  2ZYK A;  3T9U A;  4ND9 A;  2A5S A;  2B65 A;  3PPQ A;  1B9J A;  4I1D A;  3HN0 A;  3GBA A;  3DLN A;  1MS7 A;  4OTE A;  1QW0 A;  4G8H A;  1NFT A;  3MVX A;  2P2A A;  1ELJ A;  2Z8D A;  4JDF A;  4IO4 A;  4JWO A;  2OWS A;  3K1M A;  3TCG A;  4NF5 A;  1MY0 A;  1BP5 A;  1JW5 A;  1B1X A;  2OBG A;  3IOR A;  4OHN A;  3IB2 A;  1GGG A;  2VP1 A;  4BLA A;  3FVO A;  1OQG A;  1IEJ A;  4XXU A;  1N3X A;  1LB8 A;  1FTL A;  3FJG A;  1VFD A;  3VLV A;  1AH5 A;  5HPQ A;  4F3S A;  1A54 A;  1B3L A;  4F18 A;  1LFI A;  2F5X A;  3MVW A;  2HCA A;  1GR2 A;  3FAS A;  4ESX A;  4RJZ A;  2HXW A;  3QAX A;  3SKP A;  2AL5 A;  3W15 C;  3TFL A;  3Q27 A;  2QRY A;  2QMW A;  3CVG A;  2OJT A;  3M8U A;  5I58 B;  3SEW A;  5DTB A;  3R6U A;  2O68 A;  1B0H A;  3G3J A;  3VDF A;  4ELP A;  4OYV A;  4YIC A;  3KOT A;  1FQF A;  4MFI A;  4OZ9 A;  2G93 A;  1A55 A;  4U1Z A;  3HPI A;  2Y7W A;  1ATG A;  3U1O A;  1M5E A;  2GH9 A;  3RN8 A;  2VOZ A;  4GQO A;  5FHN A;  4M1V A;  2XXW A;  1R9L A;  3VVD A;  1D3K A;  3K6U A;  1B2H A;  3OEN A;  3LSW A;  4U2R A;  5H8F B;  2H9B A;  1WVJ A;  3DEL B;  1NNT A;  3EPE A;  4QRZ A;  4KYE A;  2I0B A;  4LZ7 A;  4EF1 A;  1RYX A;  4GIZ A;  4ZEI A;  3CG1 A;  4LZ8 A;  3W9V A;  3H6U A;  2M8C A;  3A09 A;  5FTI A;  1B5I A;  2Z8E A;  3HV1 A;  4F3P A;  3FUZ A;  1R6Z A;  4KFQ A;  3HST A;  2V3U A;  1BKA A;  3IOT A;  3FXQ A;  1UTB B;  2WOK A;  2DXR A;  1ZKB A;  4F31 B;  2OLB A;  4G68 B;  2O7I A;  1B0L A;  2QS4 A;  1WDN A;  2DYX A;  1EU8 A;  5L9M A;  4IO5 A;  2CMO A;  4DXU A;  3DRK A;  5LOM A;  3KGC A;  2ESN A;  1A8E A;  4F1V A;  4GF8 A;  1Y1M A;  3CR9 A;  3MPK A;  4PQJ A;  1QJM A;  2RC9 A;  1URS A;  4YU0 A;  3QXM A;  5TP9 A;  2QS3 A;  3G3K A;  3RTF B;  1MXY A;  1Q35 A;  2XXX A;  3DRG A;  4R74 A;  2VHA A;  3OSR A;  5DYH A;  4BDQ A;  5H8Q B;  1S9T A;  4NF5 B;  4EDP A;  1PC3 A;  4TLL B;  2V25 A;  3BFU A;  3C4M A;  2LAO A;  2UVJ A;  3S9L C;  4XKQ A;  3V89 B;  2H98 A;  4IO6 A;  3CIJ A;  1PBQ A;  4YKI A;  1SI1 A;  3TTM A;  2XXQ A;  3MP6 A;  4BDR A;  4FOR A;  1ZTY A;  5IKB A;  1DPP A;  3ODB A;  2Z8F A;  5J1D A;  3HCQ A;  3ZKL A;  3RNN A;  3QIM A;  4AB5 A;  1Y9U A;  5AE4 A;  1MRP A;  4G8M A;  2UYE A;  3FJ7 A;  2DE2 A;  2F7A A;  1T0K A;  3THI A;  4RYA A;  4JSO A;  5ITP A;  1H44 A;  4FED A;  3IK6 B;  4IB2 A;  3PGF A;  5ISU A;  1VE4 A;  1JVX A;  1SYH A;  3C36 A;  4XTC Q;  5L9S A;  3KEI A;  1FTO A;  3OO8 A;  5M2V A;  4QFO A;  3B6W A;  4LA9 A;  2ALU A;  2ANJ A;  4RK9 A;  2E0S A;  2O1M A;  4DDD A;  2QPQ A;  1MG1 A;  2XX8 A;  1NH8 A;  4RY1 A;  3DM0 A;  4JBZ A;  4ZEF A;  4Z7E A;  1LBC A;  5DEX A;  1SD3 A;  4X48 A;  2I0C A;  3TCH A;  3M3L A;  4RK2 A;  3G3I A;  4MF3 A;  4FJP A;  3Q26 A;  2PMS A;  3PUW E;  3O6P A;  3VV5 A;  3TQW A;  1FQA A;  1FTM A;  2F78 A;  4H5G A;  4GFR A;  1P99 A;  2RCB A;  4H1X A;  4Q0C A;  3G3F A;  3TAJ A;  2PBW A;  3A3C A;  2PT2 A;  3T9X B;  4P0G A;  3MZ9 A;  3CFZ A;  3SET A;  5ICQ A;  3DRJ A;  5AA2 D;  1N3W A;  2O69 A;  4KYS A;  1N84 A;  3TYH A;  3LBS A;  2F7B A;  5I58 A;  5DT6 A;  3PAM A;  2B4M A;  4DXB A;  1AL3 A;  1D9Y A;  4YKP A;  1QUI A;  4OFO A;  1XVX A;  1EH3 A;  1MY1 A;  2QMX A;  3K1P A;  1B5J A;  3PUV E;  2V93 A;  5AA2 A;  1LAG E;  4BDL A;  4XKP A;  3RTW B;  4O3B A;  4I9D A;  4Q5T A;  3SDF A;  3I3V A;  3CI8 A;  4PFT A;  2IA4 A;  3KSJ A;  1B46 A;  3EN3 A;  5CMC A;  1OVB A;  4G4P A;  5AA4 A;  4F3B A;  4NF8 B;  2QJE A;  3O97 A;  4WXJ A;  2REJ A;  4EXL A;  3VXC A;  3K0V A;  1LFG A;  4EQB A;  3C35 A;  2OZZ A;  1HSE A;  3MP1 A;  1IXC A;  2XXY A;  4QFL A;  4L17 A;  3ZKK A;  5CI5 A;  4M4G A;  3PMV A;  4HS7 A;  3S9M C;  3MWB A;  2YPN A;  1LGB C;  3JYR A;  4NTL A;  1MPC A;  4ZE9 A;  3MBP A;  2DE3 A;  5JEI A;  4ZZA A;  2XHD A;  2WKY A;  1B32 A;  2A5T B;  2XXH A;  1HSL A;  2HZL A;  5H8N A;  2NUV A;  2ZNU A;  3SEY A;  1UTH B;  1TWY A;  2R71 A;  3OO9 A;  1ANF A;  1B58 A;  4LVQ A;  1Z7M E;  3K00 A;  3K1N A;  1B52 A;  3OEL A;  1SYI A;  1FTJ A;  3L6G A;  3K6X A;  3DP8 A;  3PMX A;  1SW2 A;  3RPW A;  3IL1 B;  1CE2 A;  3RLF E;  3TDJ A;  3T9H B;  3SER A;  4LP2 B;  1QUL A;  5L8D A;  4OEV A;  2H5Y A;  1PB9 A;  2Y7I A;  4R75 A;  3V8X B;  1A99 A;  2Q88 A;  5DEX B;  4IO2 A;  3VVF A;  4LAT A;  3ILT B;  2I3V A;  3IO6 A;  4LUB A;  5H8Q A;  4F2Q A;  2O84 X;  3LSF B;  2Q8J A;  1DTZ A;  1MQH A;  4WED A;  3TUS A;  5CBS A;  4U23 A;  5I57 A;  2R9J A;  1IZ1 A;  3MZ1 A;  2O7U A;  4FIM A;  3UK4 A;  2F7C A;  2CZL A;  1B3E A;  4GXA A;  3SEV A;  2DOJ A;  1JQF A;  5CMM A;  2DWJ A;  5JTY A;  1O63 A;  1Y3Q A;  2WOP A;  1B6H A;  1NL5 A;  1H43 A;  1DSN A;  3O6H A;  3IO4 A;  3PD8 A;  4R2F A;  3VFJ A;  4RPO A;  3U94 A;  3E9X A;  3S9N C;  4H6D A;  1QUK A;  3FV2 A;  4IGR A;  3KOS A;  3UIF A;  1D4N A;  3FVK A;  4YMB A;  3FIR A;  4NWC A;  2HFB A;  4FE8 A;  3TTK A;  1A8F A;  3KZG A;  5AA2 B;  3U8Q A;  3VE1 B;  4ZZE A;  1SW5 A;  2XX7 A;  3KJ7 A;  2BJJ X;  3RT8 A;  1F9B A;  3H3G A;  4EXK A;  1NH7 A;  1OMP A;  1WOD A;  3S9E A;  1QUJ A;  4EQ9 A;  3TTL A;  4QSE A;  4U4S A;  3IJX B;  1PDA A;  2OK2 A;  5TPA A;  4PP0 A;  5AA4 B;  1FTK A;  3OO7 A;  3C33 A;  3P7I A;  4AQ4 A;  2I58 A;  3PPN A;  3Q28 A;  3C32 A;  3FVG A;  3O9P A;  1I69 A;  2XXP A;  3ZSF A;  3OD7 A;  3HHG A;  4X1D A;  1GTK A;  2F35 A;  2Z22 A;  3PUZ E;  3ILU B;  1Z7N E;  3MJN A;  2Z23 A;  1IXH A;  3IOV A;  4KQP A;  3I5O A;  1YTV A;  5FHM A;  4AB6 A;  3MVY A;  3D4G A;  1USY E;  2XD3 A;  2AIX A;  1S7Y A;  2XXI A;  4ECF A;  4OQO A;  3OEM A;  3RYB A;  4YZZ A;  2ZNS A;  1EZ9 A;  5H8N B;  3B7D A;  2F6G A;  4JWX A;  4YMA A;  1HSJ A;  2F6P A;  5B7D A;  5H8H B;  4GVO A;  4H65 A;  4EF2 A;  2GHA A;  3GLB A;  1TT1 A;  1Q1K A;  3UGW A;  3O2A A;  2UVG A;  4KD5 A;  1B3F A;  1FW0 A;  2XD2 A;  4MBP A;  3QK6 A;  3N6U A;  3CRB A;  4OEN A;  3ONM A;  1TFA A;  3IAZ A;  1ZJL A;  1I6Q A;  2OWT A;  1B7Z A;  2I6E A;  4GOT A;  3IR1 A;  3H6W A;  1GV8 A;  2THI A;  4NF8 A;  3PD9 A;  4POW A;  3RGY A;  4PE5 B;  1MQD A;  3UOR A;  4BDN A;  4BDM A;  1XS5 A;  2V3Q A;  2DWH A;  1JVY A;  1QVS A;  1AOV A;  4JSD A;  2HEU A;  4DCY A;  5I57 B;  1LLS A;  3L6H A;  2FA7 A;  3CHG A;  2WOL A;  1D9V A;  5JTY B;  5K2Y A;  1N0T A;  2QS1 A;  2XXR A;  4R6K A;  2A5T A;  3G7W A;  2Y7K A;  1MH3 A;  4XIG Q;  4EQ7 A;  4MH5 A;  3KN7 A;  4LQ5 A;  1UTH A;  4ZS9 A;  1B51 A;  3M3F A;  3WAE A;  1H3D A;  1FQB A;  2UYF A;  4NMY A;  5ITO A;  2G29 A;  3O6I A;  4O3A A;  1FQE A;  4KR5 A;  3MVZ A;  1Y4C A;  4YB7 A;  4QHQ A;  1PB8 A;  1R1N A;  4TQU Q;  5DVF A;  2RF1 A;  1DTG A;  4ESW A;  1B05 A;  4P0I A;  1JEU A;  1LAF E;  4ELQ A;  4OFJ A;  1AIV A;  1N76 A;  2IEE A;  1PBP A;  2DVC A;  2Y7P A;  1MQG A;  4OEU A;  1Y3P A;  3K6W A;  3CFL A;  1Y3N A;  5TPA B;  2ZNT A;  3GXA A;  5BUU A;  3MUQ A;  4ZED A;  4LZ5 A;  2OCU A;  4QSD A;  1ZMG A;  1Y4T A;  4OFL A;  2PT1 A;  4HTG A;  4R6Y A;  4ZE8 A;  3VXB A;  3SES A;  4THI A;  3OMB A;  5KCJ A;  3VVE A;  2HQ0 A;  4Q30 B;  4HCY A;  3KN8 A;  3IB0 A;  2I48 A;  1MPB A;  4KCC A;  4YKJ A;  4G68 C;  2Q2A A;  2KLF A;  3DRH A;  3UA8 A;  3MQ9 A;  3A3U A;  3N94 A;  2X26 A;  4DCX A;  4YB6 A;  5KZT A;  4E0X A;  5L9O A;  4ISU A;  3FXR A;  4OES A;  4IGT A;  1IXI A;  4POX A;  3RY3 A;  3M3K A;  1RKM A;  1EZP A;  4LON B;  1N04 A;  3T22 A;  4NF4 B;  3FXU A;  4H5F A;  1NNF A;  5I2K B;  2X7P A;  4C1T A;  4U21 A;  3ECR A;  3RQT A;  2VGQ A;  1RYO A;  3O28 A;  2Q2C A;  5F1Q A;  5AA1 A;  3MW0 A;  3H6V A;  4NWD A;  4Q8R A;  1II5 A;  2X7Q A;  3T93 B;  1O7T A;  3BFT A;  3MZB A;  3OOA A;  1JET A;  3TTR A;  1QKB A;  4DIG A;  1SW4 A;  1MPD A;  5HBC A;  1MH4 A;  5KDT B;  2ONS A;  1NNP A;  5EHM A;  3EQ1 A;  4YAH X;  4E0W A;  3DP4 A;  2D3I A;  2D21 A;  5DVJ A;  3FV1 A;  1LAX A;  4XKR A;  1MXZ A;  4H0W A;  3PUY E;  4FAT A;  1N7X A;  4JXI A;  1P1O A;  2FYI A;  3D4C A;  3GBB A;  3MPL A;  2I3W A;  1B3H A;  1XC1 A;  3RUM A;  1NNK A;  1MY2 A;  1I6B A;  5ICT A;  2YLN A;  1ZBM A;  3TCF A;  4YKK A;  2ZMB A;  4LQ2 A;  1R9Q A;  4KI0 E;  3KBR A;  5H8H A;  1SBP A;  1LCT A;  1OIB A;  4Z0I A;  3N6T A;  4OET A;  5I84 A;  3KFM A;  3TEL A;  4F19 A;  3OXN A;  4F1U A;  2D5W A;  3O66 A;  3K01 A;  2UVI A;  4X1B A;  1XOC A;  4K3F A;  2Q9T A;  4IY6 A;  1IXG A;  3QSL A;  2DE4 A;  1P1W A;  3I6V A;  1UQW A;  1ZLQ A;  2I4C A;  2VD2 A;  1MDQ A;  1LFH A;  1FQC A;  5F7V A;  4EUO A;  5CMB A;  1UIU A;  3PPR A;  4R73 A;  3TKD A;  1B40 A;  4I8C A;  1M5C A;  1NKX A;  3PPP A;  1B3G A;  2R6G E;  5JK4 A;  2E1S A;  2B3F A;  4U1O A;  3OO6 A;  4OVJ A;  4JB7 A;  4G2Z A;  1FQD A;  4ZEC A;  3BBR A;  4N07 A;  5BWJ A;  3MC2 A;  1A40 A;  1M5F A;  4GLI A;  5KCJ B;  3TTN A;  1KWH A;  4KCD A;  3LVU A;  2ZYN A;  2GRV A;  1MXX A;  1LAH E;  1S50 A;  4UA8 A;  3EHT A;  4GXS B;  3K2D A;  1SQY A;  2I4B A;  1P1U A;  2PX1 A;  2AL4 A;  3V5A A;  4FEB A;  2NXO A;  1BLF A;  1DPE A;  2V84 A;  3RYA A;  3Q29 A;  4HCW A;  1L5T A;  3MAM A;  3H4Z A;  4G8N A;  1M5D A;  3CSG A;  1N7W A;  3K6V A;  4H8J A;  3F11 A;  3TOD A;  1QKA A;  3O6G A;  1SDX A;  1POY 1;  1OQH A;  2ONR A;  4IY5 A;  1US4 A;  2F97 A;  1USY H;  3PMW A;  2DWA A;  1OVT A;  1ZU0 A;  3WAF A;  2DVZ A;  2HZK A;  1BTJ A;  3FTO A;  4DZ1 A;  2F8D A;  4NF6 B;  2RC7 A;  2O51 A;  1A7L A;  3C31 A;  3PPO A;  1I6A A;  2GHB A;  4ZDM A;  4PFU A;  4U4X A;  2DWI A;  4RXL A;  4PFY A;  2VD3 A;  3FAT A;  3Q25 A;  4R9G A;  1VR5 A;  4PFW A;  2HAU A;  4QF9 A;  3C34 A;  5IAI A;  3TPA A;  2XXT A;  2ZXT A;  3FVN A;  4X9T A;  3G3G A;  3PV0 E;  3PU5 A;  3U72 A;  1MQJ A;  1POT A;  3VLW A;  1AMF A;  1CB6 A;  5CM6 A;  1ZIU A;  4R6H A;  2DXY A;  3IOU A;  4RPN A;  3UN6 A;  4QSC A;  1XHY A;  1BIY A;  5I2N A;  1MY3 A;  2B3B A;  4QFN A;  2Y7R A;  4GRK A;  4P11 A;  3H03 A;  5DVI A;  3KSX A;  3N26 A;  3HHF A;  1YCJ A;  4F22 A;  4OER A;  2HAV A;  5I56 B;  5B70 A;  4QFP A;  3C9H A;  3T9V A;  2H99 A;  5CC2 A;  3CSB A;  2Y84 A;  4TOZ A;  4GWO A;  4NF4 A;  2DSF A;  2P0S A;  1PB7 A;  3KG2 A;  1P1N A;  1UIV A;  5I2K A;  1B4H A;  2NOO A;  3K4U A;  1PEB A;  1FCK A;  3TZA A;  1JW1 A;  2QL3 A;  3DRF A;  3EF7 A;  4KPT A;  5I59 A;  4U22 A;  1P1Q A;  3QYT A;  3VLU A;  3KJT A;  3W9W A;  2DP8 A;  5KDT A;  3K02 A;  5TU0 A;  4H67 A;  4F3G A;  3RT6 B;  1IIT A;  1MDP 1;  2DS9 A;  1H45 A;  4QFK A;  1US5 A;  4ELR A;  1DOT A;  3TEP A;  3H06 B;  3FGS A;  3DP6 A;  1B5H A;  4MLV A;  1M5B A;  2F36 A;  2NVU B;  1J1N A;  3N5L A;  4GL8 A;  2RKM A;  3B6T A;  3E13 X;  1B7H A;  2YJP A;  5A5X A;  4WEP A;  4R72 A;  4O3C A;  1B4Z A;  5K2X A;  3S4U A;  1O64 A;  1TFD A;  3KN3 A;  1LST A;  2O1L A;  4H8I A;  3LSX A;  2H25 A;  5FHO A;  1OLC A;  4DLD A;  3T66 A;  2PYY A;  3JV9 A;  1YPN A;  3T96 B;  2Q89 A;  3QUF A;  1EZO A;  3FJM A;  3BKI B;  4PET A;  4GD5 A;  4N6P A;  3OSQ A;  4DXC A;  1DMB A;  2RC8 A;  1IQ7 A;  2PVU A;  2XXU A;  3MP8 A;  4NE4 A;  3H7M A;  3GZG A;  2DQV A;  3R26 A;  4KYD A;  5ELV A;  5CMK A;  3EHU A;  4ELO A;  3QUJ A;  3EHS A;  2XXV A;  2ABH A;  2F34 A;  2RCA A;  1XVY A;  3PUX E;  1B7U A;  1SI0 A;  4G77 A;  4ZEB A;  5AA3 A;  4NED A;  4XKN A;  1MM6 A;  3UP9 A;  3AXF A;  3DRI A;  3IX1 A;  4C1U A;  3CG3 A;  3G3H A;  5I2N B;  3LR1 A;  3TMG A;  4OMB A;  4BDO A;  2UXA A;  4ONY A;  1MY4 A;  2XX9 A;  2ONK E;  2RIN A;  1B1H A;  4IO3 A;  4F2O A;  4HW8 A;  4TLM B;  3SEU A;  1VFE A;  4F39 A;  2H4I A;  3HO7 A;  4FAJ A;  1MXV A;  1OLA A;  1LBB A;  5CBR A;  4R9F A;  4C0R A;  3SEX A;  4UAC A;  2B4L A;  2ZYO A;  4NF6 A;  1LB9 A;  2I49 A;  3LUY A;  5CRY A;  3JZJ A;  5I59 B;  1Y20 A;  2QSX A;  4I62 A;  3U93 A;  1MQI A;  2REG A;  4OXV A;  4ZEK A;  1JNF A;  4JWY A;  1YAE A;  3S2V A;  3IB1 A;  1TXF A;  2V3T A; 
#chains in the Genus database with same CATH topology
 4RA1 A;  5I3S A;  3ROJ A;  4WKM A;  3OEK A;  1IUD A;  4MEV A;  4OWD A;  5TP9 B;  3FD3 A;  1GVC A;  1NMU A;  4R2B A;  4DE8 A;  5H8F A;  3TQL A;  3E3K A;  2NWJ A;  3E4R A;  2GFE A;  5EYF A;  1VSO A;  3V83 A;  1JEV A;  1SVX B;  4F29 A;  2FNC A;  5FTH A;  4OVS A;  1H76 A;  5HM4 B;  1IIW A;  4F1Y A;  3R7X A;  2OX3 A;  2UVH A;  1JW4 A;  4YB5 A;  5A5X B;  5I56 A;  3H6T A;  2AYS A;  1SW1 A;  1URG A;  1URD A;  3FZV A;  1LBY A;  2O6A A;  3B6Q A;  4FEC A;  2P1S A;  3KC1 A;  4RNS A;  3LC8 A;  5EHS A;  3B8B A;  3E78 A;  4IO7 A;  1Q9D A;  1Y1Z A;  4PBH A;  1MXW A;  4PDD A;  1UTB A;  1LCF A;  4HE0 A;  1MM7 A;  3USD A;  2QS2 A;  3LSL A;  4G68 A;  3IJO B;  3U92 A;  4JVI A;  3ZS6 A;  4N13 A;  5H8S A;  2W7Y A;  4OVT A;  3O29 A;  4GL0 A;  4KHZ E;  3CFX A;  2ZYM A;  1XT8 A;  3IOW A;  1MXU A;  4MLQ A;  2ZYK A;  3T9U A;  4ND9 A;  2A5S A;  2B65 A;  3PPQ A;  1B9J A;  4I1D A;  3HN0 A;  3GBA A;  3DLN A;  4XEQ A;  4PGN A;  1NV4 A;  1MS7 A;  4OTE A;  1QW0 A;  4G8H A;  1NFT A;  3MVX A;  2P2A A;  1ELJ A;  2Z8D A;  2WYK A;  4JDF A;  1NUX A;  4IO4 A;  4JWO A;  2OWS A;  4N4U A;  2KR0 A;  3K1M A;  3TCG A;  4GX3 A;  4NF5 A;  1MY0 A;  1BP5 A;  1JW5 A;  1B1X A;  2OBG A;  3IOR A;  4OHN A;  3IB2 A;  1GGG A;  2VP1 A;  4BLA A;  3FVO A;  1OQG A;  1IEJ A;  4XXU A;  1N3X A;  1LB8 A;  2BJI A;  1FTL A;  3FJG A;  1VFD A;  3VLV A;  1AH5 A;  5HPQ A;  4F3S A;  4N81 A;  1A54 A;  5IZ1 A;  1B3L A;  4F18 A;  1LFI A;  2F5X A;  3MVW A;  4H46 A;  2HCA A;  1GR2 A;  3FAS A;  2PFY A;  4RJZ A;  4ESX A;  2HXW A;  3QAX A;  3SKP A;  2AL5 A;  3W15 C;  3TFL A;  3Q27 A;  2QRY A;  2QMW A;  3CVG A;  2OJT A;  3M8U A;  5I58 B;  2FBP A;  3SEW A;  5DTB A;  3R6U A;  5IZZ A;  2O68 A;  1B0H A;  3G3J A;  3VDF A;  4ELP A;  4OYV A;  4YIC A;  3KOT A;  1FQF A;  4MFI A;  4OZ9 A;  2G93 A;  1A55 A;  4U1Z A;  3HPI A;  4LN5 A;  2Y7W A;  1ATG A;  3U1O A;  1M5E A;  2HHM A;  2GH9 A;  3RN8 A;  3PTY A;  4OVQ A;  2VOZ A;  4GQO A;  5FHN A;  4M1V A;  2XXW A;  1R9L A;  3VVD A;  1D3K A;  1NV2 A;  3K6U A;  1B2H A;  3OEN A;  3HFU A;  3LSW A;  4U2R A;  5H8F B;  2H9B A;  1WVJ A;  3DEL B;  1NNT A;  3EPE A;  4QRZ A;  4KYE A;  4OAN A;  2I0B A;  3FXB A;  4LZ7 A;  3GYY A;  4EF1 A;  4P1E A;  3BIH A;  1AWB A;  4X8R A;  1RYX A;  4GIZ A;  4ZEI A;  3CG1 A;  4LZ8 A;  3W9V A;  3H6U A;  2M8C A;  3A09 A;  5FTI A;  1B5I A;  2Z8E A;  3HV1 A;  4F3P A;  4KXP A;  3FUZ A;  4X04 A;  1R6Z A;  4PFB A;  4KFQ A;  3HST A;  2V3U A;  1FPD A;  1BKA A;  3IOT A;  3FXQ A;  1UTB B;  2WOK A;  2DXR A;  1ZKB A;  4F31 B;  2OLB A;  4G68 B;  2O7I A;  1B0L A;  2QS4 A;  1WDN A;  2DYX A;  1EU8 A;  1NV6 A;  5L9M A;  4IO5 A;  2CMO A;  4DXU A;  3DRK A;  2Q8M A;  5LOM A;  3KGC A;  3D1R A;  2ESN A;  2WBD A;  1A8E A;  4F1V A;  4GF8 A;  1Y1M A;  3CR9 A;  4PFI A;  4JVD A;  3MPK A;  4GX4 A;  4PQJ A;  1QJM A;  2RC9 A;  1URS A;  4YU0 A;  3QXM A;  1IME A;  5TP9 A;  2QS3 A;  3G3K A;  3RTF B;  1MXY A;  2FIE A;  1Q35 A;  2XXX A;  3DRG A;  4R74 A;  3MST A;  2VHA A;  3OSR A;  5DYH A;  4BDQ A;  5H8Q B;  1S9T A;  4NF5 B;  4EDP A;  4MNI A;  1PC3 A;  4TLL B;  2V25 A;  3BFU A;  3C4M A;  2LAO A;  2UVJ A;  5EQ7 A;  4I40 A;  5DW8 A;  3S9L C;  4XKQ A;  3V89 B;  2H98 A;  4IO6 A;  4GBW A;  2GQ1 A;  3CIJ A;  1PBQ A;  4YKI A;  1SI1 A;  3TTM A;  2XXQ A;  3MP6 A;  4BDR A;  4FOR A;  1ZTY A;  5IKB A;  1DPP A;  3ODB A;  2CEX A;  2XWI A;  2Z8F A;  5J1D A;  3HCQ A;  3ZKL A;  3RNN A;  3QIM A;  4AB5 A;  2DDK A;  1Y9U A;  5AE4 A;  1MRP A;  4G8M A;  2ZZX A;  2UYE A;  3FJ7 A;  2DE2 A;  2F7A A;  1T0K A;  4PAF A;  3THI A;  4MNC A;  4RYA A;  4JSO A;  5ITP A;  5LTC A;  1H44 A;  4FED A;  4OVR A;  3IK6 B;  4IB2 A;  3PGF A;  4NF0 A;  5ISU A;  1VE4 A;  1JVX A;  1SYH A;  1LBW A;  3C36 A;  4XTC Q;  5L9S A;  1INP A;  3KEI A;  1FTO A;  3OO8 A;  1IMC A;  5M2V A;  4QFO A;  3B6W A;  2V4C A;  4LA9 A;  2ALU A;  1NV1 A;  2ANJ A;  4RK9 A;  2E0S A;  2O1M A;  4DDD A;  4AS5 A;  2QPQ A;  1MG1 A;  2XX8 A;  1NH8 A;  4RY1 A;  2VPO A;  3DM0 A;  4JBZ A;  4ZEF A;  4Z7E A;  1LBC A;  5DEX A;  1SD3 A;  4X48 A;  2I0C A;  3TCH A;  3M3L A;  4P3L A;  4RK2 A;  3G3I A;  2P3V A;  4MF3 A;  4FJP A;  3IFA A;  3Q26 A;  2PMS A;  3PUW E;  3O6P A;  3VV5 A;  3NOH A;  3TQW A;  1FQA A;  5F24 A;  1FTM A;  2F78 A;  4H5G A;  4AS4 A;  4GFR A;  1P99 A;  2RCB A;  4H1X A;  4Q0C A;  4O7M A;  3G3F A;  4N91 A;  3TAJ A;  2PBW A;  3A3C A;  2PT2 A;  3T9X B;  4P0G A;  3MZ9 A;  3CFZ A;  3B50 A;  3SET A;  5ICQ A;  1SPI A;  3DRJ A;  5AA2 D;  1N3W A;  2O69 A;  5EQ9 A;  1NUY A;  4KYS A;  1N84 A;  3TYH A;  1IMD A;  3LBS A;  2F7B A;  5I58 A;  5DT6 A;  3PAM A;  2B4M A;  4DXB A;  1AL3 A;  1D9Y A;  4YKP A;  1QUI A;  4OFO A;  1XVX A;  1EH3 A;  1MY1 A;  2F3D A;  2QMX A;  3K1P A;  1B5J A;  3PUV E;  2V93 A;  5AA2 A;  1LAG E;  4BDL A;  4XKP A;  5I7I A;  3RTW B;  4O3B A;  4I9D A;  4Q5T A;  3SDF A;  3I3V A;  3CI8 A;  4PFT A;  2IA4 A;  3KSJ A;  1B46 A;  3EN3 A;  4NAP A;  2CZI A;  5CMC A;  4N6D A;  4O7I A;  1NV0 A;  1OVB A;  4G4P A;  5AA4 A;  4F3B A;  4NF8 B;  2QJE A;  3O97 A;  4P47 A;  4WXJ A;  2REJ A;  4EXL A;  4NG7 A;  3VXC A;  3K0V A;  1LFG A;  4EQB A;  4MMP A;  1FJ6 A;  3C35 A;  2OZZ A;  1HSE A;  3MP1 A;  1IXC A;  2XXY A;  4QFL A;  4L17 A;  3ZKK A;  5CI5 A;  3T1B A;  2XWO A;  3PMV A;  4M4G A;  4PF6 A;  4HS7 A;  3S9M C;  3MWB A;  2YPN A;  1LGB C;  3JYR A;  4NTL A;  1MPC A;  4N8G A;  4ZE9 A;  3KBZ A;  2DE3 A;  3MBP A;  5JEI A;  4ZZA A;  2XHD A;  1NV7 A;  1RDY A;  2WKY A;  1B32 A;  2PFZ A;  2A5T B;  2XXH A;  1HSL A;  2P3N A;  2HZL A;  5H8N A;  2NUV A;  2ZNU A;  3SEY A;  1UTH B;  1TWY A;  2R71 A;  5IZ3 A;  3OO9 A;  1ANF A;  2QVR A;  2FVZ A;  1K9Z A;  4XF5 A;  1B58 A;  1FPE A;  4LVQ A;  1Z7M E;  3K00 A;  3K1N A;  1B52 A;  3OEL A;  1SYI A;  5I5P A;  1FTJ A;  3L6G A;  3K6X A;  3DP8 A;  1FPG A;  3PMX A;  3FBP A;  1SW2 A;  3RPW A;  4MCO A;  3IL1 B;  4MX6 A;  1CE2 A;  3RLF E;  3TDJ A;  3T9H B;  3SER A;  4LP2 B;  1QUL A;  5L8D A;  4OEV A;  2H5Y A;  1PB9 A;  2Y7I A;  4R75 A;  3V8X B;  1A99 A;  2Q88 A;  5DEX B;  4IO2 A;  3VVF A;  4LAT A;  4DI4 B;  3ILT B;  2I3V A;  3IO6 A;  4LUB A;  5EQ8 A;  5H8Q A;  4F2Q A;  2O84 X;  3LSF B;  2Q8J A;  1DTZ A;  1MQH A;  4WED A;  3TUS A;  5CBS A;  4U23 A;  4N17 A;  5I57 A;  2R9J A;  1IZ1 A;  1FSA A;  3E79 A;  3MZ1 A;  1YXI A;  2O7U A;  4FIM A;  3UK4 A;  2F7C A;  4MNP A;  1FBD A;  2CZL A;  1B3E A;  4GXA A;  1NUZ A;  3SEV A;  2DOJ A;  1JQF A;  4PFR A;  5CMM A;  2DWJ A;  5JTY A;  1O63 A;  1Y3Q A;  2WOP A;  1B6H A;  1NL5 A;  1H43 A;  1DSN A;  3O6H A;  3IO4 A;  3PD8 A;  4R2F A;  3VFJ A;  4RPO A;  3U94 A;  1DBZ A;  3E9X A;  3S9N C;  4H6D A;  1QUK A;  3FV2 A;  4IGR A;  3KOS A;  3UIF A;  1D4N A;  3FVK A;  4YMB A;  3FIR A;  4NWC A;  2HFB A;  4FE8 A;  3TTK A;  1A8F A;  3SZP A;  4P1L A;  3KZG A;  5AA2 B;  3U8Q A;  3VE1 B;  4ZZE A;  1SW5 A;  3BIG A;  2XX7 A;  3KJ7 A;  2BJJ X;  3RT8 A;  1F9B A;  3H3G A;  4EXK A;  1NH7 A;  1OMP A;  1WOD A;  3S9E A;  4GWU A;  2XXK A;  1QUJ A;  4EQ9 A;  3TTL A;  4QSE A;  4U4S A;  3IJX B;  5T3J A;  1PDA A;  2OK2 A;  5TPA A;  4NHB A;  4PP0 A;  5AA4 B;  1FTK A;  4MIJ A;  3OO7 A;  3C33 A;  3P7I A;  4AQ4 A;  2I58 A;  1EYK A;  3PPN A;  3Q28 A;  3C32 A;  2QFL A;  4PF8 A;  3FVG A;  3O9P A;  1I69 A;  2XXP A;  3ZSF A;  3OD7 A;  3HHG A;  4X1D A;  1GTK A;  2F35 A;  4UAB A;  2Z22 A;  4FBP A;  3PUZ E;  3ILU B;  1Z7N E;  3MJN A;  2Z23 A;  4P9K A;  1IXH A;  3IOV A;  4KQP A;  3I5O A;  1YTV A;  5FHM A;  4AB6 A;  3MVY A;  3D4G A;  1USY E;  2XD3 A;  2AIX A;  1NV5 A;  1S7Y A;  2XXI A;  4ECF A;  4OQO A;  3OEM A;  3RYB A;  4YZZ A;  2ZNS A;  1EZ9 A;  5H8N B;  3B7D A;  2F6G A;  1FJ9 A;  4JWX A;  4YMA A;  1FBG A;  1HSJ A;  2F6P A;  5IZ3 B;  5B7D A;  5H8H B;  4GVO A;  4H65 A;  4EF2 A;  2GHA A;  3GLB A;  1TT1 A;  1Q1K A;  3UGW A;  4DI3 D;  3O2A A;  2UVG A;  4HXV A;  4KD5 A;  1B3F A;  1FW0 A;  2XD2 A;  4MBP A;  3QK6 A;  3N6U A;  3CRB A;  5A5L A;  4OEN A;  3ONM A;  1TFA A;  3IAZ A;  1ZJL A;  1I6Q A;  2OWT A;  1B7Z A;  2I6E A;  4GOT A;  3IR1 A;  3H6W A;  1GV8 A;  2THI A;  4NF8 A;  3PD9 A;  4POW A;  3RGY A;  2CZH A;  4PE5 B;  1IMB A;  1MQD A;  3UOR A;  4BDN A;  4BDM A;  1XS5 A;  2V3Q A;  2DWH A;  4I3Y A;  3LV0 A;  1JVY A;  1QVS A;  1AOV A;  4JSD A;  2XWK A;  2HEU A;  4DCY A;  5I57 B;  1LLS A;  3L6H A;  1LBV A;  2FA7 A;  3CHG A;  2WOL A;  3ISP A;  1D9V A;  5JTY B;  5K2Y A;  1N0T A;  2QS1 A;  2WBB A;  2XXR A;  4GX6 A;  4R6K A;  2A5T A;  3G7W A;  2Y7K A;  1LEV A;  1MH3 A;  4XIG Q;  4EQ7 A;  2OWZ A;  4MH5 A;  3KN7 A;  1LBZ A;  4LQ5 A;  1UTH A;  4ZS9 A;  1B51 A;  2HPG A;  3M3F A;  3WAE A;  1H3D A;  1FQB A;  2UYF A;  4NMY A;  5ITO A;  2G29 A;  3O6I A;  4O3A A;  1FQE A;  4KR5 A;  1IMF A;  3MVZ A;  1Y4C A;  4YB7 A;  4QHQ A;  1PB8 A;  1R1N A;  4TQU Q;  5DVF A;  3RPL A;  2RF1 A;  1IMA A;  1DTG A;  4ESW A;  1B05 A;  5J16 A;  4P0I A;  1JEU A;  1LAF E;  4ELQ A;  4OFJ A;  1AIV A;  1N76 A;  2IEE A;  1PBP A;  2DVC A;  5EQA A;  2Y7P A;  1MQG A;  4OEU A;  1Y3P A;  4N6K A;  3K6W A;  3CFL A;  1Y3N A;  5TPA B;  2ZNT A;  3GXA A;  5BUU A;  3MUQ A;  4I3E A;  4ZED A;  4LZ5 A;  1LBX A;  2OCU A;  4QSD A;  1ZMG A;  1Y4T A;  4OFL A;  2PT1 A;  4HTG A;  4O8M A;  4R6Y A;  4ZE8 A;  3VXB A;  3SES A;  4THI A;  3OMB A;  5KCJ A;  3VVE A;  2HQ0 A;  4Q30 B;  4P56 A;  4QXD A;  4HCY A;  3KN8 A;  3IB0 A;  2I48 A;  1MPB A;  4KCC A;  2ZZV A;  4YKJ A;  4G68 C;  2Q2A A;  2KLF A;  3DRH A;  3UA8 A;  3MQ9 A;  3A3U A;  3N94 A;  2X26 A;  1FPF A;  4DCX A;  4YB6 A;  5KZT A;  4E0X A;  5L9O A;  4ISU A;  3FXR A;  1FBC A;  4OES A;  4IGT A;  1IXI A;  4POX A;  3QMF A;  3RY3 A;  3M3K A;  4MJO A;  1RKM A;  1EZP A;  4LON B;  1N04 A;  5IGA A;  3T22 A;  4NF4 B;  3FXU A;  4H5F A;  4HE2 A;  2WX9 A;  1NNF A;  5I2K B;  2X7P A;  4C1T A;  4U21 A;  3ECR A;  3RQT A;  2VGQ A;  1RYO A;  3O28 A;  2Y5L A;  2Q2C A;  4NQ8 A;  5F1Q A;  5AA1 A;  3MW0 A;  3H6V A;  4NWD A;  4OVP A;  4Q8R A;  1II5 A;  2X7Q A;  3T93 B;  4MAG A;  1O7T A;  3BFT A;  3MZB A;  3OOA A;  1JET A;  3TTR A;  1QKB A;  4DIG A;  1SW4 A;  1MPD A;  5HBC A;  1MH4 A;  5KDT B;  1FPB A;  2ONS A;  1NNP A;  5EHM A;  1FBE A;  3EQ1 A;  5IM2 A;  1CNQ A;  4YAH X;  2FHY A;  4E0W A;  1G0H A;  4NGU A;  3DP4 A;  2D3I A;  2D21 A;  5DVJ A;  3FV1 A;  1LAX A;  4XKR A;  1MXZ A;  4H0W A;  5ESY A;  3PUY E;  2Y5K A;  2XA5 A;  4FAT A;  1N7X A;  4JXI A;  1P1O A;  2FYI A;  3D4C A;  3GBB A;  3MPL A;  2I3W A;  1B3H A;  1XC1 A;  1XI6 A;  3RUM A;  1NNK A;  1MY2 A;  1I6B A;  5ICT A;  2YLN A;  1ZBM A;  3TCF A;  4YKK A;  2ZMB A;  4LQ2 A;  1R9Q A;  4KI0 E;  3KBR A;  4PDH A;  5H8H A;  1SBP A;  1LCT A;  1OIB A;  4Z0I A;  4H45 A;  3N6T A;  4OET A;  5I84 A;  3KFM A;  3TEL A;  4F19 A;  3OXN A;  3RPL B;  4F1U A;  4GWX A;  2D5W A;  3O66 A;  3K01 A;  2UVI A;  2ZZW A;  4X1B A;  1XOC A;  1RDX A;  2L5V A;  4P8B A;  4K3F A;  2Q9T A;  2CZK A;  4IY6 A;  1IXG A;  3QSL A;  4GBV A;  2DE4 A;  1P1W A;  3I6V A;  5FBP A;  1UQW A;  1ZLQ A;  2I4C A;  4GWS A;  5ET6 A;  2VD2 A;  1MDQ A;  1LFH A;  1FQC A;  5F7V A;  4EUO A;  5CMB A;  1UIU A;  3PPR A;  4R73 A;  3TKD A;  4PE3 A;  4HE1 A;  1B40 A;  4I8C A;  1M5C A;  1NKX A;  3PPP A;  1JP4 A;  1B3G A;  2R6G E;  5JK4 A;  2E1S A;  2B3F A;  4U1O A;  3OO6 A;  4OVJ A;  4JB7 A;  4G2Z A;  1FQD A;  4ZEC A;  3BBR A;  4N07 A;  5BWJ A;  3MC2 A;  1A40 A;  1M5F A;  4GLI A;  5KCJ B;  3TTN A;  1KWH A;  4KCD A;  3LVU A;  1EYI A;  2ZYN A;  2GRV A;  1MXX A;  1LAH E;  1S50 A;  4UA8 A;  3EHT A;  2HXR A;  3K2D A;  4GXS B;  5EYG A;  1SQY A;  2I4B A;  1P1U A;  4QBA A;  2PX1 A;  2AL4 A;  3V5A A;  4FEB A;  2NXO A;  5LDZ A;  1BLF A;  1DPE A;  2V84 A;  4GWZ A;  3RYA A;  3Q29 A;  4HCW A;  1L5T A;  3MAM A;  3H4Z A;  4G8N A;  1M5D A;  4PCD A;  3CSG A;  2MKZ A;  1N7W A;  3K6V A;  4H8J A;  3F11 A;  1D9Q A;  3MYU A;  3KC0 A;  3TOD A;  1QKA A;  3O6G A;  1SDX A;  1POY 1;  1OQH A;  2ONR A;  4IY5 A;  2CEY A;  1US4 A;  2QVV A;  2F97 A;  1USY H;  3PMW A;  2DWA A;  1OVT A;  1ZU0 A;  3WAF A;  2DVZ A;  2HZK A;  1BTJ A;  3FTO A;  4DZ1 A;  2F8D A;  1VDW A;  4NF6 B;  2RC7 A;  2F3B A;  2O51 A;  1A7L A;  3C31 A;  3PPO A;  1I6A A;  2GHB A;  2JJK A;  1FPK A;  4ZDM A;  4PFU A;  4U4X A;  2DWI A;  4RXL A;  4PFY A;  2VD3 A;  3FAT A;  3Q25 A;  4R9G A;  1VR5 A;  4PFW A;  2HAU A;  4QF9 A;  3C34 A;  5IAI A;  3TPA A;  1FRP A;  2XXT A;  2ZXT A;  3FVN A;  4X9T A;  3G3G A;  3PV0 E;  3PU5 A;  3U72 A;  1MQJ A;  1POT A;  3VLW A;  1AMF A;  1CB6 A;  5CM6 A;  1ZIU A;  4R6H A;  2DXY A;  3IOU A;  4RPN A;  1G0I A;  1KZ8 A;  3UN6 A;  4QSC A;  1XHY A;  1BIY A;  1NI9 A;  5I2N A;  1YYZ A;  4PTK A;  1MY3 A;  2B3B A;  4QFN A;  2Y7R A;  4GRK A;  4P11 A;  3H03 A;  5DVI A;  3KSX A;  2QVU A;  3N26 A;  3HHF A;  1YCJ A;  1FPI A;  3EKI A;  1NUW A;  4F22 A;  1KA0 A;  4OER A;  4MHF A;  2HAV A;  5I56 B;  1FBF A;  5B70 A;  4QFP A;  4PC9 A;  3C9H A;  3T9V A;  2H99 A;  5CC2 A;  3CSB A;  2Y84 A;  4TOZ A;  4GWO A;  4OA4 A;  4NF4 A;  3RYD A;  2DSF A;  2P0S A;  1PB7 A;  1K9Y A;  4PAI A;  3KG2 A;  1P1N A;  1UIV A;  5I2K A;  1B4H A;  2NOO A;  1YZ0 A;  3K4U A;  1PEB A;  1FCK A;  3TZA A;  1JW1 A;  1FBP A;  3A29 A;  2R8T A;  2PCR A;  4XFE A;  2QL3 A;  4GWY A;  1RDZ A;  3DRF A;  3EF7 A;  3LUZ A;  4KPT A;  5I59 A;  4U22 A;  1P1Q A;  3QYT A;  3VLU A;  3KJT A;  3W9W A;  2DP8 A;  5KDT A;  2VPN A;  3K02 A;  5TU0 A;  4H67 A;  4F3G A;  3RT6 B;  4N8Y A;  1IIT A;  1MDP 1;  2DS9 A;  5ET7 A;  1H45 A;  2KQZ A;  4QFK A;  2WEF A;  1US5 A;  1NV3 A;  4G61 A;  4ELR A;  1DOT A;  3TEP A;  2XWV A;  3H06 B;  3FGS A;  3DP6 A;  1FPL A;  1B5H A;  4MLV A;  1M5B A;  2F36 A;  2NVU B;  1J1N A;  3N5L A;  4GL8 A;  2RKM A;  3B6T A;  3E13 X;  1B7H A;  2YJP A;  1FBH A;  5A5X A;  4WEP A;  4R72 A;  4O3C A;  1B4Z A;  5K2X A;  3S4U A;  1O64 A;  1TFD A;  3KN3 A;  1LST A;  2O1L A;  4PAK A;  4H8I A;  2VT5 A;  1KA1 A;  3LSX A;  2H25 A;  5FHO A;  1OLC A;  4DLD A;  1FPJ A;  3T66 A;  1BK4 A;  2PYY A;  3JV9 A;  1YPN A;  3T96 B;  2Q89 A;  3QUF A;  4JVC A;  1EZO A;  3FJM A;  3BKI B;  4PET A;  4GD5 A;  4N6P A;  3OSQ A;  4DXC A;  1DMB A;  2WYP A;  2RC8 A;  1IQ7 A;  2PVU A;  2XXU A;  3MP8 A;  4NE4 A;  3H7M A;  1QGX A;  3GZG A;  2DQV A;  3R26 A;  4KYD A;  5ELV A;  5CMK A;  3EHU A;  4ELO A;  3QUJ A;  4GWW A;  3EHS A;  5ET5 A;  1DK4 A;  2XXV A;  2ABH A;  2F34 A;  2RCA A;  1XVY A;  3PUX E;  4O94 A;  1B7U A;  1SI0 A;  4G77 A;  4ZEB A;  5EYH A;  5AA3 A;  4NED A;  4XKN A;  1MM6 A;  3UP9 A;  4NN3 A;  3AXF A;  3DRI A;  3IX1 A;  4C1U A;  3CG3 A;  3G3H A;  5I2N B;  3LR1 A;  3TMG A;  4OMB A;  4BDO A;  2UXA A;  4ONY A;  4NX1 A;  1MY4 A;  2XX9 A;  2ONK E;  2RIN A;  1B1H A;  4IO3 A;  4IR8 A;  4F2O A;  4HW8 A;  4TLM B;  3T0J A;  3SEU A;  1VFE A;  4F39 A;  2H4I A;  3HO7 A;  1DCU A;  4FAJ A;  1MXV A;  4PGP A;  1OLA A;  1LBB A;  5CBR A;  2Q74 A;  4R9F A;  4C0R A;  4PBQ A;  3SEX A;  4UAC A;  2B4L A;  2ZYO A;  4NF6 A;  1LB9 A;  4N15 A;  2I49 A;  3LUY A;  5CRY A;  1FTA A;  3JZJ A;  5I59 B;  1Y20 A;  2QSX A;  4I62 A;  3U93 A;  1MQI A;  2FIX A;  2REG A;  5ET8 A;  4OXV A;  4ZEK A;  1EYJ A;  1JNF A;  3IFC A;  4JWY A;  1YAE A;  3U65 A;  3S2V A;  3IB1 A;  1TXF A;  2V3T A; 
#chains in the Genus database with same CATH homology
 4RA1 A;  4WKM A;  3OEK A;  1IUD A;  4OWD A;  5TP9 B;  3FD3 A;  1GVC A;  1NMU A;  4R2B A;  4DE8 A;  5H8F A;  3TQL A;  3E3K A;  2NWJ A;  3E4R A;  2GFE A;  5EYF A;  1VSO A;  3V83 A;  1JEV A;  1SVX B;  4F29 A;  2FNC A;  5FTH A;  1H76 A;  5HM4 B;  1IIW A;  4F1Y A;  3R7X A;  2UVH A;  1JW4 A;  4YB5 A;  5A5X B;  5I56 A;  3H6T A;  2AYS A;  1SW1 A;  1URG A;  1URD A;  3FZV A;  2O6A A;  3B6Q A;  4FEC A;  2P1S A;  4RNS A;  3LC8 A;  5EHS A;  4IO7 A;  1Y1Z A;  1MXW A;  1UTB A;  1LCF A;  1MM7 A;  3USD A;  2QS2 A;  3LSL A;  4G68 A;  3IJO B;  3U92 A;  4N13 A;  3ZS6 A;  5H8S A;  2W7Y A;  3O29 A;  4GL0 A;  4KHZ E;  3CFX A;  2ZYM A;  1XT8 A;  3IOW A;  1MXU A;  4MLQ A;  2ZYK A;  3T9U A;  4ND9 A;  2A5S A;  2B65 A;  3PPQ A;  1B9J A;  4I1D A;  3HN0 A;  3GBA A;  3DLN A;  1MS7 A;  4OTE A;  1QW0 A;  4G8H A;  1NFT A;  3MVX A;  2P2A A;  1ELJ A;  2Z8D A;  4JDF A;  4IO4 A;  4JWO A;  2OWS A;  3K1M A;  3TCG A;  4NF5 A;  1MY0 A;  1BP5 A;  1JW5 A;  1B1X A;  2OBG A;  3IOR A;  4OHN A;  3IB2 A;  1GGG A;  2VP1 A;  4BLA A;  3FVO A;  1OQG A;  1IEJ A;  4XXU A;  1N3X A;  1LB8 A;  1FTL A;  3FJG A;  1VFD A;  3VLV A;  1AH5 A;  5HPQ A;  4F3S A;  1A54 A;  1B3L A;  4F18 A;  1LFI A;  2F5X A;  3MVW A;  2HCA A;  1GR2 A;  3FAS A;  4ESX A;  4RJZ A;  2HXW A;  3QAX A;  3SKP A;  2AL5 A;  3W15 C;  3TFL A;  3Q27 A;  2QRY A;  2QMW A;  3CVG A;  2OJT A;  3M8U A;  5I58 B;  3SEW A;  5DTB A;  3R6U A;  2O68 A;  1B0H A;  3G3J A;  3VDF A;  4ELP A;  4OYV A;  4YIC A;  3KOT A;  1FQF A;  4MFI A;  4OZ9 A;  2G93 A;  1A55 A;  4U1Z A;  3HPI A;  2Y7W A;  1ATG A;  3U1O A;  1M5E A;  2GH9 A;  3RN8 A;  2VOZ A;  4GQO A;  5FHN A;  4M1V A;  2XXW A;  1R9L A;  3VVD A;  1D3K A;  3K6U A;  1B2H A;  3OEN A;  3LSW A;  4U2R A;  5H8F B;  2H9B A;  1WVJ A;  3DEL B;  1NNT A;  3EPE A;  4QRZ A;  4KYE A;  2I0B A;  4LZ7 A;  4EF1 A;  1RYX A;  4GIZ A;  4ZEI A;  3CG1 A;  4LZ8 A;  3W9V A;  3H6U A;  2M8C A;  3A09 A;  5FTI A;  1B5I A;  2Z8E A;  3HV1 A;  4F3P A;  3FUZ A;  1R6Z A;  4KFQ A;  3HST A;  2V3U A;  1BKA A;  3IOT A;  3FXQ A;  1UTB B;  2WOK A;  2DXR A;  1ZKB A;  4F31 B;  2OLB A;  4G68 B;  2O7I A;  1B0L A;  2QS4 A;  1WDN A;  2DYX A;  1EU8 A;  5L9M A;  4IO5 A;  2CMO A;  4DXU A;  3DRK A;  5LOM A;  3KGC A;  2ESN A;  1A8E A;  4F1V A;  4GF8 A;  1Y1M A;  3CR9 A;  3MPK A;  4PQJ A;  1QJM A;  2RC9 A;  1URS A;  4YU0 A;  3QXM A;  5TP9 A;  2QS3 A;  3G3K A;  3RTF B;  1MXY A;  1Q35 A;  2XXX A;  3DRG A;  4R74 A;  2VHA A;  3OSR A;  5DYH A;  4BDQ A;  5H8Q B;  1S9T A;  4NF5 B;  4EDP A;  1PC3 A;  4TLL B;  2V25 A;  3BFU A;  3C4M A;  2LAO A;  2UVJ A;  3S9L C;  4XKQ A;  3V89 B;  2H98 A;  4IO6 A;  3CIJ A;  1PBQ A;  4YKI A;  1SI1 A;  3TTM A;  2XXQ A;  3MP6 A;  4BDR A;  4FOR A;  1ZTY A;  5IKB A;  1DPP A;  3ODB A;  2Z8F A;  5J1D A;  3HCQ A;  3ZKL A;  3RNN A;  3QIM A;  4AB5 A;  1Y9U A;  5AE4 A;  1MRP A;  4G8M A;  2UYE A;  3FJ7 A;  2DE2 A;  2F7A A;  1T0K A;  3THI A;  4RYA A;  4JSO A;  5ITP A;  1H44 A;  4FED A;  3IK6 B;  4IB2 A;  3PGF A;  5ISU A;  1VE4 A;  1JVX A;  1SYH A;  3C36 A;  4XTC Q;  5L9S A;  3KEI A;  1FTO A;  3OO8 A;  5M2V A;  4QFO A;  3B6W A;  4LA9 A;  2ALU A;  2ANJ A;  4RK9 A;  2E0S A;  2O1M A;  4DDD A;  2QPQ A;  1MG1 A;  2XX8 A;  1NH8 A;  4RY1 A;  3DM0 A;  4JBZ A;  4ZEF A;  4Z7E A;  1LBC A;  5DEX A;  1SD3 A;  4X48 A;  2I0C A;  3TCH A;  3M3L A;  4RK2 A;  3G3I A;  4MF3 A;  4FJP A;  3Q26 A;  2PMS A;  3PUW E;  3O6P A;  3VV5 A;  3TQW A;  1FQA A;  1FTM A;  2F78 A;  4H5G A;  4GFR A;  1P99 A;  2RCB A;  4H1X A;  4Q0C A;  3G3F A;  3TAJ A;  2PBW A;  3A3C A;  2PT2 A;  3T9X B;  4P0G A;  3MZ9 A;  3CFZ A;  3SET A;  5ICQ A;  3DRJ A;  5AA2 D;  1N3W A;  2O69 A;  4KYS A;  1N84 A;  3TYH A;  3LBS A;  2F7B A;  5I58 A;  5DT6 A;  3PAM A;  2B4M A;  4DXB A;  1AL3 A;  1D9Y A;  4YKP A;  1QUI A;  4OFO A;  1XVX A;  1EH3 A;  1MY1 A;  2QMX A;  3K1P A;  1B5J A;  3PUV E;  2V93 A;  5AA2 A;  1LAG E;  4BDL A;  4XKP A;  3RTW B;  4O3B A;  4I9D A;  4Q5T A;  3SDF A;  3I3V A;  3CI8 A;  4PFT A;  2IA4 A;  3KSJ A;  1B46 A;  3EN3 A;  5CMC A;  1OVB A;  4G4P A;  5AA4 A;  4F3B A;  4NF8 B;  2QJE A;  3O97 A;  4WXJ A;  2REJ A;  4EXL A;  3VXC A;  3K0V A;  1LFG A;  4EQB A;  3C35 A;  2OZZ A;  1HSE A;  3MP1 A;  1IXC A;  2XXY A;  4QFL A;  4L17 A;  3ZKK A;  5CI5 A;  4M4G A;  3PMV A;  4HS7 A;  3S9M C;  3MWB A;  2YPN A;  1LGB C;  3JYR A;  4NTL A;  1MPC A;  4ZE9 A;  3MBP A;  2DE3 A;  5JEI A;  4ZZA A;  2XHD A;  2WKY A;  1B32 A;  2A5T B;  2XXH A;  1HSL A;  2HZL A;  5H8N A;  2NUV A;  2ZNU A;  3SEY A;  1UTH B;  1TWY A;  2R71 A;  3OO9 A;  1ANF A;  1B58 A;  4LVQ A;  1Z7M E;  3K00 A;  3K1N A;  1B52 A;  3OEL A;  1SYI A;  1FTJ A;  3L6G A;  3K6X A;  3DP8 A;  3PMX A;  1SW2 A;  3RPW A;  3IL1 B;  1CE2 A;  3RLF E;  3TDJ A;  3T9H B;  3SER A;  4LP2 B;  1QUL A;  5L8D A;  4OEV A;  2H5Y A;  1PB9 A;  2Y7I A;  4R75 A;  3V8X B;  1A99 A;  2Q88 A;  5DEX B;  4IO2 A;  3VVF A;  4LAT A;  3ILT B;  2I3V A;  3IO6 A;  4LUB A;  5H8Q A;  4F2Q A;  2O84 X;  3LSF B;  2Q8J A;  1DTZ A;  1MQH A;  4WED A;  3TUS A;  5CBS A;  4U23 A;  5I57 A;  2R9J A;  1IZ1 A;  3MZ1 A;  2O7U A;  4FIM A;  3UK4 A;  2F7C A;  2CZL A;  1B3E A;  4GXA A;  3SEV A;  2DOJ A;  1JQF A;  5CMM A;  2DWJ A;  5JTY A;  1O63 A;  1Y3Q A;  2WOP A;  1B6H A;  1NL5 A;  1H43 A;  1DSN A;  3O6H A;  3IO4 A;  3PD8 A;  4R2F A;  3VFJ A;  4RPO A;  3U94 A;  3E9X A;  3S9N C;  4H6D A;  1QUK A;  3FV2 A;  4IGR A;  3KOS A;  3UIF A;  1D4N A;  3FVK A;  4YMB A;  3FIR A;  4NWC A;  2HFB A;  4FE8 A;  3TTK A;  1A8F A;  3KZG A;  5AA2 B;  3U8Q A;  3VE1 B;  4ZZE A;  1SW5 A;  2XX7 A;  3KJ7 A;  2BJJ X;  3RT8 A;  1F9B A;  3H3G A;  4EXK A;  1NH7 A;  1OMP A;  1WOD A;  3S9E A;  1QUJ A;  4EQ9 A;  3TTL A;  4QSE A;  4U4S A;  3IJX B;  1PDA A;  2OK2 A;  5TPA A;  4PP0 A;  5AA4 B;  1FTK A;  3OO7 A;  3C33 A;  3P7I A;  4AQ4 A;  2I58 A;  3PPN A;  3Q28 A;  3C32 A;  3FVG A;  3O9P A;  1I69 A;  2XXP A;  3ZSF A;  3OD7 A;  3HHG A;  4X1D A;  1GTK A;  2F35 A;  2Z22 A;  3PUZ E;  3ILU B;  1Z7N E;  3MJN A;  2Z23 A;  1IXH A;  3IOV A;  4KQP A;  3I5O A;  1YTV A;  5FHM A;  4AB6 A;  3MVY A;  3D4G A;  1USY E;  2XD3 A;  2AIX A;  1S7Y A;  2XXI A;  4ECF A;  4OQO A;  3OEM A;  3RYB A;  4YZZ A;  2ZNS A;  1EZ9 A;  5H8N B;  3B7D A;  2F6G A;  4JWX A;  4YMA A;  1HSJ A;  2F6P A;  5B7D A;  5H8H B;  4GVO A;  4H65 A;  4EF2 A;  2GHA A;  3GLB A;  1TT1 A;  1Q1K A;  3UGW A;  3O2A A;  2UVG A;  4KD5 A;  1B3F A;  1FW0 A;  2XD2 A;  4MBP A;  3QK6 A;  3N6U A;  3CRB A;  4OEN A;  3ONM A;  1TFA A;  3IAZ A;  1ZJL A;  1I6Q A;  2OWT A;  1B7Z A;  2I6E A;  4GOT A;  3IR1 A;  3H6W A;  1GV8 A;  2THI A;  4NF8 A;  3PD9 A;  4POW A;  3RGY A;  4PE5 B;  1MQD A;  3UOR A;  4BDN A;  4BDM A;  1XS5 A;  2V3Q A;  2DWH A;  1JVY A;  1QVS A;  1AOV A;  4JSD A;  2HEU A;  4DCY A;  5I57 B;  1LLS A;  3L6H A;  2FA7 A;  3CHG A;  2WOL A;  1D9V A;  5JTY B;  5K2Y A;  1N0T A;  2QS1 A;  2XXR A;  4R6K A;  2A5T A;  3G7W A;  2Y7K A;  1MH3 A;  4XIG Q;  4EQ7 A;  4MH5 A;  3KN7 A;  4LQ5 A;  1UTH A;  4ZS9 A;  1B51 A;  3M3F A;  3WAE A;  1H3D A;  1FQB A;  2UYF A;  4NMY A;  5ITO A;  2G29 A;  3O6I A;  4O3A A;  1FQE A;  4KR5 A;  3MVZ A;  1Y4C A;  4YB7 A;  4QHQ A;  1PB8 A;  1R1N A;  4TQU Q;  5DVF A;  2RF1 A;  1DTG A;  4ESW A;  1B05 A;  4P0I A;  1JEU A;  1LAF E;  4ELQ A;  4OFJ A;  1AIV A;  1N76 A;  2IEE A;  1PBP A;  2DVC A;  2Y7P A;  1MQG A;  4OEU A;  1Y3P A;  3K6W A;  3CFL A;  1Y3N A;  5TPA B;  2ZNT A;  3GXA A;  5BUU A;  3MUQ A;  4ZED A;  4LZ5 A;  2OCU A;  4QSD A;  1ZMG A;  1Y4T A;  4OFL A;  2PT1 A;  4HTG A;  4R6Y A;  4ZE8 A;  3VXB A;  3SES A;  4THI A;  3OMB A;  5KCJ A;  3VVE A;  2HQ0 A;  4Q30 B;  4HCY A;  3KN8 A;  3IB0 A;  2I48 A;  1MPB A;  4KCC A;  4YKJ A;  4G68 C;  2Q2A A;  2KLF A;  3DRH A;  3UA8 A;  3MQ9 A;  3A3U A;  3N94 A;  2X26 A;  4DCX A;  4YB6 A;  5KZT A;  4E0X A;  5L9O A;  4ISU A;  3FXR A;  4OES A;  4IGT A;  1IXI A;  4POX A;  3RY3 A;  3M3K A;  1RKM A;  1EZP A;  4LON B;  1N04 A;  3T22 A;  4NF4 B;  3FXU A;  4H5F A;  1NNF A;  5I2K B;  2X7P A;  4C1T A;  4U21 A;  3ECR A;  3RQT A;  2VGQ A;  1RYO A;  3O28 A;  2Q2C A;  5F1Q A;  5AA1 A;  3MW0 A;  3H6V A;  4NWD A;  4Q8R A;  1II5 A;  2X7Q A;  3T93 B;  1O7T A;  3BFT A;  3MZB A;  3OOA A;  1JET A;  3TTR A;  1QKB A;  4DIG A;  1SW4 A;  1MPD A;  5HBC A;  1MH4 A;  5KDT B;  2ONS A;  1NNP A;  5EHM A;  3EQ1 A;  4YAH X;  4E0W A;  3DP4 A;  2D3I A;  2D21 A;  5DVJ A;  3FV1 A;  1LAX A;  4XKR A;  1MXZ A;  4H0W A;  3PUY E;  4FAT A;  1N7X A;  4JXI A;  1P1O A;  2FYI A;  3D4C A;  3GBB A;  3MPL A;  2I3W A;  1B3H A;  1XC1 A;  3RUM A;  1NNK A;  1MY2 A;  1I6B A;  5ICT A;  2YLN A;  1ZBM A;  3TCF A;  4YKK A;  2ZMB A;  4LQ2 A;  1R9Q A;  4KI0 E;  3KBR A;  5H8H A;  1SBP A;  1LCT A;  1OIB A;  4Z0I A;  3N6T A;  4OET A;  5I84 A;  3KFM A;  3TEL A;  4F19 A;  3OXN A;  4F1U A;  2D5W A;  3O66 A;  3K01 A;  2UVI A;  4X1B A;  1XOC A;  4K3F A;  2Q9T A;  4IY6 A;  1IXG A;  3QSL A;  2DE4 A;  1P1W A;  3I6V A;  1UQW A;  1ZLQ A;  2I4C A;  2VD2 A;  1MDQ A;  1LFH A;  1FQC A;  5F7V A;  4EUO A;  5CMB A;  1UIU A;  3PPR A;  4R73 A;  3TKD A;  1B40 A;  4I8C A;  1M5C A;  1NKX A;  3PPP A;  1B3G A;  2R6G E;  5JK4 A;  2E1S A;  2B3F A;  4U1O A;  3OO6 A;  4OVJ A;  4JB7 A;  4G2Z A;  1FQD A;  4ZEC A;  3BBR A;  4N07 A;  5BWJ A;  3MC2 A;  1A40 A;  1M5F A;  4GLI A;  5KCJ B;  3TTN A;  1KWH A;  4KCD A;  3LVU A;  2ZYN A;  2GRV A;  1MXX A;  1LAH E;  1S50 A;  4UA8 A;  3EHT A;  4GXS B;  3K2D A;  1SQY A;  2I4B A;  1P1U A;  2PX1 A;  2AL4 A;  3V5A A;  4FEB A;  2NXO A;  1BLF A;  1DPE A;  2V84 A;  3RYA A;  3Q29 A;  4HCW A;  1L5T A;  3MAM A;  3H4Z A;  4G8N A;  1M5D A;  3CSG A;  1N7W A;  3K6V A;  4H8J A;  3F11 A;  3TOD A;  1QKA A;  3O6G A;  1SDX A;  1POY 1;  1OQH A;  2ONR A;  4IY5 A;  1US4 A;  2F97 A;  1USY H;  3PMW A;  2DWA A;  1OVT A;  1ZU0 A;  3WAF A;  2DVZ A;  2HZK A;  1BTJ A;  3FTO A;  4DZ1 A;  2F8D A;  4NF6 B;  2RC7 A;  2O51 A;  1A7L A;  3C31 A;  3PPO A;  1I6A A;  2GHB A;  4ZDM A;  4PFU A;  4U4X A;  2DWI A;  4RXL A;  4PFY A;  2VD3 A;  3FAT A;  3Q25 A;  4R9G A;  1VR5 A;  4PFW A;  2HAU A;  4QF9 A;  3C34 A;  5IAI A;  3TPA A;  2XXT A;  2ZXT A;  3FVN A;  4X9T A;  3G3G A;  3PV0 E;  3PU5 A;  3U72 A;  1MQJ A;  1POT A;  3VLW A;  1AMF A;  1CB6 A;  5CM6 A;  1ZIU A;  4R6H A;  2DXY A;  3IOU A;  4RPN A;  3UN6 A;  4QSC A;  1XHY A;  1BIY A;  5I2N A;  1MY3 A;  2B3B A;  4QFN A;  2Y7R A;  4GRK A;  4P11 A;  3H03 A;  5DVI A;  3KSX A;  3N26 A;  3HHF A;  1YCJ A;  4F22 A;  4OER A;  2HAV A;  5I56 B;  5B70 A;  4QFP A;  3C9H A;  3T9V A;  2H99 A;  5CC2 A;  3CSB A;  2Y84 A;  4TOZ A;  4GWO A;  4NF4 A;  2DSF A;  2P0S A;  1PB7 A;  3KG2 A;  1P1N A;  1UIV A;  5I2K A;  1B4H A;  2NOO A;  3K4U A;  1PEB A;  1FCK A;  3TZA A;  1JW1 A;  2QL3 A;  3DRF A;  3EF7 A;  4KPT A;  5I59 A;  4U22 A;  1P1Q A;  3QYT A;  3VLU A;  3KJT A;  3W9W A;  2DP8 A;  5KDT A;  3K02 A;  5TU0 A;  4H67 A;  4F3G A;  3RT6 B;  1IIT A;  1MDP 1;  2DS9 A;  1H45 A;  4QFK A;  1US5 A;  4ELR A;  1DOT A;  3TEP A;  3H06 B;  3FGS A;  3DP6 A;  1B5H A;  4MLV A;  1M5B A;  2F36 A;  2NVU B;  1J1N A;  3N5L A;  4GL8 A;  2RKM A;  3B6T A;  3E13 X;  1B7H A;  2YJP A;  5A5X A;  4WEP A;  4R72 A;  4O3C A;  1B4Z A;  5K2X A;  3S4U A;  1O64 A;  1TFD A;  3KN3 A;  1LST A;  2O1L A;  4H8I A;  3LSX A;  2H25 A;  5FHO A;  1OLC A;  4DLD A;  3T66 A;  2PYY A;  3JV9 A;  1YPN A;  3T96 B;  2Q89 A;  3QUF A;  1EZO A;  3FJM A;  3BKI B;  4PET A;  4GD5 A;  4N6P A;  3OSQ A;  4DXC A;  1DMB A;  2RC8 A;  1IQ7 A;  2PVU A;  2XXU A;  3MP8 A;  4NE4 A;  3H7M A;  3GZG A;  2DQV A;  3R26 A;  4KYD A;  5ELV A;  5CMK A;  3EHU A;  4ELO A;  3QUJ A;  3EHS A;  2XXV A;  2ABH A;  2F34 A;  2RCA A;  1XVY A;  3PUX E;  1B7U A;  1SI0 A;  4G77 A;  4ZEB A;  5AA3 A;  4NED A;  4XKN A;  1MM6 A;  3UP9 A;  3AXF A;  3DRI A;  3IX1 A;  4C1U A;  3CG3 A;  3G3H A;  5I2N B;  3LR1 A;  3TMG A;  4OMB A;  4BDO A;  2UXA A;  4ONY A;  1MY4 A;  2XX9 A;  2ONK E;  2RIN A;  1B1H A;  4IO3 A;  4F2O A;  4HW8 A;  4TLM B;  3SEU A;  1VFE A;  4F39 A;  2H4I A;  3HO7 A;  4FAJ A;  1MXV A;  1OLA A;  1LBB A;  5CBR A;  4R9F A;  4C0R A;  3SEX A;  4UAC A;  2B4L A;  2ZYO A;  4NF6 A;  1LB9 A;  2I49 A;  3LUY A;  5CRY A;  3JZJ A;  5I59 B;  1Y20 A;  2QSX A;  4I62 A;  3U93 A;  1MQI A;  2REG A;  4OXV A;  4ZEK A;  1JNF A;  4JWY A;  1YAE A;  3S2V A;  3IB1 A;  1TXF A;  2V3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...