3TCFA

Crystal structure of e. coli oppa complexed with endogenous ligands
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
517
structure length
517
Chain Sequence
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Periplasmic oligopeptide-binding protein
publication title Escherichia coli peptide binding protein OppA has a preference for positively charged peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 172
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3tcfA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tcfA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3tcfA02
1IQ7A 1PEBA 5L9OA 5I58A 4LONB 4FECA 5DVIA 1B2HA 4FORA 2QS1A 2ZYOA 4YB7A 4U1ZA 4GXSB 3KOSA 3TKDA 1P1OA 3LUYA 1IXCA 5I2NB 1M5EA 3C31A 5ICTA 4ZEFA 4NWCA 4U22A 1H45A 3K1MA 2AL4A 2OWTA 4Q0CA 4ELQA 4NF6A 3B7DA 1ELJA 1SW2A 4NF5A 3FGSA 3TELA 3CI8A 5CRYA 5F1QA 2RKMA 4F3PA 3O9PA 2E0SA 5ELVA 3TTMA 2UXAA 2VD2A 4PFYA 3PUVE 4UA8A 3DRJA 1ZJLA 4N13A 4DXUA 4HCYA 1TWYA 4KQPA 5CBSA 2UYEA 1B3GA 1IIWA 5I84A 3G3GA 1YAEA 3O6GA 4ZE8A 2XXQA 5BWJA 2Y7WA 1DMBA 4NEDA 1MQGA 1YPNA 3L6HA 5CBRA 4IY5A 1HSJA 3TCFA 3OXNA 4H67A 3CFLA 5HM4B 1XOCA 4QSEA 5K2YA 4YKJA 3G3IA 1MY2A 3Q28A 3QAXA 4RA1A 3LSLA 5CMMA 4Z7EA 2RC9A 3IOUA 4LVQA 2XX8A 2VP1A 5TPAB 4HW8A 4EXLA 1MY0A 1LFIA 3VVEA 3OO9A 4YICA 1TFAA 4AQ4A 5AA2D 1NL5A 2PX1A 3RT6B 3FV1A 2ZYNA 3OO6A 3EPEA 4P0GA 4OERA 4OHNA 1WDNA 5FTHA 2HZLA 3H03A 2HCAA 3K6WA 1FQFA 3E13X 1D3KA 3DM0A 5FHOA 1O64A 3N6TA 5JEIA 1QKAA 3VDFA 1MQHA 4BDRA 1MY1A 3O29A 1FCKA 5TPAA 3CR9A 3H6VA 5I2KA 4P11A 1MXUA 1AIVA 3V8XB 3R7XA 4XKPA 1ZLQA 4TOZA 2H5YA 2UVIA 5H8HA 2R6GE 2R9JA 3EF7A 4TLMB 3QIMA 2DSFA 1MM6A 1ANFA 1DPEA 1RYOA 4OEUA 1I6AA 2KLFA 2O1LA 1MPCA 3V5AA 2RINA 3H3GA 4YKKA 4KYDA 1XVYA 2XXHA 4R6HA 1B3EA 1USYH 4ELOA 1SD3A 3G3HA 3CFZA 4DDDA 2UVGA 1B6HA 3O28A 1B9JA 3VE1B 5A5XB 2UVHA 2FYIA 2ZNUA 3T66A 1OLAA 5ITPA 1M5CA 3C4MA 4U4XA 4YAHX 4DXBA 2O84X 4XTCQ 3OO8A 2A5TB 2D21A 1N7WA 1JVYA 4FEDA 1R9LA 3O97A 2ESNA 2DS9A 4H5GA 1JW4A 4O3BA 2QS4A 5TU0A 2LAOA 5L8DA 1T0KA 3TCHA 3ONMA 3O6PA 3KSXA 4IO7A 4R6KA 5I59B 3DRHA 4QF9A 3BKIB 4DXCA 2P1SA 1D9VA 2UVJA 1DTZA 3PPRA 3OOAA 1P1UA 4R9GA 1LAGE 2A5TA 2OWSA 1JNFA 3IO6A 3S4UA 1MH3A 4WEDA 3VV5A 1LFHA 2DE4A 4OXVA 2ZNTA 2QS3A 3MW0A 3VXBA 2Q89A 5CMBA 4QSDA 4DLDA 4OFOA 3MAMA 4R9FA 3VLUA 2Q8JA 1ZMGA 3T9VA 2GHBA 3PD8A 2FNCA 4NF4B 5FTIA 4G8HA 4QHQA 5CMCA 2A5SA 2Q88A 3I5OA 4KI0E 4ELPA 1JETA 1Y20A 2I4CA 3ZS6A 1HSLA 2XD2A 3TTRA 2W7YA 1JEUA 3PU5A 3IL1B 3C36A 3KG2A 4U21A 3U92A 1B1HA 4OENA 5HPQA 4I8CA 1B58A 2H98A 2XD3A 1TXFA 4F1YA 5J1DA 4G68A 4NE4A 1MQDA 3SKPA 3H4ZA 4GFRA 4JWOA 1B3FA 1Y3NA 3KJ7A 5IAIA 2O68A 3UORA 5JTYA 1B51A 4YB5A 3FJGA 5AA4B 3FATA 4RJZA 4Q5TA 1PC3A 3S9LC 4QFOA 4EF1A 3GBBA 2X7QA 3A09A 2YLNA 2Z8FA 3T22A 1US5A 3LSWA 3N94A 1P1WA 5CM6A 2PMSA 4ESXA 4IO3A 4H0WA 3PPNA 2ZYKA 3ILTB 1UTHB 3MQ9A 4MLQA 1B7HA 1BTJA 4FEBA 2NXOA 4F3BA 4U2RA 4YMBA 3KN3A 3M3KA 4R72A 2HQ0A 4X1BA 2V3QA 4C1TA 1JQFA 3T9UA 1QULA 1NH8A 3TMGA 5AA4A 3K4UA 1MG1A 3G3KA 4X9TA 3S9NC 2DWAA 2ABHA 3RLFE 4FATA 3M3FA 4GLIA 3FVNA 3IAZA 5B7DA 4ONYA 4QFKA 4RNSA 4DIGA 1UTBA 1LLSA 3CHGA 5H8QB 4WKMA 5KZTA 2RC8A 3GBAA 1QW0A 4H8IA 1IITA 3LSFB 4KPTA 5L9SA 1B5JA 1B46A 1FQBA 2I4BA 4H5FA 1SI1A 4ZS9A 3VLWA 2AIXA 2V3TA 4DCXA 2DWIA 2DWJA 1XS5A 4ESWA 3FASA 2F8DA 1RYXA 2Q2AA 4GOTA 2IEEA 3LSXA 2PYYA 4LQ2A 1URGA 2OLBA 4BDOA 2Q9TA 1N84A 3SEYA 4I9DA 3MVXA 5H8QA 3TFLA 1OVBA 4Q30B 3GZGA 2O7UA 3PPOA 3IOWA 3K2DA 5EHSA 1F9BA 3OD7A 4GD5A 1M5DA 1LGBC 3HO7A 1SVXB 1OVTA 3IO4A 3RN8A 4EXKA 1D4NA 3I6VA 1MPBA 1Y4TA 1A55A 1RKMA 2Y7IA 3FJMA 1YCJA 4DE8A 1YTVA 4NWDA 3B6QA 4ECFA 5DEXB 3SEVA 3N26A 2P2AA 4JDFA 2REJA 3SESA 2VGQA 3MPKA 4YB6A 5I2NA 4N07A 3MJNA 1MXVA 3KFMA 3QK6A 3SETA 4F3SA 4GWOA 1DSNA 3L6GA 1A8FA 2ANJA 2M8CA 1Z7ME 4IGTA 2PT1A 3SEUA 4R6YA 2I0BA 4WEPA 3U1OA 1VFEA 3M8UA 3K00A 2PBWA 1WODA 5L9MA 4IY6A 4RK2A 3UIFA 4OZ9A 3CFXA 5KDTB 4GQOA 4H65A 4NTLA 1Y1MA 3F11A 3HV1A 1URDA 5FHMA 2XXIA 5DVJA 3TUSA 3RYAA 3PMWA 4THIA 2RC7A 4TLLB 4MFIA 3QXMA 5BUUA 1US4A 1B5IA 1JEVA 4QSCA 2QMWA 1O63A 3MP1A 3CIJA 4PFWA 5DYHA 4XKNA 1J1NA 4F39A 3LVUA 3KJTA 1NNKA 5TP9B 1EH3A 5M2VA 3DP6A 5AA2B 3PMXA 2I6EA 4YKIA 1UQWA 2DOJA 3HSTA 3O2AA 3FXRA 3TQWA 3KEIA 4FJPA 4OESA 1LSTA 2F97A 5FHNA 5KCJB 4ZZAA 4RY1A 1A7LA 2H99A 4GXAA 3H7MA 5H8FB 3EQ1A 2F7CA 4EF2A 3IB0A 2F35A 3IOTA 3EHUA 4OTEA 2VD3A 2Q2CA 3HHFA 1JW5A 3VVDA 3I3VA 3SEWA 5TP9A 4ZEBA 1N3XA 3RTWB 2RCAA 3N6UA 4KCDA 1B7UA 4BDMA 5LOMA 3THIA 4KYEA 3LBSA 5AA3A 4F22A 1OQHA 1B52A 1MDQA 4GRKA 4G2ZA 2G93A 5H8FA 3CG3A 2XXVA 3IB2A 4OMBA 3MPLA 3CRBA 2QS2A 2ONRA 3O66A 3PUXE 3KZGA 1B7ZA 5ICQA 2F6GA 3CVGA 5CI5A 1BP5A 3BFUA 1P1QA 3HPIA 1JW1A 2HEUA 4R2BA 4GVOA 1S7YA 3H6TA 1D9YA 2I58A 1FQDA 1FQAA 3H6WA 4E0XA 3RT8A 1POTA 1I6BA 5A5XA 4R74A 3U93A 3FTOA 5EYFA 3T93B 4FAJA 4XKRA 2O6AA 4HCWA 1TT1A 1N76A 3N5LA 3MVYA 2V93A 4KHZE 2BJJX 1A40A 4RXLA 1POY1 2XXYA 3FIRA 4JSDA 2B3FA 1QKBA 1LAHE 4EUOA 5DTBA 1SI0A 3ECRA 2XXWA 4YMAA 3VXCA 3ZSFA 3E3KA 1B3HA 1H43A 2ZMBA 1MXZA 4L17A 3K02A 1EZOA 3O6HA 5I59A 3RTFB 4ZE9A 1MM7A 2WOPA 3ZKLA 1SDXA 4P0IA 4M1VA 4BDNA 4OEVA 4DZ1A 2OJTA 1OQGA 4PE5B 4R2FA 3IK6B 4IO5A 1GGGA 3IOVA 4Z0IA 1NMUA 2RCBA 2I3WA 4OYVA 4DCYA 3EHSA 3HHGA 1NNPA 4HS7A 4KCCA 1FQEA 3SDFA 3UN6A 1Y3QA 1ZIUA 3K6UA 4Q8RA 1B05A 1A54A 1MQJA 4OQOA 1MDP1 4KR5A 3DRFA 4I1DA 4AB5A 2B4MA 4JB7A 3JZJA 4NF4A 5F7VA 4ELRA 3TCGA 1MQIA 3DRGA 4POWA 4KD5A 4H8JA 3OENA 2O7IA 1N3WA 1PB7A 3UA8A 2RF1A 4LZ5A 2B65A 3C32A 1S50A 2DE3A 1MXXA 3UP9A 4RYAA 1VE4A 2HXWA 3TTKA 4YKPA 1P1NA 1JVXA 2HAVA 1USYE 3KOTA 1L5TA 4BDLA 3FZVA 3MVWA 3MUQA 3VFJA 3PUYE 3K0VA 3TAJA 2QSXA 2OK2A 3UK4A 4R73A 4R75A 5EHMA 1LBBA 1OLCA 3FVOA 2O69A 3FXUA 3HCQA 3P7IA 3PAMA 3PD9A 5AE4A 4QFNA 2WOKA 1TFDA 4EDPA 3RUMA 1XVXA 4MLVA 2G29A 2YJPA 2Y7PA 2F36A 4LZ7A 2V84A 1VSOA 1LAXA 2XX9A 3KN8A 4O3CA 1B4HA 2IA4A 2F7AA 1SW1A 1BIYA 3MZ9A 1H3DA 2DXYA 1B3LA 1N04A 1UTHA 3PPPA 3LR1A 2UYFA 4ZEDA 4OWDA 3RY3A 1MS7A 4G4PA 3E9XA 1UIUA 1OMPA 4UACA 1IEJA 2CZLA 4OFLA 3C33A 3OSRA 3TQLA 4YZZA 3S9MC 4HTGA 2XXPA 1ATGA 3PGFA 2FA7A 3QSLA 1II5A 1FTOA 2DE2A 4H6DA 4K3FA 1NNTA 2OCUA 3DP4A 3VLVA 4BLAA 2DVCA 1A8EA 4JSOA 1LB8A 4MF3A 3MC2A 1QUJA 2ONSA 4N6PA 4U4SA 1IXHA 4LZ8A 2HAUA 2GHAA 4ND9A 1AMFA 1Y4CA 2CMOA 2D3IA 4GF8A 1B0HA 4G8NA 1Q1KA 3PUWE 4GIZA 4JXIA 3MBPA 1HSEA 4KFQA 3IX1A 3S9EA 1MRPA 3OEKA 1CB6A 1URSA 1LB9A 4TQUQ 3T9XB 4FIMA 2DQVA 2XX7A 1LCTA 2F5XA 4ISUA 2DYXA 3K6XA 3MZ1A 1P99A 1SBPA 4F18A 2GRVA 3OELA 3IR1A 4U1OA 2NOOA 1Y1ZA 2Y7RA 1N7XA 5I57B 1Z7NE 3MZBA 5CC2A 1PBQA 3A3CA 5DVFA 2H25A 1B5HA 3Q27A 3TZAA 2OBGA 4EQ7A 5H8SA 5DEXA 2F34A 3QYTA 4QFPA 1FQCA 1ZBMA 3R6UA 4MH5A 4QFLA 1MH4A 3IJOB 1DPPA 1LCFA 2NUVA 1QUKA 5I56B 4ZZEA 2NVUB 3W9VA 2QMXA 2VHAA 1IUDA 3MWBA 3KN7A 1QVSA 1ZU0A 5I57A 2V3UA 5H8NB 3IJXB 2Y84A 2Y7KA 5ITOA 1FTMA 4OVJA 4POXA 5I2KB 4LP2B 3TYHA 1WVJA 5KDTA 4G68C 4LUBA 3WAFA 4OFJA 1O7TA 3VVFA 3S2VA 3ZKKA 3IORA 5H8HB 3DRIA 3OSQA 1MY3A 4IO6A 4M4GA 1FTKA 3RYBA 5I56A 2Z8EA 3D4GA 1EZ9A 4F2QA 1XT8A 3V83A 4ZDMA 3SERA 2QRYA 1AH5A 3C34A 3TEPA 4PP0A 5H8NA 3K1NA 2WKYA 3E4RA 1IZ1A 4F3GA 1GV8A 5AA2A 2GH9A 1ZKBA 3DP8A 3KBRA 3WAEA 2PVUA 3LC8A 3OEMA 3CG1A 4F19A 3JV9A 2XHDA 2XXUA 5KCJA 3ODBA 2XXRA 4F1UA 1NNFA 4F2OA 2ALUA 2PT2A 1XHYA 2ONKE 1LBCA 1I6QA 4U23A 3FXQA 4PQJA 3DRKA 3M3LA 4GL8A 3U8QA 4PFUA 1PDAA 1SW5A 2THIA 4IO4A 4EQBA 3ILUB 1Y9UA 3TPAA 3PUZE 1FTJA 4XIGQ 3RQTA 3TTNA 4FE8A 3B6TA 1EZPA 1R1NA 4MBPA 1ZTYA 1DTGA 4NMYA 1NKXA 1B0LA 4H1XA 1MPDA 3OMBA 4EQ9A 1MXYA 4X48A 1B1XA 5K2XA 3USDA 1B32A 2HZKA 1SYHA 4OETA 4LATA 1R9QA 2DVZA 1LFGA 1VR5A 1I69A 1NH7A 4IB2A 3Q26A 3FVKA 2QL3A 4G77A 3OO7A 1CE2A 1IXIA 3TDJA 1N0TA 1B4ZA 2ZNSA 2QPQA 3W15C 3Q29A 3R26A 2X26A 3HN0A 2I3VA 1BLFA 1R6ZA 4GL0A 2ZXTA 1FTLA 2O1MA 1UIVA 4LA9A 3MVZA 4G68B 4LQ5A 3EN3A 1M5BA 3IB1A 4F29A 4XKQA 1EU8A 1VFDA 3RPWA 3CSGA 1LAFE 3AXFA 3FV2A 5ISUA 1BKAA 3H6UA 3EHTA 3FUZA 3B6WA 4JBZA 3PMVA 5JTYB 3H06B 1M5FA 4C0RA 1XC1A 2I49A 2AL5A 4ZEIA 3CSBA 2DXRA 1DOTA 2R71A 2D5WA 3O6IA 3U94A 2DWHA 2E1SA 3BBRA 1H44A 4PFTA 2Z22A 1Y3PA 4G8MA 3T96B 2DP8A 3QUFA 4ZEKA 5DT6A 3BFTA 3MP6A 1GTKA 4F1VA 1PB9A 2O51A 1SYIA 3DLNA 4BDQA 2H4IA 3A3UA 4XXUA 2AYSA 3DELB 4RK9A 1QJMA 3FJ7A 1PB8A 4AB6A 2F7BA 2Z23A 3K01A 3RGYA 3G3JA 3SEXA 1FW0A 3G7WA 3TTLA 4I62A 2H9BA 1H76A 2QJEA 4QRZA 2X7PA 1GR2A 4NF8B 1SW4A 3D4CA 2F78A 1UTBB 2WOLA 5AA1A 2B4LA 4F31B 2Z8DA 3K6VA 1S9TA 2V25A 3K1PA 3TODA 2VOZA 1QUIA 5CMKA 1GVCA 4KYSA 3GLBA 4YU0A 2YPNA 3KGCA 3FD3A 4PETA 3QUJA 2REGA 1NFTA 2B3BA 3PPQA 2GFEA 1AOVA 4WXJA 3Q25A 2P0SA 2F6PA 4IO2A 3RNNA 2ZYMA 5HBCA 3MP8A 1Q35A 2OZZA 5I58B 4NF8A 3C35A 3GXAA 4JWYA 3V89B 1PBPA 1B40A 1MXWA 3C9HA 3FVGA 3T9HB 3W9WA 5IKBA 2NWJA 2XXTA 1A99A 3G3FA 1OIBA 2XXXA 3JYRA 4IGRA 1MY4A 4C1UA 4JWXA 1SQYA 1IXGA 4NF6B 2I0CA 4NF5B 4RPNA 4X1DA 5JK4A 3UGWA 3U72A 4RPOA 4ZECA 1AL3A 5B70A 3PV0E 4O3AA 2I48A 3KSJA 2HFBA 4E0WA 1KWHA
chains in the Genus database with same CATH superfamily
1IQ7A 1PEBA 5L9OA 4N6DA 1K9ZA 5I58A 3E78A 4LONB 4FECA 5DVIA 1B2HA 1XI6A 4FORA 2QS1A 2ZYOA 4KXPA 4YB7A 4U1ZA 4GXSB 3KOSA 3TKDA 1P1OA 3LUYA 1IXCA 4P3LA 5I2NB 4OANA 1NV5A 1M5EA 3C31A 5ICTA 1FRPA 1NUWA 4ZEFA 4NWCA 4U22A 1H45A 3K1MA 2AL4A 2OWTA 4Q0CA 4ELQA 4NF6A 3B7DA 1ELJA 1SW2A 4NF5A 4GBVA 3FGSA 3TELA 3CI8A 5CRYA 5F1QA 2RKMA 2L5VA 4F3PA 2OWZA 3O9PA 2E0SA 5ELVA 3TTMA 2VPOA 2UXAA 2VD2A 4PFYA 3PUVE 4UA8A 3DRJA 1ZJLA 4MCOA 4N13A 4DXUA 4HCYA 4H45A 1TWYA 4KQPA 5CBSA 4P47A 2UYEA 1B3GA 1IIWA 5I84A 5LTCA 3G3GA 1KA0A 1YAEA 3O6GA 4ZE8A 2XXQA 5BWJA 2Q74A 2Y7WA 1DMBA 4NEDA 1MQGA 1YPNA 3L6HA 4PCDA 5CBRA 2CZKA 4IY5A 1HSJA 3TCFA 3OXNA 4H67A 3CFLA 5HM4B 1XOCA 4QSEA 5K2YA 4YKJA 3G3IA 1MY2A 3Q28A 2BJIA 2CEXA 3QAXA 4PGNA 4PC9A 5J16A 4RA1A 3LSLA 5CMMA 4Z7EA 2RC9A 3IOUA 4LVQA 2XX8A 3BIGA 4JVCA 2VP1A 5TPAB 4HW8A 4EXLA 1MY0A 1LFIA 3VVEA 3OO9A 4YICA 1RDYA 1TFAA 4GBWA 4AQ4A 5AA2D 1NL5A 2PX1A 3RT6B 3FV1A 2ZYNA 3OO6A 3EPEA 4P0GA 3IFCA 1JP4A 1KZ8A 4OERA 2QVVA 4OHNA 1WDNA 5FTHA 2HZLA 3H03A 2ZZVA 2HCAA 3K6WA 5EQ7A 1FQFA 3EKIA 3E13X 1G0IA 1D3KA 3DM0A 4P9KA 1FBDA 5FHOA 4PFRA 2VPNA 1O64A 3N6TA 5JEIA 1QKAA 3VDFA 1MQHA 4FBPA 3PTYA 4BDRA 1MY1A 3O29A 1FCKA 5TPAA 3CR9A 3H6VA 5I2KA 4P11A 1MXUA 1AIVA 3V8XB 3R7XA 4XKPA 1ZLQA 4TOZA 2H5YA 2UVIA 5H8HA 2R6GE 2R9JA 3EF7A 4TLMB 3QIMA 2DSFA 4MX6A 1MM6A 1ANFA 1DPEA 1IMAA 2WYPA 1RYOA 4OEUA 1I6AA 2KLFA 2O1LA 1MPCA 3V5AA 2RINA 3H3GA 4YKKA 4KYDA 1XVYA 2XXHA 4R6HA 1B3EA 1USYH 4ELOA 1SD3A 3G3HA 3CFZA 4DDDA 2UVGA 1B6HA 3O28A 1B9JA 3VE1B 5A5XB 5DW8A 2UVHA 2FYIA 2WEFA 2ZNUA 3T66A 1OLAA 5ITPA 1M5CA 2VT5A 3C4MA 4U4XA 4YAHX 4AS4A 5F24A 4DXBA 2O84X 4XTCQ 3OO8A 2A5TB 2D21A 1N7WA 2WX9A 1JVYA 4FEDA 1R9LA 4P1LA 5EYHA 4HE1A 3O97A 2ESNA 2DS9A 4PFBA 4H5GA 5I5PA 1JW4A 4O3BA 2QS4A 5TU0A 2LAOA 5L8DA 1T0KA 3TCHA 3ONMA 3O6PA 3KSXA 4PFIA 4IO7A 4R6KA 5I59B 4GWWA 3DRHA 4QF9A 3BKIB 4DXCA 2P1SA 1D9VA 2UVJA 1DTZA 3PPRA 2CZIA 4NN3A 1KA1A 3OOAA 1P1UA 4R9GA 1LAGE 2A5TA 2OWSA 1FPLA 1FTAA 1JNFA 3IO6A 3S4UA 1MH3A 4WEDA 3VV5A 1LFHA 2DE4A 5I7IA 4OXVA 2ZNTA 2HHMA 2QS3A 4PBQA 3MW0A 3VXBA 2Q89A 5CMBA 4QSDA 4DLDA 4OFOA 3MAMA 4R9FA 1FPKA 2V4CA 3VLUA 2Q8JA 1ZMGA 3T9VA 4PDHA 3B50A 2GHBA 3PD8A 2FNCA 4NF4B 5FTIA 4G8HA 4QHQA 5CMCA 2A5SA 2Q88A 3I5OA 4KI0E 4ELPA 1JETA 1Y20A 2I4CA 3ZS6A 1HSLA 2XD2A 3TTRA 1Q9DA 2R8TA 2W7YA 2QVUA 1JEUA 3PU5A 1FBCA 3IL1B 3C36A 3KG2A 4U21A 4MNIA 3U92A 1B1HA 4OENA 5HPQA 4I8CA 2Y5KA 1B58A 2H98A 2XD3A 1TXFA 1YZ0A 4F1YA 4HXVA 5J1DA 4PTKA 4G68A 4NE4A 1MQDA 3SKPA 3H4ZA 4GX6A 4PGPA 4I40A 4NAPA 4GFRA 4JWOA 1B3FA 1NV1A 1Y3NA 3KJ7A 5IAIA 2O68A 3UORA 5JTYA 1B51A 4YB5A 3T0JA 3FJGA 5AA4B 3FATA 4RJZA 4Q5TA 4UABA 1PC3A 3S9LC 4QFOA 4EF1A 3GBBA 2X7QA 3A09A 2YLNA 4GWSA 2Z8FA 1FBPA 4O7MA 3T22A 1US5A 3LSWA 3N94A 1P1WA 5CM6A 2PMSA 4ESXA 4XFEA 4IO3A 4H0WA 3PPNA 2ZYKA 5IGAA 3ILTB 4GX3A 1UTHB 3MQ9A 4MLQA 1B7HA 1BTJA 4FEBA 2NXOA 1DBZA 2WBBA 4F3BA 4U2RA 1NV3A 4YMBA 3KN3A 3M3KA 4R72A 2HQ0A 4PBHA 4X1BA 2V3QA 4C1TA 1JQFA 3T9UA 1QULA 1NH8A 3TMGA 5AA4A 3K4UA 4OVSA 1MG1A 3G3KA 4X9TA 3S9NC 2DWAA 2ABHA 3RLFE 4O7IA 4FATA 3M3FA 4I3YA 4GLIA 3FVNA 2WBDA 3IAZA 5B7DA 4ONYA 4QFKA 4RNSA 4DIGA 1UTBA 1LLSA 3CHGA 1FBHA 5H8QB 4WKMA 5KZTA 2RC8A 3GBAA 4MAGA 1QW0A 4H8IA 1IITA 3LSFB 4KPTA 4O8MA 5L9SA 1B5JA 1B46A 1FQBA 2I4BA 4H5FA 1SI1A 1NV4A 4ZS9A 3VLWA 2AIXA 2V3TA 4DCXA 4MMPA 2DWIA 2DWJA 1DCUA 1XS5A 4ESWA 3FASA 2MKZA 2F8DA 1RYXA 2Q2AA 4GOTA 2IEEA 3U65A 3LSXA 2PYYA 4LQ2A 1URGA 2OLBA 4BDOA 2Q9TA 1N84A 3SEYA 4I9DA 3MVXA 5ET8A 5H8QA 3TFLA 4Q30B 1OVBA 3GZGA 2O7UA 3PPOA 2WYKA 3IOWA 3K2DA 2ZZXA 2KQZA 2DDKA 5EHSA 4DI3D 1F9BA 3OD7A 4GD5A 4PAIA 1M5DA 5FBPA 1LGBC 4QXDA 4PF6A 3HO7A 1SVXB 1OVTA 3IO4A 3RN8A 1DK4A 4EXKA 1D4NA 3I6VA 1MPBA 1Y4TA 1A55A 4HE2A 1RKMA 2Y7IA 3FJMA 4MJOA 1YCJA 4DE8A 1YTVA 4NWDA 3B6QA 5ET5A 4ECFA 5DEXB 3SEVA 3N26A 2P2AA 4JDFA 2REJA 3SESA 2VGQA 3MPKA 4YB6A 5I2NA 4N07A 1FBFA 3ISPA 3MJNA 1MXVA 3KFMA 3QK6A 3SETA 4F3SA 3FXBA 4GWOA 1DSNA 3L6GA 1A8FA 2ANJA 2M8CA 1Z7ME 4IGTA 2PT1A 3SEUA 4R6YA 2I0BA 4WEPA 3U1OA 1VFEA 4PF8A 3M8UA 3K00A 2PBWA 1WODA 5L9MA 4IY6A 3BIHA 4RK2A 4LN5A 3UIFA 2CZHA 4OZ9A 5ET7A 3CFXA 5KDTB 4GQOA 4H65A 4NTLA 1Y1MA 3F11A 3HV1A 1URDA 1FJ6A 5FHMA 2XXIA 5DVJA 3TUSA 3RYAA 3ROJA 3PMWA 4THIA 1IMFA 2RC7A 4TLLB 4MFIA 3QXMA 5BUUA 1US4A 1B5IA 1JEVA 4QSCA 2QMWA 1O63A 3MP1A 3CIJA 4PFWA 5DYHA 4XKNA 1J1NA 4F39A 1FPBA 3LVUA 3KJTA 1NNKA 5TP9B 1EH3A 5M2VA 3DP6A 5AA2B 3PMXA 2P3NA 2I6EA 4YKIA 1FBEA 1UQWA 2DOJA 3HSTA 3O2AA 3FXRA 3RPLB 3TQWA 3KEIA 4FJPA 5A5LA 4OESA 1LSTA 2F97A 5FHNA 5KCJB 5IZ3B 4ZZAA 4RY1A 1A7LA 2H99A 4GXAA 3H7MA 5H8FB 3EQ1A 2F7CA 4OVRA 1QGXA 4EF2A 4N8YA 3IB0A 2F35A 3IOTA 2XWKA 3EHUA 4OTEA 2VD3A 1LBYA 2Q2CA 3HHFA 1JW5A 3VVDA 1RDZA 3I3VA 3SEWA 5TP9A 1NV0A 4ZEBA 1N3XA 3RTWB 1EYJA 2RCAA 3N6UA 4KCDA 1B7UA 4BDMA 5LOMA 3THIA 4KYEA 3LBSA 3RPLA 5AA3A 4F22A 1OQHA 1B52A 1MDQA 4GRKA 4G2ZA 2G93A 5H8FA 3CG3A 2XXVA 3NOHA 3IB2A 4OMBA 3MPLA 3CRBA 2QS2A 2ONRA 1NUXA 3O66A 3PUXE 3KZGA 1B7ZA 5ICQA 2F6GA 3CVGA 5CI5A 1BP5A 3T1BA 3BFUA 4NG7A 1P1QA 3HPIA 4PAFA 1JW1A 2HEUA 4R2BA 4GVOA 3HFUA 4N91A 4MNCA 1S7YA 3H6TA 1D9YA 2I58A 4N81A 1FQDA 1FQAA 3H6WA 4E0XA 3RT8A 1POTA 4NF0A 4MIJA 1I6BA 5A5XA 4R74A 3U93A 3FTOA 5EYFA 3T93B 4FAJA 4XKRA 2O6AA 4HCWA 4MEVA 1TT1A 1N76A 3N5LA 3MVYA 2V93A 4KHZE 2BJJX 1A40A 3GYYA 4RXLA 1POY1 2XXYA 3FIRA 1EYKA 4JSDA 2B3FA 5IZZA 1AWBA 1QKBA 1LAHE 4EUOA 1CNQA 5DTBA 1SI0A 4GX4A 3ECRA 1FPEA 2XXWA 4YMAA 3VXCA 3ZSFA 3E3KA 1B3HA 1H43A 2ZMBA 1MXZA 4L17A 3K02A 1EZOA 3O6HA 5I59A 3RTFB 4ZE9A 1NUZA 1MM7A 2WOPA 4OVQA 3ZKLA 4AS5A 1SDXA 4P0IA 4M1VA 4BDNA 4OEVA 4DZ1A 2OJTA 1OQGA 3LUZA 4PE5B 4R2FA 3IK6B 4IO5A 1GGGA 3IOVA 4Z0IA 5EQAA 1NMUA 2RCBA 2I3WA 4OYVA 4GWYA 4DCYA 3EHSA 3HHGA 1NNPA 3KBZA 2JJKA 4HS7A 4KCCA 1FQEA 3SDFA 2PFZA 3FBPA 3UN6A 1Y3QA 1ZIUA 2HPGA 3K6UA 4Q8RA 1B05A 1A54A 1MQJA 4OQOA 1MDP1 4KR5A 3DRFA 4I1DA 4AB5A 2B4MA 4JB7A 3JZJA 4NF4A 5F7VA 2FVZA 4ELRA 3TCGA 1MQIA 3DRGA 4POWA 4KD5A 4H8JA 3OENA 2O7IA 1N3WA 1PB7A 3UA8A 2XXKA 4LZ5A 2RF1A 2B65A 3C32A 3SZPA 1S50A 4N17A 2DE3A 1MXXA 3UP9A 4RYAA 1VE4A 2HXWA 3TTKA 3E79A 4YKPA 1P1NA 1JVXA 2HAVA 1USYE 3KOTA 1L5TA 4BDLA 1LBVA 3FZVA 3MVWA 3MUQA 3VFJA 3PUYE 3K0VA 3TAJA 2QSXA 2OK2A 3UK4A 4R73A 4R75A 5EHMA 1LBBA 1OLCA 3FVOA 2O69A 3FXUA 3HCQA 2XA5A 3P7IA 3PAMA 3PD9A 4MHFA 5AE4A 4QFNA 2WOKA 1TFDA 4EDPA 3RYDA 3RUMA 1XVXA 4MLVA 2G29A 2YJPA 2Y7PA 2F36A 4LZ7A 4OA4A 3IFAA 4OVTA 2V84A 1VSOA 2XWVA 1LAXA 3A29A 2XX9A 4I3EA 3KN8A 4O3CA 1B4HA 2IA4A 2F7AA 1SW1A 1FPGA 1BIYA 5EQ8A 2F3BA 3MZ9A 1H3DA 4JVIA 2XWIA 2DXYA 1B3LA 1N04A 1LBZA 4N15A 1UTHA 5ET6A 1FPFA 3PPPA 3LR1A 2UYFA 4ZEDA 4OWDA 3RY3A 1MS7A 4G4PA 4XF5A 3E9XA 1UIUA 1OMPA 4UACA 1IEJA 4QBAA 2CZLA 4OFLA 3C33A 3OSRA 3TQLA 4YZZA 3S9MC 2PCRA 4NHBA 4HTGA 2XXPA 1ATGA 3PGFA 2FA7A 3QSLA 1II5A 1RDXA 1FTOA 2DE2A 4H6DA 4K3FA 1NNTA 2OCUA 4NX1A 3DP4A 3VLVA 2GQ1A 4BLAA 2DVCA 1A8EA 1LB8A 4JSOA 4MF3A 3MC2A 1EYIA 1QUJA 4P8BA 2ONSA 5EYGA 4O94A 4N6PA 4U4SA 1IXHA 4LZ8A 2HAUA 2GHAA 4ND9A 1AMFA 1Y4CA 2CMOA 2D3IA 4GF8A 1B0HA 4G8NA 1Q1KA 3PUWE 4GIZA 4JXIA 3MBPA 1HSEA 4KFQA 3IX1A 3S9EA 1MRPA 3OEKA 4GWZA 1CB6A 1URSA 1LB9A 4TQUQ 4OVPA 3T9XB 3MSTA 4FIMA 2DQVA 2XX7A 1IMDA 1LCTA 2F5XA 4ISUA 2DYXA 4XEQA 3K6XA 5T3JA 3MZ1A 1P99A 1SBPA 4F18A 2GRVA 3OELA 3IR1A 4U1OA 1G0HA 4P1EA 5I3SA 1FPDA 2NOOA 1Y1ZA 3D1RA 2Y7RA 1N7XA 1YYZA 5I57B 1Z7NE 3MZBA 5CC2A 1NV2A 1PBQA 3A3CA 5DVFA 2H25A 1B5HA 3Q27A 3TZAA 2OBGA 4EQ7A 5H8SA 5DEXA 2F34A 3QYTA 4QFPA 1FQCA 1ZBMA 3R6UA 4MH5A 4QFLA 1MH4A 3IJOB 1DPPA 4NQ8A 1K9YA 1LCFA 2NUVA 1QUKA 5I56B 4ZZEA 2NVUB 3W9VA 2QMXA 2VHAA 2FBPA 4DI4B 1IUDA 3B8BA 3MWBA 3KN7A 1QVSA 1ZU0A 5I57A 2V3UA 5H8NB 4JVDA 3IJXB 2Y84A 2Y7KA 4PE3A 5ITOA 1FTMA 1YXIA 4OVJA 4POXA 5I2KB 4LP2B 1BK4A 3TYHA 1WVJA 5KDTA 4G68C 4LUBA 3WAFA 4OFJA 1VDWA 1O7TA 3VVFA 3S2VA 4X04A 3ZKKA 3IORA 5H8HB 3DRIA 3OSQA 1MY3A 4IO6A 1SPIA 4M4GA 1FTKA 3RYBA 5I56A 2Z8EA 3D4GA 1NUYA 5LDZA 1EZ9A 4F2QA 1XT8A 3V83A 4ZDMA 3SERA 2QRYA 1AH5A 3C34A 5IZ1A 3TEPA 4PP0A 5H8NA 2Q8MA 3K1NA 2WKYA 3E4RA 1IZ1A 4F3GA 1GV8A 5AA2A 2GH9A 1ZKBA 3DP8A 3KBRA 3WAEA 2PVUA 3LC8A 3OEMA 3CG1A 4F19A 3JV9A 2XHDA 1LBXA 2XXUA 5KCJA 5IZ3A 3ODBA 2XXRA 4F1UA 1NNFA 2QVRA 4F2OA 2ALUA 2PT2A 2FHYA 1XHYA 2ONKE 1IMCA 1LBCA 1I6QA 4U23A 3FXQA 4PQJA 3DRKA 1LBWA 3M3LA 4GL8A 2P3VA 3U8QA 4PFUA 1PDAA 1SW5A 2THIA 4IO4A 4EQBA 3ILUB 1Y9UA 3TPAA 3PUZE 1FTJA 4XIGQ 3RQTA 3TTNA 1FPIA 4N6KA 4FE8A 3B6TA 1EZPA 1NV7A 1R1NA 2CEYA 4MBPA 1ZTYA 1DTGA 4NMYA 4GWUA 1NKXA 5EQ9A 1B0LA 4H1XA 1MPDA 1INPA 3OMBA 4EQ9A 1MXYA 4X48A 1B1XA 5K2XA 3USDA 1B32A 2HZKA 2OX3A 1SYHA 4OETA 4LATA 1R9QA 2DVZA 1LFGA 1VR5A 1I69A 1NH7A 4IB2A 3Q26A 3FVKA 2QL3A 4G77A 3OO7A 1CE2A 1IXIA 3TDJA 1N0TA 1B4ZA 2ZNSA 2QPQA 3W15C 3Q29A 3R26A 2X26A 3HN0A 2I3VA 1BLFA 1R6ZA 4GL0A 2ZXTA 1NV6A 1FTLA 2O1MA 1UIVA 1D9QA 4LA9A 3MVZA 4G68B 4LQ5A 4P56A 3EN3A 1M5BA 3IB1A 4F29A 4XKQA 1EU8A 1VFDA 2FIEA 3RPWA 3CSGA 1LAFE 3AXFA 3FV2A 2PFYA 5ISUA 1BKAA 3H6UA 3EHTA 3FUZA 3QMFA 3B6WA 4JBZA 4N8GA 3PMVA 5JTYB 3KC0A 3H06B 1M5FA 4MNPA 4C0RA 1XC1A 2I49A 2AL5A 4NGUA 2ZZWA 4ZEIA 3CSBA 2F3DA 2DXRA 1DOTA 2R71A 2D5WA 3O6IA 3U94A 2DWHA 2E1SA 3BBRA 1H44A 4PFTA 2Z22A 1Y3PA 4G8MA 3T96B 2DP8A 3QUFA 2FIXA 4ZEKA 5DT6A 3BFTA 4PDDA 3MP6A 1GTKA 1PB9A 2O51A 4F1VA 1SYIA 3DLNA 4BDQA 1IMEA 3MYUA 4PAKA 2H4IA 3A3UA 3KC1A 4XXUA 2AYSA 3DELB 4RK9A 1QJMA 3FJ7A 1PB8A 4AB6A 2F7BA 2Z23A 3K01A 3RGYA 3G3JA 3SEXA 1FW0A 3G7WA 3TTLA 4I62A 2H9BA 1H76A 5ESYA 2QJEA 4QRZA 2X7PA 1GR2A 4NF8B 1SW4A 3D4CA 2F78A 1UTBB 2WOLA 4GWXA 5AA1A 2B4LA 4F31B 4HE0A 2Z8DA 3K6VA 1S9TA 2V25A 3K1PA 3TODA 2VOZA 1QUIA 1LEVA 5CMKA 1FJ9A 2KR0A 1GVCA 4KYSA 3GLBA 4YU0A 2YPNA 3KGCA 3FD3A 4PETA 4X8RA 3QUJA 2REGA 1NFTA 2B3BA 3PPQA 2GFEA 1AOVA 4WXJA 3Q25A 4H46A 2P0SA 2F6PA 4IO2A 4IR8A 3RNNA 2ZYMA 5HBCA 3MP8A 1Q35A 2OZZA 1FBGA 2Y5LA 5I58B 5IM2A 1IMBA 2HXRA 4NF8A 2XWOA 3C35A 3GXAA 4JWYA 3V89B 1PBPA 1FPJA 1B40A 1MXWA 3C9HA 3FVGA 3T9HB 3W9WA 5IKBA 2NWJA 2XXTA 1A99A 3G3FA 1OIBA 2XXXA 3JYRA 4IGRA 1MY4A 4C1UA 4JWXA 1SQYA 1IXGA 1NI9A 4NF6B 2I0CA 4NF5B 4G61A 1FSAA 4RPNA 4X1DA 5JK4A 3UGWA 3U72A 4RPOA 4ZECA 1AL3A 2QFLA 5B70A 3PV0E 4O3AA 2I48A 3KSJA 2HFBA 3LV0A 4E0WA 1KWHA 4N4UA
chains in the Genus database with same CATH topology
1IQ7A 1PEBA 5L9OA 5I58A 4LONB 4FECA 5DVIA 1B2HA 4FORA 2QS1A 2ZYOA 4YB7A 4U1ZA 4GXSB 3KOSA 3TKDA 1P1OA 3LUYA 1IXCA 5I2NB 1M5EA 3C31A 5ICTA 4ZEFA 4NWCA 4U22A 1H45A 3K1MA 2AL4A 2OWTA 4Q0CA 4ELQA 4NF6A 3B7DA 1ELJA 1SW2A 4NF5A 3FGSA 3TELA 3CI8A 5CRYA 5F1QA 2RKMA 4F3PA 3O9PA 2E0SA 5ELVA 3TTMA 2UXAA 2VD2A 4PFYA 3PUVE 4UA8A 3DRJA 1ZJLA 4N13A 4DXUA 4HCYA 1TWYA 4KQPA 5CBSA 2UYEA 1B3GA 1IIWA 5I84A 3G3GA 1YAEA 3O6GA 4ZE8A 2XXQA 5BWJA 2Y7WA 1DMBA 4NEDA 1MQGA 1YPNA 3L6HA 5CBRA 4IY5A 1HSJA 3TCFA 3OXNA 4H67A 3CFLA 5HM4B 1XOCA 4QSEA 5K2YA 4YKJA 3G3IA 1MY2A 3Q28A 3QAXA 4RA1A 3LSLA 5CMMA 4Z7EA 2RC9A 3IOUA 4LVQA 2XX8A 2VP1A 5TPAB 4HW8A 4EXLA 1MY0A 1LFIA 3VVEA 3OO9A 4YICA 1TFAA 4AQ4A 5AA2D 1NL5A 2PX1A 3RT6B 3FV1A 2ZYNA 3OO6A 3EPEA 4P0GA 4OERA 4OHNA 1WDNA 5FTHA 2HZLA 3H03A 2HCAA 3K6WA 1FQFA 3E13X 1D3KA 3DM0A 5FHOA 1O64A 3N6TA 5JEIA 1QKAA 3VDFA 1MQHA 4BDRA 1MY1A 3O29A 1FCKA 5TPAA 3CR9A 3H6VA 5I2KA 4P11A 1MXUA 1AIVA 3V8XB 3R7XA 4XKPA 1ZLQA 4TOZA 2H5YA 2UVIA 5H8HA 2R6GE 2R9JA 3EF7A 4TLMB 3QIMA 2DSFA 1MM6A 1ANFA 1DPEA 1RYOA 4OEUA 1I6AA 2KLFA 2O1LA 1MPCA 3V5AA 2RINA 3H3GA 4YKKA 4KYDA 1XVYA 2XXHA 4R6HA 1B3EA 1USYH 4ELOA 1SD3A 3G3HA 3CFZA 4DDDA 2UVGA 1B6HA 3O28A 1B9JA 3VE1B 5A5XB 2UVHA 2FYIA 2ZNUA 3T66A 1OLAA 5ITPA 1M5CA 3C4MA 4U4XA 4YAHX 4DXBA 2O84X 4XTCQ 3OO8A 2A5TB 2D21A 1N7WA 1JVYA 4FEDA 1R9LA 3O97A 2ESNA 2DS9A 4H5GA 1JW4A 4O3BA 2QS4A 5TU0A 2LAOA 5L8DA 1T0KA 3TCHA 3ONMA 3O6PA 3KSXA 4IO7A 4R6KA 5I59B 3DRHA 4QF9A 3BKIB 4DXCA 2P1SA 1D9VA 2UVJA 1DTZA 3PPRA 3OOAA 1P1UA 4R9GA 1LAGE 2A5TA 2OWSA 1JNFA 3IO6A 3S4UA 1MH3A 4WEDA 3VV5A 1LFHA 2DE4A 4OXVA 2ZNTA 2QS3A 3MW0A 3VXBA 2Q89A 5CMBA 4QSDA 4DLDA 4OFOA 3MAMA 4R9FA 3VLUA 2Q8JA 1ZMGA 3T9VA 2GHBA 3PD8A 2FNCA 4NF4B 5FTIA 4G8HA 4QHQA 5CMCA 2A5SA 2Q88A 3I5OA 4KI0E 4ELPA 1JETA 1Y20A 2I4CA 3ZS6A 1HSLA 2XD2A 3TTRA 2W7YA 1JEUA 3PU5A 3IL1B 3C36A 3KG2A 4U21A 3U92A 1B1HA 4OENA 5HPQA 4I8CA 1B58A 2H98A 2XD3A 1TXFA 4F1YA 5J1DA 4G68A 4NE4A 1MQDA 3SKPA 3H4ZA 4GFRA 4JWOA 1B3FA 1Y3NA 3KJ7A 5IAIA 2O68A 3UORA 5JTYA 1B51A 4YB5A 3FJGA 5AA4B 3FATA 4RJZA 4Q5TA 1PC3A 3S9LC 4QFOA 4EF1A 3GBBA 2X7QA 3A09A 2YLNA 2Z8FA 3T22A 1US5A 3LSWA 3N94A 1P1WA 5CM6A 2PMSA 4ESXA 4IO3A 4H0WA 3PPNA 2ZYKA 3ILTB 1UTHB 3MQ9A 4MLQA 1B7HA 1BTJA 4FEBA 2NXOA 4F3BA 4U2RA 4YMBA 3KN3A 3M3KA 4R72A 2HQ0A 4X1BA 2V3QA 4C1TA 1JQFA 3T9UA 1QULA 1NH8A 3TMGA 5AA4A 3K4UA 1MG1A 3G3KA 4X9TA 3S9NC 2DWAA 2ABHA 3RLFE 4FATA 3M3FA 4GLIA 3FVNA 3IAZA 5B7DA 4ONYA 4QFKA 4RNSA 4DIGA 1UTBA 1LLSA 3CHGA 5H8QB 4WKMA 5KZTA 2RC8A 3GBAA 1QW0A 4H8IA 1IITA 3LSFB 4KPTA 5L9SA 1B5JA 1B46A 1FQBA 2I4BA 4H5FA 1SI1A 4ZS9A 3VLWA 2AIXA 2V3TA 4DCXA 2DWIA 2DWJA 1XS5A 4ESWA 3FASA 2F8DA 1RYXA 2Q2AA 4GOTA 2IEEA 3LSXA 2PYYA 4LQ2A 1URGA 2OLBA 4BDOA 2Q9TA 1N84A 3SEYA 4I9DA 3MVXA 5H8QA 3TFLA 1OVBA 4Q30B 3GZGA 2O7UA 3PPOA 3IOWA 3K2DA 5EHSA 1F9BA 3OD7A 4GD5A 1M5DA 1LGBC 3HO7A 1SVXB 1OVTA 3IO4A 3RN8A 4EXKA 1D4NA 3I6VA 1MPBA 1Y4TA 1A55A 1RKMA 2Y7IA 3FJMA 1YCJA 4DE8A 1YTVA 4NWDA 3B6QA 4ECFA 5DEXB 3SEVA 3N26A 2P2AA 4JDFA 2REJA 3SESA 2VGQA 3MPKA 4YB6A 5I2NA 4N07A 3MJNA 1MXVA 3KFMA 3QK6A 3SETA 4F3SA 4GWOA 1DSNA 3L6GA 1A8FA 2ANJA 2M8CA 1Z7ME 4IGTA 2PT1A 3SEUA 4R6YA 2I0BA 4WEPA 3U1OA 1VFEA 3M8UA 3K00A 2PBWA 1WODA 5L9MA 4IY6A 4RK2A 3UIFA 4OZ9A 3CFXA 5KDTB 4GQOA 4H65A 4NTLA 1Y1MA 3F11A 3HV1A 1URDA 5FHMA 2XXIA 5DVJA 3TUSA 3RYAA 3PMWA 4THIA 2RC7A 4TLLB 4MFIA 3QXMA 5BUUA 1US4A 1B5IA 1JEVA 4QSCA 2QMWA 1O63A 3MP1A 3CIJA 4PFWA 5DYHA 4XKNA 1J1NA 4F39A 3LVUA 3KJTA 1NNKA 5TP9B 1EH3A 5M2VA 3DP6A 5AA2B 3PMXA 2I6EA 4YKIA 1UQWA 2DOJA 3HSTA 3O2AA 3FXRA 3TQWA 3KEIA 4FJPA 4OESA 1LSTA 2F97A 5FHNA 5KCJB 4ZZAA 4RY1A 1A7LA 2H99A 4GXAA 3H7MA 5H8FB 3EQ1A 2F7CA 4EF2A 3IB0A 2F35A 3IOTA 3EHUA 4OTEA 2VD3A 2Q2CA 3HHFA 1JW5A 3VVDA 3I3VA 3SEWA 5TP9A 4ZEBA 1N3XA 3RTWB 2RCAA 3N6UA 4KCDA 1B7UA 4BDMA 5LOMA 3THIA 4KYEA 3LBSA 5AA3A 4F22A 1OQHA 1B52A 1MDQA 4GRKA 4G2ZA 2G93A 5H8FA 3CG3A 2XXVA 3IB2A 4OMBA 3MPLA 3CRBA 2QS2A 2ONRA 3O66A 3PUXE 3KZGA 1B7ZA 5ICQA 2F6GA 3CVGA 5CI5A 1BP5A 3BFUA 1P1QA 3HPIA 1JW1A 2HEUA 4R2BA 4GVOA 1S7YA 3H6TA 1D9YA 2I58A 1FQDA 1FQAA 3H6WA 4E0XA 3RT8A 1POTA 1I6BA 5A5XA 4R74A 3U93A 3FTOA 5EYFA 3T93B 4FAJA 4XKRA 2O6AA 4HCWA 1TT1A 1N76A 3N5LA 3MVYA 2V93A 4KHZE 2BJJX 1A40A 4RXLA 1POY1 2XXYA 3FIRA 4JSDA 2B3FA 1QKBA 1LAHE 4EUOA 5DTBA 1SI0A 3ECRA 2XXWA 4YMAA 3VXCA 3ZSFA 3E3KA 1B3HA 1H43A 2ZMBA 1MXZA 4L17A 3K02A 1EZOA 3O6HA 5I59A 3RTFB 4ZE9A 1MM7A 2WOPA 3ZKLA 1SDXA 4P0IA 4M1VA 4BDNA 4OEVA 4DZ1A 2OJTA 1OQGA 4PE5B 4R2FA 3IK6B 4IO5A 1GGGA 3IOVA 4Z0IA 1NMUA 2RCBA 2I3WA 4OYVA 4DCYA 3EHSA 3HHGA 1NNPA 4HS7A 4KCCA 1FQEA 3SDFA 3UN6A 1Y3QA 1ZIUA 3K6UA 4Q8RA 1B05A 1A54A 1MQJA 4OQOA 1MDP1 4KR5A 3DRFA 4I1DA 4AB5A 2B4MA 4JB7A 3JZJA 4NF4A 5F7VA 4ELRA 3TCGA 1MQIA 3DRGA 4POWA 4KD5A 4H8JA 3OENA 2O7IA 1N3WA 1PB7A 3UA8A 2RF1A 4LZ5A 2B65A 3C32A 1S50A 2DE3A 1MXXA 3UP9A 4RYAA 1VE4A 2HXWA 3TTKA 4YKPA 1P1NA 1JVXA 2HAVA 1USYE 3KOTA 1L5TA 4BDLA 3FZVA 3MVWA 3MUQA 3VFJA 3PUYE 3K0VA 3TAJA 2QSXA 2OK2A 3UK4A 4R73A 4R75A 5EHMA 1LBBA 1OLCA 3FVOA 2O69A 3FXUA 3HCQA 3P7IA 3PAMA 3PD9A 5AE4A 4QFNA 2WOKA 1TFDA 4EDPA 3RUMA 1XVXA 4MLVA 2G29A 2YJPA 2Y7PA 2F36A 4LZ7A 2V84A 1VSOA 1LAXA 2XX9A 3KN8A 4O3CA 1B4HA 2IA4A 2F7AA 1SW1A 1BIYA 3MZ9A 1H3DA 2DXYA 1B3LA 1N04A 1UTHA 3PPPA 3LR1A 2UYFA 4ZEDA 4OWDA 3RY3A 1MS7A 4G4PA 3E9XA 1UIUA 1OMPA 4UACA 1IEJA 2CZLA 4OFLA 3C33A 3OSRA 3TQLA 4YZZA 3S9MC 4HTGA 2XXPA 1ATGA 3PGFA 2FA7A 3QSLA 1II5A 1FTOA 2DE2A 4H6DA 4K3FA 1NNTA 2OCUA 3DP4A 3VLVA 4BLAA 2DVCA 1A8EA 4JSOA 1LB8A 4MF3A 3MC2A 1QUJA 2ONSA 4N6PA 4U4SA 1IXHA 4LZ8A 2HAUA 2GHAA 4ND9A 1AMFA 1Y4CA 2CMOA 2D3IA 4GF8A 1B0HA 4G8NA 1Q1KA 3PUWE 4GIZA 4JXIA 3MBPA 1HSEA 4KFQA 3IX1A 3S9EA 1MRPA 3OEKA 1CB6A 1URSA 1LB9A 4TQUQ 3T9XB 4FIMA 2DQVA 2XX7A 1LCTA 2F5XA 4ISUA 2DYXA 3K6XA 3MZ1A 1P99A 1SBPA 4F18A 2GRVA 3OELA 3IR1A 4U1OA 2NOOA 1Y1ZA 2Y7RA 1N7XA 5I57B 1Z7NE 3MZBA 5CC2A 1PBQA 3A3CA 5DVFA 2H25A 1B5HA 3Q27A 3TZAA 2OBGA 4EQ7A 5H8SA 5DEXA 2F34A 3QYTA 4QFPA 1FQCA 1ZBMA 3R6UA 4MH5A 4QFLA 1MH4A 3IJOB 1DPPA 1LCFA 2NUVA 1QUKA 5I56B 4ZZEA 2NVUB 3W9VA 2QMXA 2VHAA 1IUDA 3MWBA 3KN7A 1QVSA 1ZU0A 5I57A 2V3UA 5H8NB 3IJXB 2Y84A 2Y7KA 5ITOA 1FTMA 4OVJA 4POXA 5I2KB 4LP2B 3TYHA 1WVJA 5KDTA 4G68C 4LUBA 3WAFA 4OFJA 1O7TA 3VVFA 3S2VA 3ZKKA 3IORA 5H8HB 3DRIA 3OSQA 1MY3A 4IO6A 4M4GA 1FTKA 3RYBA 5I56A 2Z8EA 3D4GA 1EZ9A 4F2QA 1XT8A 3V83A 4ZDMA 3SERA 2QRYA 1AH5A 3C34A 3TEPA 4PP0A 5H8NA 3K1NA 2WKYA 3E4RA 1IZ1A 4F3GA 1GV8A 5AA2A 2GH9A 1ZKBA 3DP8A 3KBRA 3WAEA 2PVUA 3LC8A 3OEMA 3CG1A 4F19A 3JV9A 2XHDA 2XXUA 5KCJA 3ODBA 2XXRA 4F1UA 1NNFA 4F2OA 2ALUA 2PT2A 1XHYA 2ONKE 1LBCA 1I6QA 4U23A 3FXQA 4PQJA 3DRKA 3M3LA 4GL8A 3U8QA 4PFUA 1PDAA 1SW5A 2THIA 4IO4A 4EQBA 3ILUB 1Y9UA 3TPAA 3PUZE 1FTJA 4XIGQ 3RQTA 3TTNA 4FE8A 3B6TA 1EZPA 1R1NA 4MBPA 1ZTYA 1DTGA 4NMYA 1NKXA 1B0LA 4H1XA 1MPDA 3OMBA 4EQ9A 1MXYA 4X48A 1B1XA 5K2XA 3USDA 1B32A 2HZKA 1SYHA 4OETA 4LATA 1R9QA 2DVZA 1LFGA 1VR5A 1I69A 1NH7A 4IB2A 3Q26A 3FVKA 2QL3A 4G77A 3OO7A 1CE2A 1IXIA 3TDJA 1N0TA 1B4ZA 2ZNSA 2QPQA 3W15C 3Q29A 3R26A 2X26A 3HN0A 2I3VA 1BLFA 1R6ZA 4GL0A 2ZXTA 1FTLA 2O1MA 1UIVA 4LA9A 3MVZA 4G68B 4LQ5A 3EN3A 1M5BA 3IB1A 4F29A 4XKQA 1EU8A 1VFDA 3RPWA 3CSGA 1LAFE 3AXFA 3FV2A 5ISUA 1BKAA 3H6UA 3EHTA 3FUZA 3B6WA 4JBZA 3PMVA 5JTYB 3H06B 1M5FA 4C0RA 1XC1A 2I49A 2AL5A 4ZEIA 3CSBA 2DXRA 1DOTA 2R71A 2D5WA 3O6IA 3U94A 2DWHA 2E1SA 3BBRA 1H44A 4PFTA 2Z22A 1Y3PA 4G8MA 3T96B 2DP8A 3QUFA 4ZEKA 5DT6A 3BFTA 3MP6A 1GTKA 4F1VA 1PB9A 2O51A 1SYIA 3DLNA 4BDQA 2H4IA 3A3UA 4XXUA 2AYSA 3DELB 4RK9A 1QJMA 3FJ7A 1PB8A 4AB6A 2F7BA 2Z23A 3K01A 3RGYA 3G3JA 3SEXA 1FW0A 3G7WA 3TTLA 4I62A 2H9BA 1H76A 2QJEA 4QRZA 2X7PA 1GR2A 4NF8B 1SW4A 3D4CA 2F78A 1UTBB 2WOLA 5AA1A 2B4LA 4F31B 2Z8DA 3K6VA 1S9TA 2V25A 3K1PA 3TODA 2VOZA 1QUIA 5CMKA 1GVCA 4KYSA 3GLBA 4YU0A 2YPNA 3KGCA 3FD3A 4PETA 3QUJA 2REGA 1NFTA 2B3BA 3PPQA 2GFEA 1AOVA 4WXJA 3Q25A 2P0SA 2F6PA 4IO2A 3RNNA 2ZYMA 5HBCA 3MP8A 1Q35A 2OZZA 5I58B 4NF8A 3C35A 3GXAA 4JWYA 3V89B 1PBPA 1B40A 1MXWA 3C9HA 3FVGA 3T9HB 3W9WA 5IKBA 2NWJA 2XXTA 1A99A 3G3FA 1OIBA 2XXXA 3JYRA 4IGRA 1MY4A 4C1UA 4JWXA 1SQYA 1IXGA 4NF6B 2I0CA 4NF5B 4RPNA 4X1DA 5JK4A 3UGWA 3U72A 4RPOA 4ZECA 1AL3A 5B70A 3PV0E 4O3AA 2I48A 3KSJA 2HFBA 4E0WA 1KWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQ7 A;  1PEB A;  5L9O A;  5I58 A;  4LON B;  4FEC A;  5DVI A;  1B2H A;  4FOR A;  2QS1 A;  2ZYO A;  4YB7 A;  4U1Z A;  4GXS B;  3KOS A;  3TKD A;  1P1O A;  3LUY A;  1IXC A;  5I2N B;  1M5E A;  3C31 A;  5ICT A;  4ZEF A;  4NWC A;  4U22 A;  1H45 A;  3K1M A;  2AL4 A;  2OWT A;  4Q0C A;  4ELQ A;  4NF6 A;  3B7D A;  1ELJ A;  1SW2 A;  4NF5 A;  3FGS A;  3TEL A;  3CI8 A;  5CRY A;  5F1Q A;  2RKM A;  4F3P A;  3O9P A;  2E0S A;  5ELV A;  3TTM A;  2UXA A;  2VD2 A;  4PFY A;  3PUV E;  4UA8 A;  3DRJ A;  1ZJL A;  4N13 A;  4DXU A;  4HCY A;  1TWY A;  4KQP A;  5CBS A;  2UYE A;  1B3G A;  1IIW A;  5I84 A;  3G3G A;  1YAE A;  3O6G A;  4ZE8 A;  2XXQ A;  5BWJ A;  2Y7W A;  1DMB A;  4NED A;  1MQG A;  1YPN A;  3L6H A;  5CBR A;  4IY5 A;  1HSJ A;  3TCF A;  3OXN A;  4H67 A;  3CFL A;  5HM4 B;  1XOC A;  4QSE A;  5K2Y A;  4YKJ A;  3G3I A;  1MY2 A;  3Q28 A;  3QAX A;  4RA1 A;  3LSL A;  5CMM A;  4Z7E A;  2RC9 A;  3IOU A;  4LVQ A;  2XX8 A;  2VP1 A;  5TPA B;  4HW8 A;  4EXL A;  1MY0 A;  1LFI A;  3VVE A;  3OO9 A;  4YIC A;  1TFA A;  4AQ4 A;  5AA2 D;  1NL5 A;  2PX1 A;  3RT6 B;  3FV1 A;  2ZYN A;  3OO6 A;  3EPE A;  4P0G A;  4OER A;  4OHN A;  1WDN A;  5FTH A;  2HZL A;  3H03 A;  2HCA A;  3K6W A;  1FQF A;  3E13 X;  1D3K A;  3DM0 A;  5FHO A;  1O64 A;  3N6T A;  5JEI A;  1QKA A;  3VDF A;  1MQH A;  4BDR A;  1MY1 A;  3O29 A;  1FCK A;  5TPA A;  3CR9 A;  3H6V A;  5I2K A;  4P11 A;  1MXU A;  1AIV A;  3V8X B;  3R7X A;  4XKP A;  1ZLQ A;  4TOZ A;  2H5Y A;  2UVI A;  5H8H A;  2R6G E;  2R9J A;  3EF7 A;  4TLM B;  3QIM A;  2DSF A;  1MM6 A;  1ANF A;  1DPE A;  1RYO A;  4OEU A;  1I6A A;  2KLF A;  2O1L A;  1MPC A;  3V5A A;  2RIN A;  3H3G A;  4YKK A;  4KYD A;  1XVY A;  2XXH A;  4R6H A;  1B3E A;  1USY H;  4ELO A;  1SD3 A;  3G3H A;  3CFZ A;  4DDD A;  2UVG A;  1B6H A;  3O28 A;  1B9J A;  3VE1 B;  5A5X B;  2UVH A;  2FYI A;  2ZNU A;  3T66 A;  1OLA A;  5ITP A;  1M5C A;  3C4M A;  4U4X A;  4YAH X;  4DXB A;  2O84 X;  4XTC Q;  3OO8 A;  2A5T B;  2D21 A;  1N7W A;  1JVY A;  4FED A;  1R9L A;  3O97 A;  2ESN A;  2DS9 A;  4H5G A;  1JW4 A;  4O3B A;  2QS4 A;  5TU0 A;  2LAO A;  5L8D A;  1T0K A;  3TCH A;  3ONM A;  3O6P A;  3KSX A;  4IO7 A;  4R6K A;  5I59 B;  3DRH A;  4QF9 A;  3BKI B;  4DXC A;  2P1S A;  1D9V A;  2UVJ A;  1DTZ A;  3PPR A;  3OOA A;  1P1U A;  4R9G A;  1LAG E;  2A5T A;  2OWS A;  1JNF A;  3IO6 A;  3S4U A;  1MH3 A;  4WED A;  3VV5 A;  1LFH A;  2DE4 A;  4OXV A;  2ZNT A;  2QS3 A;  3MW0 A;  3VXB A;  2Q89 A;  5CMB A;  4QSD A;  4DLD A;  4OFO A;  3MAM A;  4R9F A;  3VLU A;  2Q8J A;  1ZMG A;  3T9V A;  2GHB A;  3PD8 A;  2FNC A;  4NF4 B;  5FTI A;  4G8H A;  4QHQ A;  5CMC A;  2A5S A;  2Q88 A;  3I5O A;  4KI0 E;  4ELP A;  1JET A;  1Y20 A;  2I4C A;  3ZS6 A;  1HSL A;  2XD2 A;  3TTR A;  2W7Y A;  1JEU A;  3PU5 A;  3IL1 B;  3C36 A;  3KG2 A;  4U21 A;  3U92 A;  1B1H A;  4OEN A;  5HPQ A;  4I8C A;  1B58 A;  2H98 A;  2XD3 A;  1TXF A;  4F1Y A;  5J1D A;  4G68 A;  4NE4 A;  1MQD A;  3SKP A;  3H4Z A;  4GFR A;  4JWO A;  1B3F A;  1Y3N A;  3KJ7 A;  5IAI A;  2O68 A;  3UOR A;  5JTY A;  1B51 A;  4YB5 A;  3FJG A;  5AA4 B;  3FAT A;  4RJZ A;  4Q5T A;  1PC3 A;  3S9L C;  4QFO A;  4EF1 A;  3GBB A;  2X7Q A;  3A09 A;  2YLN A;  2Z8F A;  3T22 A;  1US5 A;  3LSW A;  3N94 A;  1P1W A;  5CM6 A;  2PMS A;  4ESX A;  4IO3 A;  4H0W A;  3PPN A;  2ZYK A;  3ILT B;  1UTH B;  3MQ9 A;  4MLQ A;  1B7H A;  1BTJ A;  4FEB A;  2NXO A;  4F3B A;  4U2R A;  4YMB A;  3KN3 A;  3M3K A;  4R72 A;  2HQ0 A;  4X1B A;  2V3Q A;  4C1T A;  1JQF A;  3T9U A;  1QUL A;  1NH8 A;  3TMG A;  5AA4 A;  3K4U A;  1MG1 A;  3G3K A;  4X9T A;  3S9N C;  2DWA A;  2ABH A;  3RLF E;  4FAT A;  3M3F A;  4GLI A;  3FVN A;  3IAZ A;  5B7D A;  4ONY A;  4QFK A;  4RNS A;  4DIG A;  1UTB A;  1LLS A;  3CHG A;  5H8Q B;  4WKM A;  5KZT A;  2RC8 A;  3GBA A;  1QW0 A;  4H8I A;  1IIT A;  3LSF B;  4KPT A;  5L9S A;  1B5J A;  1B46 A;  1FQB A;  2I4B A;  4H5F A;  1SI1 A;  4ZS9 A;  3VLW A;  2AIX A;  2V3T A;  4DCX A;  2DWI A;  2DWJ A;  1XS5 A;  4ESW A;  3FAS A;  2F8D A;  1RYX A;  2Q2A A;  4GOT A;  2IEE A;  3LSX A;  2PYY A;  4LQ2 A;  1URG A;  2OLB A;  4BDO A;  2Q9T A;  1N84 A;  3SEY A;  4I9D A;  3MVX A;  5H8Q A;  3TFL A;  1OVB A;  4Q30 B;  3GZG A;  2O7U A;  3PPO A;  3IOW A;  3K2D A;  5EHS A;  1F9B A;  3OD7 A;  4GD5 A;  1M5D A;  1LGB C;  3HO7 A;  1SVX B;  1OVT A;  3IO4 A;  3RN8 A;  4EXK A;  1D4N A;  3I6V A;  1MPB A;  1Y4T A;  1A55 A;  1RKM A;  2Y7I A;  3FJM A;  1YCJ A;  4DE8 A;  1YTV A;  4NWD A;  3B6Q A;  4ECF A;  5DEX B;  3SEV A;  3N26 A;  2P2A A;  4JDF A;  2REJ A;  3SES A;  2VGQ A;  3MPK A;  4YB6 A;  5I2N A;  4N07 A;  3MJN A;  1MXV A;  3KFM A;  3QK6 A;  3SET A;  4F3S A;  4GWO A;  1DSN A;  3L6G A;  1A8F A;  2ANJ A;  2M8C A;  1Z7M E;  4IGT A;  2PT1 A;  3SEU A;  4R6Y A;  2I0B A;  4WEP A;  3U1O A;  1VFE A;  3M8U A;  3K00 A;  2PBW A;  1WOD A;  5L9M A;  4IY6 A;  4RK2 A;  3UIF A;  4OZ9 A;  3CFX A;  5KDT B;  4GQO A;  4H65 A;  4NTL A;  1Y1M A;  3F11 A;  3HV1 A;  1URD A;  5FHM A;  2XXI A;  5DVJ A;  3TUS A;  3RYA A;  3PMW A;  4THI A;  2RC7 A;  4TLL B;  4MFI A;  3QXM A;  5BUU A;  1US4 A;  1B5I A;  1JEV A;  4QSC A;  2QMW A;  1O63 A;  3MP1 A;  3CIJ A;  4PFW A;  5DYH A;  4XKN A;  1J1N A;  4F39 A;  3LVU A;  3KJT A;  1NNK A;  5TP9 B;  1EH3 A;  5M2V A;  3DP6 A;  5AA2 B;  3PMX A;  2I6E A;  4YKI A;  1UQW A;  2DOJ A;  3HST A;  3O2A A;  3FXR A;  3TQW A;  3KEI A;  4FJP A;  4OES A;  1LST A;  2F97 A;  5FHN A;  5KCJ B;  4ZZA A;  4RY1 A;  1A7L A;  2H99 A;  4GXA A;  3H7M A;  5H8F B;  3EQ1 A;  2F7C A;  4EF2 A;  3IB0 A;  2F35 A;  3IOT A;  3EHU A;  4OTE A;  2VD3 A;  2Q2C A;  3HHF A;  1JW5 A;  3VVD A;  3I3V A;  3SEW A;  5TP9 A;  4ZEB A;  1N3X A;  3RTW B;  2RCA A;  3N6U A;  4KCD A;  1B7U A;  4BDM A;  5LOM A;  3THI A;  4KYE A;  3LBS A;  5AA3 A;  4F22 A;  1OQH A;  1B52 A;  1MDQ A;  4GRK A;  4G2Z A;  2G93 A;  5H8F A;  3CG3 A;  2XXV A;  3IB2 A;  4OMB A;  3MPL A;  3CRB A;  2QS2 A;  2ONR A;  3O66 A;  3PUX E;  3KZG A;  1B7Z A;  5ICQ A;  2F6G A;  3CVG A;  5CI5 A;  1BP5 A;  3BFU A;  1P1Q A;  3HPI A;  1JW1 A;  2HEU A;  4R2B A;  4GVO A;  1S7Y A;  3H6T A;  1D9Y A;  2I58 A;  1FQD A;  1FQA A;  3H6W A;  4E0X A;  3RT8 A;  1POT A;  1I6B A;  5A5X A;  4R74 A;  3U93 A;  3FTO A;  5EYF A;  3T93 B;  4FAJ A;  4XKR A;  2O6A A;  4HCW A;  1TT1 A;  1N76 A;  3N5L A;  3MVY A;  2V93 A;  4KHZ E;  2BJJ X;  1A40 A;  4RXL A;  1POY 1;  2XXY A;  3FIR A;  4JSD A;  2B3F A;  1QKB A;  1LAH E;  4EUO A;  5DTB A;  1SI0 A;  3ECR A;  2XXW A;  4YMA A;  3VXC A;  3ZSF A;  3E3K A;  1B3H A;  1H43 A;  2ZMB A;  1MXZ A;  4L17 A;  3K02 A;  1EZO A;  3O6H A;  5I59 A;  3RTF B;  4ZE9 A;  1MM7 A;  2WOP A;  3ZKL A;  1SDX A;  4P0I A;  4M1V A;  4BDN A;  4OEV A;  4DZ1 A;  2OJT A;  1OQG A;  4PE5 B;  4R2F A;  3IK6 B;  4IO5 A;  1GGG A;  3IOV A;  4Z0I A;  1NMU A;  2RCB A;  2I3W A;  4OYV A;  4DCY A;  3EHS A;  3HHG A;  1NNP A;  4HS7 A;  4KCC A;  1FQE A;  3SDF A;  3UN6 A;  1Y3Q A;  1ZIU A;  3K6U A;  4Q8R A;  1B05 A;  1A54 A;  1MQJ A;  4OQO A;  1MDP 1;  4KR5 A;  3DRF A;  4I1D A;  4AB5 A;  2B4M A;  4JB7 A;  3JZJ A;  4NF4 A;  5F7V A;  4ELR A;  3TCG A;  1MQI A;  3DRG A;  4POW A;  4KD5 A;  4H8J A;  3OEN A;  2O7I A;  1N3W A;  1PB7 A;  3UA8 A;  2RF1 A;  4LZ5 A;  2B65 A;  3C32 A;  1S50 A;  2DE3 A;  1MXX A;  3UP9 A;  4RYA A;  1VE4 A;  2HXW A;  3TTK A;  4YKP A;  1P1N A;  1JVX A;  2HAV A;  1USY E;  3KOT A;  1L5T A;  4BDL A;  3FZV A;  3MVW A;  3MUQ A;  3VFJ A;  3PUY E;  3K0V A;  3TAJ A;  2QSX A;  2OK2 A;  3UK4 A;  4R73 A;  4R75 A;  5EHM A;  1LBB A;  1OLC A;  3FVO A;  2O69 A;  3FXU A;  3HCQ A;  3P7I A;  3PAM A;  3PD9 A;  5AE4 A;  4QFN A;  2WOK A;  1TFD A;  4EDP A;  3RUM A;  1XVX A;  4MLV A;  2G29 A;  2YJP A;  2Y7P A;  2F36 A;  4LZ7 A;  2V84 A;  1VSO A;  1LAX A;  2XX9 A;  3KN8 A;  4O3C A;  1B4H A;  2IA4 A;  2F7A A;  1SW1 A;  1BIY A;  3MZ9 A;  1H3D A;  2DXY A;  1B3L A;  1N04 A;  1UTH A;  3PPP A;  3LR1 A;  2UYF A;  4ZED A;  4OWD A;  3RY3 A;  1MS7 A;  4G4P A;  3E9X A;  1UIU A;  1OMP A;  4UAC A;  1IEJ A;  2CZL A;  4OFL A;  3C33 A;  3OSR A;  3TQL A;  4YZZ A;  3S9M C;  4HTG A;  2XXP A;  1ATG A;  3PGF A;  2FA7 A;  3QSL A;  1II5 A;  1FTO A;  2DE2 A;  4H6D A;  4K3F A;  1NNT A;  2OCU A;  3DP4 A;  3VLV A;  4BLA A;  2DVC A;  1A8E A;  4JSO A;  1LB8 A;  4MF3 A;  3MC2 A;  1QUJ A;  2ONS A;  4N6P A;  4U4S A;  1IXH A;  4LZ8 A;  2HAU A;  2GHA A;  4ND9 A;  1AMF A;  1Y4C A;  2CMO A;  2D3I A;  4GF8 A;  1B0H A;  4G8N A;  1Q1K A;  3PUW E;  4GIZ A;  4JXI A;  3MBP A;  1HSE A;  4KFQ A;  3IX1 A;  3S9E A;  1MRP A;  3OEK A;  1CB6 A;  1URS A;  1LB9 A;  4TQU Q;  3T9X B;  4FIM A;  2DQV A;  2XX7 A;  1LCT A;  2F5X A;  4ISU A;  2DYX A;  3K6X A;  3MZ1 A;  1P99 A;  1SBP A;  4F18 A;  2GRV A;  3OEL A;  3IR1 A;  4U1O A;  2NOO A;  1Y1Z A;  2Y7R A;  1N7X A;  5I57 B;  1Z7N E;  3MZB A;  5CC2 A;  1PBQ A;  3A3C A;  5DVF A;  2H25 A;  1B5H A;  3Q27 A;  3TZA A;  2OBG A;  4EQ7 A;  5H8S A;  5DEX A;  2F34 A;  3QYT A;  4QFP A;  1FQC A;  1ZBM A;  3R6U A;  4MH5 A;  4QFL A;  1MH4 A;  3IJO B;  1DPP A;  1LCF A;  2NUV A;  1QUK A;  5I56 B;  4ZZE A;  2NVU B;  3W9V A;  2QMX A;  2VHA A;  1IUD A;  3MWB A;  3KN7 A;  1QVS A;  1ZU0 A;  5I57 A;  2V3U A;  5H8N B;  3IJX B;  2Y84 A;  2Y7K A;  5ITO A;  1FTM A;  4OVJ A;  4POX A;  5I2K B;  4LP2 B;  3TYH A;  1WVJ A;  5KDT A;  4G68 C;  4LUB A;  3WAF A;  4OFJ A;  1O7T A;  3VVF A;  3S2V A;  3ZKK A;  3IOR A;  5H8H B;  3DRI A;  3OSQ A;  1MY3 A;  4IO6 A;  4M4G A;  1FTK A;  3RYB A;  5I56 A;  2Z8E A;  3D4G A;  1EZ9 A;  4F2Q A;  1XT8 A;  3V83 A;  4ZDM A;  3SER A;  2QRY A;  1AH5 A;  3C34 A;  3TEP A;  4PP0 A;  5H8N A;  3K1N A;  2WKY A;  3E4R A;  1IZ1 A;  4F3G A;  1GV8 A;  5AA2 A;  2GH9 A;  1ZKB A;  3DP8 A;  3KBR A;  3WAE A;  2PVU A;  3LC8 A;  3OEM A;  3CG1 A;  4F19 A;  3JV9 A;  2XHD A;  2XXU A;  5KCJ A;  3ODB A;  2XXR A;  4F1U A;  1NNF A;  4F2O A;  2ALU A;  2PT2 A;  1XHY A;  2ONK E;  1LBC A;  1I6Q A;  4U23 A;  3FXQ A;  4PQJ A;  3DRK A;  3M3L A;  4GL8 A;  3U8Q A;  4PFU A;  1PDA A;  1SW5 A;  2THI A;  4IO4 A;  4EQB A;  3ILU B;  1Y9U A;  3TPA A;  3PUZ E;  1FTJ A;  4XIG Q;  3RQT A;  3TTN A;  4FE8 A;  3B6T A;  1EZP A;  1R1N A;  4MBP A;  1ZTY A;  1DTG A;  4NMY A;  1NKX A;  1B0L A;  4H1X A;  1MPD A;  3OMB A;  4EQ9 A;  1MXY A;  4X48 A;  1B1X A;  5K2X A;  3USD A;  1B32 A;  2HZK A;  1SYH A;  4OET A;  4LAT A;  1R9Q A;  2DVZ A;  1LFG A;  1VR5 A;  1I69 A;  1NH7 A;  4IB2 A;  3Q26 A;  3FVK A;  2QL3 A;  4G77 A;  3OO7 A;  1CE2 A;  1IXI A;  3TDJ A;  1N0T A;  1B4Z A;  2ZNS A;  2QPQ A;  3W15 C;  3Q29 A;  3R26 A;  2X26 A;  3HN0 A;  2I3V A;  1BLF A;  1R6Z A;  4GL0 A;  2ZXT A;  1FTL A;  2O1M A;  1UIV A;  4LA9 A;  3MVZ A;  4G68 B;  4LQ5 A;  3EN3 A;  1M5B A;  3IB1 A;  4F29 A;  4XKQ A;  1EU8 A;  1VFD A;  3RPW A;  3CSG A;  1LAF E;  3AXF A;  3FV2 A;  5ISU A;  1BKA A;  3H6U A;  3EHT A;  3FUZ A;  3B6W A;  4JBZ A;  3PMV A;  5JTY B;  3H06 B;  1M5F A;  4C0R A;  1XC1 A;  2I49 A;  2AL5 A;  4ZEI A;  3CSB A;  2DXR A;  1DOT A;  2R71 A;  2D5W A;  3O6I A;  3U94 A;  2DWH A;  2E1S A;  3BBR A;  1H44 A;  4PFT A;  2Z22 A;  1Y3P A;  4G8M A;  3T96 B;  2DP8 A;  3QUF A;  4ZEK A;  5DT6 A;  3BFT A;  3MP6 A;  1GTK A;  4F1V A;  1PB9 A;  2O51 A;  1SYI A;  3DLN A;  4BDQ A;  2H4I A;  3A3U A;  4XXU A;  2AYS A;  3DEL B;  4RK9 A;  1QJM A;  3FJ7 A;  1PB8 A;  4AB6 A;  2F7B A;  2Z23 A;  3K01 A;  3RGY A;  3G3J A;  3SEX A;  1FW0 A;  3G7W A;  3TTL A;  4I62 A;  2H9B A;  1H76 A;  2QJE A;  4QRZ A;  2X7P A;  1GR2 A;  4NF8 B;  1SW4 A;  3D4C A;  2F78 A;  1UTB B;  2WOL A;  5AA1 A;  2B4L A;  4F31 B;  2Z8D A;  3K6V A;  1S9T A;  2V25 A;  3K1P A;  3TOD A;  2VOZ A;  1QUI A;  5CMK A;  1GVC A;  4KYS A;  3GLB A;  4YU0 A;  2YPN A;  3KGC A;  3FD3 A;  4PET A;  3QUJ A;  2REG A;  1NFT A;  2B3B A;  3PPQ A;  2GFE A;  1AOV A;  4WXJ A;  3Q25 A;  2P0S A;  2F6P A;  4IO2 A;  3RNN A;  2ZYM A;  5HBC A;  3MP8 A;  1Q35 A;  2OZZ A;  5I58 B;  4NF8 A;  3C35 A;  3GXA A;  4JWY A;  3V89 B;  1PBP A;  1B40 A;  1MXW A;  3C9H A;  3FVG A;  3T9H B;  3W9W A;  5IKB A;  2NWJ A;  2XXT A;  1A99 A;  3G3F A;  1OIB A;  2XXX A;  3JYR A;  4IGR A;  1MY4 A;  4C1U A;  4JWX A;  1SQY A;  1IXG A;  4NF6 B;  2I0C A;  4NF5 B;  4RPN A;  4X1D A;  5JK4 A;  3UGW A;  3U72 A;  4RPO A;  4ZEC A;  1AL3 A;  5B70 A;  3PV0 E;  4O3A A;  2I48 A;  3KSJ A;  2HFB A;  4E0W A;  1KWH A; 
#chains in the Genus database with same CATH topology
 1IQ7 A;  1PEB A;  5L9O A;  4N6D A;  1K9Z A;  5I58 A;  3E78 A;  4LON B;  4FEC A;  5DVI A;  1B2H A;  1XI6 A;  4FOR A;  2QS1 A;  2ZYO A;  4KXP A;  4YB7 A;  4U1Z A;  4GXS B;  3KOS A;  3TKD A;  1P1O A;  3LUY A;  1IXC A;  4P3L A;  5I2N B;  4OAN A;  1NV5 A;  1M5E A;  3C31 A;  5ICT A;  1FRP A;  1NUW A;  4ZEF A;  4NWC A;  4U22 A;  1H45 A;  3K1M A;  2AL4 A;  2OWT A;  4Q0C A;  4ELQ A;  4NF6 A;  3B7D A;  1ELJ A;  1SW2 A;  4NF5 A;  4GBV A;  3FGS A;  3TEL A;  3CI8 A;  5CRY A;  5F1Q A;  2RKM A;  2L5V A;  4F3P A;  2OWZ A;  3O9P A;  2E0S A;  5ELV A;  3TTM A;  2VPO A;  2UXA A;  2VD2 A;  4PFY A;  3PUV E;  4UA8 A;  3DRJ A;  1ZJL A;  4MCO A;  4N13 A;  4DXU A;  4HCY A;  4H45 A;  1TWY A;  4KQP A;  5CBS A;  4P47 A;  2UYE A;  1B3G A;  1IIW A;  5I84 A;  5LTC A;  3G3G A;  1KA0 A;  1YAE A;  3O6G A;  4ZE8 A;  2XXQ A;  5BWJ A;  2Q74 A;  2Y7W A;  1DMB A;  4NED A;  1MQG A;  1YPN A;  3L6H A;  4PCD A;  5CBR A;  2CZK A;  4IY5 A;  1HSJ A;  3TCF A;  3OXN A;  4H67 A;  3CFL A;  5HM4 B;  1XOC A;  4QSE A;  5K2Y A;  4YKJ A;  3G3I A;  1MY2 A;  3Q28 A;  2BJI A;  2CEX A;  3QAX A;  4PGN A;  4PC9 A;  5J16 A;  4RA1 A;  3LSL A;  5CMM A;  4Z7E A;  2RC9 A;  3IOU A;  4LVQ A;  2XX8 A;  3BIG A;  4JVC A;  2VP1 A;  5TPA B;  4HW8 A;  4EXL A;  1MY0 A;  1LFI A;  3VVE A;  3OO9 A;  4YIC A;  1RDY A;  1TFA A;  4GBW A;  4AQ4 A;  5AA2 D;  1NL5 A;  2PX1 A;  3RT6 B;  3FV1 A;  2ZYN A;  3OO6 A;  3EPE A;  4P0G A;  3IFC A;  1JP4 A;  1KZ8 A;  4OER A;  2QVV A;  4OHN A;  1WDN A;  5FTH A;  2HZL A;  3H03 A;  2ZZV A;  2HCA A;  3K6W A;  5EQ7 A;  1FQF A;  3EKI A;  3E13 X;  1G0I A;  1D3K A;  3DM0 A;  4P9K A;  1FBD A;  5FHO A;  4PFR A;  2VPN A;  1O64 A;  3N6T A;  5JEI A;  1QKA A;  3VDF A;  1MQH A;  4FBP A;  3PTY A;  4BDR A;  1MY1 A;  3O29 A;  1FCK A;  5TPA A;  3CR9 A;  3H6V A;  5I2K A;  4P11 A;  1MXU A;  1AIV A;  3V8X B;  3R7X A;  4XKP A;  1ZLQ A;  4TOZ A;  2H5Y A;  2UVI A;  5H8H A;  2R6G E;  2R9J A;  3EF7 A;  4TLM B;  3QIM A;  2DSF A;  4MX6 A;  1MM6 A;  1ANF A;  1DPE A;  1IMA A;  2WYP A;  1RYO A;  4OEU A;  1I6A A;  2KLF A;  2O1L A;  1MPC A;  3V5A A;  2RIN A;  3H3G A;  4YKK A;  4KYD A;  1XVY A;  2XXH A;  4R6H A;  1B3E A;  1USY H;  4ELO A;  1SD3 A;  3G3H A;  3CFZ A;  4DDD A;  2UVG A;  1B6H A;  3O28 A;  1B9J A;  3VE1 B;  5A5X B;  5DW8 A;  2UVH A;  2FYI A;  2WEF A;  2ZNU A;  3T66 A;  1OLA A;  5ITP A;  1M5C A;  2VT5 A;  3C4M A;  4U4X A;  4YAH X;  4AS4 A;  5F24 A;  4DXB A;  2O84 X;  4XTC Q;  3OO8 A;  2A5T B;  2D21 A;  1N7W A;  2WX9 A;  1JVY A;  4FED A;  1R9L A;  4P1L A;  5EYH A;  4HE1 A;  3O97 A;  2ESN A;  2DS9 A;  4PFB A;  4H5G A;  5I5P A;  1JW4 A;  4O3B A;  2QS4 A;  5TU0 A;  2LAO A;  5L8D A;  1T0K A;  3TCH A;  3ONM A;  3O6P A;  3KSX A;  4PFI A;  4IO7 A;  4R6K A;  5I59 B;  4GWW A;  3DRH A;  4QF9 A;  3BKI B;  4DXC A;  2P1S A;  1D9V A;  2UVJ A;  1DTZ A;  3PPR A;  2CZI A;  4NN3 A;  1KA1 A;  3OOA A;  1P1U A;  4R9G A;  1LAG E;  2A5T A;  2OWS A;  1FPL A;  1FTA A;  1JNF A;  3IO6 A;  3S4U A;  1MH3 A;  4WED A;  3VV5 A;  1LFH A;  2DE4 A;  5I7I A;  4OXV A;  2ZNT A;  2HHM A;  2QS3 A;  4PBQ A;  3MW0 A;  3VXB A;  2Q89 A;  5CMB A;  4QSD A;  4DLD A;  4OFO A;  3MAM A;  4R9F A;  1FPK A;  2V4C A;  3VLU A;  2Q8J A;  1ZMG A;  3T9V A;  4PDH A;  3B50 A;  2GHB A;  3PD8 A;  2FNC A;  4NF4 B;  5FTI A;  4G8H A;  4QHQ A;  5CMC A;  2A5S A;  2Q88 A;  3I5O A;  4KI0 E;  4ELP A;  1JET A;  1Y20 A;  2I4C A;  3ZS6 A;  1HSL A;  2XD2 A;  3TTR A;  1Q9D A;  2R8T A;  2W7Y A;  2QVU A;  1JEU A;  3PU5 A;  1FBC A;  3IL1 B;  3C36 A;  3KG2 A;  4U21 A;  4MNI A;  3U92 A;  1B1H A;  4OEN A;  5HPQ A;  4I8C A;  2Y5K A;  1B58 A;  2H98 A;  2XD3 A;  1TXF A;  1YZ0 A;  4F1Y A;  4HXV A;  5J1D A;  4PTK A;  4G68 A;  4NE4 A;  1MQD A;  3SKP A;  3H4Z A;  4GX6 A;  4PGP A;  4I40 A;  4NAP A;  4GFR A;  4JWO A;  1B3F A;  1NV1 A;  1Y3N A;  3KJ7 A;  5IAI A;  2O68 A;  3UOR A;  5JTY A;  1B51 A;  4YB5 A;  3T0J A;  3FJG A;  5AA4 B;  3FAT A;  4RJZ A;  4Q5T A;  4UAB A;  1PC3 A;  3S9L C;  4QFO A;  4EF1 A;  3GBB A;  2X7Q A;  3A09 A;  2YLN A;  4GWS A;  2Z8F A;  1FBP A;  4O7M A;  3T22 A;  1US5 A;  3LSW A;  3N94 A;  1P1W A;  5CM6 A;  2PMS A;  4ESX A;  4XFE A;  4IO3 A;  4H0W A;  3PPN A;  2ZYK A;  5IGA A;  3ILT B;  4GX3 A;  1UTH B;  3MQ9 A;  4MLQ A;  1B7H A;  1BTJ A;  4FEB A;  2NXO A;  1DBZ A;  2WBB A;  4F3B A;  4U2R A;  1NV3 A;  4YMB A;  3KN3 A;  3M3K A;  4R72 A;  2HQ0 A;  4PBH A;  4X1B A;  2V3Q A;  4C1T A;  1JQF A;  3T9U A;  1QUL A;  1NH8 A;  3TMG A;  5AA4 A;  3K4U A;  4OVS A;  1MG1 A;  3G3K A;  4X9T A;  3S9N C;  2DWA A;  2ABH A;  3RLF E;  4O7I A;  4FAT A;  3M3F A;  4I3Y A;  4GLI A;  3FVN A;  2WBD A;  3IAZ A;  5B7D A;  4ONY A;  4QFK A;  4RNS A;  4DIG A;  1UTB A;  1LLS A;  3CHG A;  1FBH A;  5H8Q B;  4WKM A;  5KZT A;  2RC8 A;  3GBA A;  4MAG A;  1QW0 A;  4H8I A;  1IIT A;  3LSF B;  4KPT A;  4O8M A;  5L9S A;  1B5J A;  1B46 A;  1FQB A;  2I4B A;  4H5F A;  1SI1 A;  1NV4 A;  4ZS9 A;  3VLW A;  2AIX A;  2V3T A;  4DCX A;  4MMP A;  2DWI A;  2DWJ A;  1DCU A;  1XS5 A;  4ESW A;  3FAS A;  2MKZ A;  2F8D A;  1RYX A;  2Q2A A;  4GOT A;  2IEE A;  3U65 A;  3LSX A;  2PYY A;  4LQ2 A;  1URG A;  2OLB A;  4BDO A;  2Q9T A;  1N84 A;  3SEY A;  4I9D A;  3MVX A;  5ET8 A;  5H8Q A;  3TFL A;  4Q30 B;  1OVB A;  3GZG A;  2O7U A;  3PPO A;  2WYK A;  3IOW A;  3K2D A;  2ZZX A;  2KQZ A;  2DDK A;  5EHS A;  4DI3 D;  1F9B A;  3OD7 A;  4GD5 A;  4PAI A;  1M5D A;  5FBP A;  1LGB C;  4QXD A;  4PF6 A;  3HO7 A;  1SVX B;  1OVT A;  3IO4 A;  3RN8 A;  1DK4 A;  4EXK A;  1D4N A;  3I6V A;  1MPB A;  1Y4T A;  1A55 A;  4HE2 A;  1RKM A;  2Y7I A;  3FJM A;  4MJO A;  1YCJ A;  4DE8 A;  1YTV A;  4NWD A;  3B6Q A;  5ET5 A;  4ECF A;  5DEX B;  3SEV A;  3N26 A;  2P2A A;  4JDF A;  2REJ A;  3SES A;  2VGQ A;  3MPK A;  4YB6 A;  5I2N A;  4N07 A;  1FBF A;  3ISP A;  3MJN A;  1MXV A;  3KFM A;  3QK6 A;  3SET A;  4F3S A;  3FXB A;  4GWO A;  1DSN A;  3L6G A;  1A8F A;  2ANJ A;  2M8C A;  1Z7M E;  4IGT A;  2PT1 A;  3SEU A;  4R6Y A;  2I0B A;  4WEP A;  3U1O A;  1VFE A;  4PF8 A;  3M8U A;  3K00 A;  2PBW A;  1WOD A;  5L9M A;  4IY6 A;  3BIH A;  4RK2 A;  4LN5 A;  3UIF A;  2CZH A;  4OZ9 A;  5ET7 A;  3CFX A;  5KDT B;  4GQO A;  4H65 A;  4NTL A;  1Y1M A;  3F11 A;  3HV1 A;  1URD A;  1FJ6 A;  5FHM A;  2XXI A;  5DVJ A;  3TUS A;  3RYA A;  3ROJ A;  3PMW A;  4THI A;  1IMF A;  2RC7 A;  4TLL B;  4MFI A;  3QXM A;  5BUU A;  1US4 A;  1B5I A;  1JEV A;  4QSC A;  2QMW A;  1O63 A;  3MP1 A;  3CIJ A;  4PFW A;  5DYH A;  4XKN A;  1J1N A;  4F39 A;  1FPB A;  3LVU A;  3KJT A;  1NNK A;  5TP9 B;  1EH3 A;  5M2V A;  3DP6 A;  5AA2 B;  3PMX A;  2P3N A;  2I6E A;  4YKI A;  1FBE A;  1UQW A;  2DOJ A;  3HST A;  3O2A A;  3FXR A;  3RPL B;  3TQW A;  3KEI A;  4FJP A;  5A5L A;  4OES A;  1LST A;  2F97 A;  5FHN A;  5KCJ B;  5IZ3 B;  4ZZA A;  4RY1 A;  1A7L A;  2H99 A;  4GXA A;  3H7M A;  5H8F B;  3EQ1 A;  2F7C A;  4OVR A;  1QGX A;  4EF2 A;  4N8Y A;  3IB0 A;  2F35 A;  3IOT A;  2XWK A;  3EHU A;  4OTE A;  2VD3 A;  1LBY A;  2Q2C A;  3HHF A;  1JW5 A;  3VVD A;  1RDZ A;  3I3V A;  3SEW A;  5TP9 A;  1NV0 A;  4ZEB A;  1N3X A;  3RTW B;  1EYJ A;  2RCA A;  3N6U A;  4KCD A;  1B7U A;  4BDM A;  5LOM A;  3THI A;  4KYE A;  3LBS A;  3RPL A;  5AA3 A;  4F22 A;  1OQH A;  1B52 A;  1MDQ A;  4GRK A;  4G2Z A;  2G93 A;  5H8F A;  3CG3 A;  2XXV A;  3NOH A;  3IB2 A;  4OMB A;  3MPL A;  3CRB A;  2QS2 A;  2ONR A;  1NUX A;  3O66 A;  3PUX E;  3KZG A;  1B7Z A;  5ICQ A;  2F6G A;  3CVG A;  5CI5 A;  1BP5 A;  3T1B A;  3BFU A;  4NG7 A;  1P1Q A;  3HPI A;  4PAF A;  1JW1 A;  2HEU A;  4R2B A;  4GVO A;  3HFU A;  4N91 A;  4MNC A;  1S7Y A;  3H6T A;  1D9Y A;  2I58 A;  4N81 A;  1FQD A;  1FQA A;  3H6W A;  4E0X A;  3RT8 A;  1POT A;  4NF0 A;  4MIJ A;  1I6B A;  5A5X A;  4R74 A;  3U93 A;  3FTO A;  5EYF A;  3T93 B;  4FAJ A;  4XKR A;  2O6A A;  4HCW A;  4MEV A;  1TT1 A;  1N76 A;  3N5L A;  3MVY A;  2V93 A;  4KHZ E;  2BJJ X;  1A40 A;  3GYY A;  4RXL A;  1POY 1;  2XXY A;  3FIR A;  1EYK A;  4JSD A;  2B3F A;  5IZZ A;  1AWB A;  1QKB A;  1LAH E;  4EUO A;  1CNQ A;  5DTB A;  1SI0 A;  4GX4 A;  3ECR A;  1FPE A;  2XXW A;  4YMA A;  3VXC A;  3ZSF A;  3E3K A;  1B3H A;  1H43 A;  2ZMB A;  1MXZ A;  4L17 A;  3K02 A;  1EZO A;  3O6H A;  5I59 A;  3RTF B;  4ZE9 A;  1NUZ A;  1MM7 A;  2WOP A;  4OVQ A;  3ZKL A;  4AS5 A;  1SDX A;  4P0I A;  4M1V A;  4BDN A;  4OEV A;  4DZ1 A;  2OJT A;  1OQG A;  3LUZ A;  4PE5 B;  4R2F A;  3IK6 B;  4IO5 A;  1GGG A;  3IOV A;  4Z0I A;  5EQA A;  1NMU A;  2RCB A;  2I3W A;  4OYV A;  4GWY A;  4DCY A;  3EHS A;  3HHG A;  1NNP A;  3KBZ A;  2JJK A;  4HS7 A;  4KCC A;  1FQE A;  3SDF A;  2PFZ A;  3FBP A;  3UN6 A;  1Y3Q A;  1ZIU A;  2HPG A;  3K6U A;  4Q8R A;  1B05 A;  1A54 A;  1MQJ A;  4OQO A;  1MDP 1;  4KR5 A;  3DRF A;  4I1D A;  4AB5 A;  2B4M A;  4JB7 A;  3JZJ A;  4NF4 A;  5F7V A;  2FVZ A;  4ELR A;  3TCG A;  1MQI A;  3DRG A;  4POW A;  4KD5 A;  4H8J A;  3OEN A;  2O7I A;  1N3W A;  1PB7 A;  3UA8 A;  2XXK A;  4LZ5 A;  2RF1 A;  2B65 A;  3C32 A;  3SZP A;  1S50 A;  4N17 A;  2DE3 A;  1MXX A;  3UP9 A;  4RYA A;  1VE4 A;  2HXW A;  3TTK A;  3E79 A;  4YKP A;  1P1N A;  1JVX A;  2HAV A;  1USY E;  3KOT A;  1L5T A;  4BDL A;  1LBV A;  3FZV A;  3MVW A;  3MUQ A;  3VFJ A;  3PUY E;  3K0V A;  3TAJ A;  2QSX A;  2OK2 A;  3UK4 A;  4R73 A;  4R75 A;  5EHM A;  1LBB A;  1OLC A;  3FVO A;  2O69 A;  3FXU A;  3HCQ A;  2XA5 A;  3P7I A;  3PAM A;  3PD9 A;  4MHF A;  5AE4 A;  4QFN A;  2WOK A;  1TFD A;  4EDP A;  3RYD A;  3RUM A;  1XVX A;  4MLV A;  2G29 A;  2YJP A;  2Y7P A;  2F36 A;  4LZ7 A;  4OA4 A;  3IFA A;  4OVT A;  2V84 A;  1VSO A;  2XWV A;  1LAX A;  3A29 A;  2XX9 A;  4I3E A;  3KN8 A;  4O3C A;  1B4H A;  2IA4 A;  2F7A A;  1SW1 A;  1FPG A;  1BIY A;  5EQ8 A;  2F3B A;  3MZ9 A;  1H3D A;  4JVI A;  2XWI A;  2DXY A;  1B3L A;  1N04 A;  1LBZ A;  4N15 A;  1UTH A;  5ET6 A;  1FPF A;  3PPP A;  3LR1 A;  2UYF A;  4ZED A;  4OWD A;  3RY3 A;  1MS7 A;  4G4P A;  4XF5 A;  3E9X A;  1UIU A;  1OMP A;  4UAC A;  1IEJ A;  4QBA A;  2CZL A;  4OFL A;  3C33 A;  3OSR A;  3TQL A;  4YZZ A;  3S9M C;  2PCR A;  4NHB A;  4HTG A;  2XXP A;  1ATG A;  3PGF A;  2FA7 A;  3QSL A;  1II5 A;  1RDX A;  1FTO A;  2DE2 A;  4H6D A;  4K3F A;  1NNT A;  2OCU A;  4NX1 A;  3DP4 A;  3VLV A;  2GQ1 A;  4BLA A;  2DVC A;  1A8E A;  1LB8 A;  4JSO A;  4MF3 A;  3MC2 A;  1EYI A;  1QUJ A;  4P8B A;  2ONS A;  5EYG A;  4O94 A;  4N6P A;  4U4S A;  1IXH A;  4LZ8 A;  2HAU A;  2GHA A;  4ND9 A;  1AMF A;  1Y4C A;  2CMO A;  2D3I A;  4GF8 A;  1B0H A;  4G8N A;  1Q1K A;  3PUW E;  4GIZ A;  4JXI A;  3MBP A;  1HSE A;  4KFQ A;  3IX1 A;  3S9E A;  1MRP A;  3OEK A;  4GWZ A;  1CB6 A;  1URS A;  1LB9 A;  4TQU Q;  4OVP A;  3T9X B;  3MST A;  4FIM A;  2DQV A;  2XX7 A;  1IMD A;  1LCT A;  2F5X A;  4ISU A;  2DYX A;  4XEQ A;  3K6X A;  5T3J A;  3MZ1 A;  1P99 A;  1SBP A;  4F18 A;  2GRV A;  3OEL A;  3IR1 A;  4U1O A;  1G0H A;  4P1E A;  5I3S A;  1FPD A;  2NOO A;  1Y1Z A;  3D1R A;  2Y7R A;  1N7X A;  1YYZ A;  5I57 B;  1Z7N E;  3MZB A;  5CC2 A;  1NV2 A;  1PBQ A;  3A3C A;  5DVF A;  2H25 A;  1B5H A;  3Q27 A;  3TZA A;  2OBG A;  4EQ7 A;  5H8S A;  5DEX A;  2F34 A;  3QYT A;  4QFP A;  1FQC A;  1ZBM A;  3R6U A;  4MH5 A;  4QFL A;  1MH4 A;  3IJO B;  1DPP A;  4NQ8 A;  1K9Y A;  1LCF A;  2NUV A;  1QUK A;  5I56 B;  4ZZE A;  2NVU B;  3W9V A;  2QMX A;  2VHA A;  2FBP A;  4DI4 B;  1IUD A;  3B8B A;  3MWB A;  3KN7 A;  1QVS A;  1ZU0 A;  5I57 A;  2V3U A;  5H8N B;  4JVD A;  3IJX B;  2Y84 A;  2Y7K A;  4PE3 A;  5ITO A;  1FTM A;  1YXI A;  4OVJ A;  4POX A;  5I2K B;  4LP2 B;  1BK4 A;  3TYH A;  1WVJ A;  5KDT A;  4G68 C;  4LUB A;  3WAF A;  4OFJ A;  1VDW A;  1O7T A;  3VVF A;  3S2V A;  4X04 A;  3ZKK A;  3IOR A;  5H8H B;  3DRI A;  3OSQ A;  1MY3 A;  4IO6 A;  1SPI A;  4M4G A;  1FTK A;  3RYB A;  5I56 A;  2Z8E A;  3D4G A;  1NUY A;  5LDZ A;  1EZ9 A;  4F2Q A;  1XT8 A;  3V83 A;  4ZDM A;  3SER A;  2QRY A;  1AH5 A;  3C34 A;  5IZ1 A;  3TEP A;  4PP0 A;  5H8N A;  2Q8M A;  3K1N A;  2WKY A;  3E4R A;  1IZ1 A;  4F3G A;  1GV8 A;  5AA2 A;  2GH9 A;  1ZKB A;  3DP8 A;  3KBR A;  3WAE A;  2PVU A;  3LC8 A;  3OEM A;  3CG1 A;  4F19 A;  3JV9 A;  2XHD A;  1LBX A;  2XXU A;  5KCJ A;  5IZ3 A;  3ODB A;  2XXR A;  4F1U A;  1NNF A;  2QVR A;  4F2O A;  2ALU A;  2PT2 A;  2FHY A;  1XHY A;  2ONK E;  1IMC A;  1LBC A;  1I6Q A;  4U23 A;  3FXQ A;  4PQJ A;  3DRK A;  1LBW A;  3M3L A;  4GL8 A;  2P3V A;  3U8Q A;  4PFU A;  1PDA A;  1SW5 A;  2THI A;  4IO4 A;  4EQB A;  3ILU B;  1Y9U A;  3TPA A;  3PUZ E;  1FTJ A;  4XIG Q;  3RQT A;  3TTN A;  1FPI A;  4N6K A;  4FE8 A;  3B6T A;  1EZP A;  1NV7 A;  1R1N A;  2CEY A;  4MBP A;  1ZTY A;  1DTG A;  4NMY A;  4GWU A;  1NKX A;  5EQ9 A;  1B0L A;  4H1X A;  1MPD A;  1INP A;  3OMB A;  4EQ9 A;  1MXY A;  4X48 A;  1B1X A;  5K2X A;  3USD A;  1B32 A;  2HZK A;  2OX3 A;  1SYH A;  4OET A;  4LAT A;  1R9Q A;  2DVZ A;  1LFG A;  1VR5 A;  1I69 A;  1NH7 A;  4IB2 A;  3Q26 A;  3FVK A;  2QL3 A;  4G77 A;  3OO7 A;  1CE2 A;  1IXI A;  3TDJ A;  1N0T A;  1B4Z A;  2ZNS A;  2QPQ A;  3W15 C;  3Q29 A;  3R26 A;  2X26 A;  3HN0 A;  2I3V A;  1BLF A;  1R6Z A;  4GL0 A;  2ZXT A;  1NV6 A;  1FTL A;  2O1M A;  1UIV A;  1D9Q A;  4LA9 A;  3MVZ A;  4G68 B;  4LQ5 A;  4P56 A;  3EN3 A;  1M5B A;  3IB1 A;  4F29 A;  4XKQ A;  1EU8 A;  1VFD A;  2FIE A;  3RPW A;  3CSG A;  1LAF E;  3AXF A;  3FV2 A;  2PFY A;  5ISU A;  1BKA A;  3H6U A;  3EHT A;  3FUZ A;  3QMF A;  3B6W A;  4JBZ A;  4N8G A;  3PMV A;  5JTY B;  3KC0 A;  3H06 B;  1M5F A;  4MNP A;  4C0R A;  1XC1 A;  2I49 A;  2AL5 A;  4NGU A;  2ZZW A;  4ZEI A;  3CSB A;  2F3D A;  2DXR A;  1DOT A;  2R71 A;  2D5W A;  3O6I A;  3U94 A;  2DWH A;  2E1S A;  3BBR A;  1H44 A;  4PFT A;  2Z22 A;  1Y3P A;  4G8M A;  3T96 B;  2DP8 A;  3QUF A;  2FIX A;  4ZEK A;  5DT6 A;  3BFT A;  4PDD A;  3MP6 A;  1GTK A;  1PB9 A;  2O51 A;  4F1V A;  1SYI A;  3DLN A;  4BDQ A;  1IME A;  3MYU A;  4PAK A;  2H4I A;  3A3U A;  3KC1 A;  4XXU A;  2AYS A;  3DEL B;  4RK9 A;  1QJM A;  3FJ7 A;  1PB8 A;  4AB6 A;  2F7B A;  2Z23 A;  3K01 A;  3RGY A;  3G3J A;  3SEX A;  1FW0 A;  3G7W A;  3TTL A;  4I62 A;  2H9B A;  1H76 A;  5ESY A;  2QJE A;  4QRZ A;  2X7P A;  1GR2 A;  4NF8 B;  1SW4 A;  3D4C A;  2F78 A;  1UTB B;  2WOL A;  4GWX A;  5AA1 A;  2B4L A;  4F31 B;  4HE0 A;  2Z8D A;  3K6V A;  1S9T A;  2V25 A;  3K1P A;  3TOD A;  2VOZ A;  1QUI A;  1LEV A;  5CMK A;  1FJ9 A;  2KR0 A;  1GVC A;  4KYS A;  3GLB A;  4YU0 A;  2YPN A;  3KGC A;  3FD3 A;  4PET A;  4X8R A;  3QUJ A;  2REG A;  1NFT A;  2B3B A;  3PPQ A;  2GFE A;  1AOV A;  4WXJ A;  3Q25 A;  4H46 A;  2P0S A;  2F6P A;  4IO2 A;  4IR8 A;  3RNN A;  2ZYM A;  5HBC A;  3MP8 A;  1Q35 A;  2OZZ A;  1FBG A;  2Y5L A;  5I58 B;  5IM2 A;  1IMB A;  2HXR A;  4NF8 A;  2XWO A;  3C35 A;  3GXA A;  4JWY A;  3V89 B;  1PBP A;  1FPJ A;  1B40 A;  1MXW A;  3C9H A;  3FVG A;  3T9H B;  3W9W A;  5IKB A;  2NWJ A;  2XXT A;  1A99 A;  3G3F A;  1OIB A;  2XXX A;  3JYR A;  4IGR A;  1MY4 A;  4C1U A;  4JWX A;  1SQY A;  1IXG A;  1NI9 A;  4NF6 B;  2I0C A;  4NF5 B;  4G61 A;  1FSA A;  4RPN A;  4X1D A;  5JK4 A;  3UGW A;  3U72 A;  4RPO A;  4ZEC A;  1AL3 A;  2QFL A;  5B70 A;  3PV0 E;  4O3A A;  2I48 A;  3KSJ A;  2HFB A;  3LV0 A;  4E0W A;  1KWH A;  4N4U A; 
#chains in the Genus database with same CATH homology
 1IQ7 A;  1PEB A;  5L9O A;  5I58 A;  4LON B;  4FEC A;  5DVI A;  1B2H A;  4FOR A;  2QS1 A;  2ZYO A;  4YB7 A;  4U1Z A;  4GXS B;  3KOS A;  3TKD A;  1P1O A;  3LUY A;  1IXC A;  5I2N B;  1M5E A;  3C31 A;  5ICT A;  4ZEF A;  4NWC A;  4U22 A;  1H45 A;  3K1M A;  2AL4 A;  2OWT A;  4Q0C A;  4ELQ A;  4NF6 A;  3B7D A;  1ELJ A;  1SW2 A;  4NF5 A;  3FGS A;  3TEL A;  3CI8 A;  5CRY A;  5F1Q A;  2RKM A;  4F3P A;  3O9P A;  2E0S A;  5ELV A;  3TTM A;  2UXA A;  2VD2 A;  4PFY A;  3PUV E;  4UA8 A;  3DRJ A;  1ZJL A;  4N13 A;  4DXU A;  4HCY A;  1TWY A;  4KQP A;  5CBS A;  2UYE A;  1B3G A;  1IIW A;  5I84 A;  3G3G A;  1YAE A;  3O6G A;  4ZE8 A;  2XXQ A;  5BWJ A;  2Y7W A;  1DMB A;  4NED A;  1MQG A;  1YPN A;  3L6H A;  5CBR A;  4IY5 A;  1HSJ A;  3TCF A;  3OXN A;  4H67 A;  3CFL A;  5HM4 B;  1XOC A;  4QSE A;  5K2Y A;  4YKJ A;  3G3I A;  1MY2 A;  3Q28 A;  3QAX A;  4RA1 A;  3LSL A;  5CMM A;  4Z7E A;  2RC9 A;  3IOU A;  4LVQ A;  2XX8 A;  2VP1 A;  5TPA B;  4HW8 A;  4EXL A;  1MY0 A;  1LFI A;  3VVE A;  3OO9 A;  4YIC A;  1TFA A;  4AQ4 A;  5AA2 D;  1NL5 A;  2PX1 A;  3RT6 B;  3FV1 A;  2ZYN A;  3OO6 A;  3EPE A;  4P0G A;  4OER A;  4OHN A;  1WDN A;  5FTH A;  2HZL A;  3H03 A;  2HCA A;  3K6W A;  1FQF A;  3E13 X;  1D3K A;  3DM0 A;  5FHO A;  1O64 A;  3N6T A;  5JEI A;  1QKA A;  3VDF A;  1MQH A;  4BDR A;  1MY1 A;  3O29 A;  1FCK A;  5TPA A;  3CR9 A;  3H6V A;  5I2K A;  4P11 A;  1MXU A;  1AIV A;  3V8X B;  3R7X A;  4XKP A;  1ZLQ A;  4TOZ A;  2H5Y A;  2UVI A;  5H8H A;  2R6G E;  2R9J A;  3EF7 A;  4TLM B;  3QIM A;  2DSF A;  1MM6 A;  1ANF A;  1DPE A;  1RYO A;  4OEU A;  1I6A A;  2KLF A;  2O1L A;  1MPC A;  3V5A A;  2RIN A;  3H3G A;  4YKK A;  4KYD A;  1XVY A;  2XXH A;  4R6H A;  1B3E A;  1USY H;  4ELO A;  1SD3 A;  3G3H A;  3CFZ A;  4DDD A;  2UVG A;  1B6H A;  3O28 A;  1B9J A;  3VE1 B;  5A5X B;  2UVH A;  2FYI A;  2ZNU A;  3T66 A;  1OLA A;  5ITP A;  1M5C A;  3C4M A;  4U4X A;  4YAH X;  4DXB A;  2O84 X;  4XTC Q;  3OO8 A;  2A5T B;  2D21 A;  1N7W A;  1JVY A;  4FED A;  1R9L A;  3O97 A;  2ESN A;  2DS9 A;  4H5G A;  1JW4 A;  4O3B A;  2QS4 A;  5TU0 A;  2LAO A;  5L8D A;  1T0K A;  3TCH A;  3ONM A;  3O6P A;  3KSX A;  4IO7 A;  4R6K A;  5I59 B;  3DRH A;  4QF9 A;  3BKI B;  4DXC A;  2P1S A;  1D9V A;  2UVJ A;  1DTZ A;  3PPR A;  3OOA A;  1P1U A;  4R9G A;  1LAG E;  2A5T A;  2OWS A;  1JNF A;  3IO6 A;  3S4U A;  1MH3 A;  4WED A;  3VV5 A;  1LFH A;  2DE4 A;  4OXV A;  2ZNT A;  2QS3 A;  3MW0 A;  3VXB A;  2Q89 A;  5CMB A;  4QSD A;  4DLD A;  4OFO A;  3MAM A;  4R9F A;  3VLU A;  2Q8J A;  1ZMG A;  3T9V A;  2GHB A;  3PD8 A;  2FNC A;  4NF4 B;  5FTI A;  4G8H A;  4QHQ A;  5CMC A;  2A5S A;  2Q88 A;  3I5O A;  4KI0 E;  4ELP A;  1JET A;  1Y20 A;  2I4C A;  3ZS6 A;  1HSL A;  2XD2 A;  3TTR A;  2W7Y A;  1JEU A;  3PU5 A;  3IL1 B;  3C36 A;  3KG2 A;  4U21 A;  3U92 A;  1B1H A;  4OEN A;  5HPQ A;  4I8C A;  1B58 A;  2H98 A;  2XD3 A;  1TXF A;  4F1Y A;  5J1D A;  4G68 A;  4NE4 A;  1MQD A;  3SKP A;  3H4Z A;  4GFR A;  4JWO A;  1B3F A;  1Y3N A;  3KJ7 A;  5IAI A;  2O68 A;  3UOR A;  5JTY A;  1B51 A;  4YB5 A;  3FJG A;  5AA4 B;  3FAT A;  4RJZ A;  4Q5T A;  1PC3 A;  3S9L C;  4QFO A;  4EF1 A;  3GBB A;  2X7Q A;  3A09 A;  2YLN A;  2Z8F A;  3T22 A;  1US5 A;  3LSW A;  3N94 A;  1P1W A;  5CM6 A;  2PMS A;  4ESX A;  4IO3 A;  4H0W A;  3PPN A;  2ZYK A;  3ILT B;  1UTH B;  3MQ9 A;  4MLQ A;  1B7H A;  1BTJ A;  4FEB A;  2NXO A;  4F3B A;  4U2R A;  4YMB A;  3KN3 A;  3M3K A;  4R72 A;  2HQ0 A;  4X1B A;  2V3Q A;  4C1T A;  1JQF A;  3T9U A;  1QUL A;  1NH8 A;  3TMG A;  5AA4 A;  3K4U A;  1MG1 A;  3G3K A;  4X9T A;  3S9N C;  2DWA A;  2ABH A;  3RLF E;  4FAT A;  3M3F A;  4GLI A;  3FVN A;  3IAZ A;  5B7D A;  4ONY A;  4QFK A;  4RNS A;  4DIG A;  1UTB A;  1LLS A;  3CHG A;  5H8Q B;  4WKM A;  5KZT A;  2RC8 A;  3GBA A;  1QW0 A;  4H8I A;  1IIT A;  3LSF B;  4KPT A;  5L9S A;  1B5J A;  1B46 A;  1FQB A;  2I4B A;  4H5F A;  1SI1 A;  4ZS9 A;  3VLW A;  2AIX A;  2V3T A;  4DCX A;  2DWI A;  2DWJ A;  1XS5 A;  4ESW A;  3FAS A;  2F8D A;  1RYX A;  2Q2A A;  4GOT A;  2IEE A;  3LSX A;  2PYY A;  4LQ2 A;  1URG A;  2OLB A;  4BDO A;  2Q9T A;  1N84 A;  3SEY A;  4I9D A;  3MVX A;  5H8Q A;  3TFL A;  1OVB A;  4Q30 B;  3GZG A;  2O7U A;  3PPO A;  3IOW A;  3K2D A;  5EHS A;  1F9B A;  3OD7 A;  4GD5 A;  1M5D A;  1LGB C;  3HO7 A;  1SVX B;  1OVT A;  3IO4 A;  3RN8 A;  4EXK A;  1D4N A;  3I6V A;  1MPB A;  1Y4T A;  1A55 A;  1RKM A;  2Y7I A;  3FJM A;  1YCJ A;  4DE8 A;  1YTV A;  4NWD A;  3B6Q A;  4ECF A;  5DEX B;  3SEV A;  3N26 A;  2P2A A;  4JDF A;  2REJ A;  3SES A;  2VGQ A;  3MPK A;  4YB6 A;  5I2N A;  4N07 A;  3MJN A;  1MXV A;  3KFM A;  3QK6 A;  3SET A;  4F3S A;  4GWO A;  1DSN A;  3L6G A;  1A8F A;  2ANJ A;  2M8C A;  1Z7M E;  4IGT A;  2PT1 A;  3SEU A;  4R6Y A;  2I0B A;  4WEP A;  3U1O A;  1VFE A;  3M8U A;  3K00 A;  2PBW A;  1WOD A;  5L9M A;  4IY6 A;  4RK2 A;  3UIF A;  4OZ9 A;  3CFX A;  5KDT B;  4GQO A;  4H65 A;  4NTL A;  1Y1M A;  3F11 A;  3HV1 A;  1URD A;  5FHM A;  2XXI A;  5DVJ A;  3TUS A;  3RYA A;  3PMW A;  4THI A;  2RC7 A;  4TLL B;  4MFI A;  3QXM A;  5BUU A;  1US4 A;  1B5I A;  1JEV A;  4QSC A;  2QMW A;  1O63 A;  3MP1 A;  3CIJ A;  4PFW A;  5DYH A;  4XKN A;  1J1N A;  4F39 A;  3LVU A;  3KJT A;  1NNK A;  5TP9 B;  1EH3 A;  5M2V A;  3DP6 A;  5AA2 B;  3PMX A;  2I6E A;  4YKI A;  1UQW A;  2DOJ A;  3HST A;  3O2A A;  3FXR A;  3TQW A;  3KEI A;  4FJP A;  4OES A;  1LST A;  2F97 A;  5FHN A;  5KCJ B;  4ZZA A;  4RY1 A;  1A7L A;  2H99 A;  4GXA A;  3H7M A;  5H8F B;  3EQ1 A;  2F7C A;  4EF2 A;  3IB0 A;  2F35 A;  3IOT A;  3EHU A;  4OTE A;  2VD3 A;  2Q2C A;  3HHF A;  1JW5 A;  3VVD A;  3I3V A;  3SEW A;  5TP9 A;  4ZEB A;  1N3X A;  3RTW B;  2RCA A;  3N6U A;  4KCD A;  1B7U A;  4BDM A;  5LOM A;  3THI A;  4KYE A;  3LBS A;  5AA3 A;  4F22 A;  1OQH A;  1B52 A;  1MDQ A;  4GRK A;  4G2Z A;  2G93 A;  5H8F A;  3CG3 A;  2XXV A;  3IB2 A;  4OMB A;  3MPL A;  3CRB A;  2QS2 A;  2ONR A;  3O66 A;  3PUX E;  3KZG A;  1B7Z A;  5ICQ A;  2F6G A;  3CVG A;  5CI5 A;  1BP5 A;  3BFU A;  1P1Q A;  3HPI A;  1JW1 A;  2HEU A;  4R2B A;  4GVO A;  1S7Y A;  3H6T A;  1D9Y A;  2I58 A;  1FQD A;  1FQA A;  3H6W A;  4E0X A;  3RT8 A;  1POT A;  1I6B A;  5A5X A;  4R74 A;  3U93 A;  3FTO A;  5EYF A;  3T93 B;  4FAJ A;  4XKR A;  2O6A A;  4HCW A;  1TT1 A;  1N76 A;  3N5L A;  3MVY A;  2V93 A;  4KHZ E;  2BJJ X;  1A40 A;  4RXL A;  1POY 1;  2XXY A;  3FIR A;  4JSD A;  2B3F A;  1QKB A;  1LAH E;  4EUO A;  5DTB A;  1SI0 A;  3ECR A;  2XXW A;  4YMA A;  3VXC A;  3ZSF A;  3E3K A;  1B3H A;  1H43 A;  2ZMB A;  1MXZ A;  4L17 A;  3K02 A;  1EZO A;  3O6H A;  5I59 A;  3RTF B;  4ZE9 A;  1MM7 A;  2WOP A;  3ZKL A;  1SDX A;  4P0I A;  4M1V A;  4BDN A;  4OEV A;  4DZ1 A;  2OJT A;  1OQG A;  4PE5 B;  4R2F A;  3IK6 B;  4IO5 A;  1GGG A;  3IOV A;  4Z0I A;  1NMU A;  2RCB A;  2I3W A;  4OYV A;  4DCY A;  3EHS A;  3HHG A;  1NNP A;  4HS7 A;  4KCC A;  1FQE A;  3SDF A;  3UN6 A;  1Y3Q A;  1ZIU A;  3K6U A;  4Q8R A;  1B05 A;  1A54 A;  1MQJ A;  4OQO A;  1MDP 1;  4KR5 A;  3DRF A;  4I1D A;  4AB5 A;  2B4M A;  4JB7 A;  3JZJ A;  4NF4 A;  5F7V A;  4ELR A;  3TCG A;  1MQI A;  3DRG A;  4POW A;  4KD5 A;  4H8J A;  3OEN A;  2O7I A;  1N3W A;  1PB7 A;  3UA8 A;  2RF1 A;  4LZ5 A;  2B65 A;  3C32 A;  1S50 A;  2DE3 A;  1MXX A;  3UP9 A;  4RYA A;  1VE4 A;  2HXW A;  3TTK A;  4YKP A;  1P1N A;  1JVX A;  2HAV A;  1USY E;  3KOT A;  1L5T A;  4BDL A;  3FZV A;  3MVW A;  3MUQ A;  3VFJ A;  3PUY E;  3K0V A;  3TAJ A;  2QSX A;  2OK2 A;  3UK4 A;  4R73 A;  4R75 A;  5EHM A;  1LBB A;  1OLC A;  3FVO A;  2O69 A;  3FXU A;  3HCQ A;  3P7I A;  3PAM A;  3PD9 A;  5AE4 A;  4QFN A;  2WOK A;  1TFD A;  4EDP A;  3RUM A;  1XVX A;  4MLV A;  2G29 A;  2YJP A;  2Y7P A;  2F36 A;  4LZ7 A;  2V84 A;  1VSO A;  1LAX A;  2XX9 A;  3KN8 A;  4O3C A;  1B4H A;  2IA4 A;  2F7A A;  1SW1 A;  1BIY A;  3MZ9 A;  1H3D A;  2DXY A;  1B3L A;  1N04 A;  1UTH A;  3PPP A;  3LR1 A;  2UYF A;  4ZED A;  4OWD A;  3RY3 A;  1MS7 A;  4G4P A;  3E9X A;  1UIU A;  1OMP A;  4UAC A;  1IEJ A;  2CZL A;  4OFL A;  3C33 A;  3OSR A;  3TQL A;  4YZZ A;  3S9M C;  4HTG A;  2XXP A;  1ATG A;  3PGF A;  2FA7 A;  3QSL A;  1II5 A;  1FTO A;  2DE2 A;  4H6D A;  4K3F A;  1NNT A;  2OCU A;  3DP4 A;  3VLV A;  4BLA A;  2DVC A;  1A8E A;  4JSO A;  1LB8 A;  4MF3 A;  3MC2 A;  1QUJ A;  2ONS A;  4N6P A;  4U4S A;  1IXH A;  4LZ8 A;  2HAU A;  2GHA A;  4ND9 A;  1AMF A;  1Y4C A;  2CMO A;  2D3I A;  4GF8 A;  1B0H A;  4G8N A;  1Q1K A;  3PUW E;  4GIZ A;  4JXI A;  3MBP A;  1HSE A;  4KFQ A;  3IX1 A;  3S9E A;  1MRP A;  3OEK A;  1CB6 A;  1URS A;  1LB9 A;  4TQU Q;  3T9X B;  4FIM A;  2DQV A;  2XX7 A;  1LCT A;  2F5X A;  4ISU A;  2DYX A;  3K6X A;  3MZ1 A;  1P99 A;  1SBP A;  4F18 A;  2GRV A;  3OEL A;  3IR1 A;  4U1O A;  2NOO A;  1Y1Z A;  2Y7R A;  1N7X A;  5I57 B;  1Z7N E;  3MZB A;  5CC2 A;  1PBQ A;  3A3C A;  5DVF A;  2H25 A;  1B5H A;  3Q27 A;  3TZA A;  2OBG A;  4EQ7 A;  5H8S A;  5DEX A;  2F34 A;  3QYT A;  4QFP A;  1FQC A;  1ZBM A;  3R6U A;  4MH5 A;  4QFL A;  1MH4 A;  3IJO B;  1DPP A;  1LCF A;  2NUV A;  1QUK A;  5I56 B;  4ZZE A;  2NVU B;  3W9V A;  2QMX A;  2VHA A;  1IUD A;  3MWB A;  3KN7 A;  1QVS A;  1ZU0 A;  5I57 A;  2V3U A;  5H8N B;  3IJX B;  2Y84 A;  2Y7K A;  5ITO A;  1FTM A;  4OVJ A;  4POX A;  5I2K B;  4LP2 B;  3TYH A;  1WVJ A;  5KDT A;  4G68 C;  4LUB A;  3WAF A;  4OFJ A;  1O7T A;  3VVF A;  3S2V A;  3ZKK A;  3IOR A;  5H8H B;  3DRI A;  3OSQ A;  1MY3 A;  4IO6 A;  4M4G A;  1FTK A;  3RYB A;  5I56 A;  2Z8E A;  3D4G A;  1EZ9 A;  4F2Q A;  1XT8 A;  3V83 A;  4ZDM A;  3SER A;  2QRY A;  1AH5 A;  3C34 A;  3TEP A;  4PP0 A;  5H8N A;  3K1N A;  2WKY A;  3E4R A;  1IZ1 A;  4F3G A;  1GV8 A;  5AA2 A;  2GH9 A;  1ZKB A;  3DP8 A;  3KBR A;  3WAE A;  2PVU A;  3LC8 A;  3OEM A;  3CG1 A;  4F19 A;  3JV9 A;  2XHD A;  2XXU A;  5KCJ A;  3ODB A;  2XXR A;  4F1U A;  1NNF A;  4F2O A;  2ALU A;  2PT2 A;  1XHY A;  2ONK E;  1LBC A;  1I6Q A;  4U23 A;  3FXQ A;  4PQJ A;  3DRK A;  3M3L A;  4GL8 A;  3U8Q A;  4PFU A;  1PDA A;  1SW5 A;  2THI A;  4IO4 A;  4EQB A;  3ILU B;  1Y9U A;  3TPA A;  3PUZ E;  1FTJ A;  4XIG Q;  3RQT A;  3TTN A;  4FE8 A;  3B6T A;  1EZP A;  1R1N A;  4MBP A;  1ZTY A;  1DTG A;  4NMY A;  1NKX A;  1B0L A;  4H1X A;  1MPD A;  3OMB A;  4EQ9 A;  1MXY A;  4X48 A;  1B1X A;  5K2X A;  3USD A;  1B32 A;  2HZK A;  1SYH A;  4OET A;  4LAT A;  1R9Q A;  2DVZ A;  1LFG A;  1VR5 A;  1I69 A;  1NH7 A;  4IB2 A;  3Q26 A;  3FVK A;  2QL3 A;  4G77 A;  3OO7 A;  1CE2 A;  1IXI A;  3TDJ A;  1N0T A;  1B4Z A;  2ZNS A;  2QPQ A;  3W15 C;  3Q29 A;  3R26 A;  2X26 A;  3HN0 A;  2I3V A;  1BLF A;  1R6Z A;  4GL0 A;  2ZXT A;  1FTL A;  2O1M A;  1UIV A;  4LA9 A;  3MVZ A;  4G68 B;  4LQ5 A;  3EN3 A;  1M5B A;  3IB1 A;  4F29 A;  4XKQ A;  1EU8 A;  1VFD A;  3RPW A;  3CSG A;  1LAF E;  3AXF A;  3FV2 A;  5ISU A;  1BKA A;  3H6U A;  3EHT A;  3FUZ A;  3B6W A;  4JBZ A;  3PMV A;  5JTY B;  3H06 B;  1M5F A;  4C0R A;  1XC1 A;  2I49 A;  2AL5 A;  4ZEI A;  3CSB A;  2DXR A;  1DOT A;  2R71 A;  2D5W A;  3O6I A;  3U94 A;  2DWH A;  2E1S A;  3BBR A;  1H44 A;  4PFT A;  2Z22 A;  1Y3P A;  4G8M A;  3T96 B;  2DP8 A;  3QUF A;  4ZEK A;  5DT6 A;  3BFT A;  3MP6 A;  1GTK A;  4F1V A;  1PB9 A;  2O51 A;  1SYI A;  3DLN A;  4BDQ A;  2H4I A;  3A3U A;  4XXU A;  2AYS A;  3DEL B;  4RK9 A;  1QJM A;  3FJ7 A;  1PB8 A;  4AB6 A;  2F7B A;  2Z23 A;  3K01 A;  3RGY A;  3G3J A;  3SEX A;  1FW0 A;  3G7W A;  3TTL A;  4I62 A;  2H9B A;  1H76 A;  2QJE A;  4QRZ A;  2X7P A;  1GR2 A;  4NF8 B;  1SW4 A;  3D4C A;  2F78 A;  1UTB B;  2WOL A;  5AA1 A;  2B4L A;  4F31 B;  2Z8D A;  3K6V A;  1S9T A;  2V25 A;  3K1P A;  3TOD A;  2VOZ A;  1QUI A;  5CMK A;  1GVC A;  4KYS A;  3GLB A;  4YU0 A;  2YPN A;  3KGC A;  3FD3 A;  4PET A;  3QUJ A;  2REG A;  1NFT A;  2B3B A;  3PPQ A;  2GFE A;  1AOV A;  4WXJ A;  3Q25 A;  2P0S A;  2F6P A;  4IO2 A;  3RNN A;  2ZYM A;  5HBC A;  3MP8 A;  1Q35 A;  2OZZ A;  5I58 B;  4NF8 A;  3C35 A;  3GXA A;  4JWY A;  3V89 B;  1PBP A;  1B40 A;  1MXW A;  3C9H A;  3FVG A;  3T9H B;  3W9W A;  5IKB A;  2NWJ A;  2XXT A;  1A99 A;  3G3F A;  1OIB A;  2XXX A;  3JYR A;  4IGR A;  1MY4 A;  4C1U A;  4JWX A;  1SQY A;  1IXG A;  4NF6 B;  2I0C A;  4NF5 B;  4RPN A;  4X1D A;  5JK4 A;  3UGW A;  3U72 A;  4RPO A;  4ZEC A;  1AL3 A;  5B70 A;  3PV0 E;  4O3A A;  2I48 A;  3KSJ A;  2HFB A;  4E0W A;  1KWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...