3TCGA

Crystal structure of e. coli oppa complexed with the tripeptide kge
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
517
structure length
517
Chain Sequence
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Escherichia coli peptide binding protein OppA has a preference for positively charged peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords Periplasmic oligopeptide-binding protein
total genus 176
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3tcgA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tcgA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3tcgA02
3OSQA 2D21A 5H8FB 4QFLA 3Q28A 5ICQA 4U22A 2DWHA 4HTGA 5TP9A 4AB6A 4OFJA 4K3FA 1B40A 1XOCA 2XXQA 1B7UA 1B52A 4QFKA 3W9VA 4H0WA 3E3KA 1FQEA 1LFGA 4E0XA 1Q35A 1JW1A 5HBCA 5IKBA 1IXCA 2Y7PA 5ISUA 4GD5A 4NE4A 2QJEA 4OZ9A 2WKYA 2WOPA 2ONKE 4FIMA 4KQPA 1IXIA 3O29A 5A5XB 1JEUA 3PUYE 4F31B 1SDXA 2O69A 3KOTA 3MVYA 2V25A 4OETA 3MPKA 4YZZA 3T9UA 2DXYA 1A54A 3CFXA 1O64A 3JZJA 1WDNA 4MH5A 3VVEA 4EQBA 4RA1A 3IO6A 3PMVA 4R6YA 1SYIA 3OO9A 5I58B 4O3CA 1FQCA 4QSDA 2I49A 3UK4A 1DMBA 4F3PA 2RC8A 3ZKLA 4GXAA 3S9EA 2REGA 1QUJA 4DXBA 3G3GA 3K1PA 4H8JA 1VFDA 1Y9UA 4RPOA 4U1OA 5FHMA 1AL3A 4JWOA 4QF9A 4KCDA 5H8HA 4PQJA 3IK6B 4THIA 1MY2A 1XC1A 3I3VA 2ABHA 4R2FA 2H98A 1Y20A 2HAVA 3RLFE 3TPAA 3B6QA 4QFPA 4RNSA 3K6WA 4BDNA 4EUOA 3K01A 4IGTA 3DELB 1GV8A 1HSLA 2X7PA 2F7CA 2O6AA 2A5TB 4LQ2A 3CHGA 1JEVA 3FUZA 3K02A 4EF2A 4PETA 3KFMA 3CSGA 5DVIA 1JW5A 3FVNA 5I58A 4F2QA 4F1YA 1OQGA 1A99A 2Q8JA 1CE2A 1SVXB 1AMFA 1ELJA 2B65A 1LCTA 3JV9A 3HV1A 2UYEA 1RYOA 2D3IA 2B4LA 5JTYB 1BIYA 1B51A 1Y1ZA 1NL5A 2HEUA 2H9BA 2H4IA 3TELA 5I84A 3OXNA 3G3KA 4IB2A 1PEBA 1J1NA 3UP9A 3HSTA 3PD8A 3RTWB 2GHAA 4F3GA 4DE8A 4XKPA 5J1DA 4FJPA 2XXPA 4OXVA 1OLCA 1XHYA 3K6VA 1QJMA 1I69A 3MVZA 1JVYA 2QMXA 3T96B 4KR5A 3EPEA 3C35A 2I6EA 1NNKA 3CFLA 3OD7A 1R1NA 4R2BA 4YAHX 5AA2D 2HFBA 5I56B 1N7WA 5TPAB 3FVOA 2DS9A 2O68A 1I6QA 3C33A 2DVCA 4IY6A 1EU8A 2OJTA 1H44A 3D4CA 3E4RA 5H8NB 2B4MA 2XXTA 3L6HA 5I2KB 2QS2A 2ZMBA 1SW1A 4POWA 3KSJA 3RT6B 1JNFA 3PUWE 4LZ5A 1MXWA 4F1UA 1SD3A 3GLBA 1FCKA 3ECRA 4U4SA 5L9MA 4F39A 4ELOA 3VLWA 5KZTA 1FQBA 3JYRA 4GVOA 4R74A 4HS7A 3SERA 1YCJA 1UTBA 4OYVA 1LLSA 4ZZEA 3CIJA 3KEIA 3RY3A 4H5FA 3Q26A 5FHNA 4H5GA 4NF5A 3DRGA 4OENA 1P99A 3K2DA 3P7IA 3BFTA 3R26A 1H45A 3QYTA 4LUBA 4ZDMA 3S2VA 2RC9A 3O9PA 3LVUA 1FTKA 2LAOA 4ZEIA 1SW2A 3ILTB 3S4UA 4ELQA 1Z7ME 3LBSA 3VV5A 3THIA 3FJGA 2H99A 4Z7EA 4QFOA 5DEXB 3CSBA 4PFYA 1P1NA 2XD2A 3QAXA 2DOJA 3VLVA 4GXSB 4EQ7A 2V3QA 5AA3A 2F35A 2ONRA 1URGA 5CMMA 1MQDA 5I56A 3TTRA 2FA7A 3DRFA 3IOUA 4FE8A 3GXAA 2D5WA 4ONYA 5FHOA 2VP1A 3RNNA 2NXOA 3IJOB 3USDA 3BFUA 1LAXA 4KHZE 4O3AA 1TT1A 4LONB 4GL8A 1B05A 2F6GA 4GL0A 3MWBA 4ZZAA 4FAJA 3E9XA 3IB1A 3U92A 3LC8A 4Z0IA 1MDP1 2DWAA 3LSWA 3SEWA 3K00A 4ELRA 4F22A 1P1OA 1S9TA 2PBWA 4G68A 2B3BA 5K2XA 3A09A 4DCXA 3EQ1A 3LSFB 4X48A 3V8XB 1RKMA 1MY4A 3IOTA 5BUUA 3D4GA 2KLFA 3OENA 3FTOA 3TMGA 3TQWA 1O63A 2F97A 4IO4A 1SYHA 2QMWA 3FVKA 3FZVA 4NTLA 5DT6A 2H5YA 3HHGA 1VE4A 4M4GA 4NF8B 1FTLA 3H6WA 2I4CA 2XD3A 2XXUA 3KSXA 4GWOA 2ZYNA 3O6GA 2XXIA 3C36A 3M3LA 2F34A 3C31A 3S9NC 2QPQA 4ZEKA 3PV0E 3OO7A 4N07A 3KJTA 4G68C 1IXGA 1DPPA 4LQ5A 4DZ1A 1HSEA 1OQHA 2X7QA 3ILUB 3MC2A 3Q29A 1Y3QA 4XIGQ 4YKJA 4F18A 1FQFA 1ZIUA 2NUVA 2Z23A 3TYHA 4YMBA 1IQ7A 4LATA 4RXLA 3H3GA 1B0HA 4ZEFA 4TOZA 1OVBA 3MVXA 4JBZA 1A40A 4MBPA 4YU0A 3TTKA 4BDOA 1M5BA 2QSXA 4NF5B 3DLNA 3O6IA 1BKAA 4DXUA 4ESWA 1MM7A 2GHBA 4G4PA 3F11A 4MF3A 4GIZA 1MPCA 1XVXA 2F5XA 1LB9A 3HHFA 1PC3A 3MPLA 3OEKA 3R6UA 1NFTA 4ISUA 2FYIA 3SETA 5I59B 1URDA 5EHMA 5I57A 2HZKA 3PD9A 3T66A 3TTMA 3GZGA 2REJA 3PUZE 1URSA 3IX1A 1MM6A 4KYSA 4GRKA 1MY0A 3U93A 3WAEA 4H1XA 1MPBA 3FASA 2R71A 1Y1MA 3OEMA 3QK6A 4OEUA 4NMYA 3PMXA 4YKKA 5H8NA 2NVUB 1EZ9A 3R7XA 4QHQA 1B32A 1MXXA 2ZNSA 3K0VA 1PBPA 3CI8A 4H6DA 2ANJA 4OTEA 5IAIA 2E0SA 4M1VA 3MP6A 4WEDA 1B5JA 1B4ZA 5KCJA 1B1HA 1TFAA 4JXIA 4L17A 1KWHA 4OVJA 1M5FA 3DRHA 4XKRA 1B9JA 4XXUA 1UIUA 1B7ZA 4KCCA 1MQIA 4QRZA 4RK2A 1S7YA 1O7TA 3M3FA 3T9XB 4F1VA 4GF8A 1YPNA 3M3KA 5CMCA 3T9HB 5CBSA 2CZLA 5I2NA 4R73A 2RCAA 3TTLA 2OZZA 3N6UA 4NF6A 3MAMA 5H8QB 5KDTA 1H43A 2UVIA 2O7IA 3FD3A 4KI0E 3MZ1A 3G3HA 3OO6A 3OSRA 1L5TA 1NMUA 1Y4CA 4AQ4A 5ITOA 2QRYA 1TWYA 3IB0A 3K1NA 3TFLA 1NH8A 1IXHA 3QSLA 1I6BA 4DDDA 3H7MA 1EZOA 3TZAA 3U8QA 1VSOA 2Y7WA 1GVCA 3OMBA 1DSNA 1P1WA 1US5A 2UXAA 3KOSA 3MP8A 3MVWA 3FXRA 3IOVA 2OLBA 3TTNA 2P2AA 1LAFE 5FTHA 5CMKA 3O6PA 1JVXA 4BLAA 4LZ8A 1XS5A 2Q9TA 2IA4A 3TODA 5HPQA 1B0LA 3EF7A 4G77A 2UVGA 2HZLA 4F2OA 1US4A 2DVZA 2Y7RA 1JQFA 1NNPA 3CRBA 3FJ7A 4GLIA 4YB7A 1OVTA 2Z8FA 4BDMA 2F78A 1MXYA 2F7BA 4FECA 3ONMA 1D4NA 4LP2B 3U72A 1ZJLA 3RQTA 4UACA 2I0CA 4GQOA 3O97A 3KJ7A 4IO5A 4R75A 3TCFA 4OEVA 4ECFA 1AIVA 1D9VA 3H06B 3TKDA 1M5EA 3N6TA 3ODBA 3KBRA 5B70A 5EHSA 4FEDA 1MY3A 5AA4B 1P1QA 4EDPA 1N0TA 5L8DA 4DIGA 2UYFA 3TQLA 4RPNA 4EF1A 4PE5B 2F8DA 3BBRA 1ATGA 1M5CA 4OERA 1RYXA 3MW0A 3UGWA 3VVFA 1MXZA 1NH7A 2HQ0A 2AYSA 1MG1A 1FTJA 5AA4A 2PYYA 3EHTA 3N5LA 4YKPA 3SEYA 2THIA 3B6TA 4ESXA 2QL3A 3K6XA 3S9MC 1IEJA 1D9YA 1IUDA 5F1QA 3B7DA 3IO4A 3MQ9A 2PX1A 1LSTA 2Z8DA 4MLVA 3FGSA 4P0GA 2YJPA 2DYXA 1B3GA 3HCQA 2QS3A 4QFNA 3LUYA 4C1UA 1DOTA 1M5DA 4EQ9A 3O66A 2ZYMA 2F36A 4HCWA 4ZECA 3DP4A 3OELA 5I2NB 5B7DA 3KN8A 4JWXA 2RF1A 4R72A 3TEPA 5F7VA 5JK4A 3VLUA 4JSDA 3CG1A 3HO7A 2HXWA 3HN0A 2R6GE 3G3FA 3OOAA 4U4XA 3PPPA 4R6HA 4U23A 3SEUA 1LFHA 1SI1A 4FEBA 1UTHB 4H8IA 5K2YA 3UORA 4I1DA 3VXCA 4E0WA 5BWJA 3TCGA 1N3XA 4LZ7A 5H8SA 3RYBA 2GH9A 4EXLA 3SKPA 4Q8RA 1QULA 1ZLQA 1Q1KA 1I6AA 4G8MA 2XXYA 3RN8A 4TLMB 2A5SA 3SEXA 1XVYA 4O3BA 4F3SA 4R9GA 5CRYA 3CR9A 1ZTYA 4I9DA 3IB2A 4PFWA 3LR1A 3O2AA 1FQDA 2AIXA 4LA9A 3T22A 2G29A 4MLQA 1YAEA 4HW8A 1LBBA 5I57B 1MQHA 5I59A 3PUVE 5KCJB 5H8QA 2PT1A 3DP8A 2DWIA 1QKAA 1GTKA 2CMOA 2X26A 3C34A 3BKIB 3FIRA 4ZEDA 3FV2A 2XXVA 3E13X 3FXUA 4U21A 2RCBA 4G8HA 4ZE9A 1UQWA 2P1SA 1YTVA 1LB8A 2RC7A 3O28A 1MS7A 2Z8EA 4YB6A 2ONSA 4U2RA 3ZSFA 2ZNTA 4AB5A 1EH3A 5TU0A 3RYAA 2HCAA 4OFLA 1B6HA 2OCUA 1FTMA 3C32A 3PPRA 3PUXE 5A5XA 2PVUA 4N6PA 4X9TA 2XXXA 4ZEBA 4DCYA 5HM4B 1A7LA 1MQJA 4TQUQ 3SESA 4X1BA 4KPTA 4R9FA 2PT2A 4ZS9A 1USYH 2I58A 3IJXB 1ZMGA 3IOWA 3Q27A 3VVDA 5ELVA 4GOTA 2O84X 4POXA 4JDFA 1VFEA 2F7AA 1N3WA 1PDAA 1DPEA 4OESA 4TLLB 2Q2CA 3C9HA 5AA1A 4F3BA 1LCFA 3QUFA 4NF4B 2AL5A 3GBAA 1UTBB 3KN3A 2ZNUA 3L6GA 1UIVA 1F9BA 1TFDA 2RINA 3PMWA 1N76A 2XX7A 3TCHA 5DTBA 5EYFA 2HAUA 4EXKA 3PU5A 5CI5A 1PB7A 4ELPA 4BDRA 4X1DA 1AOVA 4YB5A 1B3LA 1LGBC 1NKXA 2YPNA 4C1TA 3QUJA 4G8NA 4NF8A 1DTGA 3KZGA 1BTJA 3DRJA 5TPAA 2I48A 1QVSA 4FATA 2UVJA 2VD3A 4XKQA 4KD5A 2O7UA 4G2ZA 1FTOA 3UIFA 1OLAA 4YICA 3I5OA 2IEEA 2UVHA 4FORA 3N94A 1JETA 5AA2A 5L9SA 2V3UA 1NNFA 2WOKA 1B1XA 5KDTB 1OMPA 2DE2A 4IO3A 5CMBA 1GGGA 3T93B 4JB7A 2H25A 4YMAA 3TUSA 1USYE 3W9WA 5LOMA 1MY1A 3CVGA 2DE4A 4H67A 4KFQA 2Q2AA 4Q30B 4IO6A 1NNTA 1R9LA 3DRKA 1B3HA 1P1UA 1N84A 3H6TA 4GFRA 3OO8A 2I4BA 3W15C 1DTZA 2DE3A 2YLNA 4NF6B 4NF4A 4DLDA 4F29A 3HPIA 1B5HA 1MDQA 2ALUA 2I3WA 3QIMA 3LSXA 2ZYOA 4F19A 2F6PA 4QSCA 3RGYA 1R6ZA 4RY1A 1B3FA 1POTA 4NWDA 3V89B 5DVFA 5AA2B 4N13A 3I6VA 5CBRA 5ITPA 3EN3A 3O6HA 3SDFA 2P0SA 3MZBA 4OQOA 2BJJX 4RK9A 3RUMA 3B6WA 2VD2A 4PP0A 1MRPA 1QKBA 2Y7IA 4XTCQ 3FJMA 1A8EA 4WXJA 1II5A 1S50A 1TXFA 1HSJA 2VOZA 2W7YA 3EHSA 3GBBA 3G3JA 1XT8A 3K6UA 3LSLA 5DYHA 1SW4A 1A55A 2OWTA 3A3CA 4I8CA 2OK2A 3EHUA 3FATA 1B2HA 3IORA 4ND9A 2DSFA 3TAJA 4C0RA 4P0IA 1JW4A 1WODA 1Y4TA 4U1ZA 2OBGA 2XXWA 2WOLA 4OMBA 3DRIA 4DXCA 1MQGA 3DM0A 4IO7A 1FW0A 2E1SA 3TDJA 2O1LA 1MH3A 2XX8A 2ZXTA 1MXUA 5DVJA 3V5AA 3PAMA 3CG3A 3PPOA 4IO2A 5JTYA 3S9LC 2RKMA 2V93A 3H6UA 2M8CA 3IL1B 4KYDA 4Q0CA 1B46A 1SBPA 4KYEA 2AL4A 1Y3NA 1IZ1A 4XKNA 3ZS6A 2VGQA 3DP6A 3IAZA 5M2VA 3U94A 3VXBA 4BDQA 1H76A 1WVJA 3AXFA 3VDFA 2R9JA 4OWDA 2Z22A 4Q5TA 3VE1B 5FTIA 1B4HA 1OIBA 1PB9A 1ANFA 1BLFA 3N26A 2Y84A 2XX9A 4JWYA 1GR2A 2DP8A 1LBCA 2DWJA 2FNCA 2GFEA 3FXQA 1ZBMA 1MXVA 2GRVA 1Z7NE 2OWSA 5H8HB 3ZKKA 1SI0A 5AE4A 1T0KA 5ICTA 3H6VA 3MBPA 1BP5A 3M8UA 2QS1A 2QS4A 1SQYA 3G7WA 1Y3PA 1QW0A 2Q88A 1QUKA 3CFZA 3H03A 3RT8A 3PGFA 1ZU0A 5CC2A 3FVGA 1CB6A 1MH4A 3QXMA 1POY1 2V3TA 2XXHA 1IIWA 1UTHA 3T9VA 3KG2A 3VFJA 5CM6A 3KGCA 4G68B 3G3IA 2Q89A 4IGRA 2Y7KA 3UN6A 4LVQA 1D3KA 3C4MA 2V84A 1B58A 3MZ9A 2O1MA 3KN7A 2A5TA 5L9OA 4NWCA 1PB8A 3U1OA 2DXRA 4JSOA 3SEVA 3MUQA 4RJZA 3PPQA 2ZYKA 3UA8A 1LFIA 4WEPA 4UA8A 4PFTA 2DQVA 2XHDA 2VHAA 3RTFB 3K4UA 1A8FA 1N04A 4OFOA 1B7HA 1B3EA 3A3UA 3MP1A 1B5IA 4WKMA 5H8FA 1SW5A 2NWJA 2PMSA 5DEXA 3WAFA 1FQAA 3PPNA 1ZKBA 3H4ZA 4H65A 4BDLA 1N7XA 3MJNA 3K1MA 5JEIA 4MFIA 1QUIA 1IITA 1MPDA 2I0BA 4HCYA 3FV1A 4IY5A 2NOOA 4NEDA 3Q25A 1LAHE 2O51A 1VR5A 1H3DA 2ESNA 4OHNA 3IR1A 4P11A 4QSEA 1LAGE 4RYAA 3V83A 4ZE8A 2B3FA 5I2KA 4PFUA 1R9QA 4I62A 1EZPA 2XXRA 1PBQA 5TP9B 4R6KA 2G93A 4YKIA 3RPWA 1AH5A 2I3VA
chains in the Genus database with same CATH superfamily
3OSQA 5H8FB 4HTGA 4K3FA 1XOCA 5IKBA 1IXIA 3O29A 1DBZA 4F31B 1SDXA 2O69A 3KC0A 2DXYA 1A54A 3JZJA 3VVEA 4EQBA 4R6YA 1SYIA 2I49A 2CZKA 1RDZA 1DMBA 4H8JA 3IK6B 4R2FA 3RLFE 3T1BA 3K01A 4IGTA 3DELB 2WEFA 2X7PA 2O6AA 2A5TB 1JEVA 4PETA 1JW5A 1CE2A 1ELJA 3JV9A 4NN3A 4O7IA 1BIYA 1NL5A 5ESYA 3G3KA 1PEBA 3RTWB 2GHAA 4FJPA 2XXPA 3K6VA 1I69A 2QMXA 3EPEA 2HFBA 5I56B 1N7WA 5TPAB 4X04A 2HXRA 2OJTA 3RT6B 4F1UA 1SD3A 4U4SA 5L9MA 4F39A 4XF5A 3VLWA 5KZTA 3JYRA 3Q26A 4H5GA 4NF5A 4DI4B 4MJOA 1FTKA 3O9PA 3LVUA 4MNCA 5DEXB 2XD2A 4EQ7A 2DOJA 4GXSB 4GX3A 5CMMA 5I56A 1NI9A 3TTRA 2FA7A 4FE8A 3GXAA 2HHMA 2NXOA 1LAXA 4O3AA 4LONB 4GL0A 4FAJA 3U92A 1P1OA 4G68A 2B3BA 3EQ1A 1NV7A 5BUUA 3OENA 2BJIA 2F97A 2QMWA 4NTLA 2H5YA 4NF8B 3H6WA 2ZYNA 2QPQA 1DPPA 1Y3QA 4YKJA 4F18A 1ZIUA 1FBEA 1IMDA 3TTKA 4P8BA 2QSXA 3DLNA 1FSAA 1MM7A 1NV2A 4DXCA 1MPCA 2F5XA 3OEKA 1LB9A 4ISUA 1IMCA 5I59B 2FYIA 5EHMA 3PD9A 3GZGA 4NAPA 4GRKA 1MY0A 1MPBA 3OEMA 3PMXA 5H8NA 3R7XA 4H6DA 4WEDA 5KCJA 4JXIA 1TFAA 4OVJA 1M5FA 4NGUA 1UIUA 2WX9A 4KCCA 1MQIA 4QRZA 3M3FA 3T9XB 4GF8A 3T9HB 4AS4A 2RCAA 3N6UA 4NF6A 3OO6A 1Y4CA 2R8TA 3IB0A 3K1NA 3QSLA 3U8QA 1VSOA 3OMBA 1US5A 3MVWA 5IZ3A 1JVXA 4LZ8A 1XS5A 1B0LA 3EF7A 2Y7RA 4BDMA 2Z8FA 3U65A 2F78A 4LP2B 3U72A 3HFUA 4O8MA 4N6DA 4R75A 3TCFA 3TKDA 1M5EA 5B70A 3KBRA 5AA4B 2V4CA 3RPLB 4EDPA 3IFAA 3B8BA 3KC1A 4RPNA 4PE5B 1XI6A 3BBRA 1M5CA 2AYSA 2PYYA 1D9YA 5F1QA 3IO4A 4P0GA 4HCWA 4ZECA 3DP4A 4MIJA 3OELA 3KN8A 4JWXA 4R72A 4JSDA 1LBXA 3HN0A 2R6GE 1LFHA 4FEBA 4N4UA 3UORA 5BWJA 1N3XA 4LZ7A 1ZLQA 1G0HA 1I6AA 1NUZA 3IB2A 2G29A 4HW8A 1LBBA 5I59A 1MQHA 5H8QA 2DWIA 2PFZA 4ZEDA 3E13X 2RCBA 1UQWA 2P1SA 3O28A 4MCOA 3ZSFA 4AB5A 1EH3A 1B6HA 3C32A 2PVUA 4TQUQ 3SESA 4P3LA 4KPTA 2PT2A 3IJXB 4JDFA 4TLLB 5AA1A 1LCFA 4NF4B 1UTBB 3PMWA 1N76A 4EXKA 4PC9A 4ELPA 4G8NA 3KZGA 1BTJA 5F24A 1QVSA 4PDHA 2IEEA 4PTKA 4IO3A 2DE2A 5CMBA 4JB7A 4YMAA 5LOMA 1MY1A 1R9LA 4GFRA 2YLNA 4DLDA 3HPIA 1B5HA 4O94A 3LSXA 4QSCA 4RY1A 4NWDA 4PGPA 1NV4A 2P0SA 3PTYA 3RUMA 4XTCQ 1QKBA 1II5A 3TAJA 3VV5A 2W7YA 2OWTA 4ND9A 1B2HA 2DSFA 1Y4TA 1LBWA 2MKZA 4IO7A 2E1SA 2XX8A 5DVJA 4P9KA 1FPGA 4KYEA 1FTAA 3DP6A 5M2VA 2WBDA 4BDQA 1WVJA 5EQ7A 3VDFA 2R9JA 5FTIA 2DWJA 2DP8A 1LBCA 3FXQA 2GFEA 1MXVA 2GRVA 2QS1A 3M8UA 2VPOA 3H03A 3FVGA 3QXMA 2XXHA 2V3TA 4HE0A 1B58A 3MZ9A 5I5PA 3PPQA 2ZYKA 3UA8A 4UA8A 2DQVA 2XHDA 2FHYA 1A8FA 1N04A 5H8FA 2VPNA 2NWJA 2PMSA 1FQAA 3PPNA 1N7XA 3K1MA 1FBFA 4HCYA 3V83A 1EZPA 2QVUA 2XXRA 4YKIA 4OFLA 3SZPA 4QFLA 3Q28A 4U22A 2DWHA 4OFJA 4MEVA 1B40A 3W9VA 4QFKA 3E3KA 1Q35A 1JW1A 5HBCA 1IXCA 4NE4A 2WKYA 2F3BA 2ONKE 1JEUA 3PUYE 3KOTA 3MVYA 3MPKA 3T9UA 3CFXA 4P1EA 5DW8A 3PMVA 3OO9A 3UK4A 3ZKLA 2REGA 4DXBA 1Y9UA 5FHMA 2P3VA 1FPLA 1AL3A 4JWOA 4QF9A 5H8HA 1MY2A 2ABHA 2HAVA 4EUOA 5IZ3B 3K6WA 3CHGA 3KBZA 3FUZA 4EF2A 1NUXA 3KFMA 3CSGA 3E79A 4F2QA 2Q8JA 1SVXB 1AMFA 1LCTA 3HV1A 4GBVA 3FBPA 4NX1A 1Y1ZA 5I84A 3TELA 1J1NA 3HSTA 4OXVA 1OLCA 3MVZA 4KR5A 2I6EA 1NNKA 4YAHX 5AA2D 3FVOA 5H8NB 5I2KB 1SW1A 4G61A 3PUWE 1MXWA 3GLBA 4ELOA 3SERA 1FQBA 4HS7A 1UTBA 1LLSA 4H5FA 3DRGA 2F3DA 3K2DA 3QYTA 4LUBA 3S4UA 2LAOA 4ZEIA 3LBSA 3FJGA 4Z7EA 4QFOA 1P1NA 3QAXA 2CZHA 2ONRA 3DRFA 4ONYA 2VT5A 3RNNA 3BFUA 2PCRA 3MWBA 4ZZAA 3LSWA 3K00A 2QVVA 4ELRA 4F22A 5K2XA 3A09A 3LSFB 1RKMA 3IOTA 2KLFA 4IO4A 5DT6A 3FVKA 3FZVA 3HHGA 1VE4A 2I4CA 3O6GA 3C36A 2F34A 3C31A 3S9NC 4N07A 4GX6A 4LQ5A 4DZ1A 4PE3A 1HSEA 3MC2A 4YMBA 1FQFA 4PCDA 4LATA 3H3GA 4TOZA 1A40A 4YU0A 3FXBA 4NF5B 3O6IA 4G4PA 2ZZVA 4GIZA 2XWVA 1NFTA 2HZKA 4X8RA 3WAEA 1Y1MA 3QK6A 4NMYA 4OEUA 4H45A 2NVUB 1EZ9A 4QHQA 1K9YA 3CI8A 2E0SA 3MP6A 1B5JA 4L17A 1KWHA 1O7TA 1YPNA 5CMCA 2CZLA 1YXIA 3TTLA 2UVIA 4QXDA 4KI0E 1L5TA 5ITOA 1TWYA 1IXHA 3D1RA 3H7MA 1EZOA 2Y7WA 1DSNA 1P1WA 2UXAA 3BIHA 2DDKA 3FXRA 2P2AA 1EYJA 5HPQA 4G77A 4F2OA 2UVGA 1DK4A 3CRBA 1NNPA 1Q9DA 4GLIA 4YB7A 1MXYA 1D4NA 1YYZA 1ZJLA 3RQTA 4UACA 2XWIA 3O97A 4IO5A 1AIVA 1D9VA 3H06B 3N6TA 4FEDA 1P1QA 1N0TA 5L8DA 4DIGA 1IMAA 3NOHA 4GX4A 3MW0A 2THIA 3RYDA 4ESXA 5J16A 2PFYA 4XEQA 3B7DA 5IZZA 1LEVA 3FGSA 2QFLA 2ZYMA 2XWOA 1K9ZA 5F7VA 3PPPA 4NF0A 5K2YA 3VXCA 2WYKA 4E0WA 4EXLA 3RYBA 4Q8RA 4G8MA 4TLMB 1KA0A 1XVYA 4F3SA 5CRYA 3T22A 3PUVE 1SPIA 3DP8A 2X26A 3BKIB 5FTHA 4G8HA 4ZE9A 1LB8A 4NHBA 2Z8EA 5TU0A 1FTMA 4X9TA 1MQJA 5LDZA 3IOWA 4GOTA 4PFIA 1DPEA 3C9HA 4F3BA 3ISPA 3QUFA 2AL5A 1UIVA 1LBVA 5EYFA 2HAUA 3BIGA 3PU5A 4BDRA 4YB5A 1NKXA 5TPAA 2I48A 2VD3A 4KD5A 1FTOA 3UIFA 1OLAA 4FORA 2WOKA 1OMPA 1GGGA 3TUSA 1FJ9A 3W9WA 2DE4A 4KFQA 4OVPA 3H6TA 4OVSA 2I4BA 2DE3A 4F29A 2ALUA 4F19A 1R6ZA 5AA2B 4PAKA 3B6WA 2FVZA 1NV5A 4PP0A 3FJMA 2XXKA 4P11A 1FBGA 3GBBA 3K6UA 5J1DA 1SW4A 3EHUA 3A3CA 3FATA 3IORA 3V8XB 4C0RA 4P0IA 2WOLA 4OMBA 1MXUA 3PAMA 5JTYA 4PBHA 4KYDA 1FPDA 3VXBA 2ZZXA 3AXFA 4OWDA 3N26A 2Q8MA 5ET5A 4ECFA 5AE4A 1SI0A 3H6VA 3MBPA 1Y3PA 1QUKA 1MH4A 1UTHA 3KG2A 1D3KA 2XA5A 2O1MA 3KN7A 4NWCA 1PB8A 4JSOA 4RJZA 4PFTA 3K4UA 4OFOA 1B7HA 1B3EA 3MP1A 1B5IA 4WKMA 4MFIA 4IY5A 1VR5A 4OHNA 1LAGE 2GQ1A 4ZE8A 1R9QA 4I62A 5TP9B 3RPWA 1AH5A 1FPIA 2I3VA 5ET7A 5TP9A 1B7UA 4H0WA 1FQEA 1LFGA 5ISUA 4FIMA 4JVDA 2V25A 4OETA 4GWUA 4MH5A 1WDNA 5T3JA 3IO6A 4AS5A 5I58B 4O3CA 4QSDA 2OWZA 4F3PA 2RC8A 4GXAA 3G3GA 3VVFA 1VFDA 4KCDA 4THIA 3I3VA 2H98A 1Y20A 3B6QA 4QFPA 4RNSA 4BDNA 3QMFA 1HSLA 4LQ2A 1LBZA 2F7CA 1T0KA 3K02A 4MAGA 3FVNA 1OQGA 2B65A 4LN5A 2UYEA 2B4LA 1B51A 1NV0A 4MMPA 3UP9A 4F3GA 4GWZA 4DE8A 4XKPA 4N17A 1XHYA 1QJMA 3CFLA 4R2BA 2O68A 1I6QA 3C33A 2DVCA 1EU8A 1H44A 2ZMBA 3ECRA 4QBAA 1YCJA 3RY3A 4OENA 3BFTA 3S2VA 4ZDMA 1FRPA 3ILTB 1SW2A 3THIA 2H99A 3CSBA 4OA4A 5AA3A 1YZ0A 3VLVA 2V3QA 2F35A 1MQDA 3LV0A 2D5WA 5FHOA 4KHZE 4GL8A 3IB1A 4Z0IA 2DWAA 3SEWA 1S9TA 4DCXA 1MY4A 3D4GA 3FTOA 3TMGA 3TQWA 2WYPA 4M4GA 4PGNA 3KSXA 2XXIA 4ZEKA 1D9QA 3KJTA 4G68C 5EQ8A 2X7QA 1OQHA 3ILUB 2NUVA 1IQ7A 4RXLA 4P56A 1OVBA 4BDOA 1RDXA 4ESWA 4DXUA 3ZKKA 5KDTB 3MPLA 5I57A 3SETA 4HXVA 3TTMA 2REJA 1URSA 1QGXA 4H1XA 3FASA 4YKKA 1B32A 2ZNSA 3K0VA 4OTEA 2ANJA 4XXUA 3DRHA 3UGWA 1B9JA 1S7YA 3M3KA 2FIEA 5I2NA 4R73A 3MAMA 5H8QB 1NMUA 2QRYA 5EQ9A 5CMKA 3O6PA 2Q9TA 2DVZA 3FJ7A 4N8YA 4OEVA 1MY3A 2UYFA 2F8DA 1RYXA 1NH7A 2HQ0A 1FTJA 5AA4A 4YKPA 3EHTA 3B6TA 2P3NA 2QL3A 3K6XA 1IUDA 3MQ9A 2PX1A 4MLVA 2Z8DA 3HCQA 1B3GA 2QS3A 4QFNA 4EQ9A 1DOTA 1M5DA 3O66A 2XWKA 1DCUA 5I2NB 1G0IA 3TEPA 1KA1A 5JK4A 4H46A 3CG1A 3OOAA 4N8GA 4R6HA 1SI1A 4XFEA 1QULA 1Q1KA 3SEXA 2XXYA 2Y5LA 4O3BA 4R9GA 3CR9A 4I9DA 3LR1A 3O2AA 1FQDA 2AIXA 2KQZA 5I57B 4PBQA 1IMEA 3FV2A 2L5VA 4U21A 1YTVA 1MS7A 3T0JA 2ONSA 4U2RA 3RYAA 3PPRA 2XXXA 4ZEBA 4PF8A 1A7LA 4ZS9A 1USYH 2I58A 3VVDA 1ZMGA 4N91A 5ELVA 4PAIA 1VFEA 1PDAA 4OESA 1NUYA 2Q2CA 1FJ6A 3GBAA 3KN3A 2ZNUA 1F9BA 2RINA 2XX7A 5FBPA 4X1DA 1AOVA 1DTGA 3DRJA 4FATA 2UVJA 2O7UA 4N15A 1NV1A 5A5LA 4YICA 1FBCA 3I5OA 1BK4A 2UVHA 4I40A 3N94A 5L9SA 2V3UA 2CEXA 4GWYA 4OVRA 4N81A 2Q2AA 4HE1A 4Q30B 4IO6A 1NNTA 3A29A 3DRKA 1B3HA 1N84A 1P1UA 3OO8A 1IMBA 4KXPA 3W15C 1DTZA 4NF4A 1MDQA 3QIMA 2FIXA 3RGYA 5CBRA 5IZ1A 3V89B 4N13A 3I6VA 3O6HA 3SDFA 4RK9A 2BJJX 4OANA 1A8EA 3LSLA 2VOZA 3EHSA 5KDTA 5DYHA 2OK2A 3DRIA 3DM0A 2ZXTA 3CG3A 2RKMA 3H6UA 3IL1B 1B46A 4NQ8A 2AL4A 5LTCA 3U94A 3IAZA 1B4HA 1BLFA 2Y84A 1GR2A 1ZBMA 5ICTA 1SQYA 3G7WA 2Q88A 1QW0A 5I3SA 3CFZA 3RT8A 3PGFA 1POY1 3T9VA 1IIWA 5CM6A 2Q89A 2Y7KA 3ROJA 1FBHA 4MNPA 2V84A 2A5TA 3SEVA 3MUQA 1FPEA 4I3EA 4IR8A 2HPGA 2VHAA 2JJKA 4O7MA 1SW5A 4BDLA 4H65A 3MJNA 4I3YA 1QUIA 1MPDA 2NOOA 3Q25A 1LAHE 3IR1A 4RYAA 1PBQA 4R6KA 2D21A 5ICQA 4AB6A 2XXQA 1B52A 1NUWA 4E0XA 5I7IA 4GD5A 2Y7PA 4OZ9A 2QJEA 2WOPA 4KQPA 5A5XB 4YZZA 1O64A 4RA1A 1FBPA 1FQCA 3EKIA 3S9EA 1QUJA 3K1PA 4U1OA 4RPOA 4PQJA 1XC1A 3TPAA 1GV8A 5DVIA 5I58A 4F1YA 1A99A 4PAFA 1RYOA 2D3IA 5JTYB 3B50A 2HEUA 2H9BA 2H4IA 3OXNA 4IB2A 1FPBA 3PD8A 1EYIA 1JVYA 3T96B 3LUZA 3C35A 3OD7A 1R1NA 2OX3A 2DS9A 4IY6A 3D4CA 3E4RA 2B4MA 2XXTA 3L6HA 2QS2A 4POWA 3KSJA 1JNFA 4LZ5A 1FCKA 4GVOA 4R74A 4P47A 1INPA 4OYVA 4ZZEA 3CIJA 3KEIA 5FHNA 2Y5KA 1KZ8A 1P99A 3P7IA 3R26A 1H45A 2RC9A 4ELQA 1Z7ME 4PFYA 1URGA 5IM2A 3IOUA 3GYYA 2VP1A 4OVQA 3IJOB 3USDA 4FBPA 1TT1A 1B05A 2F6GA 5IGAA 3E9XA 3LC8A 1MDP1 2PBWA 4X48A 1O63A 1SYHA 1FTLA 2XD3A 2XXUA 4GWOA 3M3LA 3PV0E 3OO7A 1IXGA 3Q29A 1JP4A 4XIGQ 2Z23A 3TYHA 1B0HA 4ZEFA 2FBPA 3MVXA 4MBPA 1M5BA 1EYKA 1BKAA 2GHBA 3F11A 4MF3A 4LVQA 3R6UA 1XVXA 3HHFA 1PC3A 5ET6A 1URDA 3T66A 5ET8A 3PUZE 3IX1A 1MM6A 4KYSA 2R71A 1MXXA 1PBPA 4N6KA 5IAIA 4M1VA 1B4ZA 1B1HA 4XKRA 1B7ZA 4RK2A 4F1VA 5CBSA 2OZZA 4MHFA 1H43A 2O7IA 3FD3A 3MZ1A 3G3HA 3OSRA 4GWSA 4AQ4A 3TFLA 1NH8A 1LBYA 1I6BA 4DDDA 3TZAA 1GVCA 3KOSA 3MP8A 3IOVA 2OLBA 3TTNA 1LAFE 4BLAA 1FPKA 2IA4A 3TODA 4OVTA 2HZLA 1US4A 5EYHA 1JQFA 1OVTA 2F7BA 4FECA 3ONMA 2I0CA 4GQOA 3KJ7A 3ODBA 5EHSA 3TQLA 4EF1A 1ATGA 4OERA 1MXZA 1MG1A 1FPFA 3N5LA 3SEYA 3S9MC 1IEJA 1FBDA 1NV6A 1LSTA 2YJPA 2DYXA 4C1UA 3LUYA 4GWXA 2F36A 5B7DA 2RF1A 3VLUA 3HO7A 4U4XA 2HXWA 3G3FA 4U23A 3SEUA 1UTHB 4H8IA 4I1DA 3TCGA 5H8SA 2GH9A 3SKPA 3RN8A 2A5SA 1ZTYA 4PFWA 4LA9A 4MLQA 1YAEA 5KCJB 2PT1A 1CNQA 1QKAA 1GTKA 3FXUA 2CMOA 3C34A 3FIRA 4P1LA 1VDWA 3U93A 2XXVA 5EQAA 2RC7A 4YB6A 2ZNTA 4PDDA 2HCAA 2OCUA 3PUXE 5A5XA 4N6PA 4DCYA 5HM4B 4X1BA 4R9FA 3Q27A 2O84X 4POXA 2F7AA 1N3WA 3L6GA 1TFDA 3TCHA 5DTBA 2QVRA 1FPJA 5CI5A 1PB7A 1B3LA 1LGBC 2YPNA 4C1TA 3QUJA 4NF8A 4XKQA 4G2ZA 2ZZWA 4PFBA 5AA2A 1JETA 1NNFA 1B1XA 3T93B 2H25A 1USYE 4H67A 3CVGA 3IFCA 2Q74A 4JVCA 4NF6B 2I3WA 5EYGA 4PFRA 2ZYOA 4PF6A 2F6PA 1B3FA 1POTA 4NG7A 5DVFA 5ITPA 4JVIA 3MSTA 3EN3A 4OQOA 3MZBA 2VD2A 1MRPA 2Y7IA 4WXJA 1S50A 1TXFA 1HSJA 3G3JA 1XT8A 4JBZA 1A55A 4I8CA 1JW4A 1WODA 4U1ZA 2OBGA 2XXWA 4HE2A 1MQGA 1FW0A 3TDJA 2O1LA 1MH3A 3V5AA 1AWBA 3PPOA 4IO2A 3S9LC 2V93A 2M8CA 4Q0CA 1SBPA 1Y3NA 1IZ1A 4XKNA 3ZS6A 2VGQA 1H76A 4Q5TA 2Z22A 3RPLA 3VE1B 1OIBA 2CEYA 1PB9A 1ANFA 2CZIA 2XX9A 4JWYA 2FNCA 2OWSA 1Z7NE 5H8HB 1BP5A 2QS4A 4UABA 1ZU0A 4GWWA 5CC2A 1CB6A 3VFJA 3KGCA 2KR0A 3G3IA 4G68B 3E78A 4IGRA 4DI3D 3UN6A 3C4MA 2WBBA 5L9OA 3U1OA 2DXRA 1LFIA 4WEPA 3RTFB 4GBWA 3A3UA 5DEXA 3WAFA 1ZKBA 3H4ZA 5JEIA 1RDYA 4MNIA 1IITA 4MX6A 2I0BA 3FV1A 4NEDA 2O51A 2ESNA 1H3DA 4QSEA 1NV3A 2B3FA 5I2KA 4PFUA 3MYUA 1IMFA 2G93A
chains in the Genus database with same CATH topology
3OSQA 2D21A 5H8FB 4QFLA 3Q28A 5ICQA 4U22A 2DWHA 4HTGA 5TP9A 4AB6A 4OFJA 4K3FA 1B40A 1XOCA 2XXQA 1B7UA 1B52A 4QFKA 3W9VA 4H0WA 3E3KA 1FQEA 1LFGA 4E0XA 1Q35A 1JW1A 5HBCA 5IKBA 1IXCA 2Y7PA 5ISUA 4GD5A 4NE4A 2QJEA 4OZ9A 2WKYA 2WOPA 2ONKE 4FIMA 4KQPA 1IXIA 3O29A 5A5XB 1JEUA 3PUYE 4F31B 1SDXA 2O69A 3KOTA 3MVYA 2V25A 4OETA 3MPKA 4YZZA 3T9UA 2DXYA 1A54A 3CFXA 1O64A 3JZJA 1WDNA 4MH5A 3VVEA 4EQBA 4RA1A 3IO6A 3PMVA 4R6YA 1SYIA 3OO9A 5I58B 4O3CA 1FQCA 4QSDA 2I49A 3UK4A 1DMBA 4F3PA 2RC8A 3ZKLA 4GXAA 3S9EA 2REGA 1QUJA 4DXBA 3G3GA 3K1PA 4H8JA 1VFDA 1Y9UA 4RPOA 4U1OA 5FHMA 1AL3A 4JWOA 4QF9A 4KCDA 5H8HA 4PQJA 3IK6B 4THIA 1MY2A 1XC1A 3I3VA 2ABHA 4R2FA 2H98A 1Y20A 2HAVA 3RLFE 3TPAA 3B6QA 4QFPA 4RNSA 3K6WA 4BDNA 4EUOA 3K01A 4IGTA 3DELB 1GV8A 1HSLA 2X7PA 2F7CA 2O6AA 2A5TB 4LQ2A 3CHGA 1JEVA 3FUZA 3K02A 4EF2A 4PETA 3KFMA 3CSGA 5DVIA 1JW5A 3FVNA 5I58A 4F2QA 4F1YA 1OQGA 1A99A 2Q8JA 1CE2A 1SVXB 1AMFA 1ELJA 2B65A 1LCTA 3JV9A 3HV1A 2UYEA 1RYOA 2D3IA 2B4LA 5JTYB 1BIYA 1B51A 1Y1ZA 1NL5A 2HEUA 2H9BA 2H4IA 3TELA 5I84A 3OXNA 3G3KA 4IB2A 1PEBA 1J1NA 3UP9A 3HSTA 3PD8A 3RTWB 2GHAA 4F3GA 4DE8A 4XKPA 5J1DA 4FJPA 2XXPA 4OXVA 1OLCA 1XHYA 3K6VA 1QJMA 1I69A 3MVZA 1JVYA 2QMXA 3T96B 4KR5A 3EPEA 3C35A 2I6EA 1NNKA 3CFLA 3OD7A 1R1NA 4R2BA 4YAHX 5AA2D 2HFBA 5I56B 1N7WA 5TPAB 3FVOA 2DS9A 2O68A 1I6QA 3C33A 2DVCA 4IY6A 1EU8A 2OJTA 1H44A 3D4CA 3E4RA 5H8NB 2B4MA 2XXTA 3L6HA 5I2KB 2QS2A 2ZMBA 1SW1A 4POWA 3KSJA 3RT6B 1JNFA 3PUWE 4LZ5A 1MXWA 4F1UA 1SD3A 3GLBA 1FCKA 3ECRA 4U4SA 5L9MA 4F39A 4ELOA 3VLWA 5KZTA 1FQBA 3JYRA 4GVOA 4R74A 4HS7A 3SERA 1YCJA 1UTBA 4OYVA 1LLSA 4ZZEA 3CIJA 3KEIA 3RY3A 4H5FA 3Q26A 5FHNA 4H5GA 4NF5A 3DRGA 4OENA 1P99A 3K2DA 3P7IA 3BFTA 3R26A 1H45A 3QYTA 4LUBA 4ZDMA 3S2VA 2RC9A 3O9PA 3LVUA 1FTKA 2LAOA 4ZEIA 1SW2A 3ILTB 3S4UA 4ELQA 1Z7ME 3LBSA 3VV5A 3THIA 3FJGA 2H99A 4Z7EA 4QFOA 5DEXB 3CSBA 4PFYA 1P1NA 2XD2A 3QAXA 2DOJA 3VLVA 4GXSB 4EQ7A 2V3QA 5AA3A 2F35A 2ONRA 1URGA 5CMMA 1MQDA 5I56A 3TTRA 2FA7A 3DRFA 3IOUA 4FE8A 3GXAA 2D5WA 4ONYA 5FHOA 2VP1A 3RNNA 2NXOA 3IJOB 3USDA 3BFUA 1LAXA 4KHZE 4O3AA 1TT1A 4LONB 4GL8A 1B05A 2F6GA 4GL0A 3MWBA 4ZZAA 4FAJA 3E9XA 3IB1A 3U92A 3LC8A 4Z0IA 1MDP1 2DWAA 3LSWA 3SEWA 3K00A 4ELRA 4F22A 1P1OA 1S9TA 2PBWA 4G68A 2B3BA 5K2XA 3A09A 4DCXA 3EQ1A 3LSFB 4X48A 3V8XB 1RKMA 1MY4A 3IOTA 5BUUA 3D4GA 2KLFA 3OENA 3FTOA 3TMGA 3TQWA 1O63A 2F97A 4IO4A 1SYHA 2QMWA 3FVKA 3FZVA 4NTLA 5DT6A 2H5YA 3HHGA 1VE4A 4M4GA 4NF8B 1FTLA 3H6WA 2I4CA 2XD3A 2XXUA 3KSXA 4GWOA 2ZYNA 3O6GA 2XXIA 3C36A 3M3LA 2F34A 3C31A 3S9NC 2QPQA 4ZEKA 3PV0E 3OO7A 4N07A 3KJTA 4G68C 1IXGA 1DPPA 4LQ5A 4DZ1A 1HSEA 1OQHA 2X7QA 3ILUB 3MC2A 3Q29A 1Y3QA 4XIGQ 4YKJA 4F18A 1FQFA 1ZIUA 2NUVA 2Z23A 3TYHA 4YMBA 1IQ7A 4LATA 4RXLA 3H3GA 1B0HA 4ZEFA 4TOZA 1OVBA 3MVXA 4JBZA 1A40A 4MBPA 4YU0A 3TTKA 4BDOA 1M5BA 2QSXA 4NF5B 3DLNA 3O6IA 1BKAA 4DXUA 4ESWA 1MM7A 2GHBA 4G4PA 3F11A 4MF3A 4GIZA 1MPCA 1XVXA 2F5XA 1LB9A 3HHFA 1PC3A 3MPLA 3OEKA 3R6UA 1NFTA 4ISUA 2FYIA 3SETA 5I59B 1URDA 5EHMA 5I57A 2HZKA 3PD9A 3T66A 3TTMA 3GZGA 2REJA 3PUZE 1URSA 3IX1A 1MM6A 4KYSA 4GRKA 1MY0A 3U93A 3WAEA 4H1XA 1MPBA 3FASA 2R71A 1Y1MA 3OEMA 3QK6A 4OEUA 4NMYA 3PMXA 4YKKA 5H8NA 2NVUB 1EZ9A 3R7XA 4QHQA 1B32A 1MXXA 2ZNSA 3K0VA 1PBPA 3CI8A 4H6DA 2ANJA 4OTEA 5IAIA 2E0SA 4M1VA 3MP6A 4WEDA 1B5JA 1B4ZA 5KCJA 1B1HA 1TFAA 4JXIA 4L17A 1KWHA 4OVJA 1M5FA 3DRHA 4XKRA 1B9JA 4XXUA 1UIUA 1B7ZA 4KCCA 1MQIA 4QRZA 4RK2A 1S7YA 1O7TA 3M3FA 3T9XB 4F1VA 4GF8A 1YPNA 3M3KA 5CMCA 3T9HB 5CBSA 2CZLA 5I2NA 4R73A 2RCAA 3TTLA 2OZZA 3N6UA 4NF6A 3MAMA 5H8QB 5KDTA 1H43A 2UVIA 2O7IA 3FD3A 4KI0E 3MZ1A 3G3HA 3OO6A 3OSRA 1L5TA 1NMUA 1Y4CA 4AQ4A 5ITOA 2QRYA 1TWYA 3IB0A 3K1NA 3TFLA 1NH8A 1IXHA 3QSLA 1I6BA 4DDDA 3H7MA 1EZOA 3TZAA 3U8QA 1VSOA 2Y7WA 1GVCA 3OMBA 1DSNA 1P1WA 1US5A 2UXAA 3KOSA 3MP8A 3MVWA 3FXRA 3IOVA 2OLBA 3TTNA 2P2AA 1LAFE 5FTHA 5CMKA 3O6PA 1JVXA 4BLAA 4LZ8A 1XS5A 2Q9TA 2IA4A 3TODA 5HPQA 1B0LA 3EF7A 4G77A 2UVGA 2HZLA 4F2OA 1US4A 2DVZA 2Y7RA 1JQFA 1NNPA 3CRBA 3FJ7A 4GLIA 4YB7A 1OVTA 2Z8FA 4BDMA 2F78A 1MXYA 2F7BA 4FECA 3ONMA 1D4NA 4LP2B 3U72A 1ZJLA 3RQTA 4UACA 2I0CA 4GQOA 3O97A 3KJ7A 4IO5A 4R75A 3TCFA 4OEVA 4ECFA 1AIVA 1D9VA 3H06B 3TKDA 1M5EA 3N6TA 3ODBA 3KBRA 5B70A 5EHSA 4FEDA 1MY3A 5AA4B 1P1QA 4EDPA 1N0TA 5L8DA 4DIGA 2UYFA 3TQLA 4RPNA 4EF1A 4PE5B 2F8DA 3BBRA 1ATGA 1M5CA 4OERA 1RYXA 3MW0A 3UGWA 3VVFA 1MXZA 1NH7A 2HQ0A 2AYSA 1MG1A 1FTJA 5AA4A 2PYYA 3EHTA 3N5LA 4YKPA 3SEYA 2THIA 3B6TA 4ESXA 2QL3A 3K6XA 3S9MC 1IEJA 1D9YA 1IUDA 5F1QA 3B7DA 3IO4A 3MQ9A 2PX1A 1LSTA 2Z8DA 4MLVA 3FGSA 4P0GA 2YJPA 2DYXA 1B3GA 3HCQA 2QS3A 4QFNA 3LUYA 4C1UA 1DOTA 1M5DA 4EQ9A 3O66A 2ZYMA 2F36A 4HCWA 4ZECA 3DP4A 3OELA 5I2NB 5B7DA 3KN8A 4JWXA 2RF1A 4R72A 3TEPA 5F7VA 5JK4A 3VLUA 4JSDA 3CG1A 3HO7A 2HXWA 3HN0A 2R6GE 3G3FA 3OOAA 4U4XA 3PPPA 4R6HA 4U23A 3SEUA 1LFHA 1SI1A 4FEBA 1UTHB 4H8IA 5K2YA 3UORA 4I1DA 3VXCA 4E0WA 5BWJA 3TCGA 1N3XA 4LZ7A 5H8SA 3RYBA 2GH9A 4EXLA 3SKPA 4Q8RA 1QULA 1ZLQA 1Q1KA 1I6AA 4G8MA 2XXYA 3RN8A 4TLMB 2A5SA 3SEXA 1XVYA 4O3BA 4F3SA 4R9GA 5CRYA 3CR9A 1ZTYA 4I9DA 3IB2A 4PFWA 3LR1A 3O2AA 1FQDA 2AIXA 4LA9A 3T22A 2G29A 4MLQA 1YAEA 4HW8A 1LBBA 5I57B 1MQHA 5I59A 3PUVE 5KCJB 5H8QA 2PT1A 3DP8A 2DWIA 1QKAA 1GTKA 2CMOA 2X26A 3C34A 3BKIB 3FIRA 4ZEDA 3FV2A 2XXVA 3E13X 3FXUA 4U21A 2RCBA 4G8HA 4ZE9A 1UQWA 2P1SA 1YTVA 1LB8A 2RC7A 3O28A 1MS7A 2Z8EA 4YB6A 2ONSA 4U2RA 3ZSFA 2ZNTA 4AB5A 1EH3A 5TU0A 3RYAA 2HCAA 4OFLA 1B6HA 2OCUA 1FTMA 3C32A 3PPRA 3PUXE 5A5XA 2PVUA 4N6PA 4X9TA 2XXXA 4ZEBA 4DCYA 5HM4B 1A7LA 1MQJA 4TQUQ 3SESA 4X1BA 4KPTA 4R9FA 2PT2A 4ZS9A 1USYH 2I58A 3IJXB 1ZMGA 3IOWA 3Q27A 3VVDA 5ELVA 4GOTA 2O84X 4POXA 4JDFA 1VFEA 2F7AA 1N3WA 1PDAA 1DPEA 4OESA 4TLLB 2Q2CA 3C9HA 5AA1A 4F3BA 1LCFA 3QUFA 4NF4B 2AL5A 3GBAA 1UTBB 3KN3A 2ZNUA 3L6GA 1UIVA 1F9BA 1TFDA 2RINA 3PMWA 1N76A 2XX7A 3TCHA 5DTBA 5EYFA 2HAUA 4EXKA 3PU5A 5CI5A 1PB7A 4ELPA 4BDRA 4X1DA 1AOVA 4YB5A 1B3LA 1LGBC 1NKXA 2YPNA 4C1TA 3QUJA 4G8NA 4NF8A 1DTGA 3KZGA 1BTJA 3DRJA 5TPAA 2I48A 1QVSA 4FATA 2UVJA 2VD3A 4XKQA 4KD5A 2O7UA 4G2ZA 1FTOA 3UIFA 1OLAA 4YICA 3I5OA 2IEEA 2UVHA 4FORA 3N94A 1JETA 5AA2A 5L9SA 2V3UA 1NNFA 2WOKA 1B1XA 5KDTB 1OMPA 2DE2A 4IO3A 5CMBA 1GGGA 3T93B 4JB7A 2H25A 4YMAA 3TUSA 1USYE 3W9WA 5LOMA 1MY1A 3CVGA 2DE4A 4H67A 4KFQA 2Q2AA 4Q30B 4IO6A 1NNTA 1R9LA 3DRKA 1B3HA 1P1UA 1N84A 3H6TA 4GFRA 3OO8A 2I4BA 3W15C 1DTZA 2DE3A 2YLNA 4NF6B 4NF4A 4DLDA 4F29A 3HPIA 1B5HA 1MDQA 2ALUA 2I3WA 3QIMA 3LSXA 2ZYOA 4F19A 2F6PA 4QSCA 3RGYA 1R6ZA 4RY1A 1B3FA 1POTA 4NWDA 3V89B 5DVFA 5AA2B 4N13A 3I6VA 5CBRA 5ITPA 3EN3A 3O6HA 3SDFA 2P0SA 3MZBA 4OQOA 2BJJX 4RK9A 3RUMA 3B6WA 2VD2A 4PP0A 1MRPA 1QKBA 2Y7IA 4XTCQ 3FJMA 1A8EA 4WXJA 1II5A 1S50A 1TXFA 1HSJA 2VOZA 2W7YA 3EHSA 3GBBA 3G3JA 1XT8A 3K6UA 3LSLA 5DYHA 1SW4A 1A55A 2OWTA 3A3CA 4I8CA 2OK2A 3EHUA 3FATA 1B2HA 3IORA 4ND9A 2DSFA 3TAJA 4C0RA 4P0IA 1JW4A 1WODA 1Y4TA 4U1ZA 2OBGA 2XXWA 2WOLA 4OMBA 3DRIA 4DXCA 1MQGA 3DM0A 4IO7A 1FW0A 2E1SA 3TDJA 2O1LA 1MH3A 2XX8A 2ZXTA 1MXUA 5DVJA 3V5AA 3PAMA 3CG3A 3PPOA 4IO2A 5JTYA 3S9LC 2RKMA 2V93A 3H6UA 2M8CA 3IL1B 4KYDA 4Q0CA 1B46A 1SBPA 4KYEA 2AL4A 1Y3NA 1IZ1A 4XKNA 3ZS6A 2VGQA 3DP6A 3IAZA 5M2VA 3U94A 3VXBA 4BDQA 1H76A 1WVJA 3AXFA 3VDFA 2R9JA 4OWDA 2Z22A 4Q5TA 3VE1B 5FTIA 1B4HA 1OIBA 1PB9A 1ANFA 1BLFA 3N26A 2Y84A 2XX9A 4JWYA 1GR2A 2DP8A 1LBCA 2DWJA 2FNCA 2GFEA 3FXQA 1ZBMA 1MXVA 2GRVA 1Z7NE 2OWSA 5H8HB 3ZKKA 1SI0A 5AE4A 1T0KA 5ICTA 3H6VA 3MBPA 1BP5A 3M8UA 2QS1A 2QS4A 1SQYA 3G7WA 1Y3PA 1QW0A 2Q88A 1QUKA 3CFZA 3H03A 3RT8A 3PGFA 1ZU0A 5CC2A 3FVGA 1CB6A 1MH4A 3QXMA 1POY1 2V3TA 2XXHA 1IIWA 1UTHA 3T9VA 3KG2A 3VFJA 5CM6A 3KGCA 4G68B 3G3IA 2Q89A 4IGRA 2Y7KA 3UN6A 4LVQA 1D3KA 3C4MA 2V84A 1B58A 3MZ9A 2O1MA 3KN7A 2A5TA 5L9OA 4NWCA 1PB8A 3U1OA 2DXRA 4JSOA 3SEVA 3MUQA 4RJZA 3PPQA 2ZYKA 3UA8A 1LFIA 4WEPA 4UA8A 4PFTA 2DQVA 2XHDA 2VHAA 3RTFB 3K4UA 1A8FA 1N04A 4OFOA 1B7HA 1B3EA 3A3UA 3MP1A 1B5IA 4WKMA 5H8FA 1SW5A 2NWJA 2PMSA 5DEXA 3WAFA 1FQAA 3PPNA 1ZKBA 3H4ZA 4H65A 4BDLA 1N7XA 3MJNA 3K1MA 5JEIA 4MFIA 1QUIA 1IITA 1MPDA 2I0BA 4HCYA 3FV1A 4IY5A 2NOOA 4NEDA 3Q25A 1LAHE 2O51A 1VR5A 1H3DA 2ESNA 4OHNA 3IR1A 4P11A 4QSEA 1LAGE 4RYAA 3V83A 4ZE8A 2B3FA 5I2KA 4PFUA 1R9QA 4I62A 1EZPA 2XXRA 1PBQA 5TP9B 4R6KA 2G93A 4YKIA 3RPWA 1AH5A 2I3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSQ A;  2D21 A;  5H8F B;  4QFL A;  3Q28 A;  5ICQ A;  4U22 A;  2DWH A;  4HTG A;  5TP9 A;  4AB6 A;  4OFJ A;  4K3F A;  1B40 A;  1XOC A;  2XXQ A;  1B7U A;  1B52 A;  4QFK A;  3W9V A;  4H0W A;  3E3K A;  1FQE A;  1LFG A;  4E0X A;  1Q35 A;  1JW1 A;  5HBC A;  5IKB A;  1IXC A;  2Y7P A;  5ISU A;  4GD5 A;  4NE4 A;  2QJE A;  4OZ9 A;  2WKY A;  2WOP A;  2ONK E;  4FIM A;  4KQP A;  1IXI A;  3O29 A;  5A5X B;  1JEU A;  3PUY E;  4F31 B;  1SDX A;  2O69 A;  3KOT A;  3MVY A;  2V25 A;  4OET A;  3MPK A;  4YZZ A;  3T9U A;  2DXY A;  1A54 A;  3CFX A;  1O64 A;  3JZJ A;  1WDN A;  4MH5 A;  3VVE A;  4EQB A;  4RA1 A;  3IO6 A;  3PMV A;  4R6Y A;  1SYI A;  3OO9 A;  5I58 B;  4O3C A;  1FQC A;  4QSD A;  2I49 A;  3UK4 A;  1DMB A;  4F3P A;  2RC8 A;  3ZKL A;  4GXA A;  3S9E A;  2REG A;  1QUJ A;  4DXB A;  3G3G A;  3K1P A;  4H8J A;  1VFD A;  1Y9U A;  4RPO A;  4U1O A;  5FHM A;  1AL3 A;  4JWO A;  4QF9 A;  4KCD A;  5H8H A;  4PQJ A;  3IK6 B;  4THI A;  1MY2 A;  1XC1 A;  3I3V A;  2ABH A;  4R2F A;  2H98 A;  1Y20 A;  2HAV A;  3RLF E;  3TPA A;  3B6Q A;  4QFP A;  4RNS A;  3K6W A;  4BDN A;  4EUO A;  3K01 A;  4IGT A;  3DEL B;  1GV8 A;  1HSL A;  2X7P A;  2F7C A;  2O6A A;  2A5T B;  4LQ2 A;  3CHG A;  1JEV A;  3FUZ A;  3K02 A;  4EF2 A;  4PET A;  3KFM A;  3CSG A;  5DVI A;  1JW5 A;  3FVN A;  5I58 A;  4F2Q A;  4F1Y A;  1OQG A;  1A99 A;  2Q8J A;  1CE2 A;  1SVX B;  1AMF A;  1ELJ A;  2B65 A;  1LCT A;  3JV9 A;  3HV1 A;  2UYE A;  1RYO A;  2D3I A;  2B4L A;  5JTY B;  1BIY A;  1B51 A;  1Y1Z A;  1NL5 A;  2HEU A;  2H9B A;  2H4I A;  3TEL A;  5I84 A;  3OXN A;  3G3K A;  4IB2 A;  1PEB A;  1J1N A;  3UP9 A;  3HST A;  3PD8 A;  3RTW B;  2GHA A;  4F3G A;  4DE8 A;  4XKP A;  5J1D A;  4FJP A;  2XXP A;  4OXV A;  1OLC A;  1XHY A;  3K6V A;  1QJM A;  1I69 A;  3MVZ A;  1JVY A;  2QMX A;  3T96 B;  4KR5 A;  3EPE A;  3C35 A;  2I6E A;  1NNK A;  3CFL A;  3OD7 A;  1R1N A;  4R2B A;  4YAH X;  5AA2 D;  2HFB A;  5I56 B;  1N7W A;  5TPA B;  3FVO A;  2DS9 A;  2O68 A;  1I6Q A;  3C33 A;  2DVC A;  4IY6 A;  1EU8 A;  2OJT A;  1H44 A;  3D4C A;  3E4R A;  5H8N B;  2B4M A;  2XXT A;  3L6H A;  5I2K B;  2QS2 A;  2ZMB A;  1SW1 A;  4POW A;  3KSJ A;  3RT6 B;  1JNF A;  3PUW E;  4LZ5 A;  1MXW A;  4F1U A;  1SD3 A;  3GLB A;  1FCK A;  3ECR A;  4U4S A;  5L9M A;  4F39 A;  4ELO A;  3VLW A;  5KZT A;  1FQB A;  3JYR A;  4GVO A;  4R74 A;  4HS7 A;  3SER A;  1YCJ A;  1UTB A;  4OYV A;  1LLS A;  4ZZE A;  3CIJ A;  3KEI A;  3RY3 A;  4H5F A;  3Q26 A;  5FHN A;  4H5G A;  4NF5 A;  3DRG A;  4OEN A;  1P99 A;  3K2D A;  3P7I A;  3BFT A;  3R26 A;  1H45 A;  3QYT A;  4LUB A;  4ZDM A;  3S2V A;  2RC9 A;  3O9P A;  3LVU A;  1FTK A;  2LAO A;  4ZEI A;  1SW2 A;  3ILT B;  3S4U A;  4ELQ A;  1Z7M E;  3LBS A;  3VV5 A;  3THI A;  3FJG A;  2H99 A;  4Z7E A;  4QFO A;  5DEX B;  3CSB A;  4PFY A;  1P1N A;  2XD2 A;  3QAX A;  2DOJ A;  3VLV A;  4GXS B;  4EQ7 A;  2V3Q A;  5AA3 A;  2F35 A;  2ONR A;  1URG A;  5CMM A;  1MQD A;  5I56 A;  3TTR A;  2FA7 A;  3DRF A;  3IOU A;  4FE8 A;  3GXA A;  2D5W A;  4ONY A;  5FHO A;  2VP1 A;  3RNN A;  2NXO A;  3IJO B;  3USD A;  3BFU A;  1LAX A;  4KHZ E;  4O3A A;  1TT1 A;  4LON B;  4GL8 A;  1B05 A;  2F6G A;  4GL0 A;  3MWB A;  4ZZA A;  4FAJ A;  3E9X A;  3IB1 A;  3U92 A;  3LC8 A;  4Z0I A;  1MDP 1;  2DWA A;  3LSW A;  3SEW A;  3K00 A;  4ELR A;  4F22 A;  1P1O A;  1S9T A;  2PBW A;  4G68 A;  2B3B A;  5K2X A;  3A09 A;  4DCX A;  3EQ1 A;  3LSF B;  4X48 A;  3V8X B;  1RKM A;  1MY4 A;  3IOT A;  5BUU A;  3D4G A;  2KLF A;  3OEN A;  3FTO A;  3TMG A;  3TQW A;  1O63 A;  2F97 A;  4IO4 A;  1SYH A;  2QMW A;  3FVK A;  3FZV A;  4NTL A;  5DT6 A;  2H5Y A;  3HHG A;  1VE4 A;  4M4G A;  4NF8 B;  1FTL A;  3H6W A;  2I4C A;  2XD3 A;  2XXU A;  3KSX A;  4GWO A;  2ZYN A;  3O6G A;  2XXI A;  3C36 A;  3M3L A;  2F34 A;  3C31 A;  3S9N C;  2QPQ A;  4ZEK A;  3PV0 E;  3OO7 A;  4N07 A;  3KJT A;  4G68 C;  1IXG A;  1DPP A;  4LQ5 A;  4DZ1 A;  1HSE A;  1OQH A;  2X7Q A;  3ILU B;  3MC2 A;  3Q29 A;  1Y3Q A;  4XIG Q;  4YKJ A;  4F18 A;  1FQF A;  1ZIU A;  2NUV A;  2Z23 A;  3TYH A;  4YMB A;  1IQ7 A;  4LAT A;  4RXL A;  3H3G A;  1B0H A;  4ZEF A;  4TOZ A;  1OVB A;  3MVX A;  4JBZ A;  1A40 A;  4MBP A;  4YU0 A;  3TTK A;  4BDO A;  1M5B A;  2QSX A;  4NF5 B;  3DLN A;  3O6I A;  1BKA A;  4DXU A;  4ESW A;  1MM7 A;  2GHB A;  4G4P A;  3F11 A;  4MF3 A;  4GIZ A;  1MPC A;  1XVX A;  2F5X A;  1LB9 A;  3HHF A;  1PC3 A;  3MPL A;  3OEK A;  3R6U A;  1NFT A;  4ISU A;  2FYI A;  3SET A;  5I59 B;  1URD A;  5EHM A;  5I57 A;  2HZK A;  3PD9 A;  3T66 A;  3TTM A;  3GZG A;  2REJ A;  3PUZ E;  1URS A;  3IX1 A;  1MM6 A;  4KYS A;  4GRK A;  1MY0 A;  3U93 A;  3WAE A;  4H1X A;  1MPB A;  3FAS A;  2R71 A;  1Y1M A;  3OEM A;  3QK6 A;  4OEU A;  4NMY A;  3PMX A;  4YKK A;  5H8N A;  2NVU B;  1EZ9 A;  3R7X A;  4QHQ A;  1B32 A;  1MXX A;  2ZNS A;  3K0V A;  1PBP A;  3CI8 A;  4H6D A;  2ANJ A;  4OTE A;  5IAI A;  2E0S A;  4M1V A;  3MP6 A;  4WED A;  1B5J A;  1B4Z A;  5KCJ A;  1B1H A;  1TFA A;  4JXI A;  4L17 A;  1KWH A;  4OVJ A;  1M5F A;  3DRH A;  4XKR A;  1B9J A;  4XXU A;  1UIU A;  1B7Z A;  4KCC A;  1MQI A;  4QRZ A;  4RK2 A;  1S7Y A;  1O7T A;  3M3F A;  3T9X B;  4F1V A;  4GF8 A;  1YPN A;  3M3K A;  5CMC A;  3T9H B;  5CBS A;  2CZL A;  5I2N A;  4R73 A;  2RCA A;  3TTL A;  2OZZ A;  3N6U A;  4NF6 A;  3MAM A;  5H8Q B;  5KDT A;  1H43 A;  2UVI A;  2O7I A;  3FD3 A;  4KI0 E;  3MZ1 A;  3G3H A;  3OO6 A;  3OSR A;  1L5T A;  1NMU A;  1Y4C A;  4AQ4 A;  5ITO A;  2QRY A;  1TWY A;  3IB0 A;  3K1N A;  3TFL A;  1NH8 A;  1IXH A;  3QSL A;  1I6B A;  4DDD A;  3H7M A;  1EZO A;  3TZA A;  3U8Q A;  1VSO A;  2Y7W A;  1GVC A;  3OMB A;  1DSN A;  1P1W A;  1US5 A;  2UXA A;  3KOS A;  3MP8 A;  3MVW A;  3FXR A;  3IOV A;  2OLB A;  3TTN A;  2P2A A;  1LAF E;  5FTH A;  5CMK A;  3O6P A;  1JVX A;  4BLA A;  4LZ8 A;  1XS5 A;  2Q9T A;  2IA4 A;  3TOD A;  5HPQ A;  1B0L A;  3EF7 A;  4G77 A;  2UVG A;  2HZL A;  4F2O A;  1US4 A;  2DVZ A;  2Y7R A;  1JQF A;  1NNP A;  3CRB A;  3FJ7 A;  4GLI A;  4YB7 A;  1OVT A;  2Z8F A;  4BDM A;  2F78 A;  1MXY A;  2F7B A;  4FEC A;  3ONM A;  1D4N A;  4LP2 B;  3U72 A;  1ZJL A;  3RQT A;  4UAC A;  2I0C A;  4GQO A;  3O97 A;  3KJ7 A;  4IO5 A;  4R75 A;  3TCF A;  4OEV A;  4ECF A;  1AIV A;  1D9V A;  3H06 B;  3TKD A;  1M5E A;  3N6T A;  3ODB A;  3KBR A;  5B70 A;  5EHS A;  4FED A;  1MY3 A;  5AA4 B;  1P1Q A;  4EDP A;  1N0T A;  5L8D A;  4DIG A;  2UYF A;  3TQL A;  4RPN A;  4EF1 A;  4PE5 B;  2F8D A;  3BBR A;  1ATG A;  1M5C A;  4OER A;  1RYX A;  3MW0 A;  3UGW A;  3VVF A;  1MXZ A;  1NH7 A;  2HQ0 A;  2AYS A;  1MG1 A;  1FTJ A;  5AA4 A;  2PYY A;  3EHT A;  3N5L A;  4YKP A;  3SEY A;  2THI A;  3B6T A;  4ESX A;  2QL3 A;  3K6X A;  3S9M C;  1IEJ A;  1D9Y A;  1IUD A;  5F1Q A;  3B7D A;  3IO4 A;  3MQ9 A;  2PX1 A;  1LST A;  2Z8D A;  4MLV A;  3FGS A;  4P0G A;  2YJP A;  2DYX A;  1B3G A;  3HCQ A;  2QS3 A;  4QFN A;  3LUY A;  4C1U A;  1DOT A;  1M5D A;  4EQ9 A;  3O66 A;  2ZYM A;  2F36 A;  4HCW A;  4ZEC A;  3DP4 A;  3OEL A;  5I2N B;  5B7D A;  3KN8 A;  4JWX A;  2RF1 A;  4R72 A;  3TEP A;  5F7V A;  5JK4 A;  3VLU A;  4JSD A;  3CG1 A;  3HO7 A;  2HXW A;  3HN0 A;  2R6G E;  3G3F A;  3OOA A;  4U4X A;  3PPP A;  4R6H A;  4U23 A;  3SEU A;  1LFH A;  1SI1 A;  4FEB A;  1UTH B;  4H8I A;  5K2Y A;  3UOR A;  4I1D A;  3VXC A;  4E0W A;  5BWJ A;  3TCG A;  1N3X A;  4LZ7 A;  5H8S A;  3RYB A;  2GH9 A;  4EXL A;  3SKP A;  4Q8R A;  1QUL A;  1ZLQ A;  1Q1K A;  1I6A A;  4G8M A;  2XXY A;  3RN8 A;  4TLM B;  2A5S A;  3SEX A;  1XVY A;  4O3B A;  4F3S A;  4R9G A;  5CRY A;  3CR9 A;  1ZTY A;  4I9D A;  3IB2 A;  4PFW A;  3LR1 A;  3O2A A;  1FQD A;  2AIX A;  4LA9 A;  3T22 A;  2G29 A;  4MLQ A;  1YAE A;  4HW8 A;  1LBB A;  5I57 B;  1MQH A;  5I59 A;  3PUV E;  5KCJ B;  5H8Q A;  2PT1 A;  3DP8 A;  2DWI A;  1QKA A;  1GTK A;  2CMO A;  2X26 A;  3C34 A;  3BKI B;  3FIR A;  4ZED A;  3FV2 A;  2XXV A;  3E13 X;  3FXU A;  4U21 A;  2RCB A;  4G8H A;  4ZE9 A;  1UQW A;  2P1S A;  1YTV A;  1LB8 A;  2RC7 A;  3O28 A;  1MS7 A;  2Z8E A;  4YB6 A;  2ONS A;  4U2R A;  3ZSF A;  2ZNT A;  4AB5 A;  1EH3 A;  5TU0 A;  3RYA A;  2HCA A;  4OFL A;  1B6H A;  2OCU A;  1FTM A;  3C32 A;  3PPR A;  3PUX E;  5A5X A;  2PVU A;  4N6P A;  4X9T A;  2XXX A;  4ZEB A;  4DCY A;  5HM4 B;  1A7L A;  1MQJ A;  4TQU Q;  3SES A;  4X1B A;  4KPT A;  4R9F A;  2PT2 A;  4ZS9 A;  1USY H;  2I58 A;  3IJX B;  1ZMG A;  3IOW A;  3Q27 A;  3VVD A;  5ELV A;  4GOT A;  2O84 X;  4POX A;  4JDF A;  1VFE A;  2F7A A;  1N3W A;  1PDA A;  1DPE A;  4OES A;  4TLL B;  2Q2C A;  3C9H A;  5AA1 A;  4F3B A;  1LCF A;  3QUF A;  4NF4 B;  2AL5 A;  3GBA A;  1UTB B;  3KN3 A;  2ZNU A;  3L6G A;  1UIV A;  1F9B A;  1TFD A;  2RIN A;  3PMW A;  1N76 A;  2XX7 A;  3TCH A;  5DTB A;  5EYF A;  2HAU A;  4EXK A;  3PU5 A;  5CI5 A;  1PB7 A;  4ELP A;  4BDR A;  4X1D A;  1AOV A;  4YB5 A;  1B3L A;  1LGB C;  1NKX A;  2YPN A;  4C1T A;  3QUJ A;  4G8N A;  4NF8 A;  1DTG A;  3KZG A;  1BTJ A;  3DRJ A;  5TPA A;  2I48 A;  1QVS A;  4FAT A;  2UVJ A;  2VD3 A;  4XKQ A;  4KD5 A;  2O7U A;  4G2Z A;  1FTO A;  3UIF A;  1OLA A;  4YIC A;  3I5O A;  2IEE A;  2UVH A;  4FOR A;  3N94 A;  1JET A;  5AA2 A;  5L9S A;  2V3U A;  1NNF A;  2WOK A;  1B1X A;  5KDT B;  1OMP A;  2DE2 A;  4IO3 A;  5CMB A;  1GGG A;  3T93 B;  4JB7 A;  2H25 A;  4YMA A;  3TUS A;  1USY E;  3W9W A;  5LOM A;  1MY1 A;  3CVG A;  2DE4 A;  4H67 A;  4KFQ A;  2Q2A A;  4Q30 B;  4IO6 A;  1NNT A;  1R9L A;  3DRK A;  1B3H A;  1P1U A;  1N84 A;  3H6T A;  4GFR A;  3OO8 A;  2I4B A;  3W15 C;  1DTZ A;  2DE3 A;  2YLN A;  4NF6 B;  4NF4 A;  4DLD A;  4F29 A;  3HPI A;  1B5H A;  1MDQ A;  2ALU A;  2I3W A;  3QIM A;  3LSX A;  2ZYO A;  4F19 A;  2F6P A;  4QSC A;  3RGY A;  1R6Z A;  4RY1 A;  1B3F A;  1POT A;  4NWD A;  3V89 B;  5DVF A;  5AA2 B;  4N13 A;  3I6V A;  5CBR A;  5ITP A;  3EN3 A;  3O6H A;  3SDF A;  2P0S A;  3MZB A;  4OQO A;  2BJJ X;  4RK9 A;  3RUM A;  3B6W A;  2VD2 A;  4PP0 A;  1MRP A;  1QKB A;  2Y7I A;  4XTC Q;  3FJM A;  1A8E A;  4WXJ A;  1II5 A;  1S50 A;  1TXF A;  1HSJ A;  2VOZ A;  2W7Y A;  3EHS A;  3GBB A;  3G3J A;  1XT8 A;  3K6U A;  3LSL A;  5DYH A;  1SW4 A;  1A55 A;  2OWT A;  3A3C A;  4I8C A;  2OK2 A;  3EHU A;  3FAT A;  1B2H A;  3IOR A;  4ND9 A;  2DSF A;  3TAJ A;  4C0R A;  4P0I A;  1JW4 A;  1WOD A;  1Y4T A;  4U1Z A;  2OBG A;  2XXW A;  2WOL A;  4OMB A;  3DRI A;  4DXC A;  1MQG A;  3DM0 A;  4IO7 A;  1FW0 A;  2E1S A;  3TDJ A;  2O1L A;  1MH3 A;  2XX8 A;  2ZXT A;  1MXU A;  5DVJ A;  3V5A A;  3PAM A;  3CG3 A;  3PPO A;  4IO2 A;  5JTY A;  3S9L C;  2RKM A;  2V93 A;  3H6U A;  2M8C A;  3IL1 B;  4KYD A;  4Q0C A;  1B46 A;  1SBP A;  4KYE A;  2AL4 A;  1Y3N A;  1IZ1 A;  4XKN A;  3ZS6 A;  2VGQ A;  3DP6 A;  3IAZ A;  5M2V A;  3U94 A;  3VXB A;  4BDQ A;  1H76 A;  1WVJ A;  3AXF A;  3VDF A;  2R9J A;  4OWD A;  2Z22 A;  4Q5T A;  3VE1 B;  5FTI A;  1B4H A;  1OIB A;  1PB9 A;  1ANF A;  1BLF A;  3N26 A;  2Y84 A;  2XX9 A;  4JWY A;  1GR2 A;  2DP8 A;  1LBC A;  2DWJ A;  2FNC A;  2GFE A;  3FXQ A;  1ZBM A;  1MXV A;  2GRV A;  1Z7N E;  2OWS A;  5H8H B;  3ZKK A;  1SI0 A;  5AE4 A;  1T0K A;  5ICT A;  3H6V A;  3MBP A;  1BP5 A;  3M8U A;  2QS1 A;  2QS4 A;  1SQY A;  3G7W A;  1Y3P A;  1QW0 A;  2Q88 A;  1QUK A;  3CFZ A;  3H03 A;  3RT8 A;  3PGF A;  1ZU0 A;  5CC2 A;  3FVG A;  1CB6 A;  1MH4 A;  3QXM A;  1POY 1;  2V3T A;  2XXH A;  1IIW A;  1UTH A;  3T9V A;  3KG2 A;  3VFJ A;  5CM6 A;  3KGC A;  4G68 B;  3G3I A;  2Q89 A;  4IGR A;  2Y7K A;  3UN6 A;  4LVQ A;  1D3K A;  3C4M A;  2V84 A;  1B58 A;  3MZ9 A;  2O1M A;  3KN7 A;  2A5T A;  5L9O A;  4NWC A;  1PB8 A;  3U1O A;  2DXR A;  4JSO A;  3SEV A;  3MUQ A;  4RJZ A;  3PPQ A;  2ZYK A;  3UA8 A;  1LFI A;  4WEP A;  4UA8 A;  4PFT A;  2DQV A;  2XHD A;  2VHA A;  3RTF B;  3K4U A;  1A8F A;  1N04 A;  4OFO A;  1B7H A;  1B3E A;  3A3U A;  3MP1 A;  1B5I A;  4WKM A;  5H8F A;  1SW5 A;  2NWJ A;  2PMS A;  5DEX A;  3WAF A;  1FQA A;  3PPN A;  1ZKB A;  3H4Z A;  4H65 A;  4BDL A;  1N7X A;  3MJN A;  3K1M A;  5JEI A;  4MFI A;  1QUI A;  1IIT A;  1MPD A;  2I0B A;  4HCY A;  3FV1 A;  4IY5 A;  2NOO A;  4NED A;  3Q25 A;  1LAH E;  2O51 A;  1VR5 A;  1H3D A;  2ESN A;  4OHN A;  3IR1 A;  4P11 A;  4QSE A;  1LAG E;  4RYA A;  3V83 A;  4ZE8 A;  2B3F A;  5I2K A;  4PFU A;  1R9Q A;  4I62 A;  1EZP A;  2XXR A;  1PBQ A;  5TP9 B;  4R6K A;  2G93 A;  4YKI A;  3RPW A;  1AH5 A;  2I3V A; 
#chains in the Genus database with same CATH topology
 3OSQ A;  5H8F B;  4HTG A;  4K3F A;  1XOC A;  5IKB A;  1IXI A;  3O29 A;  1DBZ A;  4F31 B;  1SDX A;  2O69 A;  3KC0 A;  2DXY A;  1A54 A;  3JZJ A;  3VVE A;  4EQB A;  4R6Y A;  1SYI A;  2I49 A;  2CZK A;  1RDZ A;  1DMB A;  4H8J A;  3IK6 B;  4R2F A;  3RLF E;  3T1B A;  3K01 A;  4IGT A;  3DEL B;  2WEF A;  2X7P A;  2O6A A;  2A5T B;  1JEV A;  4PET A;  1JW5 A;  1CE2 A;  1ELJ A;  3JV9 A;  4NN3 A;  4O7I A;  1BIY A;  1NL5 A;  5ESY A;  3G3K A;  1PEB A;  3RTW B;  2GHA A;  4FJP A;  2XXP A;  3K6V A;  1I69 A;  2QMX A;  3EPE A;  2HFB A;  5I56 B;  1N7W A;  5TPA B;  4X04 A;  2HXR A;  2OJT A;  3RT6 B;  4F1U A;  1SD3 A;  4U4S A;  5L9M A;  4F39 A;  4XF5 A;  3VLW A;  5KZT A;  3JYR A;  3Q26 A;  4H5G A;  4NF5 A;  4DI4 B;  4MJO A;  1FTK A;  3O9P A;  3LVU A;  4MNC A;  5DEX B;  2XD2 A;  4EQ7 A;  2DOJ A;  4GXS B;  4GX3 A;  5CMM A;  5I56 A;  1NI9 A;  3TTR A;  2FA7 A;  4FE8 A;  3GXA A;  2HHM A;  2NXO A;  1LAX A;  4O3A A;  4LON B;  4GL0 A;  4FAJ A;  3U92 A;  1P1O A;  4G68 A;  2B3B A;  3EQ1 A;  1NV7 A;  5BUU A;  3OEN A;  2BJI A;  2F97 A;  2QMW A;  4NTL A;  2H5Y A;  4NF8 B;  3H6W A;  2ZYN A;  2QPQ A;  1DPP A;  1Y3Q A;  4YKJ A;  4F18 A;  1ZIU A;  1FBE A;  1IMD A;  3TTK A;  4P8B A;  2QSX A;  3DLN A;  1FSA A;  1MM7 A;  1NV2 A;  4DXC A;  1MPC A;  2F5X A;  3OEK A;  1LB9 A;  4ISU A;  1IMC A;  5I59 B;  2FYI A;  5EHM A;  3PD9 A;  3GZG A;  4NAP A;  4GRK A;  1MY0 A;  1MPB A;  3OEM A;  3PMX A;  5H8N A;  3R7X A;  4H6D A;  4WED A;  5KCJ A;  4JXI A;  1TFA A;  4OVJ A;  1M5F A;  4NGU A;  1UIU A;  2WX9 A;  4KCC A;  1MQI A;  4QRZ A;  3M3F A;  3T9X B;  4GF8 A;  3T9H B;  4AS4 A;  2RCA A;  3N6U A;  4NF6 A;  3OO6 A;  1Y4C A;  2R8T A;  3IB0 A;  3K1N A;  3QSL A;  3U8Q A;  1VSO A;  3OMB A;  1US5 A;  3MVW A;  5IZ3 A;  1JVX A;  4LZ8 A;  1XS5 A;  1B0L A;  3EF7 A;  2Y7R A;  4BDM A;  2Z8F A;  3U65 A;  2F78 A;  4LP2 B;  3U72 A;  3HFU A;  4O8M A;  4N6D A;  4R75 A;  3TCF A;  3TKD A;  1M5E A;  5B70 A;  3KBR A;  5AA4 B;  2V4C A;  3RPL B;  4EDP A;  3IFA A;  3B8B A;  3KC1 A;  4RPN A;  4PE5 B;  1XI6 A;  3BBR A;  1M5C A;  2AYS A;  2PYY A;  1D9Y A;  5F1Q A;  3IO4 A;  4P0G A;  4HCW A;  4ZEC A;  3DP4 A;  4MIJ A;  3OEL A;  3KN8 A;  4JWX A;  4R72 A;  4JSD A;  1LBX A;  3HN0 A;  2R6G E;  1LFH A;  4FEB A;  4N4U A;  3UOR A;  5BWJ A;  1N3X A;  4LZ7 A;  1ZLQ A;  1G0H A;  1I6A A;  1NUZ A;  3IB2 A;  2G29 A;  4HW8 A;  1LBB A;  5I59 A;  1MQH A;  5H8Q A;  2DWI A;  2PFZ A;  4ZED A;  3E13 X;  2RCB A;  1UQW A;  2P1S A;  3O28 A;  4MCO A;  3ZSF A;  4AB5 A;  1EH3 A;  1B6H A;  3C32 A;  2PVU A;  4TQU Q;  3SES A;  4P3L A;  4KPT A;  2PT2 A;  3IJX B;  4JDF A;  4TLL B;  5AA1 A;  1LCF A;  4NF4 B;  1UTB B;  3PMW A;  1N76 A;  4EXK A;  4PC9 A;  4ELP A;  4G8N A;  3KZG A;  1BTJ A;  5F24 A;  1QVS A;  4PDH A;  2IEE A;  4PTK A;  4IO3 A;  2DE2 A;  5CMB A;  4JB7 A;  4YMA A;  5LOM A;  1MY1 A;  1R9L A;  4GFR A;  2YLN A;  4DLD A;  3HPI A;  1B5H A;  4O94 A;  3LSX A;  4QSC A;  4RY1 A;  4NWD A;  4PGP A;  1NV4 A;  2P0S A;  3PTY A;  3RUM A;  4XTC Q;  1QKB A;  1II5 A;  3TAJ A;  3VV5 A;  2W7Y A;  2OWT A;  4ND9 A;  1B2H A;  2DSF A;  1Y4T A;  1LBW A;  2MKZ A;  4IO7 A;  2E1S A;  2XX8 A;  5DVJ A;  4P9K A;  1FPG A;  4KYE A;  1FTA A;  3DP6 A;  5M2V A;  2WBD A;  4BDQ A;  1WVJ A;  5EQ7 A;  3VDF A;  2R9J A;  5FTI A;  2DWJ A;  2DP8 A;  1LBC A;  3FXQ A;  2GFE A;  1MXV A;  2GRV A;  2QS1 A;  3M8U A;  2VPO A;  3H03 A;  3FVG A;  3QXM A;  2XXH A;  2V3T A;  4HE0 A;  1B58 A;  3MZ9 A;  5I5P A;  3PPQ A;  2ZYK A;  3UA8 A;  4UA8 A;  2DQV A;  2XHD A;  2FHY A;  1A8F A;  1N04 A;  5H8F A;  2VPN A;  2NWJ A;  2PMS A;  1FQA A;  3PPN A;  1N7X A;  3K1M A;  1FBF A;  4HCY A;  3V83 A;  1EZP A;  2QVU A;  2XXR A;  4YKI A;  4OFL A;  3SZP A;  4QFL A;  3Q28 A;  4U22 A;  2DWH A;  4OFJ A;  4MEV A;  1B40 A;  3W9V A;  4QFK A;  3E3K A;  1Q35 A;  1JW1 A;  5HBC A;  1IXC A;  4NE4 A;  2WKY A;  2F3B A;  2ONK E;  1JEU A;  3PUY E;  3KOT A;  3MVY A;  3MPK A;  3T9U A;  3CFX A;  4P1E A;  5DW8 A;  3PMV A;  3OO9 A;  3UK4 A;  3ZKL A;  2REG A;  4DXB A;  1Y9U A;  5FHM A;  2P3V A;  1FPL A;  1AL3 A;  4JWO A;  4QF9 A;  5H8H A;  1MY2 A;  2ABH A;  2HAV A;  4EUO A;  5IZ3 B;  3K6W A;  3CHG A;  3KBZ A;  3FUZ A;  4EF2 A;  1NUX A;  3KFM A;  3CSG A;  3E79 A;  4F2Q A;  2Q8J A;  1SVX B;  1AMF A;  1LCT A;  3HV1 A;  4GBV A;  3FBP A;  4NX1 A;  1Y1Z A;  5I84 A;  3TEL A;  1J1N A;  3HST A;  4OXV A;  1OLC A;  3MVZ A;  4KR5 A;  2I6E A;  1NNK A;  4YAH X;  5AA2 D;  3FVO A;  5H8N B;  5I2K B;  1SW1 A;  4G61 A;  3PUW E;  1MXW A;  3GLB A;  4ELO A;  3SER A;  1FQB A;  4HS7 A;  1UTB A;  1LLS A;  4H5F A;  3DRG A;  2F3D A;  3K2D A;  3QYT A;  4LUB A;  3S4U A;  2LAO A;  4ZEI A;  3LBS A;  3FJG A;  4Z7E A;  4QFO A;  1P1N A;  3QAX A;  2CZH A;  2ONR A;  3DRF A;  4ONY A;  2VT5 A;  3RNN A;  3BFU A;  2PCR A;  3MWB A;  4ZZA A;  3LSW A;  3K00 A;  2QVV A;  4ELR A;  4F22 A;  5K2X A;  3A09 A;  3LSF B;  1RKM A;  3IOT A;  2KLF A;  4IO4 A;  5DT6 A;  3FVK A;  3FZV A;  3HHG A;  1VE4 A;  2I4C A;  3O6G A;  3C36 A;  2F34 A;  3C31 A;  3S9N C;  4N07 A;  4GX6 A;  4LQ5 A;  4DZ1 A;  4PE3 A;  1HSE A;  3MC2 A;  4YMB A;  1FQF A;  4PCD A;  4LAT A;  3H3G A;  4TOZ A;  1A40 A;  4YU0 A;  3FXB A;  4NF5 B;  3O6I A;  4G4P A;  2ZZV A;  4GIZ A;  2XWV A;  1NFT A;  2HZK A;  4X8R A;  3WAE A;  1Y1M A;  3QK6 A;  4NMY A;  4OEU A;  4H45 A;  2NVU B;  1EZ9 A;  4QHQ A;  1K9Y A;  3CI8 A;  2E0S A;  3MP6 A;  1B5J A;  4L17 A;  1KWH A;  1O7T A;  1YPN A;  5CMC A;  2CZL A;  1YXI A;  3TTL A;  2UVI A;  4QXD A;  4KI0 E;  1L5T A;  5ITO A;  1TWY A;  1IXH A;  3D1R A;  3H7M A;  1EZO A;  2Y7W A;  1DSN A;  1P1W A;  2UXA A;  3BIH A;  2DDK A;  3FXR A;  2P2A A;  1EYJ A;  5HPQ A;  4G77 A;  4F2O A;  2UVG A;  1DK4 A;  3CRB A;  1NNP A;  1Q9D A;  4GLI A;  4YB7 A;  1MXY A;  1D4N A;  1YYZ A;  1ZJL A;  3RQT A;  4UAC A;  2XWI A;  3O97 A;  4IO5 A;  1AIV A;  1D9V A;  3H06 B;  3N6T A;  4FED A;  1P1Q A;  1N0T A;  5L8D A;  4DIG A;  1IMA A;  3NOH A;  4GX4 A;  3MW0 A;  2THI A;  3RYD A;  4ESX A;  5J16 A;  2PFY A;  4XEQ A;  3B7D A;  5IZZ A;  1LEV A;  3FGS A;  2QFL A;  2ZYM A;  2XWO A;  1K9Z A;  5F7V A;  3PPP A;  4NF0 A;  5K2Y A;  3VXC A;  2WYK A;  4E0W A;  4EXL A;  3RYB A;  4Q8R A;  4G8M A;  4TLM B;  1KA0 A;  1XVY A;  4F3S A;  5CRY A;  3T22 A;  3PUV E;  1SPI A;  3DP8 A;  2X26 A;  3BKI B;  5FTH A;  4G8H A;  4ZE9 A;  1LB8 A;  4NHB A;  2Z8E A;  5TU0 A;  1FTM A;  4X9T A;  1MQJ A;  5LDZ A;  3IOW A;  4GOT A;  4PFI A;  1DPE A;  3C9H A;  4F3B A;  3ISP A;  3QUF A;  2AL5 A;  1UIV A;  1LBV A;  5EYF A;  2HAU A;  3BIG A;  3PU5 A;  4BDR A;  4YB5 A;  1NKX A;  5TPA A;  2I48 A;  2VD3 A;  4KD5 A;  1FTO A;  3UIF A;  1OLA A;  4FOR A;  2WOK A;  1OMP A;  1GGG A;  3TUS A;  1FJ9 A;  3W9W A;  2DE4 A;  4KFQ A;  4OVP A;  3H6T A;  4OVS A;  2I4B A;  2DE3 A;  4F29 A;  2ALU A;  4F19 A;  1R6Z A;  5AA2 B;  4PAK A;  3B6W A;  2FVZ A;  1NV5 A;  4PP0 A;  3FJM A;  2XXK A;  4P11 A;  1FBG A;  3GBB A;  3K6U A;  5J1D A;  1SW4 A;  3EHU A;  3A3C A;  3FAT A;  3IOR A;  3V8X B;  4C0R A;  4P0I A;  2WOL A;  4OMB A;  1MXU A;  3PAM A;  5JTY A;  4PBH A;  4KYD A;  1FPD A;  3VXB A;  2ZZX A;  3AXF A;  4OWD A;  3N26 A;  2Q8M A;  5ET5 A;  4ECF A;  5AE4 A;  1SI0 A;  3H6V A;  3MBP A;  1Y3P A;  1QUK A;  1MH4 A;  1UTH A;  3KG2 A;  1D3K A;  2XA5 A;  2O1M A;  3KN7 A;  4NWC A;  1PB8 A;  4JSO A;  4RJZ A;  4PFT A;  3K4U A;  4OFO A;  1B7H A;  1B3E A;  3MP1 A;  1B5I A;  4WKM A;  4MFI A;  4IY5 A;  1VR5 A;  4OHN A;  1LAG E;  2GQ1 A;  4ZE8 A;  1R9Q A;  4I62 A;  5TP9 B;  3RPW A;  1AH5 A;  1FPI A;  2I3V A;  5ET7 A;  5TP9 A;  1B7U A;  4H0W A;  1FQE A;  1LFG A;  5ISU A;  4FIM A;  4JVD A;  2V25 A;  4OET A;  4GWU A;  4MH5 A;  1WDN A;  5T3J A;  3IO6 A;  4AS5 A;  5I58 B;  4O3C A;  4QSD A;  2OWZ A;  4F3P A;  2RC8 A;  4GXA A;  3G3G A;  3VVF A;  1VFD A;  4KCD A;  4THI A;  3I3V A;  2H98 A;  1Y20 A;  3B6Q A;  4QFP A;  4RNS A;  4BDN A;  3QMF A;  1HSL A;  4LQ2 A;  1LBZ A;  2F7C A;  1T0K A;  3K02 A;  4MAG A;  3FVN A;  1OQG A;  2B65 A;  4LN5 A;  2UYE A;  2B4L A;  1B51 A;  1NV0 A;  4MMP A;  3UP9 A;  4F3G A;  4GWZ A;  4DE8 A;  4XKP A;  4N17 A;  1XHY A;  1QJM A;  3CFL A;  4R2B A;  2O68 A;  1I6Q A;  3C33 A;  2DVC A;  1EU8 A;  1H44 A;  2ZMB A;  3ECR A;  4QBA A;  1YCJ A;  3RY3 A;  4OEN A;  3BFT A;  3S2V A;  4ZDM A;  1FRP A;  3ILT B;  1SW2 A;  3THI A;  2H99 A;  3CSB A;  4OA4 A;  5AA3 A;  1YZ0 A;  3VLV A;  2V3Q A;  2F35 A;  1MQD A;  3LV0 A;  2D5W A;  5FHO A;  4KHZ E;  4GL8 A;  3IB1 A;  4Z0I A;  2DWA A;  3SEW A;  1S9T A;  4DCX A;  1MY4 A;  3D4G A;  3FTO A;  3TMG A;  3TQW A;  2WYP A;  4M4G A;  4PGN A;  3KSX A;  2XXI A;  4ZEK A;  1D9Q A;  3KJT A;  4G68 C;  5EQ8 A;  2X7Q A;  1OQH A;  3ILU B;  2NUV A;  1IQ7 A;  4RXL A;  4P56 A;  1OVB A;  4BDO A;  1RDX A;  4ESW A;  4DXU A;  3ZKK A;  5KDT B;  3MPL A;  5I57 A;  3SET A;  4HXV A;  3TTM A;  2REJ A;  1URS A;  1QGX A;  4H1X A;  3FAS A;  4YKK A;  1B32 A;  2ZNS A;  3K0V A;  4OTE A;  2ANJ A;  4XXU A;  3DRH A;  3UGW A;  1B9J A;  1S7Y A;  3M3K A;  2FIE A;  5I2N A;  4R73 A;  3MAM A;  5H8Q B;  1NMU A;  2QRY A;  5EQ9 A;  5CMK A;  3O6P A;  2Q9T A;  2DVZ A;  3FJ7 A;  4N8Y A;  4OEV A;  1MY3 A;  2UYF A;  2F8D A;  1RYX A;  1NH7 A;  2HQ0 A;  1FTJ A;  5AA4 A;  4YKP A;  3EHT A;  3B6T A;  2P3N A;  2QL3 A;  3K6X A;  1IUD A;  3MQ9 A;  2PX1 A;  4MLV A;  2Z8D A;  3HCQ A;  1B3G A;  2QS3 A;  4QFN A;  4EQ9 A;  1DOT A;  1M5D A;  3O66 A;  2XWK A;  1DCU A;  5I2N B;  1G0I A;  3TEP A;  1KA1 A;  5JK4 A;  4H46 A;  3CG1 A;  3OOA A;  4N8G A;  4R6H A;  1SI1 A;  4XFE A;  1QUL A;  1Q1K A;  3SEX A;  2XXY A;  2Y5L A;  4O3B A;  4R9G A;  3CR9 A;  4I9D A;  3LR1 A;  3O2A A;  1FQD A;  2AIX A;  2KQZ A;  5I57 B;  4PBQ A;  1IME A;  3FV2 A;  2L5V A;  4U21 A;  1YTV A;  1MS7 A;  3T0J A;  2ONS A;  4U2R A;  3RYA A;  3PPR A;  2XXX A;  4ZEB A;  4PF8 A;  1A7L A;  4ZS9 A;  1USY H;  2I58 A;  3VVD A;  1ZMG A;  4N91 A;  5ELV A;  4PAI A;  1VFE A;  1PDA A;  4OES A;  1NUY A;  2Q2C A;  1FJ6 A;  3GBA A;  3KN3 A;  2ZNU A;  1F9B A;  2RIN A;  2XX7 A;  5FBP A;  4X1D A;  1AOV A;  1DTG A;  3DRJ A;  4FAT A;  2UVJ A;  2O7U A;  4N15 A;  1NV1 A;  5A5L A;  4YIC A;  1FBC A;  3I5O A;  1BK4 A;  2UVH A;  4I40 A;  3N94 A;  5L9S A;  2V3U A;  2CEX A;  4GWY A;  4OVR A;  4N81 A;  2Q2A A;  4HE1 A;  4Q30 B;  4IO6 A;  1NNT A;  3A29 A;  3DRK A;  1B3H A;  1N84 A;  1P1U A;  3OO8 A;  1IMB A;  4KXP A;  3W15 C;  1DTZ A;  4NF4 A;  1MDQ A;  3QIM A;  2FIX A;  3RGY A;  5CBR A;  5IZ1 A;  3V89 B;  4N13 A;  3I6V A;  3O6H A;  3SDF A;  4RK9 A;  2BJJ X;  4OAN A;  1A8E A;  3LSL A;  2VOZ A;  3EHS A;  5KDT A;  5DYH A;  2OK2 A;  3DRI A;  3DM0 A;  2ZXT A;  3CG3 A;  2RKM A;  3H6U A;  3IL1 B;  1B46 A;  4NQ8 A;  2AL4 A;  5LTC A;  3U94 A;  3IAZ A;  1B4H A;  1BLF A;  2Y84 A;  1GR2 A;  1ZBM A;  5ICT A;  1SQY A;  3G7W A;  2Q88 A;  1QW0 A;  5I3S A;  3CFZ A;  3RT8 A;  3PGF A;  1POY 1;  3T9V A;  1IIW A;  5CM6 A;  2Q89 A;  2Y7K A;  3ROJ A;  1FBH A;  4MNP A;  2V84 A;  2A5T A;  3SEV A;  3MUQ A;  1FPE A;  4I3E A;  4IR8 A;  2HPG A;  2VHA A;  2JJK A;  4O7M A;  1SW5 A;  4BDL A;  4H65 A;  3MJN A;  4I3Y A;  1QUI A;  1MPD A;  2NOO A;  3Q25 A;  1LAH E;  3IR1 A;  4RYA A;  1PBQ A;  4R6K A;  2D21 A;  5ICQ A;  4AB6 A;  2XXQ A;  1B52 A;  1NUW A;  4E0X A;  5I7I A;  4GD5 A;  2Y7P A;  4OZ9 A;  2QJE A;  2WOP A;  4KQP A;  5A5X B;  4YZZ A;  1O64 A;  4RA1 A;  1FBP A;  1FQC A;  3EKI A;  3S9E A;  1QUJ A;  3K1P A;  4U1O A;  4RPO A;  4PQJ A;  1XC1 A;  3TPA A;  1GV8 A;  5DVI A;  5I58 A;  4F1Y A;  1A99 A;  4PAF A;  1RYO A;  2D3I A;  5JTY B;  3B50 A;  2HEU A;  2H9B A;  2H4I A;  3OXN A;  4IB2 A;  1FPB A;  3PD8 A;  1EYI A;  1JVY A;  3T96 B;  3LUZ A;  3C35 A;  3OD7 A;  1R1N A;  2OX3 A;  2DS9 A;  4IY6 A;  3D4C A;  3E4R A;  2B4M A;  2XXT A;  3L6H A;  2QS2 A;  4POW A;  3KSJ A;  1JNF A;  4LZ5 A;  1FCK A;  4GVO A;  4R74 A;  4P47 A;  1INP A;  4OYV A;  4ZZE A;  3CIJ A;  3KEI A;  5FHN A;  2Y5K A;  1KZ8 A;  1P99 A;  3P7I A;  3R26 A;  1H45 A;  2RC9 A;  4ELQ A;  1Z7M E;  4PFY A;  1URG A;  5IM2 A;  3IOU A;  3GYY A;  2VP1 A;  4OVQ A;  3IJO B;  3USD A;  4FBP A;  1TT1 A;  1B05 A;  2F6G A;  5IGA A;  3E9X A;  3LC8 A;  1MDP 1;  2PBW A;  4X48 A;  1O63 A;  1SYH A;  1FTL A;  2XD3 A;  2XXU A;  4GWO A;  3M3L A;  3PV0 E;  3OO7 A;  1IXG A;  3Q29 A;  1JP4 A;  4XIG Q;  2Z23 A;  3TYH A;  1B0H A;  4ZEF A;  2FBP A;  3MVX A;  4MBP A;  1M5B A;  1EYK A;  1BKA A;  2GHB A;  3F11 A;  4MF3 A;  4LVQ A;  3R6U A;  1XVX A;  3HHF A;  1PC3 A;  5ET6 A;  1URD A;  3T66 A;  5ET8 A;  3PUZ E;  3IX1 A;  1MM6 A;  4KYS A;  2R71 A;  1MXX A;  1PBP A;  4N6K A;  5IAI A;  4M1V A;  1B4Z A;  1B1H A;  4XKR A;  1B7Z A;  4RK2 A;  4F1V A;  5CBS A;  2OZZ A;  4MHF A;  1H43 A;  2O7I A;  3FD3 A;  3MZ1 A;  3G3H A;  3OSR A;  4GWS A;  4AQ4 A;  3TFL A;  1NH8 A;  1LBY A;  1I6B A;  4DDD A;  3TZA A;  1GVC A;  3KOS A;  3MP8 A;  3IOV A;  2OLB A;  3TTN A;  1LAF E;  4BLA A;  1FPK A;  2IA4 A;  3TOD A;  4OVT A;  2HZL A;  1US4 A;  5EYH A;  1JQF A;  1OVT A;  2F7B A;  4FEC A;  3ONM A;  2I0C A;  4GQO A;  3KJ7 A;  3ODB A;  5EHS A;  3TQL A;  4EF1 A;  1ATG A;  4OER A;  1MXZ A;  1MG1 A;  1FPF A;  3N5L A;  3SEY A;  3S9M C;  1IEJ A;  1FBD A;  1NV6 A;  1LST A;  2YJP A;  2DYX A;  4C1U A;  3LUY A;  4GWX A;  2F36 A;  5B7D A;  2RF1 A;  3VLU A;  3HO7 A;  4U4X A;  2HXW A;  3G3F A;  4U23 A;  3SEU A;  1UTH B;  4H8I A;  4I1D A;  3TCG A;  5H8S A;  2GH9 A;  3SKP A;  3RN8 A;  2A5S A;  1ZTY A;  4PFW A;  4LA9 A;  4MLQ A;  1YAE A;  5KCJ B;  2PT1 A;  1CNQ A;  1QKA A;  1GTK A;  3FXU A;  2CMO A;  3C34 A;  3FIR A;  4P1L A;  1VDW A;  3U93 A;  2XXV A;  5EQA A;  2RC7 A;  4YB6 A;  2ZNT A;  4PDD A;  2HCA A;  2OCU A;  3PUX E;  5A5X A;  4N6P A;  4DCY A;  5HM4 B;  4X1B A;  4R9F A;  3Q27 A;  2O84 X;  4POX A;  2F7A A;  1N3W A;  3L6G A;  1TFD A;  3TCH A;  5DTB A;  2QVR A;  1FPJ A;  5CI5 A;  1PB7 A;  1B3L A;  1LGB C;  2YPN A;  4C1T A;  3QUJ A;  4NF8 A;  4XKQ A;  4G2Z A;  2ZZW A;  4PFB A;  5AA2 A;  1JET A;  1NNF A;  1B1X A;  3T93 B;  2H25 A;  1USY E;  4H67 A;  3CVG A;  3IFC A;  2Q74 A;  4JVC A;  4NF6 B;  2I3W A;  5EYG A;  4PFR A;  2ZYO A;  4PF6 A;  2F6P A;  1B3F A;  1POT A;  4NG7 A;  5DVF A;  5ITP A;  4JVI A;  3MST A;  3EN3 A;  4OQO A;  3MZB A;  2VD2 A;  1MRP A;  2Y7I A;  4WXJ A;  1S50 A;  1TXF A;  1HSJ A;  3G3J A;  1XT8 A;  4JBZ A;  1A55 A;  4I8C A;  1JW4 A;  1WOD A;  4U1Z A;  2OBG A;  2XXW A;  4HE2 A;  1MQG A;  1FW0 A;  3TDJ A;  2O1L A;  1MH3 A;  3V5A A;  1AWB A;  3PPO A;  4IO2 A;  3S9L C;  2V93 A;  2M8C A;  4Q0C A;  1SBP A;  1Y3N A;  1IZ1 A;  4XKN A;  3ZS6 A;  2VGQ A;  1H76 A;  4Q5T A;  2Z22 A;  3RPL A;  3VE1 B;  1OIB A;  2CEY A;  1PB9 A;  1ANF A;  2CZI A;  2XX9 A;  4JWY A;  2FNC A;  2OWS A;  1Z7N E;  5H8H B;  1BP5 A;  2QS4 A;  4UAB A;  1ZU0 A;  4GWW A;  5CC2 A;  1CB6 A;  3VFJ A;  3KGC A;  2KR0 A;  3G3I A;  4G68 B;  3E78 A;  4IGR A;  4DI3 D;  3UN6 A;  3C4M A;  2WBB A;  5L9O A;  3U1O A;  2DXR A;  1LFI A;  4WEP A;  3RTF B;  4GBW A;  3A3U A;  5DEX A;  3WAF A;  1ZKB A;  3H4Z A;  5JEI A;  1RDY A;  4MNI A;  1IIT A;  4MX6 A;  2I0B A;  3FV1 A;  4NED A;  2O51 A;  2ESN A;  1H3D A;  4QSE A;  1NV3 A;  2B3F A;  5I2K A;  4PFU A;  3MYU A;  1IMF A;  2G93 A; 
#chains in the Genus database with same CATH homology
 3OSQ A;  2D21 A;  5H8F B;  4QFL A;  3Q28 A;  5ICQ A;  4U22 A;  2DWH A;  4HTG A;  5TP9 A;  4AB6 A;  4OFJ A;  4K3F A;  1B40 A;  1XOC A;  2XXQ A;  1B7U A;  1B52 A;  4QFK A;  3W9V A;  4H0W A;  3E3K A;  1FQE A;  1LFG A;  4E0X A;  1Q35 A;  1JW1 A;  5HBC A;  5IKB A;  1IXC A;  2Y7P A;  5ISU A;  4GD5 A;  4NE4 A;  2QJE A;  4OZ9 A;  2WKY A;  2WOP A;  2ONK E;  4FIM A;  4KQP A;  1IXI A;  3O29 A;  5A5X B;  1JEU A;  3PUY E;  4F31 B;  1SDX A;  2O69 A;  3KOT A;  3MVY A;  2V25 A;  4OET A;  3MPK A;  4YZZ A;  3T9U A;  2DXY A;  1A54 A;  3CFX A;  1O64 A;  3JZJ A;  1WDN A;  4MH5 A;  3VVE A;  4EQB A;  4RA1 A;  3IO6 A;  3PMV A;  4R6Y A;  1SYI A;  3OO9 A;  5I58 B;  4O3C A;  1FQC A;  4QSD A;  2I49 A;  3UK4 A;  1DMB A;  4F3P A;  2RC8 A;  3ZKL A;  4GXA A;  3S9E A;  2REG A;  1QUJ A;  4DXB A;  3G3G A;  3K1P A;  4H8J A;  1VFD A;  1Y9U A;  4RPO A;  4U1O A;  5FHM A;  1AL3 A;  4JWO A;  4QF9 A;  4KCD A;  5H8H A;  4PQJ A;  3IK6 B;  4THI A;  1MY2 A;  1XC1 A;  3I3V A;  2ABH A;  4R2F A;  2H98 A;  1Y20 A;  2HAV A;  3RLF E;  3TPA A;  3B6Q A;  4QFP A;  4RNS A;  3K6W A;  4BDN A;  4EUO A;  3K01 A;  4IGT A;  3DEL B;  1GV8 A;  1HSL A;  2X7P A;  2F7C A;  2O6A A;  2A5T B;  4LQ2 A;  3CHG A;  1JEV A;  3FUZ A;  3K02 A;  4EF2 A;  4PET A;  3KFM A;  3CSG A;  5DVI A;  1JW5 A;  3FVN A;  5I58 A;  4F2Q A;  4F1Y A;  1OQG A;  1A99 A;  2Q8J A;  1CE2 A;  1SVX B;  1AMF A;  1ELJ A;  2B65 A;  1LCT A;  3JV9 A;  3HV1 A;  2UYE A;  1RYO A;  2D3I A;  2B4L A;  5JTY B;  1BIY A;  1B51 A;  1Y1Z A;  1NL5 A;  2HEU A;  2H9B A;  2H4I A;  3TEL A;  5I84 A;  3OXN A;  3G3K A;  4IB2 A;  1PEB A;  1J1N A;  3UP9 A;  3HST A;  3PD8 A;  3RTW B;  2GHA A;  4F3G A;  4DE8 A;  4XKP A;  5J1D A;  4FJP A;  2XXP A;  4OXV A;  1OLC A;  1XHY A;  3K6V A;  1QJM A;  1I69 A;  3MVZ A;  1JVY A;  2QMX A;  3T96 B;  4KR5 A;  3EPE A;  3C35 A;  2I6E A;  1NNK A;  3CFL A;  3OD7 A;  1R1N A;  4R2B A;  4YAH X;  5AA2 D;  2HFB A;  5I56 B;  1N7W A;  5TPA B;  3FVO A;  2DS9 A;  2O68 A;  1I6Q A;  3C33 A;  2DVC A;  4IY6 A;  1EU8 A;  2OJT A;  1H44 A;  3D4C A;  3E4R A;  5H8N B;  2B4M A;  2XXT A;  3L6H A;  5I2K B;  2QS2 A;  2ZMB A;  1SW1 A;  4POW A;  3KSJ A;  3RT6 B;  1JNF A;  3PUW E;  4LZ5 A;  1MXW A;  4F1U A;  1SD3 A;  3GLB A;  1FCK A;  3ECR A;  4U4S A;  5L9M A;  4F39 A;  4ELO A;  3VLW A;  5KZT A;  1FQB A;  3JYR A;  4GVO A;  4R74 A;  4HS7 A;  3SER A;  1YCJ A;  1UTB A;  4OYV A;  1LLS A;  4ZZE A;  3CIJ A;  3KEI A;  3RY3 A;  4H5F A;  3Q26 A;  5FHN A;  4H5G A;  4NF5 A;  3DRG A;  4OEN A;  1P99 A;  3K2D A;  3P7I A;  3BFT A;  3R26 A;  1H45 A;  3QYT A;  4LUB A;  4ZDM A;  3S2V A;  2RC9 A;  3O9P A;  3LVU A;  1FTK A;  2LAO A;  4ZEI A;  1SW2 A;  3ILT B;  3S4U A;  4ELQ A;  1Z7M E;  3LBS A;  3VV5 A;  3THI A;  3FJG A;  2H99 A;  4Z7E A;  4QFO A;  5DEX B;  3CSB A;  4PFY A;  1P1N A;  2XD2 A;  3QAX A;  2DOJ A;  3VLV A;  4GXS B;  4EQ7 A;  2V3Q A;  5AA3 A;  2F35 A;  2ONR A;  1URG A;  5CMM A;  1MQD A;  5I56 A;  3TTR A;  2FA7 A;  3DRF A;  3IOU A;  4FE8 A;  3GXA A;  2D5W A;  4ONY A;  5FHO A;  2VP1 A;  3RNN A;  2NXO A;  3IJO B;  3USD A;  3BFU A;  1LAX A;  4KHZ E;  4O3A A;  1TT1 A;  4LON B;  4GL8 A;  1B05 A;  2F6G A;  4GL0 A;  3MWB A;  4ZZA A;  4FAJ A;  3E9X A;  3IB1 A;  3U92 A;  3LC8 A;  4Z0I A;  1MDP 1;  2DWA A;  3LSW A;  3SEW A;  3K00 A;  4ELR A;  4F22 A;  1P1O A;  1S9T A;  2PBW A;  4G68 A;  2B3B A;  5K2X A;  3A09 A;  4DCX A;  3EQ1 A;  3LSF B;  4X48 A;  3V8X B;  1RKM A;  1MY4 A;  3IOT A;  5BUU A;  3D4G A;  2KLF A;  3OEN A;  3FTO A;  3TMG A;  3TQW A;  1O63 A;  2F97 A;  4IO4 A;  1SYH A;  2QMW A;  3FVK A;  3FZV A;  4NTL A;  5DT6 A;  2H5Y A;  3HHG A;  1VE4 A;  4M4G A;  4NF8 B;  1FTL A;  3H6W A;  2I4C A;  2XD3 A;  2XXU A;  3KSX A;  4GWO A;  2ZYN A;  3O6G A;  2XXI A;  3C36 A;  3M3L A;  2F34 A;  3C31 A;  3S9N C;  2QPQ A;  4ZEK A;  3PV0 E;  3OO7 A;  4N07 A;  3KJT A;  4G68 C;  1IXG A;  1DPP A;  4LQ5 A;  4DZ1 A;  1HSE A;  1OQH A;  2X7Q A;  3ILU B;  3MC2 A;  3Q29 A;  1Y3Q A;  4XIG Q;  4YKJ A;  4F18 A;  1FQF A;  1ZIU A;  2NUV A;  2Z23 A;  3TYH A;  4YMB A;  1IQ7 A;  4LAT A;  4RXL A;  3H3G A;  1B0H A;  4ZEF A;  4TOZ A;  1OVB A;  3MVX A;  4JBZ A;  1A40 A;  4MBP A;  4YU0 A;  3TTK A;  4BDO A;  1M5B A;  2QSX A;  4NF5 B;  3DLN A;  3O6I A;  1BKA A;  4DXU A;  4ESW A;  1MM7 A;  2GHB A;  4G4P A;  3F11 A;  4MF3 A;  4GIZ A;  1MPC A;  1XVX A;  2F5X A;  1LB9 A;  3HHF A;  1PC3 A;  3MPL A;  3OEK A;  3R6U A;  1NFT A;  4ISU A;  2FYI A;  3SET A;  5I59 B;  1URD A;  5EHM A;  5I57 A;  2HZK A;  3PD9 A;  3T66 A;  3TTM A;  3GZG A;  2REJ A;  3PUZ E;  1URS A;  3IX1 A;  1MM6 A;  4KYS A;  4GRK A;  1MY0 A;  3U93 A;  3WAE A;  4H1X A;  1MPB A;  3FAS A;  2R71 A;  1Y1M A;  3OEM A;  3QK6 A;  4OEU A;  4NMY A;  3PMX A;  4YKK A;  5H8N A;  2NVU B;  1EZ9 A;  3R7X A;  4QHQ A;  1B32 A;  1MXX A;  2ZNS A;  3K0V A;  1PBP A;  3CI8 A;  4H6D A;  2ANJ A;  4OTE A;  5IAI A;  2E0S A;  4M1V A;  3MP6 A;  4WED A;  1B5J A;  1B4Z A;  5KCJ A;  1B1H A;  1TFA A;  4JXI A;  4L17 A;  1KWH A;  4OVJ A;  1M5F A;  3DRH A;  4XKR A;  1B9J A;  4XXU A;  1UIU A;  1B7Z A;  4KCC A;  1MQI A;  4QRZ A;  4RK2 A;  1S7Y A;  1O7T A;  3M3F A;  3T9X B;  4F1V A;  4GF8 A;  1YPN A;  3M3K A;  5CMC A;  3T9H B;  5CBS A;  2CZL A;  5I2N A;  4R73 A;  2RCA A;  3TTL A;  2OZZ A;  3N6U A;  4NF6 A;  3MAM A;  5H8Q B;  5KDT A;  1H43 A;  2UVI A;  2O7I A;  3FD3 A;  4KI0 E;  3MZ1 A;  3G3H A;  3OO6 A;  3OSR A;  1L5T A;  1NMU A;  1Y4C A;  4AQ4 A;  5ITO A;  2QRY A;  1TWY A;  3IB0 A;  3K1N A;  3TFL A;  1NH8 A;  1IXH A;  3QSL A;  1I6B A;  4DDD A;  3H7M A;  1EZO A;  3TZA A;  3U8Q A;  1VSO A;  2Y7W A;  1GVC A;  3OMB A;  1DSN A;  1P1W A;  1US5 A;  2UXA A;  3KOS A;  3MP8 A;  3MVW A;  3FXR A;  3IOV A;  2OLB A;  3TTN A;  2P2A A;  1LAF E;  5FTH A;  5CMK A;  3O6P A;  1JVX A;  4BLA A;  4LZ8 A;  1XS5 A;  2Q9T A;  2IA4 A;  3TOD A;  5HPQ A;  1B0L A;  3EF7 A;  4G77 A;  2UVG A;  2HZL A;  4F2O A;  1US4 A;  2DVZ A;  2Y7R A;  1JQF A;  1NNP A;  3CRB A;  3FJ7 A;  4GLI A;  4YB7 A;  1OVT A;  2Z8F A;  4BDM A;  2F78 A;  1MXY A;  2F7B A;  4FEC A;  3ONM A;  1D4N A;  4LP2 B;  3U72 A;  1ZJL A;  3RQT A;  4UAC A;  2I0C A;  4GQO A;  3O97 A;  3KJ7 A;  4IO5 A;  4R75 A;  3TCF A;  4OEV A;  4ECF A;  1AIV A;  1D9V A;  3H06 B;  3TKD A;  1M5E A;  3N6T A;  3ODB A;  3KBR A;  5B70 A;  5EHS A;  4FED A;  1MY3 A;  5AA4 B;  1P1Q A;  4EDP A;  1N0T A;  5L8D A;  4DIG A;  2UYF A;  3TQL A;  4RPN A;  4EF1 A;  4PE5 B;  2F8D A;  3BBR A;  1ATG A;  1M5C A;  4OER A;  1RYX A;  3MW0 A;  3UGW A;  3VVF A;  1MXZ A;  1NH7 A;  2HQ0 A;  2AYS A;  1MG1 A;  1FTJ A;  5AA4 A;  2PYY A;  3EHT A;  3N5L A;  4YKP A;  3SEY A;  2THI A;  3B6T A;  4ESX A;  2QL3 A;  3K6X A;  3S9M C;  1IEJ A;  1D9Y A;  1IUD A;  5F1Q A;  3B7D A;  3IO4 A;  3MQ9 A;  2PX1 A;  1LST A;  2Z8D A;  4MLV A;  3FGS A;  4P0G A;  2YJP A;  2DYX A;  1B3G A;  3HCQ A;  2QS3 A;  4QFN A;  3LUY A;  4C1U A;  1DOT A;  1M5D A;  4EQ9 A;  3O66 A;  2ZYM A;  2F36 A;  4HCW A;  4ZEC A;  3DP4 A;  3OEL A;  5I2N B;  5B7D A;  3KN8 A;  4JWX A;  2RF1 A;  4R72 A;  3TEP A;  5F7V A;  5JK4 A;  3VLU A;  4JSD A;  3CG1 A;  3HO7 A;  2HXW A;  3HN0 A;  2R6G E;  3G3F A;  3OOA A;  4U4X A;  3PPP A;  4R6H A;  4U23 A;  3SEU A;  1LFH A;  1SI1 A;  4FEB A;  1UTH B;  4H8I A;  5K2Y A;  3UOR A;  4I1D A;  3VXC A;  4E0W A;  5BWJ A;  3TCG A;  1N3X A;  4LZ7 A;  5H8S A;  3RYB A;  2GH9 A;  4EXL A;  3SKP A;  4Q8R A;  1QUL A;  1ZLQ A;  1Q1K A;  1I6A A;  4G8M A;  2XXY A;  3RN8 A;  4TLM B;  2A5S A;  3SEX A;  1XVY A;  4O3B A;  4F3S A;  4R9G A;  5CRY A;  3CR9 A;  1ZTY A;  4I9D A;  3IB2 A;  4PFW A;  3LR1 A;  3O2A A;  1FQD A;  2AIX A;  4LA9 A;  3T22 A;  2G29 A;  4MLQ A;  1YAE A;  4HW8 A;  1LBB A;  5I57 B;  1MQH A;  5I59 A;  3PUV E;  5KCJ B;  5H8Q A;  2PT1 A;  3DP8 A;  2DWI A;  1QKA A;  1GTK A;  2CMO A;  2X26 A;  3C34 A;  3BKI B;  3FIR A;  4ZED A;  3FV2 A;  2XXV A;  3E13 X;  3FXU A;  4U21 A;  2RCB A;  4G8H A;  4ZE9 A;  1UQW A;  2P1S A;  1YTV A;  1LB8 A;  2RC7 A;  3O28 A;  1MS7 A;  2Z8E A;  4YB6 A;  2ONS A;  4U2R A;  3ZSF A;  2ZNT A;  4AB5 A;  1EH3 A;  5TU0 A;  3RYA A;  2HCA A;  4OFL A;  1B6H A;  2OCU A;  1FTM A;  3C32 A;  3PPR A;  3PUX E;  5A5X A;  2PVU A;  4N6P A;  4X9T A;  2XXX A;  4ZEB A;  4DCY A;  5HM4 B;  1A7L A;  1MQJ A;  4TQU Q;  3SES A;  4X1B A;  4KPT A;  4R9F A;  2PT2 A;  4ZS9 A;  1USY H;  2I58 A;  3IJX B;  1ZMG A;  3IOW A;  3Q27 A;  3VVD A;  5ELV A;  4GOT A;  2O84 X;  4POX A;  4JDF A;  1VFE A;  2F7A A;  1N3W A;  1PDA A;  1DPE A;  4OES A;  4TLL B;  2Q2C A;  3C9H A;  5AA1 A;  4F3B A;  1LCF A;  3QUF A;  4NF4 B;  2AL5 A;  3GBA A;  1UTB B;  3KN3 A;  2ZNU A;  3L6G A;  1UIV A;  1F9B A;  1TFD A;  2RIN A;  3PMW A;  1N76 A;  2XX7 A;  3TCH A;  5DTB A;  5EYF A;  2HAU A;  4EXK A;  3PU5 A;  5CI5 A;  1PB7 A;  4ELP A;  4BDR A;  4X1D A;  1AOV A;  4YB5 A;  1B3L A;  1LGB C;  1NKX A;  2YPN A;  4C1T A;  3QUJ A;  4G8N A;  4NF8 A;  1DTG A;  3KZG A;  1BTJ A;  3DRJ A;  5TPA A;  2I48 A;  1QVS A;  4FAT A;  2UVJ A;  2VD3 A;  4XKQ A;  4KD5 A;  2O7U A;  4G2Z A;  1FTO A;  3UIF A;  1OLA A;  4YIC A;  3I5O A;  2IEE A;  2UVH A;  4FOR A;  3N94 A;  1JET A;  5AA2 A;  5L9S A;  2V3U A;  1NNF A;  2WOK A;  1B1X A;  5KDT B;  1OMP A;  2DE2 A;  4IO3 A;  5CMB A;  1GGG A;  3T93 B;  4JB7 A;  2H25 A;  4YMA A;  3TUS A;  1USY E;  3W9W A;  5LOM A;  1MY1 A;  3CVG A;  2DE4 A;  4H67 A;  4KFQ A;  2Q2A A;  4Q30 B;  4IO6 A;  1NNT A;  1R9L A;  3DRK A;  1B3H A;  1P1U A;  1N84 A;  3H6T A;  4GFR A;  3OO8 A;  2I4B A;  3W15 C;  1DTZ A;  2DE3 A;  2YLN A;  4NF6 B;  4NF4 A;  4DLD A;  4F29 A;  3HPI A;  1B5H A;  1MDQ A;  2ALU A;  2I3W A;  3QIM A;  3LSX A;  2ZYO A;  4F19 A;  2F6P A;  4QSC A;  3RGY A;  1R6Z A;  4RY1 A;  1B3F A;  1POT A;  4NWD A;  3V89 B;  5DVF A;  5AA2 B;  4N13 A;  3I6V A;  5CBR A;  5ITP A;  3EN3 A;  3O6H A;  3SDF A;  2P0S A;  3MZB A;  4OQO A;  2BJJ X;  4RK9 A;  3RUM A;  3B6W A;  2VD2 A;  4PP0 A;  1MRP A;  1QKB A;  2Y7I A;  4XTC Q;  3FJM A;  1A8E A;  4WXJ A;  1II5 A;  1S50 A;  1TXF A;  1HSJ A;  2VOZ A;  2W7Y A;  3EHS A;  3GBB A;  3G3J A;  1XT8 A;  3K6U A;  3LSL A;  5DYH A;  1SW4 A;  1A55 A;  2OWT A;  3A3C A;  4I8C A;  2OK2 A;  3EHU A;  3FAT A;  1B2H A;  3IOR A;  4ND9 A;  2DSF A;  3TAJ A;  4C0R A;  4P0I A;  1JW4 A;  1WOD A;  1Y4T A;  4U1Z A;  2OBG A;  2XXW A;  2WOL A;  4OMB A;  3DRI A;  4DXC A;  1MQG A;  3DM0 A;  4IO7 A;  1FW0 A;  2E1S A;  3TDJ A;  2O1L A;  1MH3 A;  2XX8 A;  2ZXT A;  1MXU A;  5DVJ A;  3V5A A;  3PAM A;  3CG3 A;  3PPO A;  4IO2 A;  5JTY A;  3S9L C;  2RKM A;  2V93 A;  3H6U A;  2M8C A;  3IL1 B;  4KYD A;  4Q0C A;  1B46 A;  1SBP A;  4KYE A;  2AL4 A;  1Y3N A;  1IZ1 A;  4XKN A;  3ZS6 A;  2VGQ A;  3DP6 A;  3IAZ A;  5M2V A;  3U94 A;  3VXB A;  4BDQ A;  1H76 A;  1WVJ A;  3AXF A;  3VDF A;  2R9J A;  4OWD A;  2Z22 A;  4Q5T A;  3VE1 B;  5FTI A;  1B4H A;  1OIB A;  1PB9 A;  1ANF A;  1BLF A;  3N26 A;  2Y84 A;  2XX9 A;  4JWY A;  1GR2 A;  2DP8 A;  1LBC A;  2DWJ A;  2FNC A;  2GFE A;  3FXQ A;  1ZBM A;  1MXV A;  2GRV A;  1Z7N E;  2OWS A;  5H8H B;  3ZKK A;  1SI0 A;  5AE4 A;  1T0K A;  5ICT A;  3H6V A;  3MBP A;  1BP5 A;  3M8U A;  2QS1 A;  2QS4 A;  1SQY A;  3G7W A;  1Y3P A;  1QW0 A;  2Q88 A;  1QUK A;  3CFZ A;  3H03 A;  3RT8 A;  3PGF A;  1ZU0 A;  5CC2 A;  3FVG A;  1CB6 A;  1MH4 A;  3QXM A;  1POY 1;  2V3T A;  2XXH A;  1IIW A;  1UTH A;  3T9V A;  3KG2 A;  3VFJ A;  5CM6 A;  3KGC A;  4G68 B;  3G3I A;  2Q89 A;  4IGR A;  2Y7K A;  3UN6 A;  4LVQ A;  1D3K A;  3C4M A;  2V84 A;  1B58 A;  3MZ9 A;  2O1M A;  3KN7 A;  2A5T A;  5L9O A;  4NWC A;  1PB8 A;  3U1O A;  2DXR A;  4JSO A;  3SEV A;  3MUQ A;  4RJZ A;  3PPQ A;  2ZYK A;  3UA8 A;  1LFI A;  4WEP A;  4UA8 A;  4PFT A;  2DQV A;  2XHD A;  2VHA A;  3RTF B;  3K4U A;  1A8F A;  1N04 A;  4OFO A;  1B7H A;  1B3E A;  3A3U A;  3MP1 A;  1B5I A;  4WKM A;  5H8F A;  1SW5 A;  2NWJ A;  2PMS A;  5DEX A;  3WAF A;  1FQA A;  3PPN A;  1ZKB A;  3H4Z A;  4H65 A;  4BDL A;  1N7X A;  3MJN A;  3K1M A;  5JEI A;  4MFI A;  1QUI A;  1IIT A;  1MPD A;  2I0B A;  4HCY A;  3FV1 A;  4IY5 A;  2NOO A;  4NED A;  3Q25 A;  1LAH E;  2O51 A;  1VR5 A;  1H3D A;  2ESN A;  4OHN A;  3IR1 A;  4P11 A;  4QSE A;  1LAG E;  4RYA A;  3V83 A;  4ZE8 A;  2B3F A;  5I2K A;  4PFU A;  1R9Q A;  4I62 A;  1EZP A;  2XXR A;  1PBQ A;  5TP9 B;  4R6K A;  2G93 A;  4YKI A;  3RPW A;  1AH5 A;  2I3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...