3TCGA

Crystal structure of e. coli oppa complexed with the tripeptide kge
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
517
structure length
517
Chain Sequence
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Periplasmic oligopeptide-binding protein
publication title Escherichia coli peptide binding protein OppA has a preference for positively charged peptides.
pubmed doi rcsb
source organism Escherichia coli
total genus 176
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3tcgA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tcgA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3tcgA02
1NH7A 1H44A 3KJTA 2H25A 4Q8RA 1WVJA 1SI1A 3VVDA 1SYHA 3B6WA 5H8FA 1UQWA 3GBBA 4ESXA 3S9MC 4EF2A 1IXIA 3MZBA 3RT6B 2DWIA 2ZYKA 4KYSA 5CMKA 4YKKA 2DP8A 1FQAA 2B3FA 4MLQA 4IGTA 4EDPA 1POTA 5I56A 4RJZA 1UTHB 3VXBA 2QPQA 1LCFA 2XX8A 2RC8A 1A55A 4O3BA 2Q9TA 4C1UA 2I0CA 4F1YA 5HBCA 2Z8FA 3K6XA 5M2VA 1D3KA 3VV5A 1D4NA 4EQBA 3QYTA 4XKNA 2H4IA 2AL4A 2OWSA 3LSLA 4EXKA 2XXPA 3N6TA 1NMUA 1SVXB 4ELRA 3HV1A 4Q0CA 4P0GA 4MLVA 4C0RA 4WEDA 1ELJA 1A54A 4OWDA 3FGSA 2E0SA 2XD2A 2QS3A 3FZVA 1QKAA 2XXRA 1VR5A 2LAOA 4QF9A 3UP9A 1XOCA 2G93A 1FTOA 3ILUB 1VFDA 1IITA 2PT1A 1P99A 2X7QA 3A09A 3FV2A 1FTJA 4X1DA 1NKXA 3K6UA 2RCAA 1LFIA 2GH9A 4OZ9A 4O3AA 3PUVE 5FHNA 2DVZA 3I3VA 3F11A 4U22A 1IEJA 2O69A 5DTBA 1ZKBA 5CBRA 5DYHA 2VOZA 3LR1A 4F2OA 1B3EA 5HM4B 4OENA 1UTHA 4GL8A 4NF5B 4OERA 4F18A 5ICQA 4BDNA 4K3FA 4R9FA 4NE4A 3CFZA 2DWJA 3S4UA 1N76A 1MXVA 3R6UA 4R2FA 4I8CA 3VLWA 3RNNA 4QHQA 1B1XA 1H43A 4ZECA 1Y1ZA 3LBSA 3TQLA 3V5AA 4R6KA 3BKIB 3HN0A 5K2XA 3CG1A 1LB9A 1DPEA 2G29A 1JW4A 5J1DA 4ELQA 3HO7A 3FD3A 4EQ9A 2VP1A 4OVJA 1MQJA 1TT1A 2PBWA 4X1BA 4F1UA 2UVIA 5FTHA 1MY4A 1B3GA 1FQFA 4JSDA 1EU8A 3O66A 3FJMA 3QXMA 3K4UA 4QFLA 3GZGA 1YTVA 1B3LA 4PP0A 5AA2D 3G3FA 1FTKA 1Q35A 1TFAA 4QFNA 4QSEA 3IB1A 5AA2B 1GR2A 3B7DA 3OO6A 5CMCA 4WXJA 1PB9A 2O51A 2DYXA 2DQVA 1OQGA 3TEPA 4JDFA 4NF5A 4G2ZA 5CMBA 3MVZA 3DRFA 1IXHA 5HPQA 1B9JA 4ELPA 2XXYA 4HS7A 4Z7EA 1RYOA 5K2YA 3CR9A 3PMWA 1B40A 4Z0IA 3ZS6A 4R75A 4YICA 2ZNUA 4HCYA 3U93A 3RYBA 2QSXA 1WODA 3VLVA 4ESWA 3H6WA 2ZYNA 3H6TA 1M5EA 5FHOA 5AA1A 4RPOA 2XXQA 3MZ9A 4KFQA 4FE8A 3U1OA 2A5TA 3LC8A 4BDOA 2IA4A 3K1MA 3RT8A 1AH5A 2F6PA 2DWAA 3KOSA 5A5XB 3C36A 2ANJA 3M3KA 3TDJA 4GRKA 3DP4A 3EPEA 4PFWA 4H5FA 2XXXA 4OETA 4M1VA 4F39A 3T9VA 1P1NA 4G68B 1PB7A 1B32A 5F1QA 1RKMA 2P0SA 4LVQA 3CRBA 2I48A 2HAVA 1JEVA 1MQIA 5AA4B 4L17A 2V93A 4ZEKA 1PBQA 4I9DA 5AA2A 1ZJLA 3I5OA 4O3CA 4YKPA 4ECFA 2WOKA 3K6VA 1B1HA 4ND9A 3O29A 3IR1A 3MP1A 1MY1A 2XXHA 3H7MA 4XIGQ 2REGA 1IZ1A 3IOTA 1II5A 3K02A 1YCJA 4ISUA 2RCBA 3T93B 5L9OA 4F3BA 2Y7IA 4MF3A 4QFPA 3MVYA 5ICTA 3DRJA 1PDAA 4G8HA 3RN8A 1MXZA 2D3IA 3UK4A 4G8MA 2Q89A 4UA8A 1N04A 2RC9A 3SEWA 4OXVA 5CM6A 3IO6A 3VVEA 3R26A 4DXUA 2O1LA 1B3FA 3MVXA 2I58A 2ESNA 1H3DA 3Q25A 4PETA 5A5XA 3TUSA 4YB6A 4IO7A 2H99A 5TP9B 1SBPA 2DVCA 4FEBA 4KCCA 4QRZA 1LAXA 4LA9A 4U1OA 4KR5A 4F3GA 1ZIUA 2PX1A 4U23A 1JETA 3UGWA 4G68A 2F7BA 2P1SA 3C32A 2DWHA 2FNCA 2UVGA 4H67A 3TYHA 2XXVA 3RTFB 1OQHA 2W7YA 1OLCA 1EH3A 5AA4A 1MG1A 3W9WA 4NWDA 3AXFA 1UTBB 3S9EA 3K1NA 2R9JA 4R72A 1O7TA 3Q28A 4GOTA 1LGBC 2UYFA 4RYAA 3M3LA 5JK4A 4PFYA 4F1VA 1TWYA 5DEXB 3O6IA 2VD3A 4HTGA 3O97A 4LZ8A 3ECRA 1LFHA 1JW5A 3H6VA 4F31B 1VFEA 1Y3PA 2I6EA 2Q8JA 1IIWA 3TODA 3C34A 2ZMBA 2VHAA 3VFJA 3G3KA 4LZ5A 5I2NB 3FV1A 4YMBA 2XXUA 3OO9A 1B51A 1NNTA 4EF1A 3C33A 1AMFA 4LATA 4XKRA 4DXBA 3D4GA 2O84X 1B52A 1MRPA 1B0LA 3O9PA 1P1OA 2XXTA 4POXA 1EZOA 1URDA 5TP9A 2XX9A 3O6GA 1MPDA 1TFDA 2O7IA 3BFTA 3OD7A 4ZDMA 5L9MA 4PE5B 1FQBA 4H6DA 3W15C 2R71A 1QUJA 3PUZE 2OLBA 4FIMA 1MXUA 5H8NB 4AB5A 2OWTA 5FTIA 1TXFA 2Q2CA 1MQGA 3KN3A 2H9BA 1ZMGA 3L6GA 4ZZAA 1UTBA 2V3TA 1B58A 3VXCA 3DP6A 3IORA 3SEXA 4ZEBA 3TTMA 4FECA 3OO7A 5CC2A 1FQEA 3IOVA 5H8QB 2HZKA 3HCQA 3QAXA 3FJ7A 3TPAA 4U4XA 4DE8A 3SEUA 1MQHA 3JYRA 1XVXA 1CE2A 5DEXA 3KN8A 2Y7KA 1N84A 3KSXA 4RPNA 1A7LA 2GFEA 3OXNA 3FUZA 4KD5A 1PC3A 1XHYA 3ONMA 3C35A 4E0XA 1MPBA 1EZ9A 3OENA 3CG3A 1P1UA 3FIRA 3B6TA 2F36A 4UACA 1B5JA 2DS9A 3VVFA 3UORA 5I57B 3MJNA 4G77A 5I2NA 2OJTA 4GVOA 2XHDA 1D9YA 1S50A 2YJPA 2QMXA 3IOUA 4H0WA 3KZGA 5CMMA 1DTGA 3HSTA 3VDFA 2REJA 2V84A 3KBRA 4PFTA 4OEUA 3CFXA 3EHUA 2DE3A 3KOTA 4KPTA 4FEDA 3KEIA 3IJOB 3ZKLA 2WOLA 2F7CA 1OVBA 5H8HB 3SEVA 1LB8A 4IO5A 3WAFA 2QJEA 1MXXA 5H8NA 3QIMA 1Q1KA 4DLDA 3JZJA 5JTYB 2KLFA 4DXCA 2F8DA 4ONYA 1B5IA 5ISUA 2Q88A 1J1NA 4R2BA 1I6AA 4ZEIA 4F2QA 4NF6B 4GIZA 4U4SA 3DRHA 5H8QA 4LONB 3E4RA 2P2AA 5JEIA 2D21A 4G68C 3MP6A 4EQ7A 1ZU0A 3PAMA 5FHMA 1Y1MA 2UYEA 2V3QA 4OFJA 3PPOA 1Y4TA 2VD2A 4RNSA 1ZTYA 4RXLA 4QFKA 1LBCA 5H8SA 1HSLA 4YAHX 3KSJA 4Q5TA 2BJJX 3KG2A 4THIA 2HZLA 4IO4A 1EZPA 4IO2A 2Z8DA 2ONKE 1B7ZA 4FJPA 3K1PA 4DCYA 1CB6A 4YU0A 4JWOA 4N6PA 4ZEDA 4F19A 1BLFA 4MFIA 1XT8A 1FQDA 1A99A 1GTKA 3H6UA 2A5SA 4OTEA 5IAIA 5H8HA 4KCDA 3N94A 3IJXB 4JWYA 5L8DA 5B7DA 2QRYA 3KJ7A 2YPNA 3PD8A 4NF4B 4ZE9A 3RGYA 3C4MA 4I1DA 3FXQA 5CI5A 4F3SA 5ITPA 4H1XA 1LFGA 5KZTA 4NF6A 3T9UA 3MC2A 2QS2A 1UIUA 4NF8B 1FQCA 3MBPA 3TFLA 2OCUA 2ONRA 2O68A 4BDRA 5DVFA 3M3FA 2E1SA 4N07A 3U94A 1BKAA 2V25A 1FCKA 4NWCA 3G3GA 1AIVA 4BDLA 4OESA 2ZNTA 1NNFA 4ZZEA 1MM7A 3FXUA 4JB7A 3EHTA 4BLAA 1I69A 1IUDA 3HHGA 4HW8A 4F22A 1MPCA 1N0TA 1XC1A 1SD3A 2I49A 3O28A 4R6HA 1OIBA 3PPRA 4XXUA 3DLNA 3PMXA 1WDNA 4KYEA 1H45A 3DM0A 3A3CA 2PVUA 2NOOA 4GFRA 3PD9A 5TPAB 2OK2A 3O2AA 4U1ZA 4G4PA 4ZS9A 3RPWA 2Z8EA 4QSDA 3GXAA 2QL3A 3FASA 3E13X 1SYIA 4TLLB 3PUXE 3H4ZA 4DCXA 3HPIA 1NNKA 5DT6A 3TZAA 4DDDA 5ITOA 4G8NA 3MWBA 3ZSFA 4NF4A 1DMBA 1MM6A 3I6VA 3HHFA 1T0KA 1M5CA 3QUFA 3PU5A 2O6AA 3R7XA 5I59B 4OEVA 1JVYA 3V8XB 1MH4A 1GGGA 1DTZA 3FATA 3TAJA 4TOZA 1SW2A 4NF8A 2Y7PA 4GLIA 5B70A 2AIXA 3IL1B 4H65A 3THIA 1IQ7A 1B05A 2AYSA 3DELB 1AL3A 4QSCA 3EF7A 3GBAA 2ALUA 2WOPA 1P1WA 3T66A 3OEKA 2DXRA 2ABHA 2DSFA 3OELA 3W9VA 1LBBA 2F35A 4P11A 1QJMA 2H5YA 1NFTA 3TKDA 5H8FB 2UVJA 4X48A 1BTJA 4PFUA 5F7VA 1NL5A 3FVGA 3C9HA 5TPAA 1RYXA 3TTLA 3IB0A 3EHSA 2OBGA 1PBPA 1US4A 3T9XB 3SEYA 3MW0A 4XKPA 1MXYA 3IO4A 1FTLA 1MS7A 3B6QA 3E9XA 3TTKA 2OZZA 2GRVA 3FJGA 3K0VA 4WKMA 3G7WA 1MY0A 4AB6A 1LAGE 3UIFA 5I59A 5I84A 1A8FA 3SDFA 3FXRA 3TELA 2NUVA 3KFMA 3MQ9A 2DOJA 3T9HB 2PMSA 2HXWA 4YKIA 1A40A 3CSBA 4GQOA 3OEMA 3PPPA 2H98A 4Q30B 1SDXA 2XX7A 1OVTA 2QS4A 1ANFA 2Q2AA 4H8JA 5DVJA 2DE4A 4XTCQ 3MP8A 3IK6B 3PPNA 1N3XA 3PV0E 2Y84A 3SKPA 4ZE8A 1KWHA 4AQ4A 1O64A 5AE4A 5ELVA 3OMBA 3MPLA 3PUYE 1BP5A 3UA8A 2WKYA 4P0IA 1Y20A 2YLNA 3U92A 4POWA 3TTRA 4FAJA 2B4MA 1I6BA 5TU0A 3K6WA 2I4CA 1Z7NE 4RK2A 5KDTB 3RUMA 3TTNA 4FATA 1MH3A 1YPNA 2Z23A 1N3WA 4OHNA 1JW1A 2DE2A 4TLMB 5KCJB 2ZXTA 1MXWA 1QKBA 4NEDA 4OFOA 3U72A 3WAEA 3RLFE 4XKQA 1QW0A 1M5BA 4IY6A 5LOMA 3RY3A 2PT2A 1QUKA 2O7UA 3DRKA 1D9VA 3ZKKA 2NVUB 3MVWA 4GD5A 4KHZE 3K01A 4YMAA 4U21A 4F3PA 2RF1A 1N7WA 3N26A 1MDP1 3K00A 3MPKA 5BUUA 3CFLA 1JVXA 4R9GA 1B4HA 1A8EA 1XVYA 4KYDA 1M5FA 1URGA 3Q26A 3BBRA 3SERA 3FTOA 2HEUA 4NTLA 3QSLA 4JSOA 2FA7A 3P7IA 1L5TA 1S9TA 3RYAA 2THIA 3V83A 4ELOA 1ZBMA 1DSNA 3U8QA 5EYFA 4LQ5A 1DPPA 2D5WA 1JNFA 1PEBA 5KDTA 4YKJA 1NH8A 4E0WA 4KQPA 1IXCA 1I6QA 3RTWB 4GF8A 3MUQA 2ZYMA 3PMVA 1F9BA 4MBPA 1USYH 5KCJA 4GXAA 2F97A 4RY1A 4YZZA 1S7YA 1B7UA 3CHGA 1ATGA 3QK6A 1M5DA 4R6YA 5I2KB 2A5TB 1PB8A 5I57A 3JV9A 1R1NA 1B5HA 4OYVA 1UIVA 3KGCA 3E3KA 1GVCA 2NWJA 3PUWE 4TQUQ 1MY2A 3ODBA 4ZEFA 3LVUA 1MY3A 3QUJA 4LQ2A 2PYYA 2CMOA 4OMBA 3USDA 3SETA 2CZLA 3O6PA 4IO6A 1YAEA 4U2RA 3GLBA 2X7PA 1Y9UA 3FVNA 3TMGA 4R74A 4DZ1A 5JTYA 4IY5A 2IEEA 3Q29A 3K2DA 5BWJA 2HQ0A 3TCHA 2ZNSA 4PQJA 4YB5A 4BDMA 3V89B 1URSA 1OLAA 3RQTA 4LZ7A 4JXIA 1QVSA 4OQOA 4R73A 2I3VA 5L9SA 1LSTA 5AA3A 1MQDA 3CIJA 1LAHE 4RK9A 4RA1A 1Y3NA 3D4CA 5EHMA 3LSFB 1P1QA 2B3BA 1BIYA 4LUBA 5I2KA 4QFOA 1ZLQA 2Z22A 1MDQA 1SQYA 3EQ1A 4GXSB 1R9LA 1B2HA 3FVKA 1R6ZA 2B4LA 4LP2B 1SW4A 4IB2A 1DOTA 4JWXA 2FYIA 2B65A 3TCGA 1SW5A 2RINA 1B7HA 1LLSA 1Z7ME 2XD3A 4NMYA 2O1MA 2NXOA 3SESA 5CBSA 3N6UA 2I0BA 2F34A 5I58B 1O63A 1JQFA 1GV8A 2QS1A 2F7AA 1JEUA 2Y7RA 2HCAA 2VGQA 1B3HA 2GHAA 1NNPA 3C31A 2UXAA 3Q27A 3LSWA 3CI8A 3N5LA 4HCWA 3TQWA 2QMWA 1XS5A 3UN6A 2HFBA 4M4GA 5IKBA 3PGFA 1HSJA 2DXYA 4EXLA 3G3JA 1QUIA 4KI0E 3VE1B 3CSGA 1FTMA 1SI0A 1LAFE 3S2VA 3PPQA 3G3HA 4GL0A 1AOVA 5DVIA 1US5A 1USYE 3O6HA 3LSXA 4H5GA 2ZYOA 3OSRA 3EN3A 5EHSA 3MAMA 4X9TA 2X26A 1QULA 3H06B 3IB2A 4OFLA 4FORA 3FVOA 3IOWA 4F29A 3L6HA 1R9QA 2RC7A 3BFUA 3ILTB 3IX1A 4BDQA 5I56B 2F5XA 1N7XA 3VLUA 1LCTA 5CRYA 4JBZA 4YB7A 3M8UA 1OMPA 3DRIA 3A3UA 5I58A 1B4ZA 3MZ1A 3TCFA 4C1TA 4I62A 1B6HA 1POY1 1H76A 4IO3A 3G3IA 1Y3QA 1FW0A 2HAUA 3T22A 3H03A 2V3UA 2UVHA 1SW1A 4GWOA 1IXGA 2I4BA 1VE4A 3DRGA 3OSQA 3OOAA 4N13A 2Y7WA 2F6GA 1VSOA 3S9LC 3S9NC 3LUYA 2GHBA 1Y4CA 3IAZA 3OO8A 2F78A 1B0HA 3H3GA 3KN7A 1B46A 4MH5A 3DP8A 2ONSA 2I3WA 4EUOA 4IGRA 2RKMA 2R6GE 2XXWA 4WEPA 2AL5A 4H8IA 3CVGA 4DIGA 2XXIA 3T96B 1HSEA 2M8CA
chains in the Genus database with same CATH superfamily
1NH7A 1H44A 3KJTA 2H25A 4Q8RA 1WVJA 1SI1A 2CEXA 3VVDA 1SYHA 3B6WA 5H8FA 1UQWA 3GBBA 4ESXA 3S9MC 4EF2A 1IXIA 1FPIA 2XWOA 3LV0A 3MZBA 3RT6B 2DWIA 2ZYKA 4KYSA 5CMKA 4YKKA 1CNQA 2DP8A 1FQAA 5EQ8A 2B3FA 4MLQA 4IGTA 4EDPA 5A5LA 1POTA 5I56A 4RJZA 1UTHB 3BIHA 3VXBA 2QPQA 1LCFA 2V4CA 2XX8A 2RC8A 1A55A 4HE0A 4O3BA 2Q9TA 4C1UA 4NAPA 2I0CA 4HE1A 4F1YA 5HBCA 2Z8FA 3K6XA 4P47A 5M2VA 4MJOA 2VT5A 1D3KA 3VV5A 1D4NA 4EQBA 3QYTA 1NUYA 4XKNA 2H4IA 2AL4A 2OWSA 3LSLA 4EXKA 2XXPA 3N6TA 4I3EA 1NMUA 1SVXB 4ELRA 2R8TA 3HV1A 4Q0CA 4P0GA 4GBVA 4MLVA 4C0RA 1NV4A 4WEDA 1ELJA 1G0HA 1A54A 4P56A 4OWDA 3FGSA 4GWXA 2E0SA 2XD2A 2QS3A 3FZVA 1QKAA 2XXRA 1VR5A 4X8RA 2LAOA 4QF9A 3UP9A 1XOCA 2G93A 1FTOA 3ILUB 1VFDA 1FPLA 1IITA 2PT1A 1P99A 2X7QA 3A09A 3FV2A 3E78A 3RPLB 1FTJA 4X1DA 1FJ6A 1NKXA 3K6UA 2RCAA 1LFIA 2GH9A 4OZ9A 4IR8A 4O3AA 2PFYA 3PUVE 5FHNA 2DVZA 3I3VA 3F11A 1LBVA 4U22A 1IEJA 2O69A 5DTBA 1ZKBA 5CBRA 5DYHA 2VOZA 3LR1A 4F2OA 1B3EA 5HM4B 4OENA 1UTHA 2OX3A 3QMFA 4GL8A 1FBFA 4NF5B 4OERA 4F18A 5ICQA 1FJ9A 1INPA 4BDNA 4K3FA 2DDKA 4R9FA 4NE4A 3CFZA 2DWJA 3S4UA 1N76A 1MXVA 3R6UA 4R2FA 4I8CA 3VLWA 3RNNA 4QHQA 1B1XA 5F24A 1H43A 1Q9DA 4ZECA 1Y1ZA 3LBSA 3TQLA 3V5AA 4PAKA 4R6KA 3BKIB 1NV2A 3HN0A 5K2XA 3CG1A 1LB9A 1DPEA 2G29A 1JW4A 5J1DA 4ELQA 3HO7A 3FD3A 4EQ9A 2VP1A 4OVJA 4HXVA 1MQJA 1TT1A 2PBWA 4X1BA 4F1UA 2UVIA 5FTHA 1K9YA 1MY4A 1B3GA 1FQFA 3T1BA 4JSDA 1LBXA 1EU8A 3O66A 5IM2A 4XF5A 3FJMA 3QXMA 3K4UA 4NN3A 4QFLA 2FHYA 3GZGA 1YTVA 1B3LA 4PP0A 5AA2D 3G3FA 4N15A 1FTKA 1Q35A 1TFAA 4QFNA 4QSEA 3IB1A 5AA2B 1GR2A 3B7DA 5ET5A 3OO6A 5CMCA 4WXJA 1PB9A 2O51A 2DYXA 2DQVA 1OQGA 4I3YA 3TEPA 4JDFA 4NF5A 1FPDA 4G2ZA 1NV7A 5CMBA 3MVZA 3DRFA 1IXHA 5HPQA 4MNIA 1B9JA 4ELPA 3D1RA 2XXYA 4HS7A 4Z7EA 1RYOA 5K2YA 3CR9A 3PMWA 1B40A 4Z0IA 3ZS6A 2XWKA 4R75A 4YICA 2ZNUA 1D9QA 4HCYA 3U93A 3RYBA 2QSXA 1WODA 3VLVA 4ESWA 3H6WA 2ZYNA 3H6TA 1M5EA 5FHOA 1KA0A 3A29A 5AA1A 4RPOA 5ET8A 2XXQA 3MZ9A 4KFQA 4FE8A 4OVSA 3U1OA 2A5TA 3LC8A 2FBPA 4BDOA 2IA4A 3K1MA 3RT8A 1AH5A 2F6PA 2DWAA 3KOSA 5A5XB 3C36A 4PFRA 2ANJA 3M3KA 3TDJA 4MNPA 4GRKA 4PF8A 3DP4A 3EPEA 4PFWA 4H5FA 2XXXA 4OETA 4M1VA 4F39A 3T9VA 2XWVA 1P1NA 4G68B 1PB7A 1B32A 5F1QA 1FBHA 1RKMA 2P0SA 4LVQA 3CRBA 1LBWA 4PF6A 2I48A 2HAVA 1JEVA 1MQIA 2QVRA 5AA4B 4L17A 2V93A 4ZEKA 1FPEA 1PBQA 4I9DA 3GYYA 5AA2A 1ZJLA 3I5OA 4O3CA 1QGXA 4YKPA 4ECFA 2WOKA 1RDXA 3K6VA 1B1HA 4ND9A 3O29A 3IR1A 3MP1A 4X04A 1MY1A 2XXHA 3H7MA 5IGAA 4XIGQ 2REGA 1IZ1A 3IOTA 4MAGA 2Q8MA 1II5A 3K02A 1YCJA 4ISUA 2RCBA 3T93B 5L9OA 4JVIA 4F3BA 2Y7IA 4MF3A 1DK4A 4QFPA 3MVYA 5ICTA 3DRJA 1PDAA 4G8HA 3RN8A 1MXZA 2D3IA 3UK4A 4G8MA 2Q89A 4UA8A 1FPJA 1N04A 2RC9A 3SEWA 4OXVA 5CM6A 3IO6A 3VVEA 3R26A 4DXUA 4NHBA 2O1LA 4LN5A 1B3FA 3MVXA 2I58A 2ESNA 3KC0A 1H3DA 3Q25A 4PETA 5A5XA 3TUSA 4YB6A 4IO7A 2H99A 5TP9B 1SBPA 2DVCA 4FEBA 4KCCA 4QRZA 1LAXA 4LA9A 5EQ9A 4U1OA 4KR5A 5I5PA 4F3GA 1ZIUA 2PX1A 3B50A 4U23A 1JETA 3UGWA 4G68A 2F7BA 2P1SA 3C32A 2DWHA 2FNCA 2UVGA 4H67A 3TYHA 2XXVA 3RTFB 1OQHA 2W7YA 1OLCA 1EH3A 5AA4A 1MG1A 2FVZA 3W9WA 4NWDA 3AXFA 1UTBB 3S9EA 3K1NA 4NF0A 2R9JA 2XXKA 4PFIA 4R72A 1O7TA 3MYUA 3Q28A 4GOTA 1LGBC 4HE2A 2UYFA 4PBHA 4OVTA 4RYAA 3M3LA 5JK4A 3RYDA 4PFYA 4F1VA 1TWYA 5DEXB 3O6IA 2VD3A 3LUZA 1NI9A 3O97A 4HTGA 3ECRA 4LZ8A 1LFHA 1JW5A 3ROJA 3H6VA 4PE3A 2ZZWA 4F31B 3E79A 1VFEA 1Y3PA 2I6EA 2Q8JA 4AS5A 1IIWA 4P1EA 3TODA 3C34A 2ZMBA 2VHAA 3VFJA 3G3KA 4LZ5A 5I2NB 3FV1A 4YMBA 2XXUA 2Y5KA 3OO9A 1B51A 1NNTA 4EF1A 3C33A 1AMFA 4LATA 4XKRA 4DXBA 3D4GA 2O84X 1B52A 1MRPA 1B0LA 3O9PA 1P1OA 2XXTA 4POXA 1EZOA 1URDA 5TP9A 2XX9A 3NOHA 3O6GA 1MPDA 1TFDA 2O7IA 3BFTA 3OD7A 4ZDMA 5L9MA 4PE5B 1FQBA 4H6DA 2GQ1A 3W15C 4PAIA 2R71A 1QUJA 4MHFA 3PUZE 2OLBA 4FIMA 1MXUA 5H8NB 4AB5A 2OWTA 5FTIA 1TXFA 2CZIA 2Q2CA 1MQGA 5IZZA 3KN3A 4KXPA 2H9BA 1YXIA 1ZMGA 3L6GA 4GWSA 4ZZAA 1UTBA 2V3TA 1B58A 3VXCA 3DP6A 3IORA 1FBGA 3SEXA 1EYJA 4ZEBA 3TTMA 4FECA 3OO7A 5CC2A 1FQEA 2F3DA 3IOVA 5H8QB 1AWBA 3FXBA 2HZKA 3HCQA 3QAXA 1IMCA 3FJ7A 3TPAA 4U4XA 4DE8A 3SEUA 1MQHA 3JYRA 1XVXA 1CE2A 5DEXA 3KN8A 1FBPA 2Y7KA 1N84A 3KSXA 4RPNA 1A7LA 4H46A 2GFEA 4G61A 3OXNA 3FUZA 4KD5A 1PC3A 1XHYA 3ONMA 3C35A 4E0XA 1MPBA 1EZ9A 1SPIA 3OENA 3CG3A 1P1UA 3FIRA 3B6TA 2F36A 4UACA 1B5JA 2DS9A 1YZ0A 3VVFA 3UORA 5I57B 1NUZA 3MJNA 4G77A 2ZZVA 5I2NA 2OJTA 4GVOA 2XHDA 4PGPA 1D9YA 1S50A 2YJPA 2QMXA 3IOUA 4H0WA 1IMEA 3KZGA 5CMMA 1DTGA 3HSTA 3VDFA 2REJA 4OANA 2V84A 5ET7A 3KBRA 4PFTA 4OEUA 3CFXA 3EHUA 2DE3A 3KOTA 1NUWA 2MKZA 4KPTA 4FEDA 3KEIA 3IJOB 5EQAA 3ZKLA 2WOLA 2F7CA 1OVBA 4OVRA 5H8HB 3SEVA 1LB8A 4GWYA 4IO5A 4O8MA 3WAFA 4GWZA 2QJEA 1MXXA 5H8NA 3QIMA 1Q1KA 4DLDA 3JZJA 5JTYB 2KLFA 4DXCA 1FPFA 4P9KA 2F8DA 4ONYA 1B5IA 5ISUA 2Q88A 1J1NA 4R2BA 2VPNA 1I6AA 4ZEIA 4F2QA 4MIJA 4NF6B 4GIZA 4U4SA 3DRHA 5H8QA 2WX9A 4LONB 3E4RA 2P2AA 5JEIA 2D21A 4G68C 3MP6A 1RDYA 4EQ7A 1ZU0A 4PAFA 3PAMA 5FHMA 1Y1MA 2UYEA 2V3QA 4PBQA 4OFJA 4O7MA 3PPOA 1Y4TA 2VD2A 4RNSA 1ZTYA 4RXLA 2FIXA 4QFKA 1LBCA 5H8SA 1HSLA 1G0IA 4YAHX 3KSJA 4Q5TA 2BJJX 3KG2A 4THIA 2HZLA 4IO4A 1EZPA 4GBWA 4IO2A 2Z8DA 2WBDA 2ONKE 1B7ZA 3RPLA 4FJPA 3K1PA 4DCYA 1CB6A 4I40A 4YU0A 4JWOA 4N6PA 1FSAA 4ZEDA 4F19A 1BLFA 4MFIA 1XT8A 1FQDA 1A99A 1GTKA 3H6UA 2A5SA 4OTEA 3B8BA 5IAIA 5H8HA 4KCDA 3N94A 3IJXB 4JWYA 5L8DA 5B7DA 2QRYA 3KJ7A 2YPNA 3PD8A 4NF4B 4ZE9A 3RGYA 3C4MA 4I1DA 1RDZA 3FXQA 5CI5A 4F3SA 5ITPA 4H1XA 1LFGA 5KZTA 4NF6A 3T9UA 3MC2A 2HPGA 2QS2A 1UIUA 4NF8B 1FQCA 1YYZA 3MBPA 3TFLA 2OCUA 2ONRA 2O68A 4MNCA 4BDRA 4NX1A 5DVFA 3M3FA 2E1SA 4N07A 3U94A 1BKAA 2V25A 1FCKA 4NWCA 4P8BA 2L5VA 3G3GA 1AIVA 4BDLA 4OESA 2ZNTA 1NNFA 4ZZEA 1MM7A 3FXUA 4JB7A 3EHTA 4BLAA 1I69A 1NV6A 1IUDA 3HHGA 4HW8A 4F22A 1MPCA 1N0TA 1XC1A 1SD3A 2KR0A 2I49A 3O28A 4R6HA 1OIBA 3PPRA 4N8GA 4XXUA 3DLNA 3PMXA 1WDNA 4KYEA 4N81A 1H45A 3DM0A 3A3CA 1JP4A 2PVUA 2NOOA 4GFRA 3PD9A 5TPAB 2OK2A 3O2AA 4U1ZA 4G4PA 4ZS9A 3RPWA 2Z8EA 4H45A 4QSDA 3GXAA 2QL3A 3FASA 3E13X 1SYIA 4TLLB 3PUXE 3H4ZA 1IMFA 4QBAA 4DCXA 3HPIA 1NNKA 1XI6A 5DT6A 3TZAA 4DDDA 5ITOA 4MMPA 4G8NA 3MWBA 3ZSFA 4NF4A 4NGUA 1DMBA 3KC1A 1MM6A 3I6VA 3HHFA 1T0KA 1M5CA 3QUFA 3PU5A 2O6AA 3R7XA 4MEVA 5I59B 4OEVA 1JVYA 3V8XB 1MH4A 2FIEA 1GGGA 1DTZA 3FATA 3TAJA 4O94A 4TOZA 1SW2A 4NF8A 2Y7PA 4GLIA 5B70A 2AIXA 3IL1B 4H65A 1FBCA 2CEYA 2WEFA 3THIA 1IQ7A 1B05A 2AYSA 3DELB 1AL3A 4QSCA 2VPOA 3EF7A 3GBAA 2ALUA 2WOPA 1P1WA 4DI3D 3T66A 3OEKA 2DXRA 2ABHA 2DSFA 2XA5A 3OELA 3W9VA 1LBBA 2F35A 4P11A 1QJMA 2H5YA 1NFTA 3TKDA 5H8FB 4XFEA 2UVJA 4X48A 1BTJA 4PFUA 5F7VA 1NL5A 3FVGA 1NUXA 3C9HA 5TPAA 3HFUA 3MSTA 1RYXA 3TTLA 3IB0A 4PGNA 3EHSA 2OBGA 1PBPA 1US4A 3T9XB 2P3VA 3SEYA 3MW0A 4XKPA 1MXYA 3IO4A 5J16A 3BIGA 1FTLA 1MS7A 3B6QA 3E9XA 3TTKA 2OZZA 2GRVA 3FJGA 3K0VA 4WKMA 3G7WA 1MY0A 2QVUA 4AB6A 1LAGE 1BK4A 5IZ1A 4N6DA 4N8YA 3UIFA 5I59A 5I84A 1A8FA 3SDFA 5EQ7A 3FXRA 3TELA 2BJIA 2NUVA 3KFMA 3MQ9A 2DOJA 1NV5A 3T9HB 2PMSA 2HXWA 4JVCA 4YKIA 1A40A 3CSBA 4GQOA 3OEMA 4GWUA 3PPPA 2H98A 4Q30B 1SDXA 2XX7A 1OVTA 2QS4A 1ANFA 5LTCA 2Q2AA 1EYKA 4H8JA 5DVJA 1FRPA 2DE4A 4XTCQ 4JVDA 3MP8A 3IK6B 3PPNA 4OA4A 1N3XA 3PV0E 2Y84A 3SKPA 4ZE8A 1KWHA 4AQ4A 4MCOA 1O64A 2JJKA 5AE4A 4PTKA 5ELVA 3OMBA 3MPLA 5LDZA 3PUYE 1BP5A 3UA8A 2WKYA 4P0IA 1Y20A 2YLNA 3U92A 4POWA 4OVQA 3TTRA 4FAJA 2B4MA 1I6BA 5TU0A 3K6WA 2I4CA 5ET6A 1Z7NE 4RK2A 5KDTB 3RUMA 3TTNA 4FATA 4PC9A 1MH3A 1YPNA 2Z23A 1N3WA 4OHNA 1JW1A 2DE2A 2HXRA 4TLMB 5KCJB 2ZXTA 1MXWA 1QKBA 4NEDA 4OFOA 3SZPA 1FPGA 3U72A 3WAEA 3RLFE 3EKIA 4XKQA 1QW0A 1M5BA 4IY6A 5IZ3B 5T3JA 5LOMA 3RY3A 2PT2A 1QUKA 2O7UA 3DRKA 1D9VA 3ZKKA 2NVUB 3MVWA 4OVPA 4GD5A 1VDWA 4KHZE 3K01A 4YMAA 4U21A 4F3PA 2RF1A 1N7WA 3N26A 1MDP1 3K00A 3MPKA 5BUUA 3CFLA 1JVXA 2PCRA 4R9GA 1B4HA 1A8EA 1XVYA 4KYDA 1M5FA 1URGA 3Q26A 3BBRA 3SERA 4O7IA 3FTOA 2HEUA 4NTLA 3QSLA 1FBDA 4JSOA 2FA7A 3P7IA 1L5TA 1S9TA 3RYAA 2THIA 2P3NA 3V83A 4ELOA 1ZBMA 1DSNA 3U8QA 5EYFA 4LQ5A 1DPPA 1IMAA 2D5WA 2CZHA 1JNFA 4PDDA 1PEBA 4GWWA 5KDTA 4YKJA 1NH8A 4E0WA 4KQPA 1IXCA 4QXDA 1I6QA 2WYPA 5I3SA 3RTWB 4GF8A 3MUQA 2ZYMA 3PMVA 1F9BA 5EYHA 4MBPA 1USYH 1IMBA 4FBPA 5KCJA 4GXAA 2F97A 4PCDA 4RY1A 4YZZA 4NG7A 1S7YA 1B7UA 3CHGA 1ATGA 3QK6A 5IZ3A 1M5DA 4R6YA 5I2KB 2A5TB 1PB8A 2KQZA 5I57A 3JV9A 1R1NA 1B5HA 4OYVA 1UIVA 3T0JA 1LBZA 3U65A 3KGCA 3E3KA 1GVCA 2NWJA 3PUWE 4PFBA 4TQUQ 1MY2A 3ODBA 4ZEFA 3LVUA 1MY3A 3QUJA 4LQ2A 2QFLA 2PYYA 2CMOA 4OMBA 3USDA 3SETA 2CZLA 1NV3A 3O6PA 4IO6A 1YAEA 4U2RA 3GLBA 1FPKA 2X7PA 4NQ8A 2XWIA 1DBZA 3IFCA 1Y9UA 3FVNA 3TMGA 4R74A 4DZ1A 5JTYA 4IY5A 2IEEA 3Q29A 3K2DA 5BWJA 2HQ0A 3TCHA 2PFZA 2ZNSA 4PQJA 4YB5A 4BDMA 3V89B 5I7IA 1URSA 1OLAA 3RQTA 4N91A 4LZ7A 1FPBA 4JXIA 1QVSA 4OQOA 4R73A 2HHMA 2QVVA 2F3BA 2I3VA 5L9SA 1LSTA 5AA3A 1MQDA 3CIJA 1LAHE 4RK9A 4RA1A 1Y3NA 1LEVA 3D4CA 4N6KA 3PTYA 4GX3A 1NV0A 1IMDA 4DI4B 5EHMA 3LSFB 1LBYA 1P1QA 4XEQA 2B3BA 4AS4A 1BIYA 5FBPA 4LUBA 5I2KA 4QFOA 1ZLQA 2Z22A 1MDQA 1SQYA 4GX4A 3ISPA 3EQ1A 4GXSB 1R9LA 1B2HA 3FVKA 1R6ZA 2B4LA 4LP2B 1SW4A 4IB2A 1DOTA 4JWXA 2FYIA 2B65A 3TCGA 1SW5A 2RINA 1B7HA 1LLSA 1Z7ME 2XD3A 4NMYA 1FTAA 2O1MA 2NXOA 3SESA 5CBSA 3N6UA 5ESYA 2I0BA 2F34A 2CZKA 5I58B 1O63A 1JQFA 1GV8A 4N17A 2QS1A 2F7AA 1JEUA 2Y7RA 2HCAA 2VGQA 1B3HA 2GHAA 1NNPA 2WBBA 3C31A 2UXAA 3Q27A 3LSWA 3CI8A 3N5LA 4HCWA 3TQWA 2QMWA 1XS5A 1DCUA 3UN6A 2HFBA 4M4GA 5IKBA 3PGFA 1HSJA 2DXYA 4EXLA 3G3JA 1QUIA 4KI0E 4P3LA 3VE1B 3CSGA 1FTMA 1SI0A 1LAFE 3S2VA 3PPQA 3G3HA 4GL0A 1AOVA 5DVIA 1US5A 1K9ZA 1USYE 5DW8A 3O6HA 3LSXA 4H5GA 4PDHA 2ZYOA 3OSRA 3EN3A 5EHSA 3MAMA 4X9TA 2X26A 1QULA 1NV1A 3H06B 3IB2A 4OFLA 4FORA 3FVOA 3IOWA 4F29A 3L6HA 1R9QA 1KZ8A 2RC7A 3BFUA 3ILTB 3IX1A 4BDQA 2Y5LA 5I56B 2F5XA 1N7XA 4N4UA 1EYIA 2ZZXA 3VLUA 1LCTA 5CRYA 4JBZA 4YB7A 3M8UA 1OMPA 3DRIA 3A3UA 5I58A 1B4ZA 3MZ1A 3TCFA 4C1TA 4I62A 4P1LA 1B6HA 1POY1 1H76A 4IO3A 3G3IA 1Y3QA 1FW0A 2HAUA 3T22A 3H03A 2V3UA 2UVHA 1SW1A 4GWOA 1IXGA 3FBPA 2I4BA 1VE4A 3DRGA 3OSQA 3OOAA 1KA1A 4N13A 2Y7WA 2F6GA 1VSOA 3KBZA 3S9LC 3S9NC 2Q74A 2GHBA 3LUYA 1Y4CA 3IAZA 3OO8A 2F78A 2WYKA 1B0HA 3H3GA 3KN7A 1B46A 4MH5A 3DP8A 2ONSA 2I3WA 4EUOA 4IGRA 4MX6A 2RKMA 2R6GE 2XXWA 4GX6A 4WEPA 1FBEA 2AL5A 4H8IA 5EYGA 4UABA 3CVGA 2OWZA 3IFAA 4DIGA 2XXIA 3T96B 1HSEA 2M8CA
chains in the Genus database with same CATH topology
1NH7A 1H44A 3KJTA 2H25A 4Q8RA 1WVJA 1SI1A 3VVDA 1SYHA 3B6WA 5H8FA 1UQWA 3GBBA 4ESXA 3S9MC 4EF2A 1IXIA 3MZBA 3RT6B 2DWIA 2ZYKA 4KYSA 5CMKA 4YKKA 2DP8A 1FQAA 2B3FA 4MLQA 4IGTA 4EDPA 1POTA 5I56A 4RJZA 1UTHB 3VXBA 2QPQA 1LCFA 2XX8A 2RC8A 1A55A 4O3BA 2Q9TA 4C1UA 2I0CA 4F1YA 5HBCA 2Z8FA 3K6XA 5M2VA 1D3KA 3VV5A 1D4NA 4EQBA 3QYTA 4XKNA 2H4IA 2AL4A 2OWSA 3LSLA 4EXKA 2XXPA 3N6TA 1NMUA 1SVXB 4ELRA 3HV1A 4Q0CA 4P0GA 4MLVA 4C0RA 4WEDA 1ELJA 1A54A 4OWDA 3FGSA 2E0SA 2XD2A 2QS3A 3FZVA 1QKAA 2XXRA 1VR5A 2LAOA 4QF9A 3UP9A 1XOCA 2G93A 1FTOA 3ILUB 1VFDA 1IITA 2PT1A 1P99A 2X7QA 3A09A 3FV2A 1FTJA 4X1DA 1NKXA 3K6UA 2RCAA 1LFIA 2GH9A 4OZ9A 4O3AA 3PUVE 5FHNA 2DVZA 3I3VA 3F11A 4U22A 1IEJA 2O69A 5DTBA 1ZKBA 5CBRA 5DYHA 2VOZA 3LR1A 4F2OA 1B3EA 5HM4B 4OENA 1UTHA 4GL8A 4NF5B 4OERA 4F18A 5ICQA 4BDNA 4K3FA 4R9FA 4NE4A 3CFZA 2DWJA 3S4UA 1N76A 1MXVA 3R6UA 4R2FA 4I8CA 3VLWA 3RNNA 4QHQA 1B1XA 1H43A 4ZECA 1Y1ZA 3LBSA 3TQLA 3V5AA 4R6KA 3BKIB 3HN0A 5K2XA 3CG1A 1LB9A 1DPEA 2G29A 1JW4A 5J1DA 4ELQA 3HO7A 3FD3A 4EQ9A 2VP1A 4OVJA 1MQJA 1TT1A 2PBWA 4X1BA 4F1UA 2UVIA 5FTHA 1MY4A 1B3GA 1FQFA 4JSDA 1EU8A 3O66A 3FJMA 3QXMA 3K4UA 4QFLA 3GZGA 1YTVA 1B3LA 4PP0A 5AA2D 3G3FA 1FTKA 1Q35A 1TFAA 4QFNA 4QSEA 3IB1A 5AA2B 1GR2A 3B7DA 3OO6A 5CMCA 4WXJA 1PB9A 2O51A 2DYXA 2DQVA 1OQGA 3TEPA 4JDFA 4NF5A 4G2ZA 5CMBA 3MVZA 3DRFA 1IXHA 5HPQA 1B9JA 4ELPA 2XXYA 4HS7A 4Z7EA 1RYOA 5K2YA 3CR9A 3PMWA 1B40A 4Z0IA 3ZS6A 4R75A 4YICA 2ZNUA 4HCYA 3U93A 3RYBA 2QSXA 1WODA 3VLVA 4ESWA 3H6WA 2ZYNA 3H6TA 1M5EA 5FHOA 5AA1A 4RPOA 2XXQA 3MZ9A 4KFQA 4FE8A 3U1OA 2A5TA 3LC8A 4BDOA 2IA4A 3K1MA 3RT8A 1AH5A 2F6PA 2DWAA 3KOSA 5A5XB 3C36A 2ANJA 3M3KA 3TDJA 4GRKA 3DP4A 3EPEA 4PFWA 4H5FA 2XXXA 4OETA 4M1VA 4F39A 3T9VA 1P1NA 4G68B 1PB7A 1B32A 5F1QA 1RKMA 2P0SA 4LVQA 3CRBA 2I48A 2HAVA 1JEVA 1MQIA 5AA4B 4L17A 2V93A 4ZEKA 1PBQA 4I9DA 5AA2A 1ZJLA 3I5OA 4O3CA 4YKPA 4ECFA 2WOKA 3K6VA 1B1HA 4ND9A 3O29A 3IR1A 3MP1A 1MY1A 2XXHA 3H7MA 4XIGQ 2REGA 1IZ1A 3IOTA 1II5A 3K02A 1YCJA 4ISUA 2RCBA 3T93B 5L9OA 4F3BA 2Y7IA 4MF3A 4QFPA 3MVYA 5ICTA 3DRJA 1PDAA 4G8HA 3RN8A 1MXZA 2D3IA 3UK4A 4G8MA 2Q89A 4UA8A 1N04A 2RC9A 3SEWA 4OXVA 5CM6A 3IO6A 3VVEA 3R26A 4DXUA 2O1LA 1B3FA 3MVXA 2I58A 2ESNA 1H3DA 3Q25A 4PETA 5A5XA 3TUSA 4YB6A 4IO7A 2H99A 5TP9B 1SBPA 2DVCA 4FEBA 4KCCA 4QRZA 1LAXA 4LA9A 4U1OA 4KR5A 4F3GA 1ZIUA 2PX1A 4U23A 1JETA 3UGWA 4G68A 2F7BA 2P1SA 3C32A 2DWHA 2FNCA 2UVGA 4H67A 3TYHA 2XXVA 3RTFB 1OQHA 2W7YA 1OLCA 1EH3A 5AA4A 1MG1A 3W9WA 4NWDA 3AXFA 1UTBB 3S9EA 3K1NA 2R9JA 4R72A 1O7TA 3Q28A 4GOTA 1LGBC 2UYFA 4RYAA 3M3LA 5JK4A 4PFYA 4F1VA 1TWYA 5DEXB 3O6IA 2VD3A 4HTGA 3O97A 4LZ8A 3ECRA 1LFHA 1JW5A 3H6VA 4F31B 1VFEA 1Y3PA 2I6EA 2Q8JA 1IIWA 3TODA 3C34A 2ZMBA 2VHAA 3VFJA 3G3KA 4LZ5A 5I2NB 3FV1A 4YMBA 2XXUA 3OO9A 1B51A 1NNTA 4EF1A 3C33A 1AMFA 4LATA 4XKRA 4DXBA 3D4GA 2O84X 1B52A 1MRPA 1B0LA 3O9PA 1P1OA 2XXTA 4POXA 1EZOA 1URDA 5TP9A 2XX9A 3O6GA 1MPDA 1TFDA 2O7IA 3BFTA 3OD7A 4ZDMA 5L9MA 4PE5B 1FQBA 4H6DA 3W15C 2R71A 1QUJA 3PUZE 2OLBA 4FIMA 1MXUA 5H8NB 4AB5A 2OWTA 5FTIA 1TXFA 2Q2CA 1MQGA 3KN3A 2H9BA 1ZMGA 3L6GA 4ZZAA 1UTBA 2V3TA 1B58A 3VXCA 3DP6A 3IORA 3SEXA 4ZEBA 3TTMA 4FECA 3OO7A 5CC2A 1FQEA 3IOVA 5H8QB 2HZKA 3HCQA 3QAXA 3FJ7A 3TPAA 4U4XA 4DE8A 3SEUA 1MQHA 3JYRA 1XVXA 1CE2A 5DEXA 3KN8A 2Y7KA 1N84A 3KSXA 4RPNA 1A7LA 2GFEA 3OXNA 3FUZA 4KD5A 1PC3A 1XHYA 3ONMA 3C35A 4E0XA 1MPBA 1EZ9A 3OENA 3CG3A 1P1UA 3FIRA 3B6TA 2F36A 4UACA 1B5JA 2DS9A 3VVFA 3UORA 5I57B 3MJNA 4G77A 5I2NA 2OJTA 4GVOA 2XHDA 1D9YA 1S50A 2YJPA 2QMXA 3IOUA 4H0WA 3KZGA 5CMMA 1DTGA 3HSTA 3VDFA 2REJA 2V84A 3KBRA 4PFTA 4OEUA 3CFXA 3EHUA 2DE3A 3KOTA 4KPTA 4FEDA 3KEIA 3IJOB 3ZKLA 2WOLA 2F7CA 1OVBA 5H8HB 3SEVA 1LB8A 4IO5A 3WAFA 2QJEA 1MXXA 5H8NA 3QIMA 1Q1KA 4DLDA 3JZJA 5JTYB 2KLFA 4DXCA 2F8DA 4ONYA 1B5IA 5ISUA 2Q88A 1J1NA 4R2BA 1I6AA 4ZEIA 4F2QA 4NF6B 4GIZA 4U4SA 3DRHA 5H8QA 4LONB 3E4RA 2P2AA 5JEIA 2D21A 4G68C 3MP6A 4EQ7A 1ZU0A 3PAMA 5FHMA 1Y1MA 2UYEA 2V3QA 4OFJA 3PPOA 1Y4TA 2VD2A 4RNSA 1ZTYA 4RXLA 4QFKA 1LBCA 5H8SA 1HSLA 4YAHX 3KSJA 4Q5TA 2BJJX 3KG2A 4THIA 2HZLA 4IO4A 1EZPA 4IO2A 2Z8DA 2ONKE 1B7ZA 4FJPA 3K1PA 4DCYA 1CB6A 4YU0A 4JWOA 4N6PA 4ZEDA 4F19A 1BLFA 4MFIA 1XT8A 1FQDA 1A99A 1GTKA 3H6UA 2A5SA 4OTEA 5IAIA 5H8HA 4KCDA 3N94A 3IJXB 4JWYA 5L8DA 5B7DA 2QRYA 3KJ7A 2YPNA 3PD8A 4NF4B 4ZE9A 3RGYA 3C4MA 4I1DA 3FXQA 5CI5A 4F3SA 5ITPA 4H1XA 1LFGA 5KZTA 4NF6A 3T9UA 3MC2A 2QS2A 1UIUA 4NF8B 1FQCA 3MBPA 3TFLA 2OCUA 2ONRA 2O68A 4BDRA 5DVFA 3M3FA 2E1SA 4N07A 3U94A 1BKAA 2V25A 1FCKA 4NWCA 3G3GA 1AIVA 4BDLA 4OESA 2ZNTA 1NNFA 4ZZEA 1MM7A 3FXUA 4JB7A 3EHTA 4BLAA 1I69A 1IUDA 3HHGA 4HW8A 4F22A 1MPCA 1N0TA 1XC1A 1SD3A 2I49A 3O28A 4R6HA 1OIBA 3PPRA 4XXUA 3DLNA 3PMXA 1WDNA 4KYEA 1H45A 3DM0A 3A3CA 2PVUA 2NOOA 4GFRA 3PD9A 5TPAB 2OK2A 3O2AA 4U1ZA 4G4PA 4ZS9A 3RPWA 2Z8EA 4QSDA 3GXAA 2QL3A 3FASA 3E13X 1SYIA 4TLLB 3PUXE 3H4ZA 4DCXA 3HPIA 1NNKA 5DT6A 3TZAA 4DDDA 5ITOA 4G8NA 3MWBA 3ZSFA 4NF4A 1DMBA 1MM6A 3I6VA 3HHFA 1T0KA 1M5CA 3QUFA 3PU5A 2O6AA 3R7XA 5I59B 4OEVA 1JVYA 3V8XB 1MH4A 1GGGA 1DTZA 3FATA 3TAJA 4TOZA 1SW2A 4NF8A 2Y7PA 4GLIA 5B70A 2AIXA 3IL1B 4H65A 3THIA 1IQ7A 1B05A 2AYSA 3DELB 1AL3A 4QSCA 3EF7A 3GBAA 2ALUA 2WOPA 1P1WA 3T66A 3OEKA 2DXRA 2ABHA 2DSFA 3OELA 3W9VA 1LBBA 2F35A 4P11A 1QJMA 2H5YA 1NFTA 3TKDA 5H8FB 2UVJA 4X48A 1BTJA 4PFUA 5F7VA 1NL5A 3FVGA 3C9HA 5TPAA 1RYXA 3TTLA 3IB0A 3EHSA 2OBGA 1PBPA 1US4A 3T9XB 3SEYA 3MW0A 4XKPA 1MXYA 3IO4A 1FTLA 1MS7A 3B6QA 3E9XA 3TTKA 2OZZA 2GRVA 3FJGA 3K0VA 4WKMA 3G7WA 1MY0A 4AB6A 1LAGE 3UIFA 5I59A 5I84A 1A8FA 3SDFA 3FXRA 3TELA 2NUVA 3KFMA 3MQ9A 2DOJA 3T9HB 2PMSA 2HXWA 4YKIA 1A40A 3CSBA 4GQOA 3OEMA 3PPPA 2H98A 4Q30B 1SDXA 2XX7A 1OVTA 2QS4A 1ANFA 2Q2AA 4H8JA 5DVJA 2DE4A 4XTCQ 3MP8A 3IK6B 3PPNA 1N3XA 3PV0E 2Y84A 3SKPA 4ZE8A 1KWHA 4AQ4A 1O64A 5AE4A 5ELVA 3OMBA 3MPLA 3PUYE 1BP5A 3UA8A 2WKYA 4P0IA 1Y20A 2YLNA 3U92A 4POWA 3TTRA 4FAJA 2B4MA 1I6BA 5TU0A 3K6WA 2I4CA 1Z7NE 4RK2A 5KDTB 3RUMA 3TTNA 4FATA 1MH3A 1YPNA 2Z23A 1N3WA 4OHNA 1JW1A 2DE2A 4TLMB 5KCJB 2ZXTA 1MXWA 1QKBA 4NEDA 4OFOA 3U72A 3WAEA 3RLFE 4XKQA 1QW0A 1M5BA 4IY6A 5LOMA 3RY3A 2PT2A 1QUKA 2O7UA 3DRKA 1D9VA 3ZKKA 2NVUB 3MVWA 4GD5A 4KHZE 3K01A 4YMAA 4U21A 4F3PA 2RF1A 1N7WA 3N26A 1MDP1 3K00A 3MPKA 5BUUA 3CFLA 1JVXA 4R9GA 1B4HA 1A8EA 1XVYA 4KYDA 1M5FA 1URGA 3Q26A 3BBRA 3SERA 3FTOA 2HEUA 4NTLA 3QSLA 4JSOA 2FA7A 3P7IA 1L5TA 1S9TA 3RYAA 2THIA 3V83A 4ELOA 1ZBMA 1DSNA 3U8QA 5EYFA 4LQ5A 1DPPA 2D5WA 1JNFA 1PEBA 5KDTA 4YKJA 1NH8A 4E0WA 4KQPA 1IXCA 1I6QA 3RTWB 4GF8A 3MUQA 2ZYMA 3PMVA 1F9BA 4MBPA 1USYH 5KCJA 4GXAA 2F97A 4RY1A 4YZZA 1S7YA 1B7UA 3CHGA 1ATGA 3QK6A 1M5DA 4R6YA 5I2KB 2A5TB 1PB8A 5I57A 3JV9A 1R1NA 1B5HA 4OYVA 1UIVA 3KGCA 3E3KA 1GVCA 2NWJA 3PUWE 4TQUQ 1MY2A 3ODBA 4ZEFA 3LVUA 1MY3A 3QUJA 4LQ2A 2PYYA 2CMOA 4OMBA 3USDA 3SETA 2CZLA 3O6PA 4IO6A 1YAEA 4U2RA 3GLBA 2X7PA 1Y9UA 3FVNA 3TMGA 4R74A 4DZ1A 5JTYA 4IY5A 2IEEA 3Q29A 3K2DA 5BWJA 2HQ0A 3TCHA 2ZNSA 4PQJA 4YB5A 4BDMA 3V89B 1URSA 1OLAA 3RQTA 4LZ7A 4JXIA 1QVSA 4OQOA 4R73A 2I3VA 5L9SA 1LSTA 5AA3A 1MQDA 3CIJA 1LAHE 4RK9A 4RA1A 1Y3NA 3D4CA 5EHMA 3LSFB 1P1QA 2B3BA 1BIYA 4LUBA 5I2KA 4QFOA 1ZLQA 2Z22A 1MDQA 1SQYA 3EQ1A 4GXSB 1R9LA 1B2HA 3FVKA 1R6ZA 2B4LA 4LP2B 1SW4A 4IB2A 1DOTA 4JWXA 2FYIA 2B65A 3TCGA 1SW5A 2RINA 1B7HA 1LLSA 1Z7ME 2XD3A 4NMYA 2O1MA 2NXOA 3SESA 5CBSA 3N6UA 2I0BA 2F34A 5I58B 1O63A 1JQFA 1GV8A 2QS1A 2F7AA 1JEUA 2Y7RA 2HCAA 2VGQA 1B3HA 2GHAA 1NNPA 3C31A 2UXAA 3Q27A 3LSWA 3CI8A 3N5LA 4HCWA 3TQWA 2QMWA 1XS5A 3UN6A 2HFBA 4M4GA 5IKBA 3PGFA 1HSJA 2DXYA 4EXLA 3G3JA 1QUIA 4KI0E 3VE1B 3CSGA 1FTMA 1SI0A 1LAFE 3S2VA 3PPQA 3G3HA 4GL0A 1AOVA 5DVIA 1US5A 1USYE 3O6HA 3LSXA 4H5GA 2ZYOA 3OSRA 3EN3A 5EHSA 3MAMA 4X9TA 2X26A 1QULA 3H06B 3IB2A 4OFLA 4FORA 3FVOA 3IOWA 4F29A 3L6HA 1R9QA 2RC7A 3BFUA 3ILTB 3IX1A 4BDQA 5I56B 2F5XA 1N7XA 3VLUA 1LCTA 5CRYA 4JBZA 4YB7A 3M8UA 1OMPA 3DRIA 3A3UA 5I58A 1B4ZA 3MZ1A 3TCFA 4C1TA 4I62A 1B6HA 1POY1 1H76A 4IO3A 3G3IA 1Y3QA 1FW0A 2HAUA 3T22A 3H03A 2V3UA 2UVHA 1SW1A 4GWOA 1IXGA 2I4BA 1VE4A 3DRGA 3OSQA 3OOAA 4N13A 2Y7WA 2F6GA 1VSOA 3S9LC 3S9NC 3LUYA 2GHBA 1Y4CA 3IAZA 3OO8A 2F78A 1B0HA 3H3GA 3KN7A 1B46A 4MH5A 3DP8A 2ONSA 2I3WA 4EUOA 4IGRA 2RKMA 2R6GE 2XXWA 4WEPA 2AL5A 4H8IA 3CVGA 4DIGA 2XXIA 3T96B 1HSEA 2M8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH7 A;  1H44 A;  3KJT A;  2H25 A;  4Q8R A;  1WVJ A;  1SI1 A;  3VVD A;  1SYH A;  3B6W A;  5H8F A;  1UQW A;  3GBB A;  4ESX A;  3S9M C;  4EF2 A;  1IXI A;  3MZB A;  3RT6 B;  2DWI A;  2ZYK A;  4KYS A;  5CMK A;  4YKK A;  2DP8 A;  1FQA A;  2B3F A;  4MLQ A;  4IGT A;  4EDP A;  1POT A;  5I56 A;  4RJZ A;  1UTH B;  3VXB A;  2QPQ A;  1LCF A;  2XX8 A;  2RC8 A;  1A55 A;  4O3B A;  2Q9T A;  4C1U A;  2I0C A;  4F1Y A;  5HBC A;  2Z8F A;  3K6X A;  5M2V A;  1D3K A;  3VV5 A;  1D4N A;  4EQB A;  3QYT A;  4XKN A;  2H4I A;  2AL4 A;  2OWS A;  3LSL A;  4EXK A;  2XXP A;  3N6T A;  1NMU A;  1SVX B;  4ELR A;  3HV1 A;  4Q0C A;  4P0G A;  4MLV A;  4C0R A;  4WED A;  1ELJ A;  1A54 A;  4OWD A;  3FGS A;  2E0S A;  2XD2 A;  2QS3 A;  3FZV A;  1QKA A;  2XXR A;  1VR5 A;  2LAO A;  4QF9 A;  3UP9 A;  1XOC A;  2G93 A;  1FTO A;  3ILU B;  1VFD A;  1IIT A;  2PT1 A;  1P99 A;  2X7Q A;  3A09 A;  3FV2 A;  1FTJ A;  4X1D A;  1NKX A;  3K6U A;  2RCA A;  1LFI A;  2GH9 A;  4OZ9 A;  4O3A A;  3PUV E;  5FHN A;  2DVZ A;  3I3V A;  3F11 A;  4U22 A;  1IEJ A;  2O69 A;  5DTB A;  1ZKB A;  5CBR A;  5DYH A;  2VOZ A;  3LR1 A;  4F2O A;  1B3E A;  5HM4 B;  4OEN A;  1UTH A;  4GL8 A;  4NF5 B;  4OER A;  4F18 A;  5ICQ A;  4BDN A;  4K3F A;  4R9F A;  4NE4 A;  3CFZ A;  2DWJ A;  3S4U A;  1N76 A;  1MXV A;  3R6U A;  4R2F A;  4I8C A;  3VLW A;  3RNN A;  4QHQ A;  1B1X A;  1H43 A;  4ZEC A;  1Y1Z A;  3LBS A;  3TQL A;  3V5A A;  4R6K A;  3BKI B;  3HN0 A;  5K2X A;  3CG1 A;  1LB9 A;  1DPE A;  2G29 A;  1JW4 A;  5J1D A;  4ELQ A;  3HO7 A;  3FD3 A;  4EQ9 A;  2VP1 A;  4OVJ A;  1MQJ A;  1TT1 A;  2PBW A;  4X1B A;  4F1U A;  2UVI A;  5FTH A;  1MY4 A;  1B3G A;  1FQF A;  4JSD A;  1EU8 A;  3O66 A;  3FJM A;  3QXM A;  3K4U A;  4QFL A;  3GZG A;  1YTV A;  1B3L A;  4PP0 A;  5AA2 D;  3G3F A;  1FTK A;  1Q35 A;  1TFA A;  4QFN A;  4QSE A;  3IB1 A;  5AA2 B;  1GR2 A;  3B7D A;  3OO6 A;  5CMC A;  4WXJ A;  1PB9 A;  2O51 A;  2DYX A;  2DQV A;  1OQG A;  3TEP A;  4JDF A;  4NF5 A;  4G2Z A;  5CMB A;  3MVZ A;  3DRF A;  1IXH A;  5HPQ A;  1B9J A;  4ELP A;  2XXY A;  4HS7 A;  4Z7E A;  1RYO A;  5K2Y A;  3CR9 A;  3PMW A;  1B40 A;  4Z0I A;  3ZS6 A;  4R75 A;  4YIC A;  2ZNU A;  4HCY A;  3U93 A;  3RYB A;  2QSX A;  1WOD A;  3VLV A;  4ESW A;  3H6W A;  2ZYN A;  3H6T A;  1M5E A;  5FHO A;  5AA1 A;  4RPO A;  2XXQ A;  3MZ9 A;  4KFQ A;  4FE8 A;  3U1O A;  2A5T A;  3LC8 A;  4BDO A;  2IA4 A;  3K1M A;  3RT8 A;  1AH5 A;  2F6P A;  2DWA A;  3KOS A;  5A5X B;  3C36 A;  2ANJ A;  3M3K A;  3TDJ A;  4GRK A;  3DP4 A;  3EPE A;  4PFW A;  4H5F A;  2XXX A;  4OET A;  4M1V A;  4F39 A;  3T9V A;  1P1N A;  4G68 B;  1PB7 A;  1B32 A;  5F1Q A;  1RKM A;  2P0S A;  4LVQ A;  3CRB A;  2I48 A;  2HAV A;  1JEV A;  1MQI A;  5AA4 B;  4L17 A;  2V93 A;  4ZEK A;  1PBQ A;  4I9D A;  5AA2 A;  1ZJL A;  3I5O A;  4O3C A;  4YKP A;  4ECF A;  2WOK A;  3K6V A;  1B1H A;  4ND9 A;  3O29 A;  3IR1 A;  3MP1 A;  1MY1 A;  2XXH A;  3H7M A;  4XIG Q;  2REG A;  1IZ1 A;  3IOT A;  1II5 A;  3K02 A;  1YCJ A;  4ISU A;  2RCB A;  3T93 B;  5L9O A;  4F3B A;  2Y7I A;  4MF3 A;  4QFP A;  3MVY A;  5ICT A;  3DRJ A;  1PDA A;  4G8H A;  3RN8 A;  1MXZ A;  2D3I A;  3UK4 A;  4G8M A;  2Q89 A;  4UA8 A;  1N04 A;  2RC9 A;  3SEW A;  4OXV A;  5CM6 A;  3IO6 A;  3VVE A;  3R26 A;  4DXU A;  2O1L A;  1B3F A;  3MVX A;  2I58 A;  2ESN A;  1H3D A;  3Q25 A;  4PET A;  5A5X A;  3TUS A;  4YB6 A;  4IO7 A;  2H99 A;  5TP9 B;  1SBP A;  2DVC A;  4FEB A;  4KCC A;  4QRZ A;  1LAX A;  4LA9 A;  4U1O A;  4KR5 A;  4F3G A;  1ZIU A;  2PX1 A;  4U23 A;  1JET A;  3UGW A;  4G68 A;  2F7B A;  2P1S A;  3C32 A;  2DWH A;  2FNC A;  2UVG A;  4H67 A;  3TYH A;  2XXV A;  3RTF B;  1OQH A;  2W7Y A;  1OLC A;  1EH3 A;  5AA4 A;  1MG1 A;  3W9W A;  4NWD A;  3AXF A;  1UTB B;  3S9E A;  3K1N A;  2R9J A;  4R72 A;  1O7T A;  3Q28 A;  4GOT A;  1LGB C;  2UYF A;  4RYA A;  3M3L A;  5JK4 A;  4PFY A;  4F1V A;  1TWY A;  5DEX B;  3O6I A;  2VD3 A;  4HTG A;  3O97 A;  4LZ8 A;  3ECR A;  1LFH A;  1JW5 A;  3H6V A;  4F31 B;  1VFE A;  1Y3P A;  2I6E A;  2Q8J A;  1IIW A;  3TOD A;  3C34 A;  2ZMB A;  2VHA A;  3VFJ A;  3G3K A;  4LZ5 A;  5I2N B;  3FV1 A;  4YMB A;  2XXU A;  3OO9 A;  1B51 A;  1NNT A;  4EF1 A;  3C33 A;  1AMF A;  4LAT A;  4XKR A;  4DXB A;  3D4G A;  2O84 X;  1B52 A;  1MRP A;  1B0L A;  3O9P A;  1P1O A;  2XXT A;  4POX A;  1EZO A;  1URD A;  5TP9 A;  2XX9 A;  3O6G A;  1MPD A;  1TFD A;  2O7I A;  3BFT A;  3OD7 A;  4ZDM A;  5L9M A;  4PE5 B;  1FQB A;  4H6D A;  3W15 C;  2R71 A;  1QUJ A;  3PUZ E;  2OLB A;  4FIM A;  1MXU A;  5H8N B;  4AB5 A;  2OWT A;  5FTI A;  1TXF A;  2Q2C A;  1MQG A;  3KN3 A;  2H9B A;  1ZMG A;  3L6G A;  4ZZA A;  1UTB A;  2V3T A;  1B58 A;  3VXC A;  3DP6 A;  3IOR A;  3SEX A;  4ZEB A;  3TTM A;  4FEC A;  3OO7 A;  5CC2 A;  1FQE A;  3IOV A;  5H8Q B;  2HZK A;  3HCQ A;  3QAX A;  3FJ7 A;  3TPA A;  4U4X A;  4DE8 A;  3SEU A;  1MQH A;  3JYR A;  1XVX A;  1CE2 A;  5DEX A;  3KN8 A;  2Y7K A;  1N84 A;  3KSX A;  4RPN A;  1A7L A;  2GFE A;  3OXN A;  3FUZ A;  4KD5 A;  1PC3 A;  1XHY A;  3ONM A;  3C35 A;  4E0X A;  1MPB A;  1EZ9 A;  3OEN A;  3CG3 A;  1P1U A;  3FIR A;  3B6T A;  2F36 A;  4UAC A;  1B5J A;  2DS9 A;  3VVF A;  3UOR A;  5I57 B;  3MJN A;  4G77 A;  5I2N A;  2OJT A;  4GVO A;  2XHD A;  1D9Y A;  1S50 A;  2YJP A;  2QMX A;  3IOU A;  4H0W A;  3KZG A;  5CMM A;  1DTG A;  3HST A;  3VDF A;  2REJ A;  2V84 A;  3KBR A;  4PFT A;  4OEU A;  3CFX A;  3EHU A;  2DE3 A;  3KOT A;  4KPT A;  4FED A;  3KEI A;  3IJO B;  3ZKL A;  2WOL A;  2F7C A;  1OVB A;  5H8H B;  3SEV A;  1LB8 A;  4IO5 A;  3WAF A;  2QJE A;  1MXX A;  5H8N A;  3QIM A;  1Q1K A;  4DLD A;  3JZJ A;  5JTY B;  2KLF A;  4DXC A;  2F8D A;  4ONY A;  1B5I A;  5ISU A;  2Q88 A;  1J1N A;  4R2B A;  1I6A A;  4ZEI A;  4F2Q A;  4NF6 B;  4GIZ A;  4U4S A;  3DRH A;  5H8Q A;  4LON B;  3E4R A;  2P2A A;  5JEI A;  2D21 A;  4G68 C;  3MP6 A;  4EQ7 A;  1ZU0 A;  3PAM A;  5FHM A;  1Y1M A;  2UYE A;  2V3Q A;  4OFJ A;  3PPO A;  1Y4T A;  2VD2 A;  4RNS A;  1ZTY A;  4RXL A;  4QFK A;  1LBC A;  5H8S A;  1HSL A;  4YAH X;  3KSJ A;  4Q5T A;  2BJJ X;  3KG2 A;  4THI A;  2HZL A;  4IO4 A;  1EZP A;  4IO2 A;  2Z8D A;  2ONK E;  1B7Z A;  4FJP A;  3K1P A;  4DCY A;  1CB6 A;  4YU0 A;  4JWO A;  4N6P A;  4ZED A;  4F19 A;  1BLF A;  4MFI A;  1XT8 A;  1FQD A;  1A99 A;  1GTK A;  3H6U A;  2A5S A;  4OTE A;  5IAI A;  5H8H A;  4KCD A;  3N94 A;  3IJX B;  4JWY A;  5L8D A;  5B7D A;  2QRY A;  3KJ7 A;  2YPN A;  3PD8 A;  4NF4 B;  4ZE9 A;  3RGY A;  3C4M A;  4I1D A;  3FXQ A;  5CI5 A;  4F3S A;  5ITP A;  4H1X A;  1LFG A;  5KZT A;  4NF6 A;  3T9U A;  3MC2 A;  2QS2 A;  1UIU A;  4NF8 B;  1FQC A;  3MBP A;  3TFL A;  2OCU A;  2ONR A;  2O68 A;  4BDR A;  5DVF A;  3M3F A;  2E1S A;  4N07 A;  3U94 A;  1BKA A;  2V25 A;  1FCK A;  4NWC A;  3G3G A;  1AIV A;  4BDL A;  4OES A;  2ZNT A;  1NNF A;  4ZZE A;  1MM7 A;  3FXU A;  4JB7 A;  3EHT A;  4BLA A;  1I69 A;  1IUD A;  3HHG A;  4HW8 A;  4F22 A;  1MPC A;  1N0T A;  1XC1 A;  1SD3 A;  2I49 A;  3O28 A;  4R6H A;  1OIB A;  3PPR A;  4XXU A;  3DLN A;  3PMX A;  1WDN A;  4KYE A;  1H45 A;  3DM0 A;  3A3C A;  2PVU A;  2NOO A;  4GFR A;  3PD9 A;  5TPA B;  2OK2 A;  3O2A A;  4U1Z A;  4G4P A;  4ZS9 A;  3RPW A;  2Z8E A;  4QSD A;  3GXA A;  2QL3 A;  3FAS A;  3E13 X;  1SYI A;  4TLL B;  3PUX E;  3H4Z A;  4DCX A;  3HPI A;  1NNK A;  5DT6 A;  3TZA A;  4DDD A;  5ITO A;  4G8N A;  3MWB A;  3ZSF A;  4NF4 A;  1DMB A;  1MM6 A;  3I6V A;  3HHF A;  1T0K A;  1M5C A;  3QUF A;  3PU5 A;  2O6A A;  3R7X A;  5I59 B;  4OEV A;  1JVY A;  3V8X B;  1MH4 A;  1GGG A;  1DTZ A;  3FAT A;  3TAJ A;  4TOZ A;  1SW2 A;  4NF8 A;  2Y7P A;  4GLI A;  5B70 A;  2AIX A;  3IL1 B;  4H65 A;  3THI A;  1IQ7 A;  1B05 A;  2AYS A;  3DEL B;  1AL3 A;  4QSC A;  3EF7 A;  3GBA A;  2ALU A;  2WOP A;  1P1W A;  3T66 A;  3OEK A;  2DXR A;  2ABH A;  2DSF A;  3OEL A;  3W9V A;  1LBB A;  2F35 A;  4P11 A;  1QJM A;  2H5Y A;  1NFT A;  3TKD A;  5H8F B;  2UVJ A;  4X48 A;  1BTJ A;  4PFU A;  5F7V A;  1NL5 A;  3FVG A;  3C9H A;  5TPA A;  1RYX A;  3TTL A;  3IB0 A;  3EHS A;  2OBG A;  1PBP A;  1US4 A;  3T9X B;  3SEY A;  3MW0 A;  4XKP A;  1MXY A;  3IO4 A;  1FTL A;  1MS7 A;  3B6Q A;  3E9X A;  3TTK A;  2OZZ A;  2GRV A;  3FJG A;  3K0V A;  4WKM A;  3G7W A;  1MY0 A;  4AB6 A;  1LAG E;  3UIF A;  5I59 A;  5I84 A;  1A8F A;  3SDF A;  3FXR A;  3TEL A;  2NUV A;  3KFM A;  3MQ9 A;  2DOJ A;  3T9H B;  2PMS A;  2HXW A;  4YKI A;  1A40 A;  3CSB A;  4GQO A;  3OEM A;  3PPP A;  2H98 A;  4Q30 B;  1SDX A;  2XX7 A;  1OVT A;  2QS4 A;  1ANF A;  2Q2A A;  4H8J A;  5DVJ A;  2DE4 A;  4XTC Q;  3MP8 A;  3IK6 B;  3PPN A;  1N3X A;  3PV0 E;  2Y84 A;  3SKP A;  4ZE8 A;  1KWH A;  4AQ4 A;  1O64 A;  5AE4 A;  5ELV A;  3OMB A;  3MPL A;  3PUY E;  1BP5 A;  3UA8 A;  2WKY A;  4P0I A;  1Y20 A;  2YLN A;  3U92 A;  4POW A;  3TTR A;  4FAJ A;  2B4M A;  1I6B A;  5TU0 A;  3K6W A;  2I4C A;  1Z7N E;  4RK2 A;  5KDT B;  3RUM A;  3TTN A;  4FAT A;  1MH3 A;  1YPN A;  2Z23 A;  1N3W A;  4OHN A;  1JW1 A;  2DE2 A;  4TLM B;  5KCJ B;  2ZXT A;  1MXW A;  1QKB A;  4NED A;  4OFO A;  3U72 A;  3WAE A;  3RLF E;  4XKQ A;  1QW0 A;  1M5B A;  4IY6 A;  5LOM A;  3RY3 A;  2PT2 A;  1QUK A;  2O7U A;  3DRK A;  1D9V A;  3ZKK A;  2NVU B;  3MVW A;  4GD5 A;  4KHZ E;  3K01 A;  4YMA A;  4U21 A;  4F3P A;  2RF1 A;  1N7W A;  3N26 A;  1MDP 1;  3K00 A;  3MPK A;  5BUU A;  3CFL A;  1JVX A;  4R9G A;  1B4H A;  1A8E A;  1XVY A;  4KYD A;  1M5F A;  1URG A;  3Q26 A;  3BBR A;  3SER A;  3FTO A;  2HEU A;  4NTL A;  3QSL A;  4JSO A;  2FA7 A;  3P7I A;  1L5T A;  1S9T A;  3RYA A;  2THI A;  3V83 A;  4ELO A;  1ZBM A;  1DSN A;  3U8Q A;  5EYF A;  4LQ5 A;  1DPP A;  2D5W A;  1JNF A;  1PEB A;  5KDT A;  4YKJ A;  1NH8 A;  4E0W A;  4KQP A;  1IXC A;  1I6Q A;  3RTW B;  4GF8 A;  3MUQ A;  2ZYM A;  3PMV A;  1F9B A;  4MBP A;  1USY H;  5KCJ A;  4GXA A;  2F97 A;  4RY1 A;  4YZZ A;  1S7Y A;  1B7U A;  3CHG A;  1ATG A;  3QK6 A;  1M5D A;  4R6Y A;  5I2K B;  2A5T B;  1PB8 A;  5I57 A;  3JV9 A;  1R1N A;  1B5H A;  4OYV A;  1UIV A;  3KGC A;  3E3K A;  1GVC A;  2NWJ A;  3PUW E;  4TQU Q;  1MY2 A;  3ODB A;  4ZEF A;  3LVU A;  1MY3 A;  3QUJ A;  4LQ2 A;  2PYY A;  2CMO A;  4OMB A;  3USD A;  3SET A;  2CZL A;  3O6P A;  4IO6 A;  1YAE A;  4U2R A;  3GLB A;  2X7P A;  1Y9U A;  3FVN A;  3TMG A;  4R74 A;  4DZ1 A;  5JTY A;  4IY5 A;  2IEE A;  3Q29 A;  3K2D A;  5BWJ A;  2HQ0 A;  3TCH A;  2ZNS A;  4PQJ A;  4YB5 A;  4BDM A;  3V89 B;  1URS A;  1OLA A;  3RQT A;  4LZ7 A;  4JXI A;  1QVS A;  4OQO A;  4R73 A;  2I3V A;  5L9S A;  1LST A;  5AA3 A;  1MQD A;  3CIJ A;  1LAH E;  4RK9 A;  4RA1 A;  1Y3N A;  3D4C A;  5EHM A;  3LSF B;  1P1Q A;  2B3B A;  1BIY A;  4LUB A;  5I2K A;  4QFO A;  1ZLQ A;  2Z22 A;  1MDQ A;  1SQY A;  3EQ1 A;  4GXS B;  1R9L A;  1B2H A;  3FVK A;  1R6Z A;  2B4L A;  4LP2 B;  1SW4 A;  4IB2 A;  1DOT A;  4JWX A;  2FYI A;  2B65 A;  3TCG A;  1SW5 A;  2RIN A;  1B7H A;  1LLS A;  1Z7M E;  2XD3 A;  4NMY A;  2O1M A;  2NXO A;  3SES A;  5CBS A;  3N6U A;  2I0B A;  2F34 A;  5I58 B;  1O63 A;  1JQF A;  1GV8 A;  2QS1 A;  2F7A A;  1JEU A;  2Y7R A;  2HCA A;  2VGQ A;  1B3H A;  2GHA A;  1NNP A;  3C31 A;  2UXA A;  3Q27 A;  3LSW A;  3CI8 A;  3N5L A;  4HCW A;  3TQW A;  2QMW A;  1XS5 A;  3UN6 A;  2HFB A;  4M4G A;  5IKB A;  3PGF A;  1HSJ A;  2DXY A;  4EXL A;  3G3J A;  1QUI A;  4KI0 E;  3VE1 B;  3CSG A;  1FTM A;  1SI0 A;  1LAF E;  3S2V A;  3PPQ A;  3G3H A;  4GL0 A;  1AOV A;  5DVI A;  1US5 A;  1USY E;  3O6H A;  3LSX A;  4H5G A;  2ZYO A;  3OSR A;  3EN3 A;  5EHS A;  3MAM A;  4X9T A;  2X26 A;  1QUL A;  3H06 B;  3IB2 A;  4OFL A;  4FOR A;  3FVO A;  3IOW A;  4F29 A;  3L6H A;  1R9Q A;  2RC7 A;  3BFU A;  3ILT B;  3IX1 A;  4BDQ A;  5I56 B;  2F5X A;  1N7X A;  3VLU A;  1LCT A;  5CRY A;  4JBZ A;  4YB7 A;  3M8U A;  1OMP A;  3DRI A;  3A3U A;  5I58 A;  1B4Z A;  3MZ1 A;  3TCF A;  4C1T A;  4I62 A;  1B6H A;  1POY 1;  1H76 A;  4IO3 A;  3G3I A;  1Y3Q A;  1FW0 A;  2HAU A;  3T22 A;  3H03 A;  2V3U A;  2UVH A;  1SW1 A;  4GWO A;  1IXG A;  2I4B A;  1VE4 A;  3DRG A;  3OSQ A;  3OOA A;  4N13 A;  2Y7W A;  2F6G A;  1VSO A;  3S9L C;  3S9N C;  3LUY A;  2GHB A;  1Y4C A;  3IAZ A;  3OO8 A;  2F78 A;  1B0H A;  3H3G A;  3KN7 A;  1B46 A;  4MH5 A;  3DP8 A;  2ONS A;  2I3W A;  4EUO A;  4IGR A;  2RKM A;  2R6G E;  2XXW A;  4WEP A;  2AL5 A;  4H8I A;  3CVG A;  4DIG A;  2XXI A;  3T96 B;  1HSE A;  2M8C A; 
#chains in the Genus database with same CATH topology
 1NH7 A;  1H44 A;  3KJT A;  2H25 A;  4Q8R A;  1WVJ A;  1SI1 A;  2CEX A;  3VVD A;  1SYH A;  3B6W A;  5H8F A;  1UQW A;  3GBB A;  4ESX A;  3S9M C;  4EF2 A;  1IXI A;  1FPI A;  2XWO A;  3LV0 A;  3MZB A;  3RT6 B;  2DWI A;  2ZYK A;  4KYS A;  5CMK A;  4YKK A;  1CNQ A;  2DP8 A;  1FQA A;  5EQ8 A;  2B3F A;  4MLQ A;  4IGT A;  4EDP A;  5A5L A;  1POT A;  5I56 A;  4RJZ A;  1UTH B;  3BIH A;  3VXB A;  2QPQ A;  1LCF A;  2V4C A;  2XX8 A;  2RC8 A;  1A55 A;  4HE0 A;  4O3B A;  2Q9T A;  4C1U A;  4NAP A;  2I0C A;  4HE1 A;  4F1Y A;  5HBC A;  2Z8F A;  3K6X A;  4P47 A;  5M2V A;  4MJO A;  2VT5 A;  1D3K A;  3VV5 A;  1D4N A;  4EQB A;  3QYT A;  1NUY A;  4XKN A;  2H4I A;  2AL4 A;  2OWS A;  3LSL A;  4EXK A;  2XXP A;  3N6T A;  4I3E A;  1NMU A;  1SVX B;  4ELR A;  2R8T A;  3HV1 A;  4Q0C A;  4P0G A;  4GBV A;  4MLV A;  4C0R A;  1NV4 A;  4WED A;  1ELJ A;  1G0H A;  1A54 A;  4P56 A;  4OWD A;  3FGS A;  4GWX A;  2E0S A;  2XD2 A;  2QS3 A;  3FZV A;  1QKA A;  2XXR A;  1VR5 A;  4X8R A;  2LAO A;  4QF9 A;  3UP9 A;  1XOC A;  2G93 A;  1FTO A;  3ILU B;  1VFD A;  1FPL A;  1IIT A;  2PT1 A;  1P99 A;  2X7Q A;  3A09 A;  3FV2 A;  3E78 A;  3RPL B;  1FTJ A;  4X1D A;  1FJ6 A;  1NKX A;  3K6U A;  2RCA A;  1LFI A;  2GH9 A;  4OZ9 A;  4IR8 A;  4O3A A;  2PFY A;  3PUV E;  5FHN A;  2DVZ A;  3I3V A;  3F11 A;  1LBV A;  4U22 A;  1IEJ A;  2O69 A;  5DTB A;  1ZKB A;  5CBR A;  5DYH A;  2VOZ A;  3LR1 A;  4F2O A;  1B3E A;  5HM4 B;  4OEN A;  1UTH A;  2OX3 A;  3QMF A;  4GL8 A;  1FBF A;  4NF5 B;  4OER A;  4F18 A;  5ICQ A;  1FJ9 A;  1INP A;  4BDN A;  4K3F A;  2DDK A;  4R9F A;  4NE4 A;  3CFZ A;  2DWJ A;  3S4U A;  1N76 A;  1MXV A;  3R6U A;  4R2F A;  4I8C A;  3VLW A;  3RNN A;  4QHQ A;  1B1X A;  5F24 A;  1H43 A;  1Q9D A;  4ZEC A;  1Y1Z A;  3LBS A;  3TQL A;  3V5A A;  4PAK A;  4R6K A;  3BKI B;  1NV2 A;  3HN0 A;  5K2X A;  3CG1 A;  1LB9 A;  1DPE A;  2G29 A;  1JW4 A;  5J1D A;  4ELQ A;  3HO7 A;  3FD3 A;  4EQ9 A;  2VP1 A;  4OVJ A;  4HXV A;  1MQJ A;  1TT1 A;  2PBW A;  4X1B A;  4F1U A;  2UVI A;  5FTH A;  1K9Y A;  1MY4 A;  1B3G A;  1FQF A;  3T1B A;  4JSD A;  1LBX A;  1EU8 A;  3O66 A;  5IM2 A;  4XF5 A;  3FJM A;  3QXM A;  3K4U A;  4NN3 A;  4QFL A;  2FHY A;  3GZG A;  1YTV A;  1B3L A;  4PP0 A;  5AA2 D;  3G3F A;  4N15 A;  1FTK A;  1Q35 A;  1TFA A;  4QFN A;  4QSE A;  3IB1 A;  5AA2 B;  1GR2 A;  3B7D A;  5ET5 A;  3OO6 A;  5CMC A;  4WXJ A;  1PB9 A;  2O51 A;  2DYX A;  2DQV A;  1OQG A;  4I3Y A;  3TEP A;  4JDF A;  4NF5 A;  1FPD A;  4G2Z A;  1NV7 A;  5CMB A;  3MVZ A;  3DRF A;  1IXH A;  5HPQ A;  4MNI A;  1B9J A;  4ELP A;  3D1R A;  2XXY A;  4HS7 A;  4Z7E A;  1RYO A;  5K2Y A;  3CR9 A;  3PMW A;  1B40 A;  4Z0I A;  3ZS6 A;  2XWK A;  4R75 A;  4YIC A;  2ZNU A;  1D9Q A;  4HCY A;  3U93 A;  3RYB A;  2QSX A;  1WOD A;  3VLV A;  4ESW A;  3H6W A;  2ZYN A;  3H6T A;  1M5E A;  5FHO A;  1KA0 A;  3A29 A;  5AA1 A;  4RPO A;  5ET8 A;  2XXQ A;  3MZ9 A;  4KFQ A;  4FE8 A;  4OVS A;  3U1O A;  2A5T A;  3LC8 A;  2FBP A;  4BDO A;  2IA4 A;  3K1M A;  3RT8 A;  1AH5 A;  2F6P A;  2DWA A;  3KOS A;  5A5X B;  3C36 A;  4PFR A;  2ANJ A;  3M3K A;  3TDJ A;  4MNP A;  4GRK A;  4PF8 A;  3DP4 A;  3EPE A;  4PFW A;  4H5F A;  2XXX A;  4OET A;  4M1V A;  4F39 A;  3T9V A;  2XWV A;  1P1N A;  4G68 B;  1PB7 A;  1B32 A;  5F1Q A;  1FBH A;  1RKM A;  2P0S A;  4LVQ A;  3CRB A;  1LBW A;  4PF6 A;  2I48 A;  2HAV A;  1JEV A;  1MQI A;  2QVR A;  5AA4 B;  4L17 A;  2V93 A;  4ZEK A;  1FPE A;  1PBQ A;  4I9D A;  3GYY A;  5AA2 A;  1ZJL A;  3I5O A;  4O3C A;  1QGX A;  4YKP A;  4ECF A;  2WOK A;  1RDX A;  3K6V A;  1B1H A;  4ND9 A;  3O29 A;  3IR1 A;  3MP1 A;  4X04 A;  1MY1 A;  2XXH A;  3H7M A;  5IGA A;  4XIG Q;  2REG A;  1IZ1 A;  3IOT A;  4MAG A;  2Q8M A;  1II5 A;  3K02 A;  1YCJ A;  4ISU A;  2RCB A;  3T93 B;  5L9O A;  4JVI A;  4F3B A;  2Y7I A;  4MF3 A;  1DK4 A;  4QFP A;  3MVY A;  5ICT A;  3DRJ A;  1PDA A;  4G8H A;  3RN8 A;  1MXZ A;  2D3I A;  3UK4 A;  4G8M A;  2Q89 A;  4UA8 A;  1FPJ A;  1N04 A;  2RC9 A;  3SEW A;  4OXV A;  5CM6 A;  3IO6 A;  3VVE A;  3R26 A;  4DXU A;  4NHB A;  2O1L A;  4LN5 A;  1B3F A;  3MVX A;  2I58 A;  2ESN A;  3KC0 A;  1H3D A;  3Q25 A;  4PET A;  5A5X A;  3TUS A;  4YB6 A;  4IO7 A;  2H99 A;  5TP9 B;  1SBP A;  2DVC A;  4FEB A;  4KCC A;  4QRZ A;  1LAX A;  4LA9 A;  5EQ9 A;  4U1O A;  4KR5 A;  5I5P A;  4F3G A;  1ZIU A;  2PX1 A;  3B50 A;  4U23 A;  1JET A;  3UGW A;  4G68 A;  2F7B A;  2P1S A;  3C32 A;  2DWH A;  2FNC A;  2UVG A;  4H67 A;  3TYH A;  2XXV A;  3RTF B;  1OQH A;  2W7Y A;  1OLC A;  1EH3 A;  5AA4 A;  1MG1 A;  2FVZ A;  3W9W A;  4NWD A;  3AXF A;  1UTB B;  3S9E A;  3K1N A;  4NF0 A;  2R9J A;  2XXK A;  4PFI A;  4R72 A;  1O7T A;  3MYU A;  3Q28 A;  4GOT A;  1LGB C;  4HE2 A;  2UYF A;  4PBH A;  4OVT A;  4RYA A;  3M3L A;  5JK4 A;  3RYD A;  4PFY A;  4F1V A;  1TWY A;  5DEX B;  3O6I A;  2VD3 A;  3LUZ A;  1NI9 A;  3O97 A;  4HTG A;  3ECR A;  4LZ8 A;  1LFH A;  1JW5 A;  3ROJ A;  3H6V A;  4PE3 A;  2ZZW A;  4F31 B;  3E79 A;  1VFE A;  1Y3P A;  2I6E A;  2Q8J A;  4AS5 A;  1IIW A;  4P1E A;  3TOD A;  3C34 A;  2ZMB A;  2VHA A;  3VFJ A;  3G3K A;  4LZ5 A;  5I2N B;  3FV1 A;  4YMB A;  2XXU A;  2Y5K A;  3OO9 A;  1B51 A;  1NNT A;  4EF1 A;  3C33 A;  1AMF A;  4LAT A;  4XKR A;  4DXB A;  3D4G A;  2O84 X;  1B52 A;  1MRP A;  1B0L A;  3O9P A;  1P1O A;  2XXT A;  4POX A;  1EZO A;  1URD A;  5TP9 A;  2XX9 A;  3NOH A;  3O6G A;  1MPD A;  1TFD A;  2O7I A;  3BFT A;  3OD7 A;  4ZDM A;  5L9M A;  4PE5 B;  1FQB A;  4H6D A;  2GQ1 A;  3W15 C;  4PAI A;  2R71 A;  1QUJ A;  4MHF A;  3PUZ E;  2OLB A;  4FIM A;  1MXU A;  5H8N B;  4AB5 A;  2OWT A;  5FTI A;  1TXF A;  2CZI A;  2Q2C A;  1MQG A;  5IZZ A;  3KN3 A;  4KXP A;  2H9B A;  1YXI A;  1ZMG A;  3L6G A;  4GWS A;  4ZZA A;  1UTB A;  2V3T A;  1B58 A;  3VXC A;  3DP6 A;  3IOR A;  1FBG A;  3SEX A;  1EYJ A;  4ZEB A;  3TTM A;  4FEC A;  3OO7 A;  5CC2 A;  1FQE A;  2F3D A;  3IOV A;  5H8Q B;  1AWB A;  3FXB A;  2HZK A;  3HCQ A;  3QAX A;  1IMC A;  3FJ7 A;  3TPA A;  4U4X A;  4DE8 A;  3SEU A;  1MQH A;  3JYR A;  1XVX A;  1CE2 A;  5DEX A;  3KN8 A;  1FBP A;  2Y7K A;  1N84 A;  3KSX A;  4RPN A;  1A7L A;  4H46 A;  2GFE A;  4G61 A;  3OXN A;  3FUZ A;  4KD5 A;  1PC3 A;  1XHY A;  3ONM A;  3C35 A;  4E0X A;  1MPB A;  1EZ9 A;  1SPI A;  3OEN A;  3CG3 A;  1P1U A;  3FIR A;  3B6T A;  2F36 A;  4UAC A;  1B5J A;  2DS9 A;  1YZ0 A;  3VVF A;  3UOR A;  5I57 B;  1NUZ A;  3MJN A;  4G77 A;  2ZZV A;  5I2N A;  2OJT A;  4GVO A;  2XHD A;  4PGP A;  1D9Y A;  1S50 A;  2YJP A;  2QMX A;  3IOU A;  4H0W A;  1IME A;  3KZG A;  5CMM A;  1DTG A;  3HST A;  3VDF A;  2REJ A;  4OAN A;  2V84 A;  5ET7 A;  3KBR A;  4PFT A;  4OEU A;  3CFX A;  3EHU A;  2DE3 A;  3KOT A;  1NUW A;  2MKZ A;  4KPT A;  4FED A;  3KEI A;  3IJO B;  5EQA A;  3ZKL A;  2WOL A;  2F7C A;  1OVB A;  4OVR A;  5H8H B;  3SEV A;  1LB8 A;  4GWY A;  4IO5 A;  4O8M A;  3WAF A;  4GWZ A;  2QJE A;  1MXX A;  5H8N A;  3QIM A;  1Q1K A;  4DLD A;  3JZJ A;  5JTY B;  2KLF A;  4DXC A;  1FPF A;  4P9K A;  2F8D A;  4ONY A;  1B5I A;  5ISU A;  2Q88 A;  1J1N A;  4R2B A;  2VPN A;  1I6A A;  4ZEI A;  4F2Q A;  4MIJ A;  4NF6 B;  4GIZ A;  4U4S A;  3DRH A;  5H8Q A;  2WX9 A;  4LON B;  3E4R A;  2P2A A;  5JEI A;  2D21 A;  4G68 C;  3MP6 A;  1RDY A;  4EQ7 A;  1ZU0 A;  4PAF A;  3PAM A;  5FHM A;  1Y1M A;  2UYE A;  2V3Q A;  4PBQ A;  4OFJ A;  4O7M A;  3PPO A;  1Y4T A;  2VD2 A;  4RNS A;  1ZTY A;  4RXL A;  2FIX A;  4QFK A;  1LBC A;  5H8S A;  1HSL A;  1G0I A;  4YAH X;  3KSJ A;  4Q5T A;  2BJJ X;  3KG2 A;  4THI A;  2HZL A;  4IO4 A;  1EZP A;  4GBW A;  4IO2 A;  2Z8D A;  2WBD A;  2ONK E;  1B7Z A;  3RPL A;  4FJP A;  3K1P A;  4DCY A;  1CB6 A;  4I40 A;  4YU0 A;  4JWO A;  4N6P A;  1FSA A;  4ZED A;  4F19 A;  1BLF A;  4MFI A;  1XT8 A;  1FQD A;  1A99 A;  1GTK A;  3H6U A;  2A5S A;  4OTE A;  3B8B A;  5IAI A;  5H8H A;  4KCD A;  3N94 A;  3IJX B;  4JWY A;  5L8D A;  5B7D A;  2QRY A;  3KJ7 A;  2YPN A;  3PD8 A;  4NF4 B;  4ZE9 A;  3RGY A;  3C4M A;  4I1D A;  1RDZ A;  3FXQ A;  5CI5 A;  4F3S A;  5ITP A;  4H1X A;  1LFG A;  5KZT A;  4NF6 A;  3T9U A;  3MC2 A;  2HPG A;  2QS2 A;  1UIU A;  4NF8 B;  1FQC A;  1YYZ A;  3MBP A;  3TFL A;  2OCU A;  2ONR A;  2O68 A;  4MNC A;  4BDR A;  4NX1 A;  5DVF A;  3M3F A;  2E1S A;  4N07 A;  3U94 A;  1BKA A;  2V25 A;  1FCK A;  4NWC A;  4P8B A;  2L5V A;  3G3G A;  1AIV A;  4BDL A;  4OES A;  2ZNT A;  1NNF A;  4ZZE A;  1MM7 A;  3FXU A;  4JB7 A;  3EHT A;  4BLA A;  1I69 A;  1NV6 A;  1IUD A;  3HHG A;  4HW8 A;  4F22 A;  1MPC A;  1N0T A;  1XC1 A;  1SD3 A;  2KR0 A;  2I49 A;  3O28 A;  4R6H A;  1OIB A;  3PPR A;  4N8G A;  4XXU A;  3DLN A;  3PMX A;  1WDN A;  4KYE A;  4N81 A;  1H45 A;  3DM0 A;  3A3C A;  1JP4 A;  2PVU A;  2NOO A;  4GFR A;  3PD9 A;  5TPA B;  2OK2 A;  3O2A A;  4U1Z A;  4G4P A;  4ZS9 A;  3RPW A;  2Z8E A;  4H45 A;  4QSD A;  3GXA A;  2QL3 A;  3FAS A;  3E13 X;  1SYI A;  4TLL B;  3PUX E;  3H4Z A;  1IMF A;  4QBA A;  4DCX A;  3HPI A;  1NNK A;  1XI6 A;  5DT6 A;  3TZA A;  4DDD A;  5ITO A;  4MMP A;  4G8N A;  3MWB A;  3ZSF A;  4NF4 A;  4NGU A;  1DMB A;  3KC1 A;  1MM6 A;  3I6V A;  3HHF A;  1T0K A;  1M5C A;  3QUF A;  3PU5 A;  2O6A A;  3R7X A;  4MEV A;  5I59 B;  4OEV A;  1JVY A;  3V8X B;  1MH4 A;  2FIE A;  1GGG A;  1DTZ A;  3FAT A;  3TAJ A;  4O94 A;  4TOZ A;  1SW2 A;  4NF8 A;  2Y7P A;  4GLI A;  5B70 A;  2AIX A;  3IL1 B;  4H65 A;  1FBC A;  2CEY A;  2WEF A;  3THI A;  1IQ7 A;  1B05 A;  2AYS A;  3DEL B;  1AL3 A;  4QSC A;  2VPO A;  3EF7 A;  3GBA A;  2ALU A;  2WOP A;  1P1W A;  4DI3 D;  3T66 A;  3OEK A;  2DXR A;  2ABH A;  2DSF A;  2XA5 A;  3OEL A;  3W9V A;  1LBB A;  2F35 A;  4P11 A;  1QJM A;  2H5Y A;  1NFT A;  3TKD A;  5H8F B;  4XFE A;  2UVJ A;  4X48 A;  1BTJ A;  4PFU A;  5F7V A;  1NL5 A;  3FVG A;  1NUX A;  3C9H A;  5TPA A;  3HFU A;  3MST A;  1RYX A;  3TTL A;  3IB0 A;  4PGN A;  3EHS A;  2OBG A;  1PBP A;  1US4 A;  3T9X B;  2P3V A;  3SEY A;  3MW0 A;  4XKP A;  1MXY A;  3IO4 A;  5J16 A;  3BIG A;  1FTL A;  1MS7 A;  3B6Q A;  3E9X A;  3TTK A;  2OZZ A;  2GRV A;  3FJG A;  3K0V A;  4WKM A;  3G7W A;  1MY0 A;  2QVU A;  4AB6 A;  1LAG E;  1BK4 A;  5IZ1 A;  4N6D A;  4N8Y A;  3UIF A;  5I59 A;  5I84 A;  1A8F A;  3SDF A;  5EQ7 A;  3FXR A;  3TEL A;  2BJI A;  2NUV A;  3KFM A;  3MQ9 A;  2DOJ A;  1NV5 A;  3T9H B;  2PMS A;  2HXW A;  4JVC A;  4YKI A;  1A40 A;  3CSB A;  4GQO A;  3OEM A;  4GWU A;  3PPP A;  2H98 A;  4Q30 B;  1SDX A;  2XX7 A;  1OVT A;  2QS4 A;  1ANF A;  5LTC A;  2Q2A A;  1EYK A;  4H8J A;  5DVJ A;  1FRP A;  2DE4 A;  4XTC Q;  4JVD A;  3MP8 A;  3IK6 B;  3PPN A;  4OA4 A;  1N3X A;  3PV0 E;  2Y84 A;  3SKP A;  4ZE8 A;  1KWH A;  4AQ4 A;  4MCO A;  1O64 A;  2JJK A;  5AE4 A;  4PTK A;  5ELV A;  3OMB A;  3MPL A;  5LDZ A;  3PUY E;  1BP5 A;  3UA8 A;  2WKY A;  4P0I A;  1Y20 A;  2YLN A;  3U92 A;  4POW A;  4OVQ A;  3TTR A;  4FAJ A;  2B4M A;  1I6B A;  5TU0 A;  3K6W A;  2I4C A;  5ET6 A;  1Z7N E;  4RK2 A;  5KDT B;  3RUM A;  3TTN A;  4FAT A;  4PC9 A;  1MH3 A;  1YPN A;  2Z23 A;  1N3W A;  4OHN A;  1JW1 A;  2DE2 A;  2HXR A;  4TLM B;  5KCJ B;  2ZXT A;  1MXW A;  1QKB A;  4NED A;  4OFO A;  3SZP A;  1FPG A;  3U72 A;  3WAE A;  3RLF E;  3EKI A;  4XKQ A;  1QW0 A;  1M5B A;  4IY6 A;  5IZ3 B;  5T3J A;  5LOM A;  3RY3 A;  2PT2 A;  1QUK A;  2O7U A;  3DRK A;  1D9V A;  3ZKK A;  2NVU B;  3MVW A;  4OVP A;  4GD5 A;  1VDW A;  4KHZ E;  3K01 A;  4YMA A;  4U21 A;  4F3P A;  2RF1 A;  1N7W A;  3N26 A;  1MDP 1;  3K00 A;  3MPK A;  5BUU A;  3CFL A;  1JVX A;  2PCR A;  4R9G A;  1B4H A;  1A8E A;  1XVY A;  4KYD A;  1M5F A;  1URG A;  3Q26 A;  3BBR A;  3SER A;  4O7I A;  3FTO A;  2HEU A;  4NTL A;  3QSL A;  1FBD A;  4JSO A;  2FA7 A;  3P7I A;  1L5T A;  1S9T A;  3RYA A;  2THI A;  2P3N A;  3V83 A;  4ELO A;  1ZBM A;  1DSN A;  3U8Q A;  5EYF A;  4LQ5 A;  1DPP A;  1IMA A;  2D5W A;  2CZH A;  1JNF A;  4PDD A;  1PEB A;  4GWW A;  5KDT A;  4YKJ A;  1NH8 A;  4E0W A;  4KQP A;  1IXC A;  4QXD A;  1I6Q A;  2WYP A;  5I3S A;  3RTW B;  4GF8 A;  3MUQ A;  2ZYM A;  3PMV A;  1F9B A;  5EYH A;  4MBP A;  1USY H;  1IMB A;  4FBP A;  5KCJ A;  4GXA A;  2F97 A;  4PCD A;  4RY1 A;  4YZZ A;  4NG7 A;  1S7Y A;  1B7U A;  3CHG A;  1ATG A;  3QK6 A;  5IZ3 A;  1M5D A;  4R6Y A;  5I2K B;  2A5T B;  1PB8 A;  2KQZ A;  5I57 A;  3JV9 A;  1R1N A;  1B5H A;  4OYV A;  1UIV A;  3T0J A;  1LBZ A;  3U65 A;  3KGC A;  3E3K A;  1GVC A;  2NWJ A;  3PUW E;  4PFB A;  4TQU Q;  1MY2 A;  3ODB A;  4ZEF A;  3LVU A;  1MY3 A;  3QUJ A;  4LQ2 A;  2QFL A;  2PYY A;  2CMO A;  4OMB A;  3USD A;  3SET A;  2CZL A;  1NV3 A;  3O6P A;  4IO6 A;  1YAE A;  4U2R A;  3GLB A;  1FPK A;  2X7P A;  4NQ8 A;  2XWI A;  1DBZ A;  3IFC A;  1Y9U A;  3FVN A;  3TMG A;  4R74 A;  4DZ1 A;  5JTY A;  4IY5 A;  2IEE A;  3Q29 A;  3K2D A;  5BWJ A;  2HQ0 A;  3TCH A;  2PFZ A;  2ZNS A;  4PQJ A;  4YB5 A;  4BDM A;  3V89 B;  5I7I A;  1URS A;  1OLA A;  3RQT A;  4N91 A;  4LZ7 A;  1FPB A;  4JXI A;  1QVS A;  4OQO A;  4R73 A;  2HHM A;  2QVV A;  2F3B A;  2I3V A;  5L9S A;  1LST A;  5AA3 A;  1MQD A;  3CIJ A;  1LAH E;  4RK9 A;  4RA1 A;  1Y3N A;  1LEV A;  3D4C A;  4N6K A;  3PTY A;  4GX3 A;  1NV0 A;  1IMD A;  4DI4 B;  5EHM A;  3LSF B;  1LBY A;  1P1Q A;  4XEQ A;  2B3B A;  4AS4 A;  1BIY A;  5FBP A;  4LUB A;  5I2K A;  4QFO A;  1ZLQ A;  2Z22 A;  1MDQ A;  1SQY A;  4GX4 A;  3ISP A;  3EQ1 A;  4GXS B;  1R9L A;  1B2H A;  3FVK A;  1R6Z A;  2B4L A;  4LP2 B;  1SW4 A;  4IB2 A;  1DOT A;  4JWX A;  2FYI A;  2B65 A;  3TCG A;  1SW5 A;  2RIN A;  1B7H A;  1LLS A;  1Z7M E;  2XD3 A;  4NMY A;  1FTA A;  2O1M A;  2NXO A;  3SES A;  5CBS A;  3N6U A;  5ESY A;  2I0B A;  2F34 A;  2CZK A;  5I58 B;  1O63 A;  1JQF A;  1GV8 A;  4N17 A;  2QS1 A;  2F7A A;  1JEU A;  2Y7R A;  2HCA A;  2VGQ A;  1B3H A;  2GHA A;  1NNP A;  2WBB A;  3C31 A;  2UXA A;  3Q27 A;  3LSW A;  3CI8 A;  3N5L A;  4HCW A;  3TQW A;  2QMW A;  1XS5 A;  1DCU A;  3UN6 A;  2HFB A;  4M4G A;  5IKB A;  3PGF A;  1HSJ A;  2DXY A;  4EXL A;  3G3J A;  1QUI A;  4KI0 E;  4P3L A;  3VE1 B;  3CSG A;  1FTM A;  1SI0 A;  1LAF E;  3S2V A;  3PPQ A;  3G3H A;  4GL0 A;  1AOV A;  5DVI A;  1US5 A;  1K9Z A;  1USY E;  5DW8 A;  3O6H A;  3LSX A;  4H5G A;  4PDH A;  2ZYO A;  3OSR A;  3EN3 A;  5EHS A;  3MAM A;  4X9T A;  2X26 A;  1QUL A;  1NV1 A;  3H06 B;  3IB2 A;  4OFL A;  4FOR A;  3FVO A;  3IOW A;  4F29 A;  3L6H A;  1R9Q A;  1KZ8 A;  2RC7 A;  3BFU A;  3ILT B;  3IX1 A;  4BDQ A;  2Y5L A;  5I56 B;  2F5X A;  1N7X A;  4N4U A;  1EYI A;  2ZZX A;  3VLU A;  1LCT A;  5CRY A;  4JBZ A;  4YB7 A;  3M8U A;  1OMP A;  3DRI A;  3A3U A;  5I58 A;  1B4Z A;  3MZ1 A;  3TCF A;  4C1T A;  4I62 A;  4P1L A;  1B6H A;  1POY 1;  1H76 A;  4IO3 A;  3G3I A;  1Y3Q A;  1FW0 A;  2HAU A;  3T22 A;  3H03 A;  2V3U A;  2UVH A;  1SW1 A;  4GWO A;  1IXG A;  3FBP A;  2I4B A;  1VE4 A;  3DRG A;  3OSQ A;  3OOA A;  1KA1 A;  4N13 A;  2Y7W A;  2F6G A;  1VSO A;  3KBZ A;  3S9L C;  3S9N C;  2Q74 A;  2GHB A;  3LUY A;  1Y4C A;  3IAZ A;  3OO8 A;  2F78 A;  2WYK A;  1B0H A;  3H3G A;  3KN7 A;  1B46 A;  4MH5 A;  3DP8 A;  2ONS A;  2I3W A;  4EUO A;  4IGR A;  4MX6 A;  2RKM A;  2R6G E;  2XXW A;  4GX6 A;  4WEP A;  1FBE A;  2AL5 A;  4H8I A;  5EYG A;  4UAB A;  3CVG A;  2OWZ A;  3IFA A;  4DIG A;  2XXI A;  3T96 B;  1HSE A;  2M8C A; 
#chains in the Genus database with same CATH homology
 1NH7 A;  1H44 A;  3KJT A;  2H25 A;  4Q8R A;  1WVJ A;  1SI1 A;  3VVD A;  1SYH A;  3B6W A;  5H8F A;  1UQW A;  3GBB A;  4ESX A;  3S9M C;  4EF2 A;  1IXI A;  3MZB A;  3RT6 B;  2DWI A;  2ZYK A;  4KYS A;  5CMK A;  4YKK A;  2DP8 A;  1FQA A;  2B3F A;  4MLQ A;  4IGT A;  4EDP A;  1POT A;  5I56 A;  4RJZ A;  1UTH B;  3VXB A;  2QPQ A;  1LCF A;  2XX8 A;  2RC8 A;  1A55 A;  4O3B A;  2Q9T A;  4C1U A;  2I0C A;  4F1Y A;  5HBC A;  2Z8F A;  3K6X A;  5M2V A;  1D3K A;  3VV5 A;  1D4N A;  4EQB A;  3QYT A;  4XKN A;  2H4I A;  2AL4 A;  2OWS A;  3LSL A;  4EXK A;  2XXP A;  3N6T A;  1NMU A;  1SVX B;  4ELR A;  3HV1 A;  4Q0C A;  4P0G A;  4MLV A;  4C0R A;  4WED A;  1ELJ A;  1A54 A;  4OWD A;  3FGS A;  2E0S A;  2XD2 A;  2QS3 A;  3FZV A;  1QKA A;  2XXR A;  1VR5 A;  2LAO A;  4QF9 A;  3UP9 A;  1XOC A;  2G93 A;  1FTO A;  3ILU B;  1VFD A;  1IIT A;  2PT1 A;  1P99 A;  2X7Q A;  3A09 A;  3FV2 A;  1FTJ A;  4X1D A;  1NKX A;  3K6U A;  2RCA A;  1LFI A;  2GH9 A;  4OZ9 A;  4O3A A;  3PUV E;  5FHN A;  2DVZ A;  3I3V A;  3F11 A;  4U22 A;  1IEJ A;  2O69 A;  5DTB A;  1ZKB A;  5CBR A;  5DYH A;  2VOZ A;  3LR1 A;  4F2O A;  1B3E A;  5HM4 B;  4OEN A;  1UTH A;  4GL8 A;  4NF5 B;  4OER A;  4F18 A;  5ICQ A;  4BDN A;  4K3F A;  4R9F A;  4NE4 A;  3CFZ A;  2DWJ A;  3S4U A;  1N76 A;  1MXV A;  3R6U A;  4R2F A;  4I8C A;  3VLW A;  3RNN A;  4QHQ A;  1B1X A;  1H43 A;  4ZEC A;  1Y1Z A;  3LBS A;  3TQL A;  3V5A A;  4R6K A;  3BKI B;  3HN0 A;  5K2X A;  3CG1 A;  1LB9 A;  1DPE A;  2G29 A;  1JW4 A;  5J1D A;  4ELQ A;  3HO7 A;  3FD3 A;  4EQ9 A;  2VP1 A;  4OVJ A;  1MQJ A;  1TT1 A;  2PBW A;  4X1B A;  4F1U A;  2UVI A;  5FTH A;  1MY4 A;  1B3G A;  1FQF A;  4JSD A;  1EU8 A;  3O66 A;  3FJM A;  3QXM A;  3K4U A;  4QFL A;  3GZG A;  1YTV A;  1B3L A;  4PP0 A;  5AA2 D;  3G3F A;  1FTK A;  1Q35 A;  1TFA A;  4QFN A;  4QSE A;  3IB1 A;  5AA2 B;  1GR2 A;  3B7D A;  3OO6 A;  5CMC A;  4WXJ A;  1PB9 A;  2O51 A;  2DYX A;  2DQV A;  1OQG A;  3TEP A;  4JDF A;  4NF5 A;  4G2Z A;  5CMB A;  3MVZ A;  3DRF A;  1IXH A;  5HPQ A;  1B9J A;  4ELP A;  2XXY A;  4HS7 A;  4Z7E A;  1RYO A;  5K2Y A;  3CR9 A;  3PMW A;  1B40 A;  4Z0I A;  3ZS6 A;  4R75 A;  4YIC A;  2ZNU A;  4HCY A;  3U93 A;  3RYB A;  2QSX A;  1WOD A;  3VLV A;  4ESW A;  3H6W A;  2ZYN A;  3H6T A;  1M5E A;  5FHO A;  5AA1 A;  4RPO A;  2XXQ A;  3MZ9 A;  4KFQ A;  4FE8 A;  3U1O A;  2A5T A;  3LC8 A;  4BDO A;  2IA4 A;  3K1M A;  3RT8 A;  1AH5 A;  2F6P A;  2DWA A;  3KOS A;  5A5X B;  3C36 A;  2ANJ A;  3M3K A;  3TDJ A;  4GRK A;  3DP4 A;  3EPE A;  4PFW A;  4H5F A;  2XXX A;  4OET A;  4M1V A;  4F39 A;  3T9V A;  1P1N A;  4G68 B;  1PB7 A;  1B32 A;  5F1Q A;  1RKM A;  2P0S A;  4LVQ A;  3CRB A;  2I48 A;  2HAV A;  1JEV A;  1MQI A;  5AA4 B;  4L17 A;  2V93 A;  4ZEK A;  1PBQ A;  4I9D A;  5AA2 A;  1ZJL A;  3I5O A;  4O3C A;  4YKP A;  4ECF A;  2WOK A;  3K6V A;  1B1H A;  4ND9 A;  3O29 A;  3IR1 A;  3MP1 A;  1MY1 A;  2XXH A;  3H7M A;  4XIG Q;  2REG A;  1IZ1 A;  3IOT A;  1II5 A;  3K02 A;  1YCJ A;  4ISU A;  2RCB A;  3T93 B;  5L9O A;  4F3B A;  2Y7I A;  4MF3 A;  4QFP A;  3MVY A;  5ICT A;  3DRJ A;  1PDA A;  4G8H A;  3RN8 A;  1MXZ A;  2D3I A;  3UK4 A;  4G8M A;  2Q89 A;  4UA8 A;  1N04 A;  2RC9 A;  3SEW A;  4OXV A;  5CM6 A;  3IO6 A;  3VVE A;  3R26 A;  4DXU A;  2O1L A;  1B3F A;  3MVX A;  2I58 A;  2ESN A;  1H3D A;  3Q25 A;  4PET A;  5A5X A;  3TUS A;  4YB6 A;  4IO7 A;  2H99 A;  5TP9 B;  1SBP A;  2DVC A;  4FEB A;  4KCC A;  4QRZ A;  1LAX A;  4LA9 A;  4U1O A;  4KR5 A;  4F3G A;  1ZIU A;  2PX1 A;  4U23 A;  1JET A;  3UGW A;  4G68 A;  2F7B A;  2P1S A;  3C32 A;  2DWH A;  2FNC A;  2UVG A;  4H67 A;  3TYH A;  2XXV A;  3RTF B;  1OQH A;  2W7Y A;  1OLC A;  1EH3 A;  5AA4 A;  1MG1 A;  3W9W A;  4NWD A;  3AXF A;  1UTB B;  3S9E A;  3K1N A;  2R9J A;  4R72 A;  1O7T A;  3Q28 A;  4GOT A;  1LGB C;  2UYF A;  4RYA A;  3M3L A;  5JK4 A;  4PFY A;  4F1V A;  1TWY A;  5DEX B;  3O6I A;  2VD3 A;  4HTG A;  3O97 A;  4LZ8 A;  3ECR A;  1LFH A;  1JW5 A;  3H6V A;  4F31 B;  1VFE A;  1Y3P A;  2I6E A;  2Q8J A;  1IIW A;  3TOD A;  3C34 A;  2ZMB A;  2VHA A;  3VFJ A;  3G3K A;  4LZ5 A;  5I2N B;  3FV1 A;  4YMB A;  2XXU A;  3OO9 A;  1B51 A;  1NNT A;  4EF1 A;  3C33 A;  1AMF A;  4LAT A;  4XKR A;  4DXB A;  3D4G A;  2O84 X;  1B52 A;  1MRP A;  1B0L A;  3O9P A;  1P1O A;  2XXT A;  4POX A;  1EZO A;  1URD A;  5TP9 A;  2XX9 A;  3O6G A;  1MPD A;  1TFD A;  2O7I A;  3BFT A;  3OD7 A;  4ZDM A;  5L9M A;  4PE5 B;  1FQB A;  4H6D A;  3W15 C;  2R71 A;  1QUJ A;  3PUZ E;  2OLB A;  4FIM A;  1MXU A;  5H8N B;  4AB5 A;  2OWT A;  5FTI A;  1TXF A;  2Q2C A;  1MQG A;  3KN3 A;  2H9B A;  1ZMG A;  3L6G A;  4ZZA A;  1UTB A;  2V3T A;  1B58 A;  3VXC A;  3DP6 A;  3IOR A;  3SEX A;  4ZEB A;  3TTM A;  4FEC A;  3OO7 A;  5CC2 A;  1FQE A;  3IOV A;  5H8Q B;  2HZK A;  3HCQ A;  3QAX A;  3FJ7 A;  3TPA A;  4U4X A;  4DE8 A;  3SEU A;  1MQH A;  3JYR A;  1XVX A;  1CE2 A;  5DEX A;  3KN8 A;  2Y7K A;  1N84 A;  3KSX A;  4RPN A;  1A7L A;  2GFE A;  3OXN A;  3FUZ A;  4KD5 A;  1PC3 A;  1XHY A;  3ONM A;  3C35 A;  4E0X A;  1MPB A;  1EZ9 A;  3OEN A;  3CG3 A;  1P1U A;  3FIR A;  3B6T A;  2F36 A;  4UAC A;  1B5J A;  2DS9 A;  3VVF A;  3UOR A;  5I57 B;  3MJN A;  4G77 A;  5I2N A;  2OJT A;  4GVO A;  2XHD A;  1D9Y A;  1S50 A;  2YJP A;  2QMX A;  3IOU A;  4H0W A;  3KZG A;  5CMM A;  1DTG A;  3HST A;  3VDF A;  2REJ A;  2V84 A;  3KBR A;  4PFT A;  4OEU A;  3CFX A;  3EHU A;  2DE3 A;  3KOT A;  4KPT A;  4FED A;  3KEI A;  3IJO B;  3ZKL A;  2WOL A;  2F7C A;  1OVB A;  5H8H B;  3SEV A;  1LB8 A;  4IO5 A;  3WAF A;  2QJE A;  1MXX A;  5H8N A;  3QIM A;  1Q1K A;  4DLD A;  3JZJ A;  5JTY B;  2KLF A;  4DXC A;  2F8D A;  4ONY A;  1B5I A;  5ISU A;  2Q88 A;  1J1N A;  4R2B A;  1I6A A;  4ZEI A;  4F2Q A;  4NF6 B;  4GIZ A;  4U4S A;  3DRH A;  5H8Q A;  4LON B;  3E4R A;  2P2A A;  5JEI A;  2D21 A;  4G68 C;  3MP6 A;  4EQ7 A;  1ZU0 A;  3PAM A;  5FHM A;  1Y1M A;  2UYE A;  2V3Q A;  4OFJ A;  3PPO A;  1Y4T A;  2VD2 A;  4RNS A;  1ZTY A;  4RXL A;  4QFK A;  1LBC A;  5H8S A;  1HSL A;  4YAH X;  3KSJ A;  4Q5T A;  2BJJ X;  3KG2 A;  4THI A;  2HZL A;  4IO4 A;  1EZP A;  4IO2 A;  2Z8D A;  2ONK E;  1B7Z A;  4FJP A;  3K1P A;  4DCY A;  1CB6 A;  4YU0 A;  4JWO A;  4N6P A;  4ZED A;  4F19 A;  1BLF A;  4MFI A;  1XT8 A;  1FQD A;  1A99 A;  1GTK A;  3H6U A;  2A5S A;  4OTE A;  5IAI A;  5H8H A;  4KCD A;  3N94 A;  3IJX B;  4JWY A;  5L8D A;  5B7D A;  2QRY A;  3KJ7 A;  2YPN A;  3PD8 A;  4NF4 B;  4ZE9 A;  3RGY A;  3C4M A;  4I1D A;  3FXQ A;  5CI5 A;  4F3S A;  5ITP A;  4H1X A;  1LFG A;  5KZT A;  4NF6 A;  3T9U A;  3MC2 A;  2QS2 A;  1UIU A;  4NF8 B;  1FQC A;  3MBP A;  3TFL A;  2OCU A;  2ONR A;  2O68 A;  4BDR A;  5DVF A;  3M3F A;  2E1S A;  4N07 A;  3U94 A;  1BKA A;  2V25 A;  1FCK A;  4NWC A;  3G3G A;  1AIV A;  4BDL A;  4OES A;  2ZNT A;  1NNF A;  4ZZE A;  1MM7 A;  3FXU A;  4JB7 A;  3EHT A;  4BLA A;  1I69 A;  1IUD A;  3HHG A;  4HW8 A;  4F22 A;  1MPC A;  1N0T A;  1XC1 A;  1SD3 A;  2I49 A;  3O28 A;  4R6H A;  1OIB A;  3PPR A;  4XXU A;  3DLN A;  3PMX A;  1WDN A;  4KYE A;  1H45 A;  3DM0 A;  3A3C A;  2PVU A;  2NOO A;  4GFR A;  3PD9 A;  5TPA B;  2OK2 A;  3O2A A;  4U1Z A;  4G4P A;  4ZS9 A;  3RPW A;  2Z8E A;  4QSD A;  3GXA A;  2QL3 A;  3FAS A;  3E13 X;  1SYI A;  4TLL B;  3PUX E;  3H4Z A;  4DCX A;  3HPI A;  1NNK A;  5DT6 A;  3TZA A;  4DDD A;  5ITO A;  4G8N A;  3MWB A;  3ZSF A;  4NF4 A;  1DMB A;  1MM6 A;  3I6V A;  3HHF A;  1T0K A;  1M5C A;  3QUF A;  3PU5 A;  2O6A A;  3R7X A;  5I59 B;  4OEV A;  1JVY A;  3V8X B;  1MH4 A;  1GGG A;  1DTZ A;  3FAT A;  3TAJ A;  4TOZ A;  1SW2 A;  4NF8 A;  2Y7P A;  4GLI A;  5B70 A;  2AIX A;  3IL1 B;  4H65 A;  3THI A;  1IQ7 A;  1B05 A;  2AYS A;  3DEL B;  1AL3 A;  4QSC A;  3EF7 A;  3GBA A;  2ALU A;  2WOP A;  1P1W A;  3T66 A;  3OEK A;  2DXR A;  2ABH A;  2DSF A;  3OEL A;  3W9V A;  1LBB A;  2F35 A;  4P11 A;  1QJM A;  2H5Y A;  1NFT A;  3TKD A;  5H8F B;  2UVJ A;  4X48 A;  1BTJ A;  4PFU A;  5F7V A;  1NL5 A;  3FVG A;  3C9H A;  5TPA A;  1RYX A;  3TTL A;  3IB0 A;  3EHS A;  2OBG A;  1PBP A;  1US4 A;  3T9X B;  3SEY A;  3MW0 A;  4XKP A;  1MXY A;  3IO4 A;  1FTL A;  1MS7 A;  3B6Q A;  3E9X A;  3TTK A;  2OZZ A;  2GRV A;  3FJG A;  3K0V A;  4WKM A;  3G7W A;  1MY0 A;  4AB6 A;  1LAG E;  3UIF A;  5I59 A;  5I84 A;  1A8F A;  3SDF A;  3FXR A;  3TEL A;  2NUV A;  3KFM A;  3MQ9 A;  2DOJ A;  3T9H B;  2PMS A;  2HXW A;  4YKI A;  1A40 A;  3CSB A;  4GQO A;  3OEM A;  3PPP A;  2H98 A;  4Q30 B;  1SDX A;  2XX7 A;  1OVT A;  2QS4 A;  1ANF A;  2Q2A A;  4H8J A;  5DVJ A;  2DE4 A;  4XTC Q;  3MP8 A;  3IK6 B;  3PPN A;  1N3X A;  3PV0 E;  2Y84 A;  3SKP A;  4ZE8 A;  1KWH A;  4AQ4 A;  1O64 A;  5AE4 A;  5ELV A;  3OMB A;  3MPL A;  3PUY E;  1BP5 A;  3UA8 A;  2WKY A;  4P0I A;  1Y20 A;  2YLN A;  3U92 A;  4POW A;  3TTR A;  4FAJ A;  2B4M A;  1I6B A;  5TU0 A;  3K6W A;  2I4C A;  1Z7N E;  4RK2 A;  5KDT B;  3RUM A;  3TTN A;  4FAT A;  1MH3 A;  1YPN A;  2Z23 A;  1N3W A;  4OHN A;  1JW1 A;  2DE2 A;  4TLM B;  5KCJ B;  2ZXT A;  1MXW A;  1QKB A;  4NED A;  4OFO A;  3U72 A;  3WAE A;  3RLF E;  4XKQ A;  1QW0 A;  1M5B A;  4IY6 A;  5LOM A;  3RY3 A;  2PT2 A;  1QUK A;  2O7U A;  3DRK A;  1D9V A;  3ZKK A;  2NVU B;  3MVW A;  4GD5 A;  4KHZ E;  3K01 A;  4YMA A;  4U21 A;  4F3P A;  2RF1 A;  1N7W A;  3N26 A;  1MDP 1;  3K00 A;  3MPK A;  5BUU A;  3CFL A;  1JVX A;  4R9G A;  1B4H A;  1A8E A;  1XVY A;  4KYD A;  1M5F A;  1URG A;  3Q26 A;  3BBR A;  3SER A;  3FTO A;  2HEU A;  4NTL A;  3QSL A;  4JSO A;  2FA7 A;  3P7I A;  1L5T A;  1S9T A;  3RYA A;  2THI A;  3V83 A;  4ELO A;  1ZBM A;  1DSN A;  3U8Q A;  5EYF A;  4LQ5 A;  1DPP A;  2D5W A;  1JNF A;  1PEB A;  5KDT A;  4YKJ A;  1NH8 A;  4E0W A;  4KQP A;  1IXC A;  1I6Q A;  3RTW B;  4GF8 A;  3MUQ A;  2ZYM A;  3PMV A;  1F9B A;  4MBP A;  1USY H;  5KCJ A;  4GXA A;  2F97 A;  4RY1 A;  4YZZ A;  1S7Y A;  1B7U A;  3CHG A;  1ATG A;  3QK6 A;  1M5D A;  4R6Y A;  5I2K B;  2A5T B;  1PB8 A;  5I57 A;  3JV9 A;  1R1N A;  1B5H A;  4OYV A;  1UIV A;  3KGC A;  3E3K A;  1GVC A;  2NWJ A;  3PUW E;  4TQU Q;  1MY2 A;  3ODB A;  4ZEF A;  3LVU A;  1MY3 A;  3QUJ A;  4LQ2 A;  2PYY A;  2CMO A;  4OMB A;  3USD A;  3SET A;  2CZL A;  3O6P A;  4IO6 A;  1YAE A;  4U2R A;  3GLB A;  2X7P A;  1Y9U A;  3FVN A;  3TMG A;  4R74 A;  4DZ1 A;  5JTY A;  4IY5 A;  2IEE A;  3Q29 A;  3K2D A;  5BWJ A;  2HQ0 A;  3TCH A;  2ZNS A;  4PQJ A;  4YB5 A;  4BDM A;  3V89 B;  1URS A;  1OLA A;  3RQT A;  4LZ7 A;  4JXI A;  1QVS A;  4OQO A;  4R73 A;  2I3V A;  5L9S A;  1LST A;  5AA3 A;  1MQD A;  3CIJ A;  1LAH E;  4RK9 A;  4RA1 A;  1Y3N A;  3D4C A;  5EHM A;  3LSF B;  1P1Q A;  2B3B A;  1BIY A;  4LUB A;  5I2K A;  4QFO A;  1ZLQ A;  2Z22 A;  1MDQ A;  1SQY A;  3EQ1 A;  4GXS B;  1R9L A;  1B2H A;  3FVK A;  1R6Z A;  2B4L A;  4LP2 B;  1SW4 A;  4IB2 A;  1DOT A;  4JWX A;  2FYI A;  2B65 A;  3TCG A;  1SW5 A;  2RIN A;  1B7H A;  1LLS A;  1Z7M E;  2XD3 A;  4NMY A;  2O1M A;  2NXO A;  3SES A;  5CBS A;  3N6U A;  2I0B A;  2F34 A;  5I58 B;  1O63 A;  1JQF A;  1GV8 A;  2QS1 A;  2F7A A;  1JEU A;  2Y7R A;  2HCA A;  2VGQ A;  1B3H A;  2GHA A;  1NNP A;  3C31 A;  2UXA A;  3Q27 A;  3LSW A;  3CI8 A;  3N5L A;  4HCW A;  3TQW A;  2QMW A;  1XS5 A;  3UN6 A;  2HFB A;  4M4G A;  5IKB A;  3PGF A;  1HSJ A;  2DXY A;  4EXL A;  3G3J A;  1QUI A;  4KI0 E;  3VE1 B;  3CSG A;  1FTM A;  1SI0 A;  1LAF E;  3S2V A;  3PPQ A;  3G3H A;  4GL0 A;  1AOV A;  5DVI A;  1US5 A;  1USY E;  3O6H A;  3LSX A;  4H5G A;  2ZYO A;  3OSR A;  3EN3 A;  5EHS A;  3MAM A;  4X9T A;  2X26 A;  1QUL A;  3H06 B;  3IB2 A;  4OFL A;  4FOR A;  3FVO A;  3IOW A;  4F29 A;  3L6H A;  1R9Q A;  2RC7 A;  3BFU A;  3ILT B;  3IX1 A;  4BDQ A;  5I56 B;  2F5X A;  1N7X A;  3VLU A;  1LCT A;  5CRY A;  4JBZ A;  4YB7 A;  3M8U A;  1OMP A;  3DRI A;  3A3U A;  5I58 A;  1B4Z A;  3MZ1 A;  3TCF A;  4C1T A;  4I62 A;  1B6H A;  1POY 1;  1H76 A;  4IO3 A;  3G3I A;  1Y3Q A;  1FW0 A;  2HAU A;  3T22 A;  3H03 A;  2V3U A;  2UVH A;  1SW1 A;  4GWO A;  1IXG A;  2I4B A;  1VE4 A;  3DRG A;  3OSQ A;  3OOA A;  4N13 A;  2Y7W A;  2F6G A;  1VSO A;  3S9L C;  3S9N C;  3LUY A;  2GHB A;  1Y4C A;  3IAZ A;  3OO8 A;  2F78 A;  1B0H A;  3H3G A;  3KN7 A;  1B46 A;  4MH5 A;  3DP8 A;  2ONS A;  2I3W A;  4EUO A;  4IGR A;  2RKM A;  2R6G E;  2XXW A;  4WEP A;  2AL5 A;  4H8I A;  3CVG A;  4DIG A;  2XXI A;  3T96 B;  1HSE A;  2M8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...