3TCGA

Crystal structure of e. coli oppa complexed with the tripeptide kge
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
517
structure length
517
Chain Sequence
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Periplasmic oligopeptide-binding protein
publication title Escherichia coli peptide binding protein OppA has a preference for positively charged peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 176
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3tcgA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tcgA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3tcgA02
2F8DA 2Z8DA 3K2DA 3T66A 1URGA 4MBPA 5AA2A 2I48A 4KR5A 4FEDA 3ONMA 4XKNA 4RK9A 3RNNA 4KYSA 4NF4A 2ONSA 4P0IA 3I3VA 2WOPA 5HPQA 3CSBA 1Y1ZA 5A5XA 3ZKLA 1UTBA 3TELA 1IIWA 1Y3QA 1GGGA 4BDMA 3TTMA 2WKYA 2OWTA 1XVYA 1A40A 4O3BA 4U1OA 4OMBA 2F7AA 4P11A 3O66A 3EHUA 2RKMA 3O28A 2QS1A 3S9LC 2Y7PA 5K2YA 1NMUA 3SERA 3TTKA 2I3WA 5H8FA 1A8FA 4N13A 3CIJA 3OEKA 2B65A 4FJPA 1LCFA 2PMSA 4H1XA 1A8EA 3FTOA 1LGBC 4G68C 2G29A 4U21A 5EYFA 3FVGA 1FQBA 3O6HA 4X1DA 3ILTB 3S9EA 4RXLA 4NF5B 1TT1A 5ITOA 5JTYA 1B5IA 2XX9A 4LQ5A 1MY0A 4H8JA 5IKBA 3O6GA 3UK4A 5EHSA 2DE2A 1MS7A 2ZYMA 5FHOA 2DWIA 2M8CA 1LBBA 4N07A 1SW2A 4IGTA 1UTHB 5I58B 2I0BA 5DEXB 3FJMA 4F39A 1IZ1A 5FTIA 2O1LA 2ZNSA 4GD5A 1BP5A 3RGYA 1CE2A 4IO4A 1Y9UA 1O7TA 2YLNA 2I58A 2OJTA 3K01A 3ODBA 3FXQA 3T96B 3QIMA 5FHMA 2DVZA 2V93A 3K4UA 2XXTA 4GXSB 3CR9A 3TQLA 4HCWA 4ZEIA 4R9GA 2R71A 4DDDA 3G3HA 4QFKA 1R1NA 4GQOA 4F3BA 2BJJX 1XS5A 4DIGA 4OXVA 3CFLA 3EQ1A 3M3LA 1MXYA 4BDNA 3H03A 1NNPA 4RYAA 3KN7A 3MVXA 4LA9A 1MXVA 1MXXA 1B51A 1SDXA 3A3UA 2AL4A 4YB5A 2XXQA 1MPCA 5JK4A 1MY3A 2F5XA 4RA1A 3MW0A 2UVIA 1MY1A 2F97A 4GRKA 1MH3A 1XOCA 1B7ZA 3FATA 3MBPA 1B6HA 5I2NB 2RC7A 3KBRA 3H6TA 4ZE8A 4EUOA 2ALUA 5KDTA 1M5CA 3PMWA 2HZKA 4F3PA 1OLAA 1USYE 3DRKA 4NE4A 1LLSA 4ZECA 4ZEDA 2PBWA 2Q8JA 1KWHA 3GBAA 4X48A 1QVSA 1ZMGA 1IXCA 3RYAA 2I3VA 4R9FA 4WEDA 2H98A 5HBCA 4ZEBA 4FECA 5BWJA 2FNCA 3PUZE 4Q0CA 1ZBMA 4BDRA 4IO7A 4ZEKA 5J1DA 4TLMB 4OFOA 4FATA 4WXJA 2O7UA 4U4XA 3U1OA 2XX7A 1BIYA 3OSQA 4YKJA 3K02A 2DQVA 3RN8A 3UP9A 2CZLA 1US4A 4NTLA 1POY1 1I6QA 4MLVA 1AIVA 1CB6A 4NF6A 4ECFA 3T9UA 1PB9A 5I58A 5KZTA 5ITPA 3O6PA 1SI1A 2P2AA 1DSNA 3DRHA 2HEUA 4JB7A 3C9HA 5AA2B 4IGRA 2UXAA 2GHAA 3IL1B 4LUBA 4KFQA 4EF2A 4RNSA 4IY6A 2A5TB 4JDFA 4YICA 3Q29A 4RPOA 4ISUA 1ANFA 3HPIA 4C1TA 1P1WA 4F1UA 4MLQA 1JNFA 3PAMA 2B3FA 1DPPA 4QFPA 1S50A 3HV1A 1B3HA 1OLCA 2ZYOA 3U8QA 1N7WA 4GL8A 4XIGQ 2V3TA 5AA4B 5I84A 4OEUA 5AA3A 4QFNA 2UYFA 2O51A 3KEIA 3VV5A 4N6PA 3TCFA 5H8FB 5CI5A 3M3KA 2E1SA 2RINA 3CFZA 3OO8A 5DVIA 2Z8EA 3Q25A 4NF8B 2XXHA 2Q2AA 3FIRA 4R2FA 1FCKA 2GH9A 3SESA 2Y7KA 3UA8A 3D4GA 3T9XB 4R75A 3FGSA 5I2NA 2DXRA 3EF7A 3S4UA 2YJPA 2H99A 4RK2A 1EU8A 3TCHA 1O64A 2IA4A 3TPAA 4KYDA 4TOZA 4I1DA 3PGFA 1Z7ME 2X7QA 3IOUA 2F34A 1EZ9A 5L9SA 1FTKA 2NOOA 1H44A 1Y1MA 1BLFA 3DRGA 3VVDA 3TYHA 4LVQA 4JWXA 2FYIA 2NUVA 1OMPA 4Z0IA 3K0VA 1MXUA 3VXCA 4DXBA 1DTZA 5I59B 4LP2B 1N04A 3FVNA 3MC2A 3THIA 1LBCA 5CRYA 2ZYNA 1MDQA 4ZZEA 4YKPA 3R6UA 2VHAA 3MP6A 1SVXB 5I56B 2LAOA 3GZGA 3IJOB 1SBPA 4EXKA 1MRPA 2RCAA 5ICTA 3PMXA 1B40A 3PUXE 4X9TA 3U94A 3T93B 3A09A 2Y7IA 1JW4A 1SI0A 2ONRA 3HO7A 3QUFA 1NH8A 3D4CA 1QUJA 5H8HB 3EN3A 3C4MA 1UIVA 2F35A 4XKQA 4Z7EA 4R6HA 2PT1A 1NNTA 2OZZA 1QKBA 3N5LA 1ZJLA 4JSOA 4ZE9A 3OO6A 3V83A 3CG1A 2A5TA 2Y7RA 2PVUA 2VOZA 4F31B 1LAGE 2ONKE 4P0GA 3Q26A 2DWJA 5AA1A 1MQGA 3OO9A 2I4BA 1SD3A 5TP9A 5AA4A 5KDTB 2ZMBA 1P99A 4XKPA 2O69A 2DOJA 1YCJA 4NEDA 4M1VA 3MZBA 4GIZA 2QL3A 3U93A 1B9JA 1FQDA 4NF8A 1IEJA 4IY5A 4F1VA 2I6EA 1JW1A 2Q89A 1LAXA 3EHTA 4ND9A 1VR5A 1OVBA 5DTBA 3RTWB 3TUSA 4OVJA 3LSXA 2QMXA 1OVTA 3B6QA 5CBSA 3B7DA 4ELRA 2F78A 1YPNA 4EQ9A 1Z7NE 3USDA 4ZZAA 5B7DA 2H4IA 3TTLA 4NF6B 1LB8A 1TFAA 3MPKA 2H9BA 3RUMA 5CC2A 3CG3A 3R26A 1B3GA 4POWA 1P1OA 3QAXA 5M2VA 4I62A 3LSLA 2O84X 1VSOA 4IO3A 5I59A 2Q88A 2HXWA 1TXFA 3H6UA 4OERA 1FTMA 4KD5A 3U72A 3I5OA 3QYTA 2OLBA 2F7CA 3B6TA 3MZ9A 4F18A 4R72A 3LSWA 2XXUA 3N6UA 4YAHX 4PFUA 4U2RA 1AOVA 2G93A 3HCQA 2HFBA 4NWCA 5I56A 1MH4A 3T9VA 3PMVA 4U4SA 1N3WA 3RYBA 1YAEA 4H67A 3TKDA 4R2BA 3KSJA 3E4RA 3T22A 2QSXA 3CI8A 2REGA 1BTJA 4TQUQ 5H8HA 3VFJA 1ELJA 3KSXA 3N6TA 1WVJA 1NKXA 1N7XA 3FZVA 1J1NA 3DELB 4KCDA 1M5DA 2IEEA 5L9OA 4AB6A 3C33A 2ZXTA 4MH5A 2Y84A 1JEVA 2E0SA 4F19A 1AL3A 4QF9A 1MM6A 3BBRA 3OOAA 1MQDA 4JXIA 4I9DA 3G3IA 3OO7A 1PC3A 2P1SA 4JSDA 1PEBA 1DPEA 3C35A 2QS2A 2Z8FA 3MZ1A 3MAMA 1FQCA 2ANJA 2V3QA 3PPOA 3SEVA 1II5A 1L5TA 4F29A 5H8QB 3HN0A 4K3FA 4G2ZA 3TAJA 3C36A 1QUKA 1QKAA 5H8SA 3FD3A 2XXXA 2FA7A 1LSTA 3O6IA 1MPDA 3S9NC 3UGWA 3OELA 4RPNA 4KYEA 1NFTA 3G3FA 3E9XA 2RF1A 3K6WA 4BDQA 5KCJA 2UYEA 2DYXA 4I8CA 5FHNA 5CM6A 2WOKA 1N0TA 3W9VA 2DSFA 1B1HA 1FTLA 2D21A 4X1BA 1ZTYA 1A54A 3FJGA 3OXNA 4LONB 1VE4A 4OEVA 2Z22A 2Y7WA 4KI0E 1WODA 2H5YA 3EPEA 1B5JA 4NWDA 1MY4A 4ZEFA 4WEPA 1YTVA 4BDLA 1Q35A 2XXIA 3C31A 1MM7A 1A7LA 3C34A 3CRBA 1B0HA 4KQPA 4IO6A 1PBQA 1OQHA 3KN8A 2ABHA 1D9YA 1NL5A 3LR1A 1SYIA 4BLAA 3BFTA 3IO4A 3V5AA 4XKRA 4MF3A 4QFOA 3VDFA 5TP9B 2GRVA 1T0KA 4GOTA 1RYOA 2ZNTA 1Q1KA 4JWYA 3HHGA 1JVXA 3IO6A 3TMGA 3OMBA 1IXGA 3P7IA 1POTA 1Y4TA 2XXPA 4L17A 1M5BA 5I2KA 1N76A 2W7YA 1B46A 4QFLA 2QJEA 1B7UA 4EQ7A 3W9WA 3TCGA 4LATA 1FQFA 1NNFA 3EHSA 4EDPA 1AMFA 3MP8A 5ISUA 3F11A 1S9TA 1GR2A 2XXWA 2YPNA 1SW5A 4RY1A 1UQWA 4F22A 4ESXA 1QULA 1B2HA 1A99A 3QUJA 1HSEA 4YKIA 2CMOA 2KLFA 2DE4A 3PU5A 2UVHA 3PUVE 2Q9TA 1P1UA 3SDFA 3G3GA 3H6WA 4LZ5A 3K00A 3UN6A 4AQ4A 2DXYA 4GXAA 3TTNA 3VVFA 4R6YA 5H8QA 2D3IA 2OCUA 4U22A 3DM0A 3RPWA 2HZLA 4R73A 5TU0A 3WAFA 4PP0A 3O9PA 4G4PA 4FEBA 1P1QA 5TPAA 3LUYA 5L8DA 3SKPA 3O2AA 3OD7A 5HM4B 4H5FA 1BKAA 3E3KA 4PFWA 1R6ZA 1VFDA 5AA2D 3SEUA 3N94A 1WDNA 1EH3A 3O29A 1MXZA 3N26A 4DXUA 2XHDA 1FTJA 2F36A 3S9MC 1SW1A 4HCYA 3MPLA 1B3EA 3DRIA 1DTGA 4LQ2A 2PYYA 3L6HA 1PB7A 1B4ZA 3K1NA 3FV1A 4HS7A 3IK6B 4G68A 2I49A 2XD3A 1XVXA 2X26A 3K6UA 3TDJA 3SETA 3JZJA 3KOTA 1VFEA 3KZGA 3VLVA 1DOTA 1SQYA 4OQOA 4WKMA 3RTFB 5DVJA 2P0SA 3GXAA 1B5HA 4OTEA 4OENA 4YMAA 4JWOA 3MVZA 4YKKA 2QRYA 3GBBA 1P1NA 4DZ1A 3LBSA 1S7YA 2O6AA 4YB6A 4YMBA 1LFGA 4IB2A 4H0WA 1FW0A 3TODA 4FE8A 1MQJA 1ZU0A 4IO5A 3TTRA 4RJZA 1QW0A 1FQEA 1B3LA 2DE3A 4U23A 1XHYA 1H3DA 1URSA 3DP4A 2NVUB 5FTHA 3MP1A 1PB8A 3DRFA 3DP6A 5CMBA 1MG1A 1HSLA 3VVEA 2QPQA 1LFHA 4NMYA 3TEPA 2X7PA 5CBRA 3M3FA 1Y3NA 1FTOA 1URDA 1O63A 4OHNA 3DRJA 2PT2A 3KG2A 5L9MA 4DLDA 3CSGA 2AL5A 3S2VA 4OESA 4H6DA 3IOWA 5KCJB 3RT6B 3DP8A 3DLNA 1RKMA 5BUUA 1H45A 4OYVA 1TWYA 2HQ0A 3VLWA 2I4CA 1EZPA 4PE5B 1LB9A 4QHQA 1LAFE 2ZNUA 1D9VA 3PPPA 2B3BA 3H6VA 2O7IA 2QMWA 1PBPA 3MJNA 1IITA 1NH7A 4PFTA 1SYHA 3KN3A 5CMKA 3SEXA 2OWSA 2HCAA 4ELOA 4ESWA 2GHBA 4ZDMA 3C32A 1B52A 2VD2A 3IORA 2THIA 1GTKA 4DXCA 1R9LA 4F2QA 1JQFA 4GF8A 1GVCA 1Y20A 3VE1B 5F1QA 5B70A 2VGQA 2QS4A 1B58A 3OEMA 3CHGA 4OFLA 5CMCA 4GFRA 1D4NA 2DS9A 1F9BA 4GVOA 5DYHA 2DWHA 1MXWA 1B1XA 5EHMA 3FV2A 3Q27A 4KPTA 1Y3PA 3QXMA 1MPBA 4FIMA 1B7HA 1I69A 1IXHA 3FJ7A 4GLIA 4THIA 4KCCA 2AYSA 5I2KB 5H8NA 1NNKA 4G8MA 3I6VA 3R7XA 3Q28A 3HSTA 3KOSA 5K2XA 3QK6A 3FVOA 3QSLA 2B4MA 1SW4A 2RC9A 4H5GA 1XC1A 3LC8A 3CVGA 1B05A 4ELPA 4HW8A 2REJA 3V8XB 3PD8A 3UIFA 2AIXA 2UVGA 1PDAA 3K6XA 3A3CA 3VLUA 2ESNA 4Q5TA 4H65A 3MUQA 3TZAA 1OQGA 2WOLA 5DT6A 2HAUA 1N3XA 4FAJA 4G8HA 3MVYA 4KHZE 3SEYA 4U1ZA 5TPAB 1A55A 3PD9A 3ZSFA 3LSFB 3KFMA 4C0RA 4OETA 4TLLB 5IAIA 3IX1A 1AH5A 4DCYA 5DVFA 1XT8A 4DE8A 3H7MA 2XD2A 5JEIA 4F2OA 2RC8A 4JBZA 4O3AA 4NF5A 1JEUA 1I6BA 3H4ZA 4ONYA 4M4GA 3H06B 1IQ7A 2DVCA 2O68A 3FVKA 1JVYA 4YZZA 3SEWA 3KJTA 2D5WA 3HHFA 1RYXA 1R9QA 2V25A 4G68B 3U92A 1USYH 3IB0A 3IOVA 1ZKBA 4G77A 2F6GA 3FXRA 3OSRA 3PPNA 1MDP1 2O1MA 2B4LA 3UORA 4AB5A 4XTCQ 1UTHA 3K6VA 3PPRA 5DEXA 1US5A 3IOTA 1IXIA 1I6AA 4PETA 3IJXB 1ZLQA 5I57B 2V84A 5ICQA 1H76A 4FORA 4R6KA 4E0XA 1MY2A 1LCTA 4Q30B 4QSEA 4UA8A 3BKIB 3H3GA 1H43A 2XXRA 3PV0E 3PUYE 4GWOA 3FUZA 3MWBA 2A5SA 4NF4B 3RT8A 2XXYA 5A5XB 2XX8A 4IO2A 2HAVA 4YB7A 1UTBB 2R6GE 4EQBA 2RCBA 3GLBA 3IAZA 3AXFA 3ECRA 3V89B 3W15C 2VP1A 4HTGA 1MQHA 3O97A 3G3JA 3ILUB 1FQAA 1ZIUA 4BDOA 1B32A 3FASA 3PPQA 4LZ8A 4ZS9A 1M5EA 1B0LA 3OENA 1EZOA 4YU0A 4GL0A 3B6WA 3RQTA 4E0WA 3L6GA 1UIUA 5F7VA 3RLFE 2NXOA 3LVUA 4XXUA 3K1MA 1LFIA 3JV9A 1QUIA 1OIBA 1JETA 4F1YA 2V3UA 4QRZA 1LAHE 5JTYB 3IB2A 5ELVA 2F7BA 3E13X 2PX1A 2Q2CA 3MQ9A 4UACA 3KJ7A 4O3CA 3JYRA 3K1PA 2GFEA 3KGCA 3CFXA 4Q8RA 1JW5A 3ZS6A 3IB1A 1B4HA 3VXBA 2R9JA 5CMMA 4EF1A 4OFJA 3ZKKA 3M8UA 4OWDA 4F3GA 1M5FA 3MVWA 2UVJA 3BFUA 1B3FA 1ATGA 4OZ9A 4R74A 4POXA 4G8NA 3T9HB 1GV8A 4EXLA 3PUWE 2NWJA 2ZYKA 3G7WA 2XXVA 4F3SA 2VD3A 3FXUA 3RY3A 4ELQA 2DWAA 1TFDA 4QSCA 2I0CA 1Y4CA 4LZ7A 4DCXA 3IR1A 1MQIA 2F6PA 5LOMA 4QSDA 4PQJA 3TQWA 4MFIA 1HSJA 1QJMA 4H8IA 1D3KA 2Z23A 3TFLA 2DP8A 2QS3A 5AE4A 1IUDA 2OK2A 5H8NB 4PFYA 3G3KA 2OBGA 2H25A 1DMBA 4C1UA 3WAEA 1N84A 5I57A
chains in the Genus database with same CATH superfamily
2F8DA 2Z8DA 3K2DA 3T66A 1URGA 4MBPA 5AA2A 2I48A 4KR5A 4FEDA 3ONMA 4XKNA 4RK9A 3RNNA 4XF5A 4X8RA 4KYSA 4NF4A 2ONSA 4P0IA 3I3VA 1K9YA 2WOPA 2WYKA 5HPQA 1AWBA 3CSBA 1Y1ZA 5A5XA 3ZKLA 1UTBA 3TELA 1IIWA 5T3JA 1Y3QA 1GGGA 4BDMA 4OA4A 3TTMA 2WKYA 2OWTA 1XVYA 1A40A 4O3BA 4U1OA 4OMBA 2F7AA 4P11A 3O66A 3EHUA 2RKMA 3O28A 2QS1A 5LTCA 3S9LC 4QBAA 2Y7PA 5K2YA 1NMUA 3SERA 3TTKA 4PF8A 4N8GA 2I3WA 5H8FA 1A8FA 4N13A 3T1BA 3CIJA 3OEKA 2B65A 4FJPA 1LCFA 4GWWA 2PMSA 4H1XA 1FBFA 1A8EA 2VT5A 3FTOA 1EYJA 1LGBC 4G68C 2G29A 4U21A 5EYFA 3FVGA 1FQBA 3O6HA 4X1DA 3ILTB 1FBCA 3S9EA 4RXLA 4NF5B 1NUXA 1TT1A 5ITOA 4HXVA 5JTYA 1B5IA 2XX9A 4LQ5A 1MY0A 4H8JA 5IKBA 3O6GA 3UK4A 1QGXA 5EHSA 2DE2A 5DW8A 1MS7A 5FBPA 2ZYMA 5FHOA 2DWIA 2M8CA 1LBBA 4N07A 1SW2A 2KQZA 4IGTA 1UTHB 5I58B 2I0BA 5DEXB 3FJMA 4F39A 1IZ1A 5FTIA 2O1LA 4HE2A 2ZNSA 4GD5A 1BP5A 3RGYA 1CE2A 4IO4A 1Y9UA 1O7TA 3QMFA 2YLNA 3IFCA 2I58A 2OJTA 1FBGA 3K01A 3ODBA 3FXQA 3T96B 3QIMA 2JJKA 4PBQA 5A5LA 5FHMA 2Q74A 2DVZA 2V93A 3K4UA 2XXTA 4N81A 4GXSB 1NUYA 2VPNA 3CR9A 3TQLA 4HCWA 4ZEIA 4R9GA 1IMEA 2R71A 4DDDA 3G3HA 4QFKA 1R1NA 4GQOA 4F3BA 1YXIA 2BJJX 1XS5A 4DIGA 4OXVA 3CFLA 3B8BA 3EQ1A 3M3LA 1MXYA 4BDNA 5LDZA 3H03A 1NNPA 4RYAA 4PE3A 3KN7A 3MVXA 4LA9A 1MXVA 1MXXA 1B51A 1SDXA 3A3UA 2AL4A 4YB5A 2XXQA 1MPCA 5JK4A 1MY3A 2F5XA 2HHMA 4RA1A 3MW0A 1DK4A 1MY1A 2F97A 2UVIA 4GRKA 1NUZA 1MH3A 1XOCA 1B7ZA 3FATA 3MBPA 1B6HA 5I2NB 2RC7A 3KBRA 3H6TA 4ZE8A 4DI4B 4LN5A 1KA1A 4EUOA 2ALUA 5KDTA 1M5CA 3PMWA 2HZKA 2L5VA 4F3PA 1OLAA 1USYE 3DRKA 4NE4A 4O8MA 1FPLA 1NV0A 1LLSA 4ZECA 4ZEDA 2PBWA 2CZKA 2FHYA 2Q8JA 1KWHA 3GBAA 4X48A 1QVSA 4PTKA 1ZMGA 5IGAA 1IXCA 3RYAA 2I3VA 4R9FA 4WEDA 2H98A 5HBCA 4ZEBA 4FECA 5BWJA 2FNCA 3PUZE 4Q0CA 1ZBMA 4IR8A 1IMDA 4BDRA 4IO7A 4ZEKA 5J1DA 4TLMB 4OFOA 4FATA 4WXJA 2O7UA 4U4XA 3U1OA 3RYDA 2XX7A 4MMPA 1BIYA 3OSQA 4YKJA 3K02A 2DQVA 3RN8A 3UP9A 2CZLA 1US4A 4NTLA 1FPBA 1POY1 1I6QA 4MLVA 1AIVA 1CB6A 4NF6A 4ECFA 3T9UA 1PB9A 3BIGA 1LEVA 5I58A 5KZTA 5ITPA 3O6PA 1SI1A 2P2AA 1DSNA 1FBPA 3DRHA 2HEUA 4JB7A 3C9HA 5AA2B 4IGRA 1LBVA 2UXAA 2GHAA 3IL1B 4GWZA 4LUBA 4KFQA 4PGPA 4I3EA 5EQAA 4EF2A 4RNSA 4IY6A 2A5TB 4JDFA 5I7IA 4YICA 3Q29A 4RPOA 4ISUA 1ANFA 2WYPA 3HPIA 4C1TA 1P1WA 1FPEA 4F1UA 4MLQA 4AS4A 1JNFA 3PAMA 1IMCA 2B3FA 1DPPA 4QFPA 1S50A 3HV1A 1B3HA 1OLCA 2ZYOA 3U8QA 1N7WA 4GL8A 4GX3A 4XIGQ 2V3TA 5AA4B 3PTYA 5I84A 4OEUA 5AA3A 4QFNA 2UYFA 2O51A 3KEIA 3VV5A 4N6PA 3TCFA 5H8FB 5CI5A 1FPGA 3M3KA 2E1SA 2RINA 3CFZA 3OO8A 2CZHA 5DVIA 2Z8EA 3Q25A 4NF8B 2XXHA 2Q2AA 1NUWA 3FIRA 4R2FA 1FCKA 2GH9A 3SESA 2Y7KA 3UA8A 4MEVA 3D4GA 5F24A 3E79A 3T9XB 4R75A 3FGSA 4P1EA 5I2NA 5IZ3A 2DXRA 3EF7A 3S4UA 2YJPA 2H99A 4RK2A 1EU8A 3TCHA 1O64A 2IA4A 4MHFA 3TPAA 4KYDA 4TOZA 4I1DA 3PGFA 1Z7ME 2X7QA 2FBPA 3IOUA 2F34A 1EZ9A 5L9SA 1FTKA 2NOOA 1H44A 1Y1MA 1NV7A 1BLFA 3DRGA 3VVDA 4PCDA 3TYHA 4LVQA 2QVVA 4GWSA 3NOHA 1LBYA 2FYIA 4JWXA 2NUVA 1OMPA 4Z0IA 3K0VA 1MXUA 3VXCA 4DXBA 1DTZA 5I59B 4LP2B 1N04A 3FVNA 3MC2A 3THIA 1LBCA 5CRYA 2ZYNA 4O7IA 1MDQA 2ZZWA 4ZZEA 4YKPA 3R6UA 4OVRA 3RPLA 2VHAA 3MP6A 1SVXB 5I56B 2LAOA 3GZGA 2P3VA 3IJOB 1SBPA 4EXKA 1MRPA 2RCAA 5ICTA 2V4CA 3PMXA 1B40A 3PUXE 4X9TA 3U94A 3T93B 3A09A 1RDYA 2Y7IA 1JW4A 1SI0A 2ONRA 3HO7A 3QUFA 1NH8A 3D4CA 4PFBA 1QUJA 5H8HB 3EN3A 3C4MA 4N8YA 1UIVA 2F35A 4XKQA 4Z7EA 4R6HA 2PT1A 1NNTA 2OZZA 1QKBA 3N5LA 1ZJLA 4JSOA 4ZE9A 4PBHA 1IMAA 3OO6A 3V83A 1FPFA 3CG1A 4PFIA 2A5TA 2Y7RA 2PVUA 2VOZA 4F31B 1LAGE 2ONKE 4P0GA 3Q26A 4N17A 2DWJA 5EQ8A 5AA1A 4MNCA 1MQGA 3OO9A 2P3NA 2I4BA 1SD3A 5TP9A 5AA4A 5KDTB 1VDWA 2ZMBA 4P3LA 1P99A 2WBDA 4XKPA 4GX6A 2O69A 2DOJA 1YCJA 4NEDA 2VPOA 4M1VA 3MZBA 4GIZA 2QL3A 1KA0A 2OX3A 3U93A 1B9JA 1FQDA 4NF8A 1IEJA 4IY5A 4F1VA 2I6EA 3B50A 1JW1A 2Q89A 5EYGA 1LAXA 3EHTA 4ND9A 4PAIA 1VR5A 1OVBA 5IZ1A 5DTBA 3RTWB 3TUSA 4OVJA 3LSXA 2QMXA 1OVTA 3B6QA 5CBSA 3B7DA 4ELRA 2F78A 1YPNA 4EQ9A 1Z7NE 3USDA 4ZZAA 5B7DA 2H4IA 3TTLA 5EYHA 4NF6B 1LB8A 1TFAA 3MPKA 2H9BA 1FRPA 3RUMA 5CC2A 3CG3A 3R26A 1B3GA 4POWA 1P1OA 3QAXA 1LBZA 5M2VA 4I62A 3LSLA 2O84X 1VSOA 4IO3A 5I59A 2Q88A 2HXWA 1TXFA 3H6UA 4OERA 1FTMA 4KD5A 3U72A 3I5OA 1FPIA 3QYTA 2OLBA 2F7CA 3D1RA 2R8TA 3B6TA 4JVDA 3MZ9A 4F18A 4R72A 3LSWA 2XXUA 5IM2A 3N6UA 4YAHX 3ISPA 4PFUA 4NHBA 4U2RA 1AOVA 2G93A 3HCQA 2HFBA 4NWCA 5I56A 1MH4A 1YZ0A 3T9VA 1FTAA 3PMVA 4U4SA 1N3WA 3RYBA 1YAEA 4H67A 3TKDA 4R2BA 3IFAA 3KSJA 3E4RA 3T22A 1NV6A 2QSXA 2QVRA 3CI8A 2REGA 1BTJA 4TQUQ 5H8HA 3VFJA 1ELJA 2FVZA 3KSXA 3N6TA 1WVJA 1NKXA 1N7XA 3FZVA 1J1NA 3DELB 4KCDA 2Y5LA 4KXPA 2FIXA 4FBPA 1M5DA 2IEEA 5ET5A 4AB6A 5L9OA 3C33A 2ZXTA 4MH5A 2Y84A 1JEVA 1BK4A 2E0SA 4F19A 4X04A 1FPKA 1AL3A 4QF9A 1MM6A 5IZ3B 3BBRA 3OOAA 3E78A 1MQDA 4JXIA 2Q8MA 4I9DA 3G3IA 3OO7A 1PC3A 2P1SA 4MIJA 4JSDA 1PEBA 1DPEA 3C35A 1FJ6A 2QS2A 2Z8FA 3MZ1A 3MAMA 4PC9A 1FQCA 2ANJA 2V3QA 3PPOA 3SEVA 1II5A 1L5TA 4F29A 5H8QB 4NF0A 3HN0A 4K3FA 4G2ZA 3TAJA 3C36A 2CZIA 1QUKA 1CNQA 1QKAA 5H8SA 3FD3A 2XXXA 2FA7A 1LSTA 3O6IA 1MPDA 1NV2A 2XWVA 3UGWA 3S9NC 3OELA 1FJ9A 4RPNA 4KYEA 1NFTA 1EYKA 2WEFA 3G3FA 3E9XA 2RF1A 3K6WA 4BDQA 5KCJA 2UYEA 2DYXA 4I8CA 2DDKA 5FHNA 3RPLB 5CM6A 2WOKA 1N0TA 4P56A 1FBHA 1KZ8A 4N6DA 3W9VA 4MAGA 1FPDA 2DSFA 1B1HA 2F3DA 1FTLA 2D21A 4X1BA 1ZTYA 1A54A 3FJGA 3OXNA 4LONB 1VE4A 4OEVA 2Z22A 2Y7WA 4KI0E 4H46A 3U65A 1WODA 2H5YA 3EPEA 4PDDA 1B5JA 3KC1A 2PFYA 4NWDA 2XXKA 1MY4A 4ZEFA 4WEPA 1YTVA 4BDLA 1Q35A 2XXIA 3C31A 1SPIA 3FXBA 1MM7A 1A7LA 3C34A 3CRBA 1B0HA 4KQPA 4IO6A 1PBQA 1OQHA 2MKZA 1G0HA 3KN8A 2ABHA 1D9YA 1NL5A 5EQ9A 3LR1A 1JP4A 1SYIA 4BLAA 3BFTA 3IO4A 3V5AA 2ZZVA 3SZPA 4XKRA 4MF3A 4QFOA 4N4UA 3VDFA 5TP9B 2GRVA 1T0KA 4GOTA 1RYOA 2ZNTA 1Q1KA 4JWYA 3HHGA 1JVXA 3IO6A 3TMGA 3OMBA 1IXGA 3P7IA 1POTA 1Y4TA 2XXPA 4OANA 4L17A 1YYZA 1M5BA 5I2KA 4PAKA 1N76A 1FBDA 1NV3A 1B46A 2W7YA 4QFLA 2QJEA 1B7UA 4EQ7A 1EYIA 3W9WA 1K9ZA 3TCGA 4LATA 1FQFA 1NNFA 3EHSA 4EDPA 2QVUA 1AMFA 3MP8A 4UABA 5ISUA 3F11A 1S9TA 1GR2A 2XXWA 2BJIA 3KC0A 2YPNA 1SW5A 4RY1A 1UQWA 4F22A 4ESXA 1QULA 1IMBA 5ESYA 1B2HA 1A99A 3QUJA 4GBVA 1HSEA 4YKIA 2CMOA 2GQ1A 2HXRA 2KLFA 1NV5A 2DE4A 2XWIA 3PU5A 4PAFA 2UVHA 3PUVE 4P1LA 2Q9TA 1FPJA 1P1UA 3SDFA 3G3GA 4NAPA 3H6WA 4LZ5A 3K00A 3UN6A 4AQ4A 2DXYA 4GXAA 3TTNA 3MSTA 4R6YA 3VVFA 5H8QA 2D3IA 2OCUA 4PDHA 4U22A 2PCRA 3DM0A 3RPWA 2HZLA 4R73A 5TU0A 3WAFA 4PP0A 3O9PA 4G4PA 4FEBA 1P1QA 5TPAA 3LUYA 5L8DA 3SKPA 3O2AA 3OD7A 5HM4B 4H5FA 1BKAA 3E3KA 4OVSA 4PFWA 4XFEA 1R6ZA 4NG7A 1VFDA 5AA2D 3SEUA 3N94A 1WDNA 1EH3A 3O29A 1MXZA 3N26A 4DXUA 2XHDA 1FTJA 2F36A 3S9MC 1SW1A 4HCYA 3MPLA 1B3EA 3DRIA 4G61A 1DTGA 4LQ2A 2PYYA 4N15A 3L6HA 4O7MA 1PB7A 1B4ZA 2CEXA 3K1NA 3FV1A 4HS7A 4PF6A 3IK6B 4G68A 2I49A 2XD3A 1XVXA 4XEQA 5ET7A 2X26A 3K6UA 1D9QA 1NV1A 3TDJA 3SETA 3KBZA 3JZJA 3KOTA 1VFEA 3KZGA 3VLVA 1DOTA 1SQYA 4OQOA 4WKMA 3RTFB 5DVJA 1IMFA 2P0SA 3GXAA 1B5HA 4OTEA 4OENA 4YMAA 4JWOA 3MVZA 4YKKA 2QRYA 3GBBA 1P1NA 4DZ1A 3LBSA 1S7YA 2O6AA 4YB6A 4YMBA 1LFGA 4IB2A 4H0WA 1FW0A 3TODA 4FE8A 1MQJA 1ZU0A 4IO5A 3TTRA 4MNIA 4RJZA 1QW0A 1FQEA 1B3LA 2DE3A 4U23A 1XHYA 1H3DA 1URSA 3DP4A 2NVUB 5FTHA 3MP1A 1PB8A 3DRFA 3DP6A 5CMBA 1MG1A 1HSLA 3VVEA 2QPQA 1LFHA 4NMYA 3TEPA 2X7PA 5CBRA 3M3FA 1NV4A 1Y3NA 1FTOA 5I3SA 1URDA 1O63A 3GYYA 4OHNA 3DRJA 2PT2A 3KG2A 5L9MA 4DLDA 3CSGA 2AL5A 3S2VA 4OESA 4H6DA 3IOWA 5KCJB 3RT6B 3DP8A 4O94A 1FSAA 3DLNA 1RKMA 5BUUA 1NI9A 1H45A 4GWUA 4OYVA 1FBEA 1TWYA 2PFZA 2HQ0A 3VLWA 2I4CA 1EZPA 4PE5B 1G0IA 1LB9A 4H45A 4QHQA 1LAFE 2ZNUA 1D9VA 3PPPA 2B3BA 3H6VA 2O7IA 4NX1A 2QMWA 2QFLA 1DCUA 1PBPA 3MJNA 1IITA 1NH7A 4PFTA 1SYHA 3KN3A 5CMKA 3SEXA 2OWSA 2HCAA 4ELOA 2FIEA 2GHBA 4ESWA 4ZDMA 3C32A 1B52A 2VD2A 2XWOA 3IORA 2THIA 4P47A 1GTKA 4DXCA 1R9LA 4F2QA 1JQFA 4GF8A 1GVCA 4JVCA 1Y20A 3VE1B 5F1QA 5B70A 2VGQA 2QS4A 1B58A 3OEMA 3CHGA 4OFLA 5CMCA 4GFRA 3LUZA 1D4NA 2DS9A 1F9BA 4GVOA 5DYHA 2DWHA 1MXWA 1B1XA 5EHMA 2Y5KA 3FV2A 3Q27A 4KPTA 1Y3PA 3QXMA 1INPA 1MPBA 4FIMA 4MNPA 1B7HA 1I69A 1IXHA 4NQ8A 3FJ7A 4GLIA 4THIA 4KCCA 2WBBA 2AYSA 5I2KB 4MJOA 5H8NA 1NNKA 4MX6A 4G8MA 3I6VA 3R7XA 3Q28A 5IZZA 3HSTA 3KOSA 5K2XA 3QK6A 3FVOA 3QSLA 2B4MA 1RDZA 1SW4A 2RC9A 4H5GA 1XC1A 3LC8A 2OWZA 3CVGA 1B05A 4ELPA 4HW8A 2REJA 5J16A 3V8XB 3PD8A 3UIFA 2AIXA 2UVGA 4HE1A 1PDAA 3K6XA 3HFUA 3A3CA 3T0JA 4GWXA 3VLUA 5I5PA 2ZZXA 2ESNA 4Q5TA 4H65A 3MUQA 3TZAA 3LV0A 1OQGA 4I3YA 2WOLA 5DT6A 2HAUA 1N3XA 4GBWA 4FAJA 4G8HA 3MVYA 4KHZE 1Q9DA 3SEYA 4U1ZA 5TPAB 1A55A 3PD9A 4GX4A 3ZSFA 5ET8A 3LSFB 3KFMA 4MCOA 4C0RA 4OETA 4N91A 4N6KA 4TLLB 5IAIA 3IX1A 1AH5A 4DCYA 5DVFA 1XT8A 4DE8A 3H7MA 2XD2A 5JEIA 4F2OA 2RC8A 4P9KA 4JBZA 4O3AA 2CEYA 4NF5A 1JEUA 3MYUA 1I6BA 3H4ZA 4ONYA 4M4GA 3H06B 1IQ7A 2DVCA 1LBWA 2O68A 3FVKA 1JVYA 4YZZA 3SEWA 3KJTA 5EQ7A 2D5WA 3HHFA 3ROJA 1RYXA 1R9QA 2V25A 4G68B 3U92A 1USYH 3IB0A 4GWYA 3IOVA 1ZKBA 4G77A 2F6GA 3FXRA 3OSRA 3PPNA 1MDP1 2O1MA 2B4LA 3UORA 4NN3A 4AB5A 4XTCQ 1UTHA 3K6VA 3PPRA 5DEXA 1US5A 3IOTA 1IXIA 1I6AA 4PETA 2WX9A 3IJXB 1ZLQA 5I57B 2V84A 5ICQA 1RDXA 1H76A 4FORA 4R6KA 4E0XA 1MY2A 1LCTA 4Q30B 4QSEA 4UA8A 2XWKA 3BKIB 3H3GA 1H43A 2XXRA 4DI3D 3PV0E 3PUYE 4GWOA 3FUZA 3MWBA 2A5SA 4NF4B 4PFRA 3RT8A 2XXYA 5A5XB 2XX8A 4IO2A 2HAVA 4YB7A 1UTBB 2R6GE 4EQBA 2RCBA 3GLBA 3IAZA 3AXFA 4AS5A 3ECRA 3V89B 3W15C 2VP1A 4OVPA 4PGNA 4HTGA 1MQHA 4I40A 3O97A 4JVIA 3G3JA 3ILUB 1FQAA 2XA5A 1ZIUA 4BDOA 1B32A 3FASA 2HPGA 3A29A 3PPQA 4LZ8A 4ZS9A 3EKIA 1M5EA 1B0LA 3OENA 1EZOA 4YU0A 4GL0A 3B6WA 3RQTA 4OVQA 4E0WA 3L6GA 4QXDA 1UIUA 5F7VA 3RLFE 2NXOA 3LVUA 4XXUA 3K1MA 1LFIA 3JV9A 1QUIA 1DBZA 1OIBA 4OVTA 1JETA 4F1YA 2V3UA 4QRZA 1LAHE 5JTYB 2KR0A 3IB2A 5ELVA 2F7BA 3E13X 2PX1A 5ET6A 4P8BA 2Q2CA 4NGUA 2F3BA 3MQ9A 4UACA 3KJ7A 4O3CA 3JYRA 3K1PA 2GFEA 3KGCA 3CFXA 4Q8RA 1JW5A 3ZS6A 3IB1A 1B4HA 3VXBA 1LBXA 2R9JA 5CMMA 4EF1A 4OFJA 3ZKKA 3BIHA 3M8UA 4OWDA 4F3GA 1M5FA 3MVWA 2UVJA 3BFUA 1B3FA 1ATGA 4OZ9A 4R74A 4POXA 4G8NA 3T9HB 1GV8A 4EXLA 3PUWE 2NWJA 2ZYKA 3G7WA 3FBPA 2XXVA 2VD3A 4F3SA 3FXUA 3RY3A 4HE0A 4ELQA 2DWAA 1TFDA 4QSCA 2I0CA 1Y4CA 4LZ7A 4DCXA 3IR1A 1MQIA 2F6PA 5LOMA 4QSDA 4PQJA 3TQWA 4MFIA 1HSJA 1QJMA 4H8IA 1XI6A 1D3KA 2Z23A 3TFLA 2DP8A 2QS3A 5AE4A 1IUDA 2OK2A 5H8NB 4PFYA 3G3KA 2OBGA 2H25A 1DMBA 4C1UA 3WAEA 1N84A 5I57A
chains in the Genus database with same CATH topology
2F8DA 2Z8DA 3K2DA 3T66A 1URGA 4MBPA 5AA2A 2I48A 4KR5A 4FEDA 3ONMA 4XKNA 4RK9A 3RNNA 4KYSA 4NF4A 2ONSA 4P0IA 3I3VA 2WOPA 5HPQA 3CSBA 1Y1ZA 5A5XA 3ZKLA 1UTBA 3TELA 1IIWA 1Y3QA 1GGGA 4BDMA 3TTMA 2WKYA 2OWTA 1XVYA 1A40A 4O3BA 4U1OA 4OMBA 2F7AA 4P11A 3O66A 3EHUA 2RKMA 3O28A 2QS1A 3S9LC 2Y7PA 5K2YA 1NMUA 3SERA 3TTKA 2I3WA 5H8FA 1A8FA 4N13A 3CIJA 3OEKA 2B65A 4FJPA 1LCFA 2PMSA 4H1XA 1A8EA 3FTOA 1LGBC 4G68C 2G29A 4U21A 5EYFA 3FVGA 1FQBA 3O6HA 4X1DA 3ILTB 3S9EA 4RXLA 4NF5B 1TT1A 5ITOA 5JTYA 1B5IA 2XX9A 4LQ5A 1MY0A 4H8JA 5IKBA 3O6GA 3UK4A 5EHSA 2DE2A 1MS7A 2ZYMA 5FHOA 2DWIA 2M8CA 1LBBA 4N07A 1SW2A 4IGTA 1UTHB 5I58B 2I0BA 5DEXB 3FJMA 4F39A 1IZ1A 5FTIA 2O1LA 2ZNSA 4GD5A 1BP5A 3RGYA 1CE2A 4IO4A 1Y9UA 1O7TA 2YLNA 2I58A 2OJTA 3K01A 3ODBA 3FXQA 3T96B 3QIMA 5FHMA 2DVZA 2V93A 3K4UA 2XXTA 4GXSB 3CR9A 3TQLA 4HCWA 4ZEIA 4R9GA 2R71A 4DDDA 3G3HA 4QFKA 1R1NA 4GQOA 4F3BA 2BJJX 1XS5A 4DIGA 4OXVA 3CFLA 3EQ1A 3M3LA 1MXYA 4BDNA 3H03A 1NNPA 4RYAA 3KN7A 3MVXA 4LA9A 1MXVA 1MXXA 1B51A 1SDXA 3A3UA 2AL4A 4YB5A 2XXQA 1MPCA 5JK4A 1MY3A 2F5XA 4RA1A 3MW0A 2UVIA 1MY1A 2F97A 4GRKA 1MH3A 1XOCA 1B7ZA 3FATA 3MBPA 1B6HA 5I2NB 2RC7A 3KBRA 3H6TA 4ZE8A 4EUOA 2ALUA 5KDTA 1M5CA 3PMWA 2HZKA 4F3PA 1OLAA 1USYE 3DRKA 4NE4A 1LLSA 4ZECA 4ZEDA 2PBWA 2Q8JA 1KWHA 3GBAA 4X48A 1QVSA 1ZMGA 1IXCA 3RYAA 2I3VA 4R9FA 4WEDA 2H98A 5HBCA 4ZEBA 4FECA 5BWJA 2FNCA 3PUZE 4Q0CA 1ZBMA 4BDRA 4IO7A 4ZEKA 5J1DA 4TLMB 4OFOA 4FATA 4WXJA 2O7UA 4U4XA 3U1OA 2XX7A 1BIYA 3OSQA 4YKJA 3K02A 2DQVA 3RN8A 3UP9A 2CZLA 1US4A 4NTLA 1POY1 1I6QA 4MLVA 1AIVA 1CB6A 4NF6A 4ECFA 3T9UA 1PB9A 5I58A 5KZTA 5ITPA 3O6PA 1SI1A 2P2AA 1DSNA 3DRHA 2HEUA 4JB7A 3C9HA 5AA2B 4IGRA 2UXAA 2GHAA 3IL1B 4LUBA 4KFQA 4EF2A 4RNSA 4IY6A 2A5TB 4JDFA 4YICA 3Q29A 4RPOA 4ISUA 1ANFA 3HPIA 4C1TA 1P1WA 4F1UA 4MLQA 1JNFA 3PAMA 2B3FA 1DPPA 4QFPA 1S50A 3HV1A 1B3HA 1OLCA 2ZYOA 3U8QA 1N7WA 4GL8A 4XIGQ 2V3TA 5AA4B 5I84A 4OEUA 5AA3A 4QFNA 2UYFA 2O51A 3KEIA 3VV5A 4N6PA 3TCFA 5H8FB 5CI5A 3M3KA 2E1SA 2RINA 3CFZA 3OO8A 5DVIA 2Z8EA 3Q25A 4NF8B 2XXHA 2Q2AA 3FIRA 4R2FA 1FCKA 2GH9A 3SESA 2Y7KA 3UA8A 3D4GA 3T9XB 4R75A 3FGSA 5I2NA 2DXRA 3EF7A 3S4UA 2YJPA 2H99A 4RK2A 1EU8A 3TCHA 1O64A 2IA4A 3TPAA 4KYDA 4TOZA 4I1DA 3PGFA 1Z7ME 2X7QA 3IOUA 2F34A 1EZ9A 5L9SA 1FTKA 2NOOA 1H44A 1Y1MA 1BLFA 3DRGA 3VVDA 3TYHA 4LVQA 4JWXA 2FYIA 2NUVA 1OMPA 4Z0IA 3K0VA 1MXUA 3VXCA 4DXBA 1DTZA 5I59B 4LP2B 1N04A 3FVNA 3MC2A 3THIA 1LBCA 5CRYA 2ZYNA 1MDQA 4ZZEA 4YKPA 3R6UA 2VHAA 3MP6A 1SVXB 5I56B 2LAOA 3GZGA 3IJOB 1SBPA 4EXKA 1MRPA 2RCAA 5ICTA 3PMXA 1B40A 3PUXE 4X9TA 3U94A 3T93B 3A09A 2Y7IA 1JW4A 1SI0A 2ONRA 3HO7A 3QUFA 1NH8A 3D4CA 1QUJA 5H8HB 3EN3A 3C4MA 1UIVA 2F35A 4XKQA 4Z7EA 4R6HA 2PT1A 1NNTA 2OZZA 1QKBA 3N5LA 1ZJLA 4JSOA 4ZE9A 3OO6A 3V83A 3CG1A 2A5TA 2Y7RA 2PVUA 2VOZA 4F31B 1LAGE 2ONKE 4P0GA 3Q26A 2DWJA 5AA1A 1MQGA 3OO9A 2I4BA 1SD3A 5TP9A 5AA4A 5KDTB 2ZMBA 1P99A 4XKPA 2O69A 2DOJA 1YCJA 4NEDA 4M1VA 3MZBA 4GIZA 2QL3A 3U93A 1B9JA 1FQDA 4NF8A 1IEJA 4IY5A 4F1VA 2I6EA 1JW1A 2Q89A 1LAXA 3EHTA 4ND9A 1VR5A 1OVBA 5DTBA 3RTWB 3TUSA 4OVJA 3LSXA 2QMXA 1OVTA 3B6QA 5CBSA 3B7DA 4ELRA 2F78A 1YPNA 4EQ9A 1Z7NE 3USDA 4ZZAA 5B7DA 2H4IA 3TTLA 4NF6B 1LB8A 1TFAA 3MPKA 2H9BA 3RUMA 5CC2A 3CG3A 3R26A 1B3GA 4POWA 1P1OA 3QAXA 5M2VA 4I62A 3LSLA 2O84X 1VSOA 4IO3A 5I59A 2Q88A 2HXWA 1TXFA 3H6UA 4OERA 1FTMA 4KD5A 3U72A 3I5OA 3QYTA 2OLBA 2F7CA 3B6TA 3MZ9A 4F18A 4R72A 3LSWA 2XXUA 3N6UA 4YAHX 4PFUA 4U2RA 1AOVA 2G93A 3HCQA 2HFBA 4NWCA 5I56A 1MH4A 3T9VA 3PMVA 4U4SA 1N3WA 3RYBA 1YAEA 4H67A 3TKDA 4R2BA 3KSJA 3E4RA 3T22A 2QSXA 3CI8A 2REGA 1BTJA 4TQUQ 5H8HA 3VFJA 1ELJA 3KSXA 3N6TA 1WVJA 1NKXA 1N7XA 3FZVA 1J1NA 3DELB 4KCDA 1M5DA 2IEEA 5L9OA 4AB6A 3C33A 2ZXTA 4MH5A 2Y84A 1JEVA 2E0SA 4F19A 1AL3A 4QF9A 1MM6A 3BBRA 3OOAA 1MQDA 4JXIA 4I9DA 3G3IA 3OO7A 1PC3A 2P1SA 4JSDA 1PEBA 1DPEA 3C35A 2QS2A 2Z8FA 3MZ1A 3MAMA 1FQCA 2ANJA 2V3QA 3PPOA 3SEVA 1II5A 1L5TA 4F29A 5H8QB 3HN0A 4K3FA 4G2ZA 3TAJA 3C36A 1QUKA 1QKAA 5H8SA 3FD3A 2XXXA 2FA7A 1LSTA 3O6IA 1MPDA 3S9NC 3UGWA 3OELA 4RPNA 4KYEA 1NFTA 3G3FA 3E9XA 2RF1A 3K6WA 4BDQA 5KCJA 2UYEA 2DYXA 4I8CA 5FHNA 5CM6A 2WOKA 1N0TA 3W9VA 2DSFA 1B1HA 1FTLA 2D21A 4X1BA 1ZTYA 1A54A 3FJGA 3OXNA 4LONB 1VE4A 4OEVA 2Z22A 2Y7WA 4KI0E 1WODA 2H5YA 3EPEA 1B5JA 4NWDA 1MY4A 4ZEFA 4WEPA 1YTVA 4BDLA 1Q35A 2XXIA 3C31A 1MM7A 1A7LA 3C34A 3CRBA 1B0HA 4KQPA 4IO6A 1PBQA 1OQHA 3KN8A 2ABHA 1D9YA 1NL5A 3LR1A 1SYIA 4BLAA 3BFTA 3IO4A 3V5AA 4XKRA 4MF3A 4QFOA 3VDFA 5TP9B 2GRVA 1T0KA 4GOTA 1RYOA 2ZNTA 1Q1KA 4JWYA 3HHGA 1JVXA 3IO6A 3TMGA 3OMBA 1IXGA 3P7IA 1POTA 1Y4TA 2XXPA 4L17A 1M5BA 5I2KA 1N76A 2W7YA 1B46A 4QFLA 2QJEA 1B7UA 4EQ7A 3W9WA 3TCGA 4LATA 1FQFA 1NNFA 3EHSA 4EDPA 1AMFA 3MP8A 5ISUA 3F11A 1S9TA 1GR2A 2XXWA 2YPNA 1SW5A 4RY1A 1UQWA 4F22A 4ESXA 1QULA 1B2HA 1A99A 3QUJA 1HSEA 4YKIA 2CMOA 2KLFA 2DE4A 3PU5A 2UVHA 3PUVE 2Q9TA 1P1UA 3SDFA 3G3GA 3H6WA 4LZ5A 3K00A 3UN6A 4AQ4A 2DXYA 4GXAA 3TTNA 3VVFA 4R6YA 5H8QA 2D3IA 2OCUA 4U22A 3DM0A 3RPWA 2HZLA 4R73A 5TU0A 3WAFA 4PP0A 3O9PA 4G4PA 4FEBA 1P1QA 5TPAA 3LUYA 5L8DA 3SKPA 3O2AA 3OD7A 5HM4B 4H5FA 1BKAA 3E3KA 4PFWA 1R6ZA 1VFDA 5AA2D 3SEUA 3N94A 1WDNA 1EH3A 3O29A 1MXZA 3N26A 4DXUA 2XHDA 1FTJA 2F36A 3S9MC 1SW1A 4HCYA 3MPLA 1B3EA 3DRIA 1DTGA 4LQ2A 2PYYA 3L6HA 1PB7A 1B4ZA 3K1NA 3FV1A 4HS7A 3IK6B 4G68A 2I49A 2XD3A 1XVXA 2X26A 3K6UA 3TDJA 3SETA 3JZJA 3KOTA 1VFEA 3KZGA 3VLVA 1DOTA 1SQYA 4OQOA 4WKMA 3RTFB 5DVJA 2P0SA 3GXAA 1B5HA 4OTEA 4OENA 4YMAA 4JWOA 3MVZA 4YKKA 2QRYA 3GBBA 1P1NA 4DZ1A 3LBSA 1S7YA 2O6AA 4YB6A 4YMBA 1LFGA 4IB2A 4H0WA 1FW0A 3TODA 4FE8A 1MQJA 1ZU0A 4IO5A 3TTRA 4RJZA 1QW0A 1FQEA 1B3LA 2DE3A 4U23A 1XHYA 1H3DA 1URSA 3DP4A 2NVUB 5FTHA 3MP1A 1PB8A 3DRFA 3DP6A 5CMBA 1MG1A 1HSLA 3VVEA 2QPQA 1LFHA 4NMYA 3TEPA 2X7PA 5CBRA 3M3FA 1Y3NA 1FTOA 1URDA 1O63A 4OHNA 3DRJA 2PT2A 3KG2A 5L9MA 4DLDA 3CSGA 2AL5A 3S2VA 4OESA 4H6DA 3IOWA 5KCJB 3RT6B 3DP8A 3DLNA 1RKMA 5BUUA 1H45A 4OYVA 1TWYA 2HQ0A 3VLWA 2I4CA 1EZPA 4PE5B 1LB9A 4QHQA 1LAFE 2ZNUA 1D9VA 3PPPA 2B3BA 3H6VA 2O7IA 2QMWA 1PBPA 3MJNA 1IITA 1NH7A 4PFTA 1SYHA 3KN3A 5CMKA 3SEXA 2OWSA 2HCAA 4ELOA 4ESWA 2GHBA 4ZDMA 3C32A 1B52A 2VD2A 3IORA 2THIA 1GTKA 4DXCA 1R9LA 4F2QA 1JQFA 4GF8A 1GVCA 1Y20A 3VE1B 5F1QA 5B70A 2VGQA 2QS4A 1B58A 3OEMA 3CHGA 4OFLA 5CMCA 4GFRA 1D4NA 2DS9A 1F9BA 4GVOA 5DYHA 2DWHA 1MXWA 1B1XA 5EHMA 3FV2A 3Q27A 4KPTA 1Y3PA 3QXMA 1MPBA 4FIMA 1B7HA 1I69A 1IXHA 3FJ7A 4GLIA 4THIA 4KCCA 2AYSA 5I2KB 5H8NA 1NNKA 4G8MA 3I6VA 3R7XA 3Q28A 3HSTA 3KOSA 5K2XA 3QK6A 3FVOA 3QSLA 2B4MA 1SW4A 2RC9A 4H5GA 1XC1A 3LC8A 3CVGA 1B05A 4ELPA 4HW8A 2REJA 3V8XB 3PD8A 3UIFA 2AIXA 2UVGA 1PDAA 3K6XA 3A3CA 3VLUA 2ESNA 4Q5TA 4H65A 3MUQA 3TZAA 1OQGA 2WOLA 5DT6A 2HAUA 1N3XA 4FAJA 4G8HA 3MVYA 4KHZE 3SEYA 4U1ZA 5TPAB 1A55A 3PD9A 3ZSFA 3LSFB 3KFMA 4C0RA 4OETA 4TLLB 5IAIA 3IX1A 1AH5A 4DCYA 5DVFA 1XT8A 4DE8A 3H7MA 2XD2A 5JEIA 4F2OA 2RC8A 4JBZA 4O3AA 4NF5A 1JEUA 1I6BA 3H4ZA 4ONYA 4M4GA 3H06B 1IQ7A 2DVCA 2O68A 3FVKA 1JVYA 4YZZA 3SEWA 3KJTA 2D5WA 3HHFA 1RYXA 1R9QA 2V25A 4G68B 3U92A 1USYH 3IB0A 3IOVA 1ZKBA 4G77A 2F6GA 3FXRA 3OSRA 3PPNA 1MDP1 2O1MA 2B4LA 3UORA 4AB5A 4XTCQ 1UTHA 3K6VA 3PPRA 5DEXA 1US5A 3IOTA 1IXIA 1I6AA 4PETA 3IJXB 1ZLQA 5I57B 2V84A 5ICQA 1H76A 4FORA 4R6KA 4E0XA 1MY2A 1LCTA 4Q30B 4QSEA 4UA8A 3BKIB 3H3GA 1H43A 2XXRA 3PV0E 3PUYE 4GWOA 3FUZA 3MWBA 2A5SA 4NF4B 3RT8A 2XXYA 5A5XB 2XX8A 4IO2A 2HAVA 4YB7A 1UTBB 2R6GE 4EQBA 2RCBA 3GLBA 3IAZA 3AXFA 3ECRA 3V89B 3W15C 2VP1A 4HTGA 1MQHA 3O97A 3G3JA 3ILUB 1FQAA 1ZIUA 4BDOA 1B32A 3FASA 3PPQA 4LZ8A 4ZS9A 1M5EA 1B0LA 3OENA 1EZOA 4YU0A 4GL0A 3B6WA 3RQTA 4E0WA 3L6GA 1UIUA 5F7VA 3RLFE 2NXOA 3LVUA 4XXUA 3K1MA 1LFIA 3JV9A 1QUIA 1OIBA 1JETA 4F1YA 2V3UA 4QRZA 1LAHE 5JTYB 3IB2A 5ELVA 2F7BA 3E13X 2PX1A 2Q2CA 3MQ9A 4UACA 3KJ7A 4O3CA 3JYRA 3K1PA 2GFEA 3KGCA 3CFXA 4Q8RA 1JW5A 3ZS6A 3IB1A 1B4HA 3VXBA 2R9JA 5CMMA 4EF1A 4OFJA 3ZKKA 3M8UA 4OWDA 4F3GA 1M5FA 3MVWA 2UVJA 3BFUA 1B3FA 1ATGA 4OZ9A 4R74A 4POXA 4G8NA 3T9HB 1GV8A 4EXLA 3PUWE 2NWJA 2ZYKA 3G7WA 2XXVA 4F3SA 2VD3A 3FXUA 3RY3A 4ELQA 2DWAA 1TFDA 4QSCA 2I0CA 1Y4CA 4LZ7A 4DCXA 3IR1A 1MQIA 2F6PA 5LOMA 4QSDA 4PQJA 3TQWA 4MFIA 1HSJA 1QJMA 4H8IA 1D3KA 2Z23A 3TFLA 2DP8A 2QS3A 5AE4A 1IUDA 2OK2A 5H8NB 4PFYA 3G3KA 2OBGA 2H25A 1DMBA 4C1UA 3WAEA 1N84A 5I57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8D A;  2Z8D A;  3K2D A;  3T66 A;  1URG A;  4MBP A;  5AA2 A;  2I48 A;  4KR5 A;  4FED A;  3ONM A;  4XKN A;  4RK9 A;  3RNN A;  4KYS A;  4NF4 A;  2ONS A;  4P0I A;  3I3V A;  2WOP A;  5HPQ A;  3CSB A;  1Y1Z A;  5A5X A;  3ZKL A;  1UTB A;  3TEL A;  1IIW A;  1Y3Q A;  1GGG A;  4BDM A;  3TTM A;  2WKY A;  2OWT A;  1XVY A;  1A40 A;  4O3B A;  4U1O A;  4OMB A;  2F7A A;  4P11 A;  3O66 A;  3EHU A;  2RKM A;  3O28 A;  2QS1 A;  3S9L C;  2Y7P A;  5K2Y A;  1NMU A;  3SER A;  3TTK A;  2I3W A;  5H8F A;  1A8F A;  4N13 A;  3CIJ A;  3OEK A;  2B65 A;  4FJP A;  1LCF A;  2PMS A;  4H1X A;  1A8E A;  3FTO A;  1LGB C;  4G68 C;  2G29 A;  4U21 A;  5EYF A;  3FVG A;  1FQB A;  3O6H A;  4X1D A;  3ILT B;  3S9E A;  4RXL A;  4NF5 B;  1TT1 A;  5ITO A;  5JTY A;  1B5I A;  2XX9 A;  4LQ5 A;  1MY0 A;  4H8J A;  5IKB A;  3O6G A;  3UK4 A;  5EHS A;  2DE2 A;  1MS7 A;  2ZYM A;  5FHO A;  2DWI A;  2M8C A;  1LBB A;  4N07 A;  1SW2 A;  4IGT A;  1UTH B;  5I58 B;  2I0B A;  5DEX B;  3FJM A;  4F39 A;  1IZ1 A;  5FTI A;  2O1L A;  2ZNS A;  4GD5 A;  1BP5 A;  3RGY A;  1CE2 A;  4IO4 A;  1Y9U A;  1O7T A;  2YLN A;  2I58 A;  2OJT A;  3K01 A;  3ODB A;  3FXQ A;  3T96 B;  3QIM A;  5FHM A;  2DVZ A;  2V93 A;  3K4U A;  2XXT A;  4GXS B;  3CR9 A;  3TQL A;  4HCW A;  4ZEI A;  4R9G A;  2R71 A;  4DDD A;  3G3H A;  4QFK A;  1R1N A;  4GQO A;  4F3B A;  2BJJ X;  1XS5 A;  4DIG A;  4OXV A;  3CFL A;  3EQ1 A;  3M3L A;  1MXY A;  4BDN A;  3H03 A;  1NNP A;  4RYA A;  3KN7 A;  3MVX A;  4LA9 A;  1MXV A;  1MXX A;  1B51 A;  1SDX A;  3A3U A;  2AL4 A;  4YB5 A;  2XXQ A;  1MPC A;  5JK4 A;  1MY3 A;  2F5X A;  4RA1 A;  3MW0 A;  2UVI A;  1MY1 A;  2F97 A;  4GRK A;  1MH3 A;  1XOC A;  1B7Z A;  3FAT A;  3MBP A;  1B6H A;  5I2N B;  2RC7 A;  3KBR A;  3H6T A;  4ZE8 A;  4EUO A;  2ALU A;  5KDT A;  1M5C A;  3PMW A;  2HZK A;  4F3P A;  1OLA A;  1USY E;  3DRK A;  4NE4 A;  1LLS A;  4ZEC A;  4ZED A;  2PBW A;  2Q8J A;  1KWH A;  3GBA A;  4X48 A;  1QVS A;  1ZMG A;  1IXC A;  3RYA A;  2I3V A;  4R9F A;  4WED A;  2H98 A;  5HBC A;  4ZEB A;  4FEC A;  5BWJ A;  2FNC A;  3PUZ E;  4Q0C A;  1ZBM A;  4BDR A;  4IO7 A;  4ZEK A;  5J1D A;  4TLM B;  4OFO A;  4FAT A;  4WXJ A;  2O7U A;  4U4X A;  3U1O A;  2XX7 A;  1BIY A;  3OSQ A;  4YKJ A;  3K02 A;  2DQV A;  3RN8 A;  3UP9 A;  2CZL A;  1US4 A;  4NTL A;  1POY 1;  1I6Q A;  4MLV A;  1AIV A;  1CB6 A;  4NF6 A;  4ECF A;  3T9U A;  1PB9 A;  5I58 A;  5KZT A;  5ITP A;  3O6P A;  1SI1 A;  2P2A A;  1DSN A;  3DRH A;  2HEU A;  4JB7 A;  3C9H A;  5AA2 B;  4IGR A;  2UXA A;  2GHA A;  3IL1 B;  4LUB A;  4KFQ A;  4EF2 A;  4RNS A;  4IY6 A;  2A5T B;  4JDF A;  4YIC A;  3Q29 A;  4RPO A;  4ISU A;  1ANF A;  3HPI A;  4C1T A;  1P1W A;  4F1U A;  4MLQ A;  1JNF A;  3PAM A;  2B3F A;  1DPP A;  4QFP A;  1S50 A;  3HV1 A;  1B3H A;  1OLC A;  2ZYO A;  3U8Q A;  1N7W A;  4GL8 A;  4XIG Q;  2V3T A;  5AA4 B;  5I84 A;  4OEU A;  5AA3 A;  4QFN A;  2UYF A;  2O51 A;  3KEI A;  3VV5 A;  4N6P A;  3TCF A;  5H8F B;  5CI5 A;  3M3K A;  2E1S A;  2RIN A;  3CFZ A;  3OO8 A;  5DVI A;  2Z8E A;  3Q25 A;  4NF8 B;  2XXH A;  2Q2A A;  3FIR A;  4R2F A;  1FCK A;  2GH9 A;  3SES A;  2Y7K A;  3UA8 A;  3D4G A;  3T9X B;  4R75 A;  3FGS A;  5I2N A;  2DXR A;  3EF7 A;  3S4U A;  2YJP A;  2H99 A;  4RK2 A;  1EU8 A;  3TCH A;  1O64 A;  2IA4 A;  3TPA A;  4KYD A;  4TOZ A;  4I1D A;  3PGF A;  1Z7M E;  2X7Q A;  3IOU A;  2F34 A;  1EZ9 A;  5L9S A;  1FTK A;  2NOO A;  1H44 A;  1Y1M A;  1BLF A;  3DRG A;  3VVD A;  3TYH A;  4LVQ A;  4JWX A;  2FYI A;  2NUV A;  1OMP A;  4Z0I A;  3K0V A;  1MXU A;  3VXC A;  4DXB A;  1DTZ A;  5I59 B;  4LP2 B;  1N04 A;  3FVN A;  3MC2 A;  3THI A;  1LBC A;  5CRY A;  2ZYN A;  1MDQ A;  4ZZE A;  4YKP A;  3R6U A;  2VHA A;  3MP6 A;  1SVX B;  5I56 B;  2LAO A;  3GZG A;  3IJO B;  1SBP A;  4EXK A;  1MRP A;  2RCA A;  5ICT A;  3PMX A;  1B40 A;  3PUX E;  4X9T A;  3U94 A;  3T93 B;  3A09 A;  2Y7I A;  1JW4 A;  1SI0 A;  2ONR A;  3HO7 A;  3QUF A;  1NH8 A;  3D4C A;  1QUJ A;  5H8H B;  3EN3 A;  3C4M A;  1UIV A;  2F35 A;  4XKQ A;  4Z7E A;  4R6H A;  2PT1 A;  1NNT A;  2OZZ A;  1QKB A;  3N5L A;  1ZJL A;  4JSO A;  4ZE9 A;  3OO6 A;  3V83 A;  3CG1 A;  2A5T A;  2Y7R A;  2PVU A;  2VOZ A;  4F31 B;  1LAG E;  2ONK E;  4P0G A;  3Q26 A;  2DWJ A;  5AA1 A;  1MQG A;  3OO9 A;  2I4B A;  1SD3 A;  5TP9 A;  5AA4 A;  5KDT B;  2ZMB A;  1P99 A;  4XKP A;  2O69 A;  2DOJ A;  1YCJ A;  4NED A;  4M1V A;  3MZB A;  4GIZ A;  2QL3 A;  3U93 A;  1B9J A;  1FQD A;  4NF8 A;  1IEJ A;  4IY5 A;  4F1V A;  2I6E A;  1JW1 A;  2Q89 A;  1LAX A;  3EHT A;  4ND9 A;  1VR5 A;  1OVB A;  5DTB A;  3RTW B;  3TUS A;  4OVJ A;  3LSX A;  2QMX A;  1OVT A;  3B6Q A;  5CBS A;  3B7D A;  4ELR A;  2F78 A;  1YPN A;  4EQ9 A;  1Z7N E;  3USD A;  4ZZA A;  5B7D A;  2H4I A;  3TTL A;  4NF6 B;  1LB8 A;  1TFA A;  3MPK A;  2H9B A;  3RUM A;  5CC2 A;  3CG3 A;  3R26 A;  1B3G A;  4POW A;  1P1O A;  3QAX A;  5M2V A;  4I62 A;  3LSL A;  2O84 X;  1VSO A;  4IO3 A;  5I59 A;  2Q88 A;  2HXW A;  1TXF A;  3H6U A;  4OER A;  1FTM A;  4KD5 A;  3U72 A;  3I5O A;  3QYT A;  2OLB A;  2F7C A;  3B6T A;  3MZ9 A;  4F18 A;  4R72 A;  3LSW A;  2XXU A;  3N6U A;  4YAH X;  4PFU A;  4U2R A;  1AOV A;  2G93 A;  3HCQ A;  2HFB A;  4NWC A;  5I56 A;  1MH4 A;  3T9V A;  3PMV A;  4U4S A;  1N3W A;  3RYB A;  1YAE A;  4H67 A;  3TKD A;  4R2B A;  3KSJ A;  3E4R A;  3T22 A;  2QSX A;  3CI8 A;  2REG A;  1BTJ A;  4TQU Q;  5H8H A;  3VFJ A;  1ELJ A;  3KSX A;  3N6T A;  1WVJ A;  1NKX A;  1N7X A;  3FZV A;  1J1N A;  3DEL B;  4KCD A;  1M5D A;  2IEE A;  5L9O A;  4AB6 A;  3C33 A;  2ZXT A;  4MH5 A;  2Y84 A;  1JEV A;  2E0S A;  4F19 A;  1AL3 A;  4QF9 A;  1MM6 A;  3BBR A;  3OOA A;  1MQD A;  4JXI A;  4I9D A;  3G3I A;  3OO7 A;  1PC3 A;  2P1S A;  4JSD A;  1PEB A;  1DPE A;  3C35 A;  2QS2 A;  2Z8F A;  3MZ1 A;  3MAM A;  1FQC A;  2ANJ A;  2V3Q A;  3PPO A;  3SEV A;  1II5 A;  1L5T A;  4F29 A;  5H8Q B;  3HN0 A;  4K3F A;  4G2Z A;  3TAJ A;  3C36 A;  1QUK A;  1QKA A;  5H8S A;  3FD3 A;  2XXX A;  2FA7 A;  1LST A;  3O6I A;  1MPD A;  3S9N C;  3UGW A;  3OEL A;  4RPN A;  4KYE A;  1NFT A;  3G3F A;  3E9X A;  2RF1 A;  3K6W A;  4BDQ A;  5KCJ A;  2UYE A;  2DYX A;  4I8C A;  5FHN A;  5CM6 A;  2WOK A;  1N0T A;  3W9V A;  2DSF A;  1B1H A;  1FTL A;  2D21 A;  4X1B A;  1ZTY A;  1A54 A;  3FJG A;  3OXN A;  4LON B;  1VE4 A;  4OEV A;  2Z22 A;  2Y7W A;  4KI0 E;  1WOD A;  2H5Y A;  3EPE A;  1B5J A;  4NWD A;  1MY4 A;  4ZEF A;  4WEP A;  1YTV A;  4BDL A;  1Q35 A;  2XXI A;  3C31 A;  1MM7 A;  1A7L A;  3C34 A;  3CRB A;  1B0H A;  4KQP A;  4IO6 A;  1PBQ A;  1OQH A;  3KN8 A;  2ABH A;  1D9Y A;  1NL5 A;  3LR1 A;  1SYI A;  4BLA A;  3BFT A;  3IO4 A;  3V5A A;  4XKR A;  4MF3 A;  4QFO A;  3VDF A;  5TP9 B;  2GRV A;  1T0K A;  4GOT A;  1RYO A;  2ZNT A;  1Q1K A;  4JWY A;  3HHG A;  1JVX A;  3IO6 A;  3TMG A;  3OMB A;  1IXG A;  3P7I A;  1POT A;  1Y4T A;  2XXP A;  4L17 A;  1M5B A;  5I2K A;  1N76 A;  2W7Y A;  1B46 A;  4QFL A;  2QJE A;  1B7U A;  4EQ7 A;  3W9W A;  3TCG A;  4LAT A;  1FQF A;  1NNF A;  3EHS A;  4EDP A;  1AMF A;  3MP8 A;  5ISU A;  3F11 A;  1S9T A;  1GR2 A;  2XXW A;  2YPN A;  1SW5 A;  4RY1 A;  1UQW A;  4F22 A;  4ESX A;  1QUL A;  1B2H A;  1A99 A;  3QUJ A;  1HSE A;  4YKI A;  2CMO A;  2KLF A;  2DE4 A;  3PU5 A;  2UVH A;  3PUV E;  2Q9T A;  1P1U A;  3SDF A;  3G3G A;  3H6W A;  4LZ5 A;  3K00 A;  3UN6 A;  4AQ4 A;  2DXY A;  4GXA A;  3TTN A;  3VVF A;  4R6Y A;  5H8Q A;  2D3I A;  2OCU A;  4U22 A;  3DM0 A;  3RPW A;  2HZL A;  4R73 A;  5TU0 A;  3WAF A;  4PP0 A;  3O9P A;  4G4P A;  4FEB A;  1P1Q A;  5TPA A;  3LUY A;  5L8D A;  3SKP A;  3O2A A;  3OD7 A;  5HM4 B;  4H5F A;  1BKA A;  3E3K A;  4PFW A;  1R6Z A;  1VFD A;  5AA2 D;  3SEU A;  3N94 A;  1WDN A;  1EH3 A;  3O29 A;  1MXZ A;  3N26 A;  4DXU A;  2XHD A;  1FTJ A;  2F36 A;  3S9M C;  1SW1 A;  4HCY A;  3MPL A;  1B3E A;  3DRI A;  1DTG A;  4LQ2 A;  2PYY A;  3L6H A;  1PB7 A;  1B4Z A;  3K1N A;  3FV1 A;  4HS7 A;  3IK6 B;  4G68 A;  2I49 A;  2XD3 A;  1XVX A;  2X26 A;  3K6U A;  3TDJ A;  3SET A;  3JZJ A;  3KOT A;  1VFE A;  3KZG A;  3VLV A;  1DOT A;  1SQY A;  4OQO A;  4WKM A;  3RTF B;  5DVJ A;  2P0S A;  3GXA A;  1B5H A;  4OTE A;  4OEN A;  4YMA A;  4JWO A;  3MVZ A;  4YKK A;  2QRY A;  3GBB A;  1P1N A;  4DZ1 A;  3LBS A;  1S7Y A;  2O6A A;  4YB6 A;  4YMB A;  1LFG A;  4IB2 A;  4H0W A;  1FW0 A;  3TOD A;  4FE8 A;  1MQJ A;  1ZU0 A;  4IO5 A;  3TTR A;  4RJZ A;  1QW0 A;  1FQE A;  1B3L A;  2DE3 A;  4U23 A;  1XHY A;  1H3D A;  1URS A;  3DP4 A;  2NVU B;  5FTH A;  3MP1 A;  1PB8 A;  3DRF A;  3DP6 A;  5CMB A;  1MG1 A;  1HSL A;  3VVE A;  2QPQ A;  1LFH A;  4NMY A;  3TEP A;  2X7P A;  5CBR A;  3M3F A;  1Y3N A;  1FTO A;  1URD A;  1O63 A;  4OHN A;  3DRJ A;  2PT2 A;  3KG2 A;  5L9M A;  4DLD A;  3CSG A;  2AL5 A;  3S2V A;  4OES A;  4H6D A;  3IOW A;  5KCJ B;  3RT6 B;  3DP8 A;  3DLN A;  1RKM A;  5BUU A;  1H45 A;  4OYV A;  1TWY A;  2HQ0 A;  3VLW A;  2I4C A;  1EZP A;  4PE5 B;  1LB9 A;  4QHQ A;  1LAF E;  2ZNU A;  1D9V A;  3PPP A;  2B3B A;  3H6V A;  2O7I A;  2QMW A;  1PBP A;  3MJN A;  1IIT A;  1NH7 A;  4PFT A;  1SYH A;  3KN3 A;  5CMK A;  3SEX A;  2OWS A;  2HCA A;  4ELO A;  4ESW A;  2GHB A;  4ZDM A;  3C32 A;  1B52 A;  2VD2 A;  3IOR A;  2THI A;  1GTK A;  4DXC A;  1R9L A;  4F2Q A;  1JQF A;  4GF8 A;  1GVC A;  1Y20 A;  3VE1 B;  5F1Q A;  5B70 A;  2VGQ A;  2QS4 A;  1B58 A;  3OEM A;  3CHG A;  4OFL A;  5CMC A;  4GFR A;  1D4N A;  2DS9 A;  1F9B A;  4GVO A;  5DYH A;  2DWH A;  1MXW A;  1B1X A;  5EHM A;  3FV2 A;  3Q27 A;  4KPT A;  1Y3P A;  3QXM A;  1MPB A;  4FIM A;  1B7H A;  1I69 A;  1IXH A;  3FJ7 A;  4GLI A;  4THI A;  4KCC A;  2AYS A;  5I2K B;  5H8N A;  1NNK A;  4G8M A;  3I6V A;  3R7X A;  3Q28 A;  3HST A;  3KOS A;  5K2X A;  3QK6 A;  3FVO A;  3QSL A;  2B4M A;  1SW4 A;  2RC9 A;  4H5G A;  1XC1 A;  3LC8 A;  3CVG A;  1B05 A;  4ELP A;  4HW8 A;  2REJ A;  3V8X B;  3PD8 A;  3UIF A;  2AIX A;  2UVG A;  1PDA A;  3K6X A;  3A3C A;  3VLU A;  2ESN A;  4Q5T A;  4H65 A;  3MUQ A;  3TZA A;  1OQG A;  2WOL A;  5DT6 A;  2HAU A;  1N3X A;  4FAJ A;  4G8H A;  3MVY A;  4KHZ E;  3SEY A;  4U1Z A;  5TPA B;  1A55 A;  3PD9 A;  3ZSF A;  3LSF B;  3KFM A;  4C0R A;  4OET A;  4TLL B;  5IAI A;  3IX1 A;  1AH5 A;  4DCY A;  5DVF A;  1XT8 A;  4DE8 A;  3H7M A;  2XD2 A;  5JEI A;  4F2O A;  2RC8 A;  4JBZ A;  4O3A A;  4NF5 A;  1JEU A;  1I6B A;  3H4Z A;  4ONY A;  4M4G A;  3H06 B;  1IQ7 A;  2DVC A;  2O68 A;  3FVK A;  1JVY A;  4YZZ A;  3SEW A;  3KJT A;  2D5W A;  3HHF A;  1RYX A;  1R9Q A;  2V25 A;  4G68 B;  3U92 A;  1USY H;  3IB0 A;  3IOV A;  1ZKB A;  4G77 A;  2F6G A;  3FXR A;  3OSR A;  3PPN A;  1MDP 1;  2O1M A;  2B4L A;  3UOR A;  4AB5 A;  4XTC Q;  1UTH A;  3K6V A;  3PPR A;  5DEX A;  1US5 A;  3IOT A;  1IXI A;  1I6A A;  4PET A;  3IJX B;  1ZLQ A;  5I57 B;  2V84 A;  5ICQ A;  1H76 A;  4FOR A;  4R6K A;  4E0X A;  1MY2 A;  1LCT A;  4Q30 B;  4QSE A;  4UA8 A;  3BKI B;  3H3G A;  1H43 A;  2XXR A;  3PV0 E;  3PUY E;  4GWO A;  3FUZ A;  3MWB A;  2A5S A;  4NF4 B;  3RT8 A;  2XXY A;  5A5X B;  2XX8 A;  4IO2 A;  2HAV A;  4YB7 A;  1UTB B;  2R6G E;  4EQB A;  2RCB A;  3GLB A;  3IAZ A;  3AXF A;  3ECR A;  3V89 B;  3W15 C;  2VP1 A;  4HTG A;  1MQH A;  3O97 A;  3G3J A;  3ILU B;  1FQA A;  1ZIU A;  4BDO A;  1B32 A;  3FAS A;  3PPQ A;  4LZ8 A;  4ZS9 A;  1M5E A;  1B0L A;  3OEN A;  1EZO A;  4YU0 A;  4GL0 A;  3B6W A;  3RQT A;  4E0W A;  3L6G A;  1UIU A;  5F7V A;  3RLF E;  2NXO A;  3LVU A;  4XXU A;  3K1M A;  1LFI A;  3JV9 A;  1QUI A;  1OIB A;  1JET A;  4F1Y A;  2V3U A;  4QRZ A;  1LAH E;  5JTY B;  3IB2 A;  5ELV A;  2F7B A;  3E13 X;  2PX1 A;  2Q2C A;  3MQ9 A;  4UAC A;  3KJ7 A;  4O3C A;  3JYR A;  3K1P A;  2GFE A;  3KGC A;  3CFX A;  4Q8R A;  1JW5 A;  3ZS6 A;  3IB1 A;  1B4H A;  3VXB A;  2R9J A;  5CMM A;  4EF1 A;  4OFJ A;  3ZKK A;  3M8U A;  4OWD A;  4F3G A;  1M5F A;  3MVW A;  2UVJ A;  3BFU A;  1B3F A;  1ATG A;  4OZ9 A;  4R74 A;  4POX A;  4G8N A;  3T9H B;  1GV8 A;  4EXL A;  3PUW E;  2NWJ A;  2ZYK A;  3G7W A;  2XXV A;  4F3S A;  2VD3 A;  3FXU A;  3RY3 A;  4ELQ A;  2DWA A;  1TFD A;  4QSC A;  2I0C A;  1Y4C A;  4LZ7 A;  4DCX A;  3IR1 A;  1MQI A;  2F6P A;  5LOM A;  4QSD A;  4PQJ A;  3TQW A;  4MFI A;  1HSJ A;  1QJM A;  4H8I A;  1D3K A;  2Z23 A;  3TFL A;  2DP8 A;  2QS3 A;  5AE4 A;  1IUD A;  2OK2 A;  5H8N B;  4PFY A;  3G3K A;  2OBG A;  2H25 A;  1DMB A;  4C1U A;  3WAE A;  1N84 A;  5I57 A; 
#chains in the Genus database with same CATH topology
 2F8D A;  2Z8D A;  3K2D A;  3T66 A;  1URG A;  4MBP A;  5AA2 A;  2I48 A;  4KR5 A;  4FED A;  3ONM A;  4XKN A;  4RK9 A;  3RNN A;  4XF5 A;  4X8R A;  4KYS A;  4NF4 A;  2ONS A;  4P0I A;  3I3V A;  1K9Y A;  2WOP A;  2WYK A;  5HPQ A;  1AWB A;  3CSB A;  1Y1Z A;  5A5X A;  3ZKL A;  1UTB A;  3TEL A;  1IIW A;  5T3J A;  1Y3Q A;  1GGG A;  4BDM A;  4OA4 A;  3TTM A;  2WKY A;  2OWT A;  1XVY A;  1A40 A;  4O3B A;  4U1O A;  4OMB A;  2F7A A;  4P11 A;  3O66 A;  3EHU A;  2RKM A;  3O28 A;  2QS1 A;  5LTC A;  3S9L C;  4QBA A;  2Y7P A;  5K2Y A;  1NMU A;  3SER A;  3TTK A;  4PF8 A;  4N8G A;  2I3W A;  5H8F A;  1A8F A;  4N13 A;  3T1B A;  3CIJ A;  3OEK A;  2B65 A;  4FJP A;  1LCF A;  4GWW A;  2PMS A;  4H1X A;  1FBF A;  1A8E A;  2VT5 A;  3FTO A;  1EYJ A;  1LGB C;  4G68 C;  2G29 A;  4U21 A;  5EYF A;  3FVG A;  1FQB A;  3O6H A;  4X1D A;  3ILT B;  1FBC A;  3S9E A;  4RXL A;  4NF5 B;  1NUX A;  1TT1 A;  5ITO A;  4HXV A;  5JTY A;  1B5I A;  2XX9 A;  4LQ5 A;  1MY0 A;  4H8J A;  5IKB A;  3O6G A;  3UK4 A;  1QGX A;  5EHS A;  2DE2 A;  5DW8 A;  1MS7 A;  5FBP A;  2ZYM A;  5FHO A;  2DWI A;  2M8C A;  1LBB A;  4N07 A;  1SW2 A;  2KQZ A;  4IGT A;  1UTH B;  5I58 B;  2I0B A;  5DEX B;  3FJM A;  4F39 A;  1IZ1 A;  5FTI A;  2O1L A;  4HE2 A;  2ZNS A;  4GD5 A;  1BP5 A;  3RGY A;  1CE2 A;  4IO4 A;  1Y9U A;  1O7T A;  3QMF A;  2YLN A;  3IFC A;  2I58 A;  2OJT A;  1FBG A;  3K01 A;  3ODB A;  3FXQ A;  3T96 B;  3QIM A;  2JJK A;  4PBQ A;  5A5L A;  5FHM A;  2Q74 A;  2DVZ A;  2V93 A;  3K4U A;  2XXT A;  4N81 A;  4GXS B;  1NUY A;  2VPN A;  3CR9 A;  3TQL A;  4HCW A;  4ZEI A;  4R9G A;  1IME A;  2R71 A;  4DDD A;  3G3H A;  4QFK A;  1R1N A;  4GQO A;  4F3B A;  1YXI A;  2BJJ X;  1XS5 A;  4DIG A;  4OXV A;  3CFL A;  3B8B A;  3EQ1 A;  3M3L A;  1MXY A;  4BDN A;  5LDZ A;  3H03 A;  1NNP A;  4RYA A;  4PE3 A;  3KN7 A;  3MVX A;  4LA9 A;  1MXV A;  1MXX A;  1B51 A;  1SDX A;  3A3U A;  2AL4 A;  4YB5 A;  2XXQ A;  1MPC A;  5JK4 A;  1MY3 A;  2F5X A;  2HHM A;  4RA1 A;  3MW0 A;  1DK4 A;  1MY1 A;  2F97 A;  2UVI A;  4GRK A;  1NUZ A;  1MH3 A;  1XOC A;  1B7Z A;  3FAT A;  3MBP A;  1B6H A;  5I2N B;  2RC7 A;  3KBR A;  3H6T A;  4ZE8 A;  4DI4 B;  4LN5 A;  1KA1 A;  4EUO A;  2ALU A;  5KDT A;  1M5C A;  3PMW A;  2HZK A;  2L5V A;  4F3P A;  1OLA A;  1USY E;  3DRK A;  4NE4 A;  4O8M A;  1FPL A;  1NV0 A;  1LLS A;  4ZEC A;  4ZED A;  2PBW A;  2CZK A;  2FHY A;  2Q8J A;  1KWH A;  3GBA A;  4X48 A;  1QVS A;  4PTK A;  1ZMG A;  5IGA A;  1IXC A;  3RYA A;  2I3V A;  4R9F A;  4WED A;  2H98 A;  5HBC A;  4ZEB A;  4FEC A;  5BWJ A;  2FNC A;  3PUZ E;  4Q0C A;  1ZBM A;  4IR8 A;  1IMD A;  4BDR A;  4IO7 A;  4ZEK A;  5J1D A;  4TLM B;  4OFO A;  4FAT A;  4WXJ A;  2O7U A;  4U4X A;  3U1O A;  3RYD A;  2XX7 A;  4MMP A;  1BIY A;  3OSQ A;  4YKJ A;  3K02 A;  2DQV A;  3RN8 A;  3UP9 A;  2CZL A;  1US4 A;  4NTL A;  1FPB A;  1POY 1;  1I6Q A;  4MLV A;  1AIV A;  1CB6 A;  4NF6 A;  4ECF A;  3T9U A;  1PB9 A;  3BIG A;  1LEV A;  5I58 A;  5KZT A;  5ITP A;  3O6P A;  1SI1 A;  2P2A A;  1DSN A;  1FBP A;  3DRH A;  2HEU A;  4JB7 A;  3C9H A;  5AA2 B;  4IGR A;  1LBV A;  2UXA A;  2GHA A;  3IL1 B;  4GWZ A;  4LUB A;  4KFQ A;  4PGP A;  4I3E A;  5EQA A;  4EF2 A;  4RNS A;  4IY6 A;  2A5T B;  4JDF A;  5I7I A;  4YIC A;  3Q29 A;  4RPO A;  4ISU A;  1ANF A;  2WYP A;  3HPI A;  4C1T A;  1P1W A;  1FPE A;  4F1U A;  4MLQ A;  4AS4 A;  1JNF A;  3PAM A;  1IMC A;  2B3F A;  1DPP A;  4QFP A;  1S50 A;  3HV1 A;  1B3H A;  1OLC A;  2ZYO A;  3U8Q A;  1N7W A;  4GL8 A;  4GX3 A;  4XIG Q;  2V3T A;  5AA4 B;  3PTY A;  5I84 A;  4OEU A;  5AA3 A;  4QFN A;  2UYF A;  2O51 A;  3KEI A;  3VV5 A;  4N6P A;  3TCF A;  5H8F B;  5CI5 A;  1FPG A;  3M3K A;  2E1S A;  2RIN A;  3CFZ A;  3OO8 A;  2CZH A;  5DVI A;  2Z8E A;  3Q25 A;  4NF8 B;  2XXH A;  2Q2A A;  1NUW A;  3FIR A;  4R2F A;  1FCK A;  2GH9 A;  3SES A;  2Y7K A;  3UA8 A;  4MEV A;  3D4G A;  5F24 A;  3E79 A;  3T9X B;  4R75 A;  3FGS A;  4P1E A;  5I2N A;  5IZ3 A;  2DXR A;  3EF7 A;  3S4U A;  2YJP A;  2H99 A;  4RK2 A;  1EU8 A;  3TCH A;  1O64 A;  2IA4 A;  4MHF A;  3TPA A;  4KYD A;  4TOZ A;  4I1D A;  3PGF A;  1Z7M E;  2X7Q A;  2FBP A;  3IOU A;  2F34 A;  1EZ9 A;  5L9S A;  1FTK A;  2NOO A;  1H44 A;  1Y1M A;  1NV7 A;  1BLF A;  3DRG A;  3VVD A;  4PCD A;  3TYH A;  4LVQ A;  2QVV A;  4GWS A;  3NOH A;  1LBY A;  2FYI A;  4JWX A;  2NUV A;  1OMP A;  4Z0I A;  3K0V A;  1MXU A;  3VXC A;  4DXB A;  1DTZ A;  5I59 B;  4LP2 B;  1N04 A;  3FVN A;  3MC2 A;  3THI A;  1LBC A;  5CRY A;  2ZYN A;  4O7I A;  1MDQ A;  2ZZW A;  4ZZE A;  4YKP A;  3R6U A;  4OVR A;  3RPL A;  2VHA A;  3MP6 A;  1SVX B;  5I56 B;  2LAO A;  3GZG A;  2P3V A;  3IJO B;  1SBP A;  4EXK A;  1MRP A;  2RCA A;  5ICT A;  2V4C A;  3PMX A;  1B40 A;  3PUX E;  4X9T A;  3U94 A;  3T93 B;  3A09 A;  1RDY A;  2Y7I A;  1JW4 A;  1SI0 A;  2ONR A;  3HO7 A;  3QUF A;  1NH8 A;  3D4C A;  4PFB A;  1QUJ A;  5H8H B;  3EN3 A;  3C4M A;  4N8Y A;  1UIV A;  2F35 A;  4XKQ A;  4Z7E A;  4R6H A;  2PT1 A;  1NNT A;  2OZZ A;  1QKB A;  3N5L A;  1ZJL A;  4JSO A;  4ZE9 A;  4PBH A;  1IMA A;  3OO6 A;  3V83 A;  1FPF A;  3CG1 A;  4PFI A;  2A5T A;  2Y7R A;  2PVU A;  2VOZ A;  4F31 B;  1LAG E;  2ONK E;  4P0G A;  3Q26 A;  4N17 A;  2DWJ A;  5EQ8 A;  5AA1 A;  4MNC A;  1MQG A;  3OO9 A;  2P3N A;  2I4B A;  1SD3 A;  5TP9 A;  5AA4 A;  5KDT B;  1VDW A;  2ZMB A;  4P3L A;  1P99 A;  2WBD A;  4XKP A;  4GX6 A;  2O69 A;  2DOJ A;  1YCJ A;  4NED A;  2VPO A;  4M1V A;  3MZB A;  4GIZ A;  2QL3 A;  1KA0 A;  2OX3 A;  3U93 A;  1B9J A;  1FQD A;  4NF8 A;  1IEJ A;  4IY5 A;  4F1V A;  2I6E A;  3B50 A;  1JW1 A;  2Q89 A;  5EYG A;  1LAX A;  3EHT A;  4ND9 A;  4PAI A;  1VR5 A;  1OVB A;  5IZ1 A;  5DTB A;  3RTW B;  3TUS A;  4OVJ A;  3LSX A;  2QMX A;  1OVT A;  3B6Q A;  5CBS A;  3B7D A;  4ELR A;  2F78 A;  1YPN A;  4EQ9 A;  1Z7N E;  3USD A;  4ZZA A;  5B7D A;  2H4I A;  3TTL A;  5EYH A;  4NF6 B;  1LB8 A;  1TFA A;  3MPK A;  2H9B A;  1FRP A;  3RUM A;  5CC2 A;  3CG3 A;  3R26 A;  1B3G A;  4POW A;  1P1O A;  3QAX A;  1LBZ A;  5M2V A;  4I62 A;  3LSL A;  2O84 X;  1VSO A;  4IO3 A;  5I59 A;  2Q88 A;  2HXW A;  1TXF A;  3H6U A;  4OER A;  1FTM A;  4KD5 A;  3U72 A;  3I5O A;  1FPI A;  3QYT A;  2OLB A;  2F7C A;  3D1R A;  2R8T A;  3B6T A;  4JVD A;  3MZ9 A;  4F18 A;  4R72 A;  3LSW A;  2XXU A;  5IM2 A;  3N6U A;  4YAH X;  3ISP A;  4PFU A;  4NHB A;  4U2R A;  1AOV A;  2G93 A;  3HCQ A;  2HFB A;  4NWC A;  5I56 A;  1MH4 A;  1YZ0 A;  3T9V A;  1FTA A;  3PMV A;  4U4S A;  1N3W A;  3RYB A;  1YAE A;  4H67 A;  3TKD A;  4R2B A;  3IFA A;  3KSJ A;  3E4R A;  3T22 A;  1NV6 A;  2QSX A;  2QVR A;  3CI8 A;  2REG A;  1BTJ A;  4TQU Q;  5H8H A;  3VFJ A;  1ELJ A;  2FVZ A;  3KSX A;  3N6T A;  1WVJ A;  1NKX A;  1N7X A;  3FZV A;  1J1N A;  3DEL B;  4KCD A;  2Y5L A;  4KXP A;  2FIX A;  4FBP A;  1M5D A;  2IEE A;  5ET5 A;  4AB6 A;  5L9O A;  3C33 A;  2ZXT A;  4MH5 A;  2Y84 A;  1JEV A;  1BK4 A;  2E0S A;  4F19 A;  4X04 A;  1FPK A;  1AL3 A;  4QF9 A;  1MM6 A;  5IZ3 B;  3BBR A;  3OOA A;  3E78 A;  1MQD A;  4JXI A;  2Q8M A;  4I9D A;  3G3I A;  3OO7 A;  1PC3 A;  2P1S A;  4MIJ A;  4JSD A;  1PEB A;  1DPE A;  3C35 A;  1FJ6 A;  2QS2 A;  2Z8F A;  3MZ1 A;  3MAM A;  4PC9 A;  1FQC A;  2ANJ A;  2V3Q A;  3PPO A;  3SEV A;  1II5 A;  1L5T A;  4F29 A;  5H8Q B;  4NF0 A;  3HN0 A;  4K3F A;  4G2Z A;  3TAJ A;  3C36 A;  2CZI A;  1QUK A;  1CNQ A;  1QKA A;  5H8S A;  3FD3 A;  2XXX A;  2FA7 A;  1LST A;  3O6I A;  1MPD A;  1NV2 A;  2XWV A;  3UGW A;  3S9N C;  3OEL A;  1FJ9 A;  4RPN A;  4KYE A;  1NFT A;  1EYK A;  2WEF A;  3G3F A;  3E9X A;  2RF1 A;  3K6W A;  4BDQ A;  5KCJ A;  2UYE A;  2DYX A;  4I8C A;  2DDK A;  5FHN A;  3RPL B;  5CM6 A;  2WOK A;  1N0T A;  4P56 A;  1FBH A;  1KZ8 A;  4N6D A;  3W9V A;  4MAG A;  1FPD A;  2DSF A;  1B1H A;  2F3D A;  1FTL A;  2D21 A;  4X1B A;  1ZTY A;  1A54 A;  3FJG A;  3OXN A;  4LON B;  1VE4 A;  4OEV A;  2Z22 A;  2Y7W A;  4KI0 E;  4H46 A;  3U65 A;  1WOD A;  2H5Y A;  3EPE A;  4PDD A;  1B5J A;  3KC1 A;  2PFY A;  4NWD A;  2XXK A;  1MY4 A;  4ZEF A;  4WEP A;  1YTV A;  4BDL A;  1Q35 A;  2XXI A;  3C31 A;  1SPI A;  3FXB A;  1MM7 A;  1A7L A;  3C34 A;  3CRB A;  1B0H A;  4KQP A;  4IO6 A;  1PBQ A;  1OQH A;  2MKZ A;  1G0H A;  3KN8 A;  2ABH A;  1D9Y A;  1NL5 A;  5EQ9 A;  3LR1 A;  1JP4 A;  1SYI A;  4BLA A;  3BFT A;  3IO4 A;  3V5A A;  2ZZV A;  3SZP A;  4XKR A;  4MF3 A;  4QFO A;  4N4U A;  3VDF A;  5TP9 B;  2GRV A;  1T0K A;  4GOT A;  1RYO A;  2ZNT A;  1Q1K A;  4JWY A;  3HHG A;  1JVX A;  3IO6 A;  3TMG A;  3OMB A;  1IXG A;  3P7I A;  1POT A;  1Y4T A;  2XXP A;  4OAN A;  4L17 A;  1YYZ A;  1M5B A;  5I2K A;  4PAK A;  1N76 A;  1FBD A;  1NV3 A;  1B46 A;  2W7Y A;  4QFL A;  2QJE A;  1B7U A;  4EQ7 A;  1EYI A;  3W9W A;  1K9Z A;  3TCG A;  4LAT A;  1FQF A;  1NNF A;  3EHS A;  4EDP A;  2QVU A;  1AMF A;  3MP8 A;  4UAB A;  5ISU A;  3F11 A;  1S9T A;  1GR2 A;  2XXW A;  2BJI A;  3KC0 A;  2YPN A;  1SW5 A;  4RY1 A;  1UQW A;  4F22 A;  4ESX A;  1QUL A;  1IMB A;  5ESY A;  1B2H A;  1A99 A;  3QUJ A;  4GBV A;  1HSE A;  4YKI A;  2CMO A;  2GQ1 A;  2HXR A;  2KLF A;  1NV5 A;  2DE4 A;  2XWI A;  3PU5 A;  4PAF A;  2UVH A;  3PUV E;  4P1L A;  2Q9T A;  1FPJ A;  1P1U A;  3SDF A;  3G3G A;  4NAP A;  3H6W A;  4LZ5 A;  3K00 A;  3UN6 A;  4AQ4 A;  2DXY A;  4GXA A;  3TTN A;  3MST A;  4R6Y A;  3VVF A;  5H8Q A;  2D3I A;  2OCU A;  4PDH A;  4U22 A;  2PCR A;  3DM0 A;  3RPW A;  2HZL A;  4R73 A;  5TU0 A;  3WAF A;  4PP0 A;  3O9P A;  4G4P A;  4FEB A;  1P1Q A;  5TPA A;  3LUY A;  5L8D A;  3SKP A;  3O2A A;  3OD7 A;  5HM4 B;  4H5F A;  1BKA A;  3E3K A;  4OVS A;  4PFW A;  4XFE A;  1R6Z A;  4NG7 A;  1VFD A;  5AA2 D;  3SEU A;  3N94 A;  1WDN A;  1EH3 A;  3O29 A;  1MXZ A;  3N26 A;  4DXU A;  2XHD A;  1FTJ A;  2F36 A;  3S9M C;  1SW1 A;  4HCY A;  3MPL A;  1B3E A;  3DRI A;  4G61 A;  1DTG A;  4LQ2 A;  2PYY A;  4N15 A;  3L6H A;  4O7M A;  1PB7 A;  1B4Z A;  2CEX A;  3K1N A;  3FV1 A;  4HS7 A;  4PF6 A;  3IK6 B;  4G68 A;  2I49 A;  2XD3 A;  1XVX A;  4XEQ A;  5ET7 A;  2X26 A;  3K6U A;  1D9Q A;  1NV1 A;  3TDJ A;  3SET A;  3KBZ A;  3JZJ A;  3KOT A;  1VFE A;  3KZG A;  3VLV A;  1DOT A;  1SQY A;  4OQO A;  4WKM A;  3RTF B;  5DVJ A;  1IMF A;  2P0S A;  3GXA A;  1B5H A;  4OTE A;  4OEN A;  4YMA A;  4JWO A;  3MVZ A;  4YKK A;  2QRY A;  3GBB A;  1P1N A;  4DZ1 A;  3LBS A;  1S7Y A;  2O6A A;  4YB6 A;  4YMB A;  1LFG A;  4IB2 A;  4H0W A;  1FW0 A;  3TOD A;  4FE8 A;  1MQJ A;  1ZU0 A;  4IO5 A;  3TTR A;  4MNI A;  4RJZ A;  1QW0 A;  1FQE A;  1B3L A;  2DE3 A;  4U23 A;  1XHY A;  1H3D A;  1URS A;  3DP4 A;  2NVU B;  5FTH A;  3MP1 A;  1PB8 A;  3DRF A;  3DP6 A;  5CMB A;  1MG1 A;  1HSL A;  3VVE A;  2QPQ A;  1LFH A;  4NMY A;  3TEP A;  2X7P A;  5CBR A;  3M3F A;  1NV4 A;  1Y3N A;  1FTO A;  5I3S A;  1URD A;  1O63 A;  3GYY A;  4OHN A;  3DRJ A;  2PT2 A;  3KG2 A;  5L9M A;  4DLD A;  3CSG A;  2AL5 A;  3S2V A;  4OES A;  4H6D A;  3IOW A;  5KCJ B;  3RT6 B;  3DP8 A;  4O94 A;  1FSA A;  3DLN A;  1RKM A;  5BUU A;  1NI9 A;  1H45 A;  4GWU A;  4OYV A;  1FBE A;  1TWY A;  2PFZ A;  2HQ0 A;  3VLW A;  2I4C A;  1EZP A;  4PE5 B;  1G0I A;  1LB9 A;  4H45 A;  4QHQ A;  1LAF E;  2ZNU A;  1D9V A;  3PPP A;  2B3B A;  3H6V A;  2O7I A;  4NX1 A;  2QMW A;  2QFL A;  1DCU A;  1PBP A;  3MJN A;  1IIT A;  1NH7 A;  4PFT A;  1SYH A;  3KN3 A;  5CMK A;  3SEX A;  2OWS A;  2HCA A;  4ELO A;  2FIE A;  2GHB A;  4ESW A;  4ZDM A;  3C32 A;  1B52 A;  2VD2 A;  2XWO A;  3IOR A;  2THI A;  4P47 A;  1GTK A;  4DXC A;  1R9L A;  4F2Q A;  1JQF A;  4GF8 A;  1GVC A;  4JVC A;  1Y20 A;  3VE1 B;  5F1Q A;  5B70 A;  2VGQ A;  2QS4 A;  1B58 A;  3OEM A;  3CHG A;  4OFL A;  5CMC A;  4GFR A;  3LUZ A;  1D4N A;  2DS9 A;  1F9B A;  4GVO A;  5DYH A;  2DWH A;  1MXW A;  1B1X A;  5EHM A;  2Y5K A;  3FV2 A;  3Q27 A;  4KPT A;  1Y3P A;  3QXM A;  1INP A;  1MPB A;  4FIM A;  4MNP A;  1B7H A;  1I69 A;  1IXH A;  4NQ8 A;  3FJ7 A;  4GLI A;  4THI A;  4KCC A;  2WBB A;  2AYS A;  5I2K B;  4MJO A;  5H8N A;  1NNK A;  4MX6 A;  4G8M A;  3I6V A;  3R7X A;  3Q28 A;  5IZZ A;  3HST A;  3KOS A;  5K2X A;  3QK6 A;  3FVO A;  3QSL A;  2B4M A;  1RDZ A;  1SW4 A;  2RC9 A;  4H5G A;  1XC1 A;  3LC8 A;  2OWZ A;  3CVG A;  1B05 A;  4ELP A;  4HW8 A;  2REJ A;  5J16 A;  3V8X B;  3PD8 A;  3UIF A;  2AIX A;  2UVG A;  4HE1 A;  1PDA A;  3K6X A;  3HFU A;  3A3C A;  3T0J A;  4GWX A;  3VLU A;  5I5P A;  2ZZX A;  2ESN A;  4Q5T A;  4H65 A;  3MUQ A;  3TZA A;  3LV0 A;  1OQG A;  4I3Y A;  2WOL A;  5DT6 A;  2HAU A;  1N3X A;  4GBW A;  4FAJ A;  4G8H A;  3MVY A;  4KHZ E;  1Q9D A;  3SEY A;  4U1Z A;  5TPA B;  1A55 A;  3PD9 A;  4GX4 A;  3ZSF A;  5ET8 A;  3LSF B;  3KFM A;  4MCO A;  4C0R A;  4OET A;  4N91 A;  4N6K A;  4TLL B;  5IAI A;  3IX1 A;  1AH5 A;  4DCY A;  5DVF A;  1XT8 A;  4DE8 A;  3H7M A;  2XD2 A;  5JEI A;  4F2O A;  2RC8 A;  4P9K A;  4JBZ A;  4O3A A;  2CEY A;  4NF5 A;  1JEU A;  3MYU A;  1I6B A;  3H4Z A;  4ONY A;  4M4G A;  3H06 B;  1IQ7 A;  2DVC A;  1LBW A;  2O68 A;  3FVK A;  1JVY A;  4YZZ A;  3SEW A;  3KJT A;  5EQ7 A;  2D5W A;  3HHF A;  3ROJ A;  1RYX A;  1R9Q A;  2V25 A;  4G68 B;  3U92 A;  1USY H;  3IB0 A;  4GWY A;  3IOV A;  1ZKB A;  4G77 A;  2F6G A;  3FXR A;  3OSR A;  3PPN A;  1MDP 1;  2O1M A;  2B4L A;  3UOR A;  4NN3 A;  4AB5 A;  4XTC Q;  1UTH A;  3K6V A;  3PPR A;  5DEX A;  1US5 A;  3IOT A;  1IXI A;  1I6A A;  4PET A;  2WX9 A;  3IJX B;  1ZLQ A;  5I57 B;  2V84 A;  5ICQ A;  1RDX A;  1H76 A;  4FOR A;  4R6K A;  4E0X A;  1MY2 A;  1LCT A;  4Q30 B;  4QSE A;  4UA8 A;  2XWK A;  3BKI B;  3H3G A;  1H43 A;  2XXR A;  4DI3 D;  3PV0 E;  3PUY E;  4GWO A;  3FUZ A;  3MWB A;  2A5S A;  4NF4 B;  4PFR A;  3RT8 A;  2XXY A;  5A5X B;  2XX8 A;  4IO2 A;  2HAV A;  4YB7 A;  1UTB B;  2R6G E;  4EQB A;  2RCB A;  3GLB A;  3IAZ A;  3AXF A;  4AS5 A;  3ECR A;  3V89 B;  3W15 C;  2VP1 A;  4OVP A;  4PGN A;  4HTG A;  1MQH A;  4I40 A;  3O97 A;  4JVI A;  3G3J A;  3ILU B;  1FQA A;  2XA5 A;  1ZIU A;  4BDO A;  1B32 A;  3FAS A;  2HPG A;  3A29 A;  3PPQ A;  4LZ8 A;  4ZS9 A;  3EKI A;  1M5E A;  1B0L A;  3OEN A;  1EZO A;  4YU0 A;  4GL0 A;  3B6W A;  3RQT A;  4OVQ A;  4E0W A;  3L6G A;  4QXD A;  1UIU A;  5F7V A;  3RLF E;  2NXO A;  3LVU A;  4XXU A;  3K1M A;  1LFI A;  3JV9 A;  1QUI A;  1DBZ A;  1OIB A;  4OVT A;  1JET A;  4F1Y A;  2V3U A;  4QRZ A;  1LAH E;  5JTY B;  2KR0 A;  3IB2 A;  5ELV A;  2F7B A;  3E13 X;  2PX1 A;  5ET6 A;  4P8B A;  2Q2C A;  4NGU A;  2F3B A;  3MQ9 A;  4UAC A;  3KJ7 A;  4O3C A;  3JYR A;  3K1P A;  2GFE A;  3KGC A;  3CFX A;  4Q8R A;  1JW5 A;  3ZS6 A;  3IB1 A;  1B4H A;  3VXB A;  1LBX A;  2R9J A;  5CMM A;  4EF1 A;  4OFJ A;  3ZKK A;  3BIH A;  3M8U A;  4OWD A;  4F3G A;  1M5F A;  3MVW A;  2UVJ A;  3BFU A;  1B3F A;  1ATG A;  4OZ9 A;  4R74 A;  4POX A;  4G8N A;  3T9H B;  1GV8 A;  4EXL A;  3PUW E;  2NWJ A;  2ZYK A;  3G7W A;  3FBP A;  2XXV A;  2VD3 A;  4F3S A;  3FXU A;  3RY3 A;  4HE0 A;  4ELQ A;  2DWA A;  1TFD A;  4QSC A;  2I0C A;  1Y4C A;  4LZ7 A;  4DCX A;  3IR1 A;  1MQI A;  2F6P A;  5LOM A;  4QSD A;  4PQJ A;  3TQW A;  4MFI A;  1HSJ A;  1QJM A;  4H8I A;  1XI6 A;  1D3K A;  2Z23 A;  3TFL A;  2DP8 A;  2QS3 A;  5AE4 A;  1IUD A;  2OK2 A;  5H8N B;  4PFY A;  3G3K A;  2OBG A;  2H25 A;  1DMB A;  4C1U A;  3WAE A;  1N84 A;  5I57 A; 
#chains in the Genus database with same CATH homology
 2F8D A;  2Z8D A;  3K2D A;  3T66 A;  1URG A;  4MBP A;  5AA2 A;  2I48 A;  4KR5 A;  4FED A;  3ONM A;  4XKN A;  4RK9 A;  3RNN A;  4KYS A;  4NF4 A;  2ONS A;  4P0I A;  3I3V A;  2WOP A;  5HPQ A;  3CSB A;  1Y1Z A;  5A5X A;  3ZKL A;  1UTB A;  3TEL A;  1IIW A;  1Y3Q A;  1GGG A;  4BDM A;  3TTM A;  2WKY A;  2OWT A;  1XVY A;  1A40 A;  4O3B A;  4U1O A;  4OMB A;  2F7A A;  4P11 A;  3O66 A;  3EHU A;  2RKM A;  3O28 A;  2QS1 A;  3S9L C;  2Y7P A;  5K2Y A;  1NMU A;  3SER A;  3TTK A;  2I3W A;  5H8F A;  1A8F A;  4N13 A;  3CIJ A;  3OEK A;  2B65 A;  4FJP A;  1LCF A;  2PMS A;  4H1X A;  1A8E A;  3FTO A;  1LGB C;  4G68 C;  2G29 A;  4U21 A;  5EYF A;  3FVG A;  1FQB A;  3O6H A;  4X1D A;  3ILT B;  3S9E A;  4RXL A;  4NF5 B;  1TT1 A;  5ITO A;  5JTY A;  1B5I A;  2XX9 A;  4LQ5 A;  1MY0 A;  4H8J A;  5IKB A;  3O6G A;  3UK4 A;  5EHS A;  2DE2 A;  1MS7 A;  2ZYM A;  5FHO A;  2DWI A;  2M8C A;  1LBB A;  4N07 A;  1SW2 A;  4IGT A;  1UTH B;  5I58 B;  2I0B A;  5DEX B;  3FJM A;  4F39 A;  1IZ1 A;  5FTI A;  2O1L A;  2ZNS A;  4GD5 A;  1BP5 A;  3RGY A;  1CE2 A;  4IO4 A;  1Y9U A;  1O7T A;  2YLN A;  2I58 A;  2OJT A;  3K01 A;  3ODB A;  3FXQ A;  3T96 B;  3QIM A;  5FHM A;  2DVZ A;  2V93 A;  3K4U A;  2XXT A;  4GXS B;  3CR9 A;  3TQL A;  4HCW A;  4ZEI A;  4R9G A;  2R71 A;  4DDD A;  3G3H A;  4QFK A;  1R1N A;  4GQO A;  4F3B A;  2BJJ X;  1XS5 A;  4DIG A;  4OXV A;  3CFL A;  3EQ1 A;  3M3L A;  1MXY A;  4BDN A;  3H03 A;  1NNP A;  4RYA A;  3KN7 A;  3MVX A;  4LA9 A;  1MXV A;  1MXX A;  1B51 A;  1SDX A;  3A3U A;  2AL4 A;  4YB5 A;  2XXQ A;  1MPC A;  5JK4 A;  1MY3 A;  2F5X A;  4RA1 A;  3MW0 A;  2UVI A;  1MY1 A;  2F97 A;  4GRK A;  1MH3 A;  1XOC A;  1B7Z A;  3FAT A;  3MBP A;  1B6H A;  5I2N B;  2RC7 A;  3KBR A;  3H6T A;  4ZE8 A;  4EUO A;  2ALU A;  5KDT A;  1M5C A;  3PMW A;  2HZK A;  4F3P A;  1OLA A;  1USY E;  3DRK A;  4NE4 A;  1LLS A;  4ZEC A;  4ZED A;  2PBW A;  2Q8J A;  1KWH A;  3GBA A;  4X48 A;  1QVS A;  1ZMG A;  1IXC A;  3RYA A;  2I3V A;  4R9F A;  4WED A;  2H98 A;  5HBC A;  4ZEB A;  4FEC A;  5BWJ A;  2FNC A;  3PUZ E;  4Q0C A;  1ZBM A;  4BDR A;  4IO7 A;  4ZEK A;  5J1D A;  4TLM B;  4OFO A;  4FAT A;  4WXJ A;  2O7U A;  4U4X A;  3U1O A;  2XX7 A;  1BIY A;  3OSQ A;  4YKJ A;  3K02 A;  2DQV A;  3RN8 A;  3UP9 A;  2CZL A;  1US4 A;  4NTL A;  1POY 1;  1I6Q A;  4MLV A;  1AIV A;  1CB6 A;  4NF6 A;  4ECF A;  3T9U A;  1PB9 A;  5I58 A;  5KZT A;  5ITP A;  3O6P A;  1SI1 A;  2P2A A;  1DSN A;  3DRH A;  2HEU A;  4JB7 A;  3C9H A;  5AA2 B;  4IGR A;  2UXA A;  2GHA A;  3IL1 B;  4LUB A;  4KFQ A;  4EF2 A;  4RNS A;  4IY6 A;  2A5T B;  4JDF A;  4YIC A;  3Q29 A;  4RPO A;  4ISU A;  1ANF A;  3HPI A;  4C1T A;  1P1W A;  4F1U A;  4MLQ A;  1JNF A;  3PAM A;  2B3F A;  1DPP A;  4QFP A;  1S50 A;  3HV1 A;  1B3H A;  1OLC A;  2ZYO A;  3U8Q A;  1N7W A;  4GL8 A;  4XIG Q;  2V3T A;  5AA4 B;  5I84 A;  4OEU A;  5AA3 A;  4QFN A;  2UYF A;  2O51 A;  3KEI A;  3VV5 A;  4N6P A;  3TCF A;  5H8F B;  5CI5 A;  3M3K A;  2E1S A;  2RIN A;  3CFZ A;  3OO8 A;  5DVI A;  2Z8E A;  3Q25 A;  4NF8 B;  2XXH A;  2Q2A A;  3FIR A;  4R2F A;  1FCK A;  2GH9 A;  3SES A;  2Y7K A;  3UA8 A;  3D4G A;  3T9X B;  4R75 A;  3FGS A;  5I2N A;  2DXR A;  3EF7 A;  3S4U A;  2YJP A;  2H99 A;  4RK2 A;  1EU8 A;  3TCH A;  1O64 A;  2IA4 A;  3TPA A;  4KYD A;  4TOZ A;  4I1D A;  3PGF A;  1Z7M E;  2X7Q A;  3IOU A;  2F34 A;  1EZ9 A;  5L9S A;  1FTK A;  2NOO A;  1H44 A;  1Y1M A;  1BLF A;  3DRG A;  3VVD A;  3TYH A;  4LVQ A;  4JWX A;  2FYI A;  2NUV A;  1OMP A;  4Z0I A;  3K0V A;  1MXU A;  3VXC A;  4DXB A;  1DTZ A;  5I59 B;  4LP2 B;  1N04 A;  3FVN A;  3MC2 A;  3THI A;  1LBC A;  5CRY A;  2ZYN A;  1MDQ A;  4ZZE A;  4YKP A;  3R6U A;  2VHA A;  3MP6 A;  1SVX B;  5I56 B;  2LAO A;  3GZG A;  3IJO B;  1SBP A;  4EXK A;  1MRP A;  2RCA A;  5ICT A;  3PMX A;  1B40 A;  3PUX E;  4X9T A;  3U94 A;  3T93 B;  3A09 A;  2Y7I A;  1JW4 A;  1SI0 A;  2ONR A;  3HO7 A;  3QUF A;  1NH8 A;  3D4C A;  1QUJ A;  5H8H B;  3EN3 A;  3C4M A;  1UIV A;  2F35 A;  4XKQ A;  4Z7E A;  4R6H A;  2PT1 A;  1NNT A;  2OZZ A;  1QKB A;  3N5L A;  1ZJL A;  4JSO A;  4ZE9 A;  3OO6 A;  3V83 A;  3CG1 A;  2A5T A;  2Y7R A;  2PVU A;  2VOZ A;  4F31 B;  1LAG E;  2ONK E;  4P0G A;  3Q26 A;  2DWJ A;  5AA1 A;  1MQG A;  3OO9 A;  2I4B A;  1SD3 A;  5TP9 A;  5AA4 A;  5KDT B;  2ZMB A;  1P99 A;  4XKP A;  2O69 A;  2DOJ A;  1YCJ A;  4NED A;  4M1V A;  3MZB A;  4GIZ A;  2QL3 A;  3U93 A;  1B9J A;  1FQD A;  4NF8 A;  1IEJ A;  4IY5 A;  4F1V A;  2I6E A;  1JW1 A;  2Q89 A;  1LAX A;  3EHT A;  4ND9 A;  1VR5 A;  1OVB A;  5DTB A;  3RTW B;  3TUS A;  4OVJ A;  3LSX A;  2QMX A;  1OVT A;  3B6Q A;  5CBS A;  3B7D A;  4ELR A;  2F78 A;  1YPN A;  4EQ9 A;  1Z7N E;  3USD A;  4ZZA A;  5B7D A;  2H4I A;  3TTL A;  4NF6 B;  1LB8 A;  1TFA A;  3MPK A;  2H9B A;  3RUM A;  5CC2 A;  3CG3 A;  3R26 A;  1B3G A;  4POW A;  1P1O A;  3QAX A;  5M2V A;  4I62 A;  3LSL A;  2O84 X;  1VSO A;  4IO3 A;  5I59 A;  2Q88 A;  2HXW A;  1TXF A;  3H6U A;  4OER A;  1FTM A;  4KD5 A;  3U72 A;  3I5O A;  3QYT A;  2OLB A;  2F7C A;  3B6T A;  3MZ9 A;  4F18 A;  4R72 A;  3LSW A;  2XXU A;  3N6U A;  4YAH X;  4PFU A;  4U2R A;  1AOV A;  2G93 A;  3HCQ A;  2HFB A;  4NWC A;  5I56 A;  1MH4 A;  3T9V A;  3PMV A;  4U4S A;  1N3W A;  3RYB A;  1YAE A;  4H67 A;  3TKD A;  4R2B A;  3KSJ A;  3E4R A;  3T22 A;  2QSX A;  3CI8 A;  2REG A;  1BTJ A;  4TQU Q;  5H8H A;  3VFJ A;  1ELJ A;  3KSX A;  3N6T A;  1WVJ A;  1NKX A;  1N7X A;  3FZV A;  1J1N A;  3DEL B;  4KCD A;  1M5D A;  2IEE A;  5L9O A;  4AB6 A;  3C33 A;  2ZXT A;  4MH5 A;  2Y84 A;  1JEV A;  2E0S A;  4F19 A;  1AL3 A;  4QF9 A;  1MM6 A;  3BBR A;  3OOA A;  1MQD A;  4JXI A;  4I9D A;  3G3I A;  3OO7 A;  1PC3 A;  2P1S A;  4JSD A;  1PEB A;  1DPE A;  3C35 A;  2QS2 A;  2Z8F A;  3MZ1 A;  3MAM A;  1FQC A;  2ANJ A;  2V3Q A;  3PPO A;  3SEV A;  1II5 A;  1L5T A;  4F29 A;  5H8Q B;  3HN0 A;  4K3F A;  4G2Z A;  3TAJ A;  3C36 A;  1QUK A;  1QKA A;  5H8S A;  3FD3 A;  2XXX A;  2FA7 A;  1LST A;  3O6I A;  1MPD A;  3S9N C;  3UGW A;  3OEL A;  4RPN A;  4KYE A;  1NFT A;  3G3F A;  3E9X A;  2RF1 A;  3K6W A;  4BDQ A;  5KCJ A;  2UYE A;  2DYX A;  4I8C A;  5FHN A;  5CM6 A;  2WOK A;  1N0T A;  3W9V A;  2DSF A;  1B1H A;  1FTL A;  2D21 A;  4X1B A;  1ZTY A;  1A54 A;  3FJG A;  3OXN A;  4LON B;  1VE4 A;  4OEV A;  2Z22 A;  2Y7W A;  4KI0 E;  1WOD A;  2H5Y A;  3EPE A;  1B5J A;  4NWD A;  1MY4 A;  4ZEF A;  4WEP A;  1YTV A;  4BDL A;  1Q35 A;  2XXI A;  3C31 A;  1MM7 A;  1A7L A;  3C34 A;  3CRB A;  1B0H A;  4KQP A;  4IO6 A;  1PBQ A;  1OQH A;  3KN8 A;  2ABH A;  1D9Y A;  1NL5 A;  3LR1 A;  1SYI A;  4BLA A;  3BFT A;  3IO4 A;  3V5A A;  4XKR A;  4MF3 A;  4QFO A;  3VDF A;  5TP9 B;  2GRV A;  1T0K A;  4GOT A;  1RYO A;  2ZNT A;  1Q1K A;  4JWY A;  3HHG A;  1JVX A;  3IO6 A;  3TMG A;  3OMB A;  1IXG A;  3P7I A;  1POT A;  1Y4T A;  2XXP A;  4L17 A;  1M5B A;  5I2K A;  1N76 A;  2W7Y A;  1B46 A;  4QFL A;  2QJE A;  1B7U A;  4EQ7 A;  3W9W A;  3TCG A;  4LAT A;  1FQF A;  1NNF A;  3EHS A;  4EDP A;  1AMF A;  3MP8 A;  5ISU A;  3F11 A;  1S9T A;  1GR2 A;  2XXW A;  2YPN A;  1SW5 A;  4RY1 A;  1UQW A;  4F22 A;  4ESX A;  1QUL A;  1B2H A;  1A99 A;  3QUJ A;  1HSE A;  4YKI A;  2CMO A;  2KLF A;  2DE4 A;  3PU5 A;  2UVH A;  3PUV E;  2Q9T A;  1P1U A;  3SDF A;  3G3G A;  3H6W A;  4LZ5 A;  3K00 A;  3UN6 A;  4AQ4 A;  2DXY A;  4GXA A;  3TTN A;  3VVF A;  4R6Y A;  5H8Q A;  2D3I A;  2OCU A;  4U22 A;  3DM0 A;  3RPW A;  2HZL A;  4R73 A;  5TU0 A;  3WAF A;  4PP0 A;  3O9P A;  4G4P A;  4FEB A;  1P1Q A;  5TPA A;  3LUY A;  5L8D A;  3SKP A;  3O2A A;  3OD7 A;  5HM4 B;  4H5F A;  1BKA A;  3E3K A;  4PFW A;  1R6Z A;  1VFD A;  5AA2 D;  3SEU A;  3N94 A;  1WDN A;  1EH3 A;  3O29 A;  1MXZ A;  3N26 A;  4DXU A;  2XHD A;  1FTJ A;  2F36 A;  3S9M C;  1SW1 A;  4HCY A;  3MPL A;  1B3E A;  3DRI A;  1DTG A;  4LQ2 A;  2PYY A;  3L6H A;  1PB7 A;  1B4Z A;  3K1N A;  3FV1 A;  4HS7 A;  3IK6 B;  4G68 A;  2I49 A;  2XD3 A;  1XVX A;  2X26 A;  3K6U A;  3TDJ A;  3SET A;  3JZJ A;  3KOT A;  1VFE A;  3KZG A;  3VLV A;  1DOT A;  1SQY A;  4OQO A;  4WKM A;  3RTF B;  5DVJ A;  2P0S A;  3GXA A;  1B5H A;  4OTE A;  4OEN A;  4YMA A;  4JWO A;  3MVZ A;  4YKK A;  2QRY A;  3GBB A;  1P1N A;  4DZ1 A;  3LBS A;  1S7Y A;  2O6A A;  4YB6 A;  4YMB A;  1LFG A;  4IB2 A;  4H0W A;  1FW0 A;  3TOD A;  4FE8 A;  1MQJ A;  1ZU0 A;  4IO5 A;  3TTR A;  4RJZ A;  1QW0 A;  1FQE A;  1B3L A;  2DE3 A;  4U23 A;  1XHY A;  1H3D A;  1URS A;  3DP4 A;  2NVU B;  5FTH A;  3MP1 A;  1PB8 A;  3DRF A;  3DP6 A;  5CMB A;  1MG1 A;  1HSL A;  3VVE A;  2QPQ A;  1LFH A;  4NMY A;  3TEP A;  2X7P A;  5CBR A;  3M3F A;  1Y3N A;  1FTO A;  1URD A;  1O63 A;  4OHN A;  3DRJ A;  2PT2 A;  3KG2 A;  5L9M A;  4DLD A;  3CSG A;  2AL5 A;  3S2V A;  4OES A;  4H6D A;  3IOW A;  5KCJ B;  3RT6 B;  3DP8 A;  3DLN A;  1RKM A;  5BUU A;  1H45 A;  4OYV A;  1TWY A;  2HQ0 A;  3VLW A;  2I4C A;  1EZP A;  4PE5 B;  1LB9 A;  4QHQ A;  1LAF E;  2ZNU A;  1D9V A;  3PPP A;  2B3B A;  3H6V A;  2O7I A;  2QMW A;  1PBP A;  3MJN A;  1IIT A;  1NH7 A;  4PFT A;  1SYH A;  3KN3 A;  5CMK A;  3SEX A;  2OWS A;  2HCA A;  4ELO A;  4ESW A;  2GHB A;  4ZDM A;  3C32 A;  1B52 A;  2VD2 A;  3IOR A;  2THI A;  1GTK A;  4DXC A;  1R9L A;  4F2Q A;  1JQF A;  4GF8 A;  1GVC A;  1Y20 A;  3VE1 B;  5F1Q A;  5B70 A;  2VGQ A;  2QS4 A;  1B58 A;  3OEM A;  3CHG A;  4OFL A;  5CMC A;  4GFR A;  1D4N A;  2DS9 A;  1F9B A;  4GVO A;  5DYH A;  2DWH A;  1MXW A;  1B1X A;  5EHM A;  3FV2 A;  3Q27 A;  4KPT A;  1Y3P A;  3QXM A;  1MPB A;  4FIM A;  1B7H A;  1I69 A;  1IXH A;  3FJ7 A;  4GLI A;  4THI A;  4KCC A;  2AYS A;  5I2K B;  5H8N A;  1NNK A;  4G8M A;  3I6V A;  3R7X A;  3Q28 A;  3HST A;  3KOS A;  5K2X A;  3QK6 A;  3FVO A;  3QSL A;  2B4M A;  1SW4 A;  2RC9 A;  4H5G A;  1XC1 A;  3LC8 A;  3CVG A;  1B05 A;  4ELP A;  4HW8 A;  2REJ A;  3V8X B;  3PD8 A;  3UIF A;  2AIX A;  2UVG A;  1PDA A;  3K6X A;  3A3C A;  3VLU A;  2ESN A;  4Q5T A;  4H65 A;  3MUQ A;  3TZA A;  1OQG A;  2WOL A;  5DT6 A;  2HAU A;  1N3X A;  4FAJ A;  4G8H A;  3MVY A;  4KHZ E;  3SEY A;  4U1Z A;  5TPA B;  1A55 A;  3PD9 A;  3ZSF A;  3LSF B;  3KFM A;  4C0R A;  4OET A;  4TLL B;  5IAI A;  3IX1 A;  1AH5 A;  4DCY A;  5DVF A;  1XT8 A;  4DE8 A;  3H7M A;  2XD2 A;  5JEI A;  4F2O A;  2RC8 A;  4JBZ A;  4O3A A;  4NF5 A;  1JEU A;  1I6B A;  3H4Z A;  4ONY A;  4M4G A;  3H06 B;  1IQ7 A;  2DVC A;  2O68 A;  3FVK A;  1JVY A;  4YZZ A;  3SEW A;  3KJT A;  2D5W A;  3HHF A;  1RYX A;  1R9Q A;  2V25 A;  4G68 B;  3U92 A;  1USY H;  3IB0 A;  3IOV A;  1ZKB A;  4G77 A;  2F6G A;  3FXR A;  3OSR A;  3PPN A;  1MDP 1;  2O1M A;  2B4L A;  3UOR A;  4AB5 A;  4XTC Q;  1UTH A;  3K6V A;  3PPR A;  5DEX A;  1US5 A;  3IOT A;  1IXI A;  1I6A A;  4PET A;  3IJX B;  1ZLQ A;  5I57 B;  2V84 A;  5ICQ A;  1H76 A;  4FOR A;  4R6K A;  4E0X A;  1MY2 A;  1LCT A;  4Q30 B;  4QSE A;  4UA8 A;  3BKI B;  3H3G A;  1H43 A;  2XXR A;  3PV0 E;  3PUY E;  4GWO A;  3FUZ A;  3MWB A;  2A5S A;  4NF4 B;  3RT8 A;  2XXY A;  5A5X B;  2XX8 A;  4IO2 A;  2HAV A;  4YB7 A;  1UTB B;  2R6G E;  4EQB A;  2RCB A;  3GLB A;  3IAZ A;  3AXF A;  3ECR A;  3V89 B;  3W15 C;  2VP1 A;  4HTG A;  1MQH A;  3O97 A;  3G3J A;  3ILU B;  1FQA A;  1ZIU A;  4BDO A;  1B32 A;  3FAS A;  3PPQ A;  4LZ8 A;  4ZS9 A;  1M5E A;  1B0L A;  3OEN A;  1EZO A;  4YU0 A;  4GL0 A;  3B6W A;  3RQT A;  4E0W A;  3L6G A;  1UIU A;  5F7V A;  3RLF E;  2NXO A;  3LVU A;  4XXU A;  3K1M A;  1LFI A;  3JV9 A;  1QUI A;  1OIB A;  1JET A;  4F1Y A;  2V3U A;  4QRZ A;  1LAH E;  5JTY B;  3IB2 A;  5ELV A;  2F7B A;  3E13 X;  2PX1 A;  2Q2C A;  3MQ9 A;  4UAC A;  3KJ7 A;  4O3C A;  3JYR A;  3K1P A;  2GFE A;  3KGC A;  3CFX A;  4Q8R A;  1JW5 A;  3ZS6 A;  3IB1 A;  1B4H A;  3VXB A;  2R9J A;  5CMM A;  4EF1 A;  4OFJ A;  3ZKK A;  3M8U A;  4OWD A;  4F3G A;  1M5F A;  3MVW A;  2UVJ A;  3BFU A;  1B3F A;  1ATG A;  4OZ9 A;  4R74 A;  4POX A;  4G8N A;  3T9H B;  1GV8 A;  4EXL A;  3PUW E;  2NWJ A;  2ZYK A;  3G7W A;  2XXV A;  4F3S A;  2VD3 A;  3FXU A;  3RY3 A;  4ELQ A;  2DWA A;  1TFD A;  4QSC A;  2I0C A;  1Y4C A;  4LZ7 A;  4DCX A;  3IR1 A;  1MQI A;  2F6P A;  5LOM A;  4QSD A;  4PQJ A;  3TQW A;  4MFI A;  1HSJ A;  1QJM A;  4H8I A;  1D3K A;  2Z23 A;  3TFL A;  2DP8 A;  2QS3 A;  5AE4 A;  1IUD A;  2OK2 A;  5H8N B;  4PFY A;  3G3K A;  2OBG A;  2H25 A;  1DMB A;  4C1U A;  3WAE A;  1N84 A;  5I57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...