3TCFA

Crystal structure of e. coli oppa complexed with endogenous ligands
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
517
structure length
517
Chain Sequence
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Periplasmic oligopeptide-binding protein
publication title Escherichia coli peptide binding protein OppA has a preference for positively charged peptides.
pubmed doi rcsb
source organism Escherichia coli
total genus 172
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3tcfA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tcfA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3tcfA02
1SI1A 3MPLA 3TTRA 1CE2A 1LLSA 3Q27A 1MS7A 1XOCA 3PUXE 5ITPA 3DRFA 3VVEA 2XXYA 3FVKA 4G4PA 1LFGA 2R6GE 2IEEA 4AB6A 3L6HA 1MQDA 3VFJA 4Z0IA 3TQWA 4WEDA 2V93A 3MPKA 2B3FA 2OJTA 2ABHA 1JW1A 3WAFA 1N7XA 3W9WA 5H8FA 4PETA 3U8QA 4G2ZA 1B5HA 1MDQA 2Y7PA 2HCAA 4LONB 1QKAA 4BDQA 1BIYA 4KQPA 1AL3A 4GFRA 2O7UA 3QAXA 4KCCA 4NEDA 3K1PA 2A5TA 2XXQA 3N5LA 3CR9A 3OD7A 1B2HA 5L9OA 2XX8A 1FQCA 4UACA 4IO2A 1MXUA 2H25A 4YB5A 3RYBA 4KI0E 3SETA 3KGCA 1LFIA 4ND9A 1IZ1A 4JWOA 1A7LA 2GFEA 4ZEIA 2I49A 2IA4A 3PGFA 3A09A 2QL3A 1EZ9A 1MPCA 4YAHX 5AA1A 3FXRA 5CBSA 3IOVA 2RINA 4G8NA 2I4CA 4OZ9A 3SEXA 4F19A 4H5FA 3TTMA 1QUKA 3S9MC 1B3FA 3RQTA 4U4SA 1JW5A 1MY4A 3TYHA 4XKPA 1B58A 3RYAA 3SERA 2DQVA 3TCHA 4QSEA 5LOMA 5AA2B 3W15C 2HZKA 3IOTA 2QJEA 1ZJLA 1H43A 3LVUA 2GRVA 4GL8A 4Z7EA 4RYAA 3S9NC 2AL4A 5F1QA 4M4GA 4DIGA 4ELPA 3ZS6A 3PPQA 1M5FA 2F7CA 4KCDA 5M2VA 4F18A 4YMBA 5JK4A 4F29A 1N3WA 2ALUA 3N26A 1B3EA 4NF6B 4FIMA 1GTKA 1B4ZA 4YKKA 3T9VA 3R26A 3KOSA 1N7WA 1FTLA 3OO6A 1LGBC 2DE2A 4ESXA 1WVJA 5I56A 2OWSA 4G77A 4IGRA 1B7ZA 1MQIA 3VXCA 4ZZAA 4ELRA 4KYSA 5DYHA 3H06B 3H6VA 1SW1A 2RC8A 1SYHA 1MPBA 2OLBA 2Y7KA 1HSLA 2VD3A 4GWOA 3EPEA 1B51A 4H6DA 4FATA 4Q5TA 4G8HA 3PUZE 4RY1A 1O64A 3KSXA 3K01A 1IIWA 5H8NB 3IOWA 3DP6A 4JDFA 2ZNTA 1Z7NE 3DRIA 2P0SA 1RYOA 4KYDA 4QFNA 3O2AA 3CVGA 1P1WA 1EU8A 2Z8FA 1O7TA 4XTCQ 3WAEA 1M5BA 3A3UA 1D4NA 3OO8A 1R6ZA 3QXMA 2YJPA 3O9PA 1H44A 1US5A 1A40A 2XX9A 3K0VA 4EUOA 3FATA 3I6VA 3RN8A 3S9LC 4IO3A 3LSXA 5I59A 3ZSFA 3QYTA 1IITA 3OSRA 2DE3A 4G8MA 3HV1A 3C36A 1IEJA 4LA9A 4IO4A 4H1XA 2B65A 2ZNSA 5AE4A 1H76A 2QS1A 3OO9A 1SW2A 2UVIA 4MBPA 3PV0E 1LAFE 2ZMBA 3LSWA 2V84A 3H3GA 2I3WA 4JWYA 1H3DA 4GOTA 4M1VA 1USYH 3KBRA 3LSLA 4WXJA 1P1OA 1PEBA 4RK9A 3MVYA 2CMOA 3CFLA 4R6YA 5ICTA 2GHBA 2Y84A 4LZ8A 2WOLA 3ZKKA 1JVYA 1S50A 1CB6A 1EZPA 4KYEA 3O6HA 2V3TA 3PUVE 1JETA 5DTBA 5A5XA 3KFMA 4G68B 4RK2A 2VHAA 1UTBB 1OLAA 4GIZA 1MG1A 4LQ2A 1MQGA 3FGSA 4R2FA 5H8QA 5TPAB 1FCKA 3T66A 4JBZA 2XXRA 3TTLA 3KOTA 2Q9TA 1NFTA 3A3CA 5ELVA 3N6UA 1JW4A 1ZLQA 4EQ9A 3UIFA 4OQOA 1ZBMA 1OQGA 5CMBA 4IO6A 1N0TA 4R74A 3THIA 4YKIA 5CMCA 4GQOA 3MZBA 1M5CA 4F39A 3DRJA 1B40A 1ATGA 4ZS9A 4HS7A 4F2QA 1B0LA 4OEUA 3LC8A 2REGA 3B6QA 3G3GA 1IXCA 4PFUA 4THIA 3EN3A 3MZ9A 4NF5A 3UP9A 2F35A 4FORA 3Q26A 3I3VA 1MQHA 2KLFA 4ELOA 2HEUA 4R9GA 1B6HA 4IY6A 4R6KA 5KCJA 3IR1A 3OENA 1MY3A 1I6AA 2PVUA 2UVGA 4GL0A 2F6GA 4JWXA 3S4UA 2B3BA 2DXYA 4PFYA 1PB8A 3FUZA 5H8HA 3KN7A 3IB2A 3CIJA 3RTFB 3BFUA 4P0GA 3PPRA 5HM4B 3UK4A 4HW8A 4QFPA 4IY5A 5TP9B 2R9JA 1DPPA 3V89B 3PAMA 2LAOA 5AA4A 3S9EA 4PP0A 2DWAA 2V25A 3C4MA 2NUVA 4MLVA 4U1OA 3FZVA 2E0SA 3Q25A 4ZZEA 1SW4A 1OQHA 4LP2B 4X1BA 3R6UA 2AYSA 5TU0A 1Y4TA 2WKYA 4POWA 3MC2A 3PUYE 1QW0A 4X9TA 3AXFA 1A54A 1NL5A 3QSLA 4GVOA 5FHNA 1BLFA 2XD3A 3K02A 4QSCA 4U2RA 3TTNA 3RY3A 4FE8A 1MY2A 2Q2AA 2ZNUA 4GF8A 1XS5A 3DM0A 2PBWA 2FA7A 3IJOB 4Q8RA 4OESA 4I9DA 2RCBA 3RT6B 4R72A 4N07A 5JTYA 3PD9A 3GBBA 4H5GA 5CMMA 1PB9A 3V83A 3O66A 1MM6A 5I57A 2DXRA 3EHTA 1MQJA 2Z8DA 2Q89A 4GD5A 1XT8A 3IB0A 4YKJA 4EDPA 4H67A 2HAUA 2ESNA 3DRGA 3JYRA 4HCWA 4UA8A 3OELA 3SEYA 3TPAA 2OBGA 1I6QA 2O84X 4FEDA 4Q0CA 4RNSA 5KDTA 4NWDA 3H7MA 4F2OA 4F3BA 4LATA 4PFTA 3LSFB 1WODA 3IORA 4ZEDA 1B05A 3FASA 1B5IA 3MUQA 4ISUA 2ZXTA 2P1SA 1GR2A 4LVQA 4TLLB 4KPTA 2I4BA 2HAVA 2DE4A 2UYEA 1TFDA 3RNNA 4N13A 4XKRA 4FEBA 1B1XA 3PU5A 4YKPA 2X7PA 4FJPA 1SI0A 1Y3NA 1TT1A 1OLCA 4GXAA 4X48A 3ECRA 3OMBA 2DVZA 3T22A 3BKIB 1UQWA 3VVDA 2PT2A 2RCAA 1Y20A 2PX1A 3QIMA 1TWYA 3OSQA 1N76A 3EHSA 3FV1A 1R1NA 4GRKA 3RPWA 3GBAA 5I58A 3CSBA 1VFEA 1MXVA 5I2KB 3FV2A 3HPIA 3H6UA 3FJMA 1ZU0A 1LBBA 3U94A 3IO4A 5HPQA 4I62A 4EF2A 3RT8A 4U23A 3TCGA 1B3LA 5CMKA 1IXHA 4ZECA 3MVWA 3P7IA 3FVNA 3K6VA 1FTKA 4Q30B 5L8DA 1JNFA 1Q35A 1NKXA 3KJTA 3TMGA 4NF8A 3DRHA 4OFOA 5DVFA 3MP8A 5H8SA 1A99A 4POXA 5H8FB 5CC2A 1XVXA 3CFZA 2QMWA 3D4CA 1YPNA 2B4LA 4H65A 3I5OA 3H03A 1BTJA 3R7XA 3H4ZA 4XIGQ 3E4RA 2A5TB 1UTHA 1USYE 1PDAA 3K1MA 2D5WA 2DWIA 4PQJA 2ZYOA 2H5YA 3HN0A 3N94A 1SDXA 1BKAA 1D3KA 2F36A 3ZKLA 1N3XA 2X26A 3M3KA 1B32A 4TQUQ 3RLFE 3SEVA 3VE1B 1PC3A 2VP1A 1FW0A 3ODBA 2M8CA 1BP5A 2REJA 2Q2CA 3B6WA 5CM6A 2XXVA 5I2NA 3IOUA 2I58A 2Z23A 1QVSA 3MW0A 2O7IA 3FD3A 4NF4A 5DEXA 3T9XB 1ELJA 3PPPA 1TFAA 1PBQA 4H8IA 2OWTA 1NMUA 3UN6A 4F3PA 5FTHA 3C9HA 3BFTA 3ONMA 3TFLA 4DDDA 3GLBA 2W7YA 4XXUA 4C1TA 1FTOA 3TAJA 2GH9A 4R75A 3QK6A 1B1HA 1B9JA 3FXQA 4WEPA 5AA3A 3H6WA 1VSOA 1HSEA 1N84A 4DZ1A 3ILTB 3FXUA 4BDNA 2RC9A 2QSXA 4I8CA 4XKQA 3C32A 4JB7A 1XC1A 3C35A 1GVCA 3TTKA 4ESWA 4GLIA 1NNFA 3U92A 5KZTA 5FHOA 3G3FA 3SEWA 1KWHA 2OZZA 3EHUA 4ZDMA 1B5JA 1PB7A 4ZE8A 5FTIA 3OEMA 4ZEFA 1QJMA 3C33A 2DVCA 1II5A 2HZLA 1EH3A 4EF1A 5IAIA 1WDNA 1Y3QA 1S9TA 1A55A 3T9HB 3TDJA 1GGGA 1MXZA 1AH5A 3VLUA 3HO7A 1MDP1 4O3BA 3U93A 4ZEKA 1YTVA 1B3GA 1POY1 2H98A 5EHMA 4KD5A 4QFOA 1Y3PA 3LR1A 5I56B 4L17A 4N6PA 2H9BA 1ZKBA 2D21A 1Z7ME 3TCFA 1B7HA 2ONRA 2XD2A 5F7VA 1VR5A 3MVZA 3T96B 2UVHA 2F5XA 3F11A 1NNTA 1N04A 1PBPA 3E9XA 3IAZA 1P1QA 5CBRA 4HTGA 4NWCA 1MY0A 1OMPA 1SVXB 2YPNA 3OO7A 2NOOA 2O1LA 4WKMA 1US4A 4YU0A 1MXYA 2VGQA 2I6EA 3DELB 1DTGA 1R9QA 1URDA 4P11A 4DE8A 4TLMB 1P99A 3S2VA 5ITOA 4YZZA 3MP6A 4LUBA 3T93B 2DP8A 1JEVA 2Q88A 3G7WA 5AA2A 1MPDA 1DSNA 4DCXA 1NH7A 2V3QA 1Y9UA 4OENA 2OK2A 4BDRA 1ZMGA 4OVJA 3CG1A 1UIVA 1IUDA 4F3GA 4G68C 1GV8A 3DLNA 2H4IA 4QFKA 1IXGA 1POTA 3G3JA 1FQBA 3N6TA 4F1UA 4IO5A 5FHMA 4OWDA 3SDFA 3IX1A 5BWJA 1MH3A 1OVTA 3MJNA 3KSJA 4NF6A 1B4HA 2DOJA 3T9UA 2Z22A 1JQFA 3MAMA 3PD8A 1DOTA 2QS2A 5DT6A 5B70A 3JV9A 4IO7A 3MP1A 3TZAA 3LUYA 3OOAA 4RA1A 2I0CA 3FJ7A 4ONYA 4OYVA 2QMXA 4C0RA 2E1SA 3PUWE 3G3IA 1F9BA 1JEUA 1J1NA 2H99A 3CG3A 3GZGA 4C1UA 4IB2A 5A5XB 2PT1A 4FAJA 5BUUA 4EQ7A 5H8QB 2AL5A 3FJGA 4AQ4A 1LAGE 2A5SA 3O6PA 4HCYA 3O28A 4DXCA 3O29A 4ZEBA 5J1DA 3B6TA 1UIUA 3TUSA 3USDA 5H8NA 2O69A 3GXAA 1QUIA 4OEVA 1LB8A 2F97A 3Q29A 5AA2D 4OFJA 4U22A 1SQYA 2WOKA 4YB7A 2QS3A 4OHNA 2I0BA 2UXAA 3BBRA 2F34A 3DP4A 1YAEA 4GXSB 3V5AA 3KZGA 3KJ7A 4U4XA 3CHGA 4OXVA 1DMBA 4NE4A 5JEIA 4OETA 1VFDA 2QPQA 4FECA 5DVJA 2XXIA 1YCJA 2THIA 3FIRA 3K1NA 2AIXA 3CFXA 3PPOA 4NF5B 3G3HA 3CRBA 1OIBA 3RUMA 4NMYA 2XXXA 1D9VA 1XVYA 1NNPA 3K00A 1A8EA 3HHFA 1DTZA 1DPEA 2R71A 5KCJB 2F78A 2BJJX 2F7AA 3OEKA 1TXFA 4KFQA 5IKBA 1MXXA 3M3LA 3RGYA 2QS4A 1NNKA 1Y4CA 5H8HB 4ZE9A 2ANJA 1SW5A 2HFBA 5L9SA 3O6IA 1MXWA 1LFHA 3K6WA 4K3FA 3PPNA 2FYIA 1QULA 3PMVA 3UGWA 5K2YA 2XXHA 5AA4B 3FVGA 4AB5A 2Y7IA 4R2BA 4BDMA 1HSJA 4H0WA 5CRYA 2V3UA 4G68A 1UTBA 1MH4A 1FQFA 5TPAA 1FQDA 5DVIA 4ELQA 4MFIA 3O6GA 1Y1ZA 1IXIA 2O6AA 1B3HA 3IO6A 5ICQA 5L9MA 1MM7A 2XHDA 3DP8A 3H6TA 2ZYKA 3DRKA 1MRPA 2B4MA 4YB6A 1A8FA 4DXUA 2F7BA 1SBPA 4P0IA 4YMAA 2HXWA 4BDLA 4F1VA 2XXTA 4QRZA 4PE5B 2XX7A 5JTYB 2I48A 2FNCA 4R9FA 3TQLA 3VDFA 2HQ0A 2Y7WA 4E0WA 3E13X 5I57B 1AOVA 2Y7RA 1JVXA 4QF9A 3U72A 3HHGA 4OFLA 1MY1A 1LB9A 1T0KA 4X1DA 3IL1B 2UVJA 4EXKA 5KDTB 3QUFA 1M5DA 4QFLA 1Q1KA 4YICA 4QSDA 3V8XB 3TKDA 2NWJA 2GHAA 1LCTA 1B46A 1FTJA 2D3IA 3PMWA 3C34A 4MLQA 1ZIUA 2ONSA 2VOZA 3B7DA 3SKPA 3TODA 2CZLA 1AMFA 2UYFA 4NTLA 3MQ9A 5TP9A 4DXBA 1M5EA 2DWJA 2XXWA 2NXOA 5CI5A 3CSGA 3KG2A 2X7QA 2XXUA 3TELA 2QRYA 1B7UA 4RJZA 1I6BA 2P2AA 3K4UA 1P1UA 3CI8A 2O51A 1L5TA 2XXPA 3KEIA 2NVUB 1LSTA 4U21A 5ISUA 5K2XA 3TEPA 3SESA 5EYFA 3MVXA 2ZYNA 1EZOA 1FTMA 3LBSA 2VD2A 3HSTA 1FQEA 3MBPA 2DS9A 3M3FA 4O3CA 3K2DA 3IJXB 1SD3A 4R6HA 3SEUA 5I58B 5HBCA 4QHQA 4I1DA 2RKMA 2PMSA 4BDOA 4LZ5A 2O68A 1LAHE 1LCFA 1LBCA 4EXLA 3L6GA 5EHSA 1URSA 3VVFA 4F31B 5I84A 1D9YA 3FTOA 2ONKE 1P1NA 4MH5A 2PYYA 1H45A 3IB1A 4XKNA 1URGA 3D4GA 4JXIA 1QUJA 1AIVA 2ZYMA 1IQ7A 4EQBA 4NF8B 4OMBA 3MWBA 2RF1A 1LAXA 1QKBA 4H8JA 5B7DA 1VE4A 1RYXA 3K6XA 1RKMA 3VV5A 3IK6B 3U1OA 2O1MA 3VLVA 4RXLA 2F6PA 3QUJA 1B0HA 1B52A 2F8DA 3EF7A 1UTHB 1XHYA 4E0XA 4F22A 2YLNA 2RC7A 3HCQA 1ANFA 4RPOA 4DCYA 2Q8JA 3G3KA 1O63A 3RTWB 3W9VA 3OXNA 4JSDA 4U1ZA 3UA8A 1Y1MA 3C31A 4RPNA 1R9LA 4IGTA 3JZJA 3KN8A 4DLDA 2Z8EA 3UORA 1S7YA 4OERA 5I2NB 1ZTYA 2DWHA 4MF3A 4F3SA 5I59B 4NF4B 1NH8A 5DEXB 4KHZE 2I3VA 3Q28A 4ECFA 4O3AA 4TOZA 2DYXA 1I69A 4OTEA 2DSFA 3E3KA 3EQ1A 4KR5A 2G29A 2WOPA 3KN3A 3K6UA 2G93A 4JSOA 2OCUA 3MZ1A 1FQAA 3VLWA 5I2KA 1OVBA 1SYIA 3ILUB 4LZ7A 3O97A 4F1YA 3VXBA 4R73A 4BLAA 3M8UA 4LQ5A 4PFWA 3FVOA 3PMXA
chains in the Genus database with same CATH superfamily
1SI1A 2QVUA 3MPLA 3TTRA 1CE2A 1LLSA 3Q27A 1MS7A 1XOCA 3PUXE 5ITPA 3DRFA 3VVEA 2XXYA 3FVKA 4G4PA 1LFGA 2R6GE 2IEEA 4AB6A 3L6HA 1MQDA 2V4CA 3VFJA 4Z0IA 3TQWA 4WEDA 1FBGA 2V93A 3MPKA 2B3FA 2OJTA 4P3LA 2ABHA 1JW1A 3WAFA 1N7XA 3W9WA 5H8FA 4PETA 4N8GA 3U8QA 4G2ZA 3SZPA 1B5HA 1MDQA 4PFBA 2Y7PA 2HCAA 4LONB 1QKAA 4BDQA 2JJKA 1BIYA 4KQPA 1AL3A 4GFRA 2O7UA 3QAXA 5EQ7A 4KCCA 2WEFA 4NEDA 3K1PA 2A5TA 2XXQA 4P9KA 4O7IA 3N5LA 3CR9A 3OD7A 1B2HA 5L9OA 2XX8A 1FQCA 4UACA 4IO2A 1NV1A 1MXUA 2H25A 4YB5A 3RYBA 5IM2A 4KI0E 4MMPA 2XWVA 3SETA 3KGCA 1LFIA 4ND9A 1FBPA 1IZ1A 4JWOA 1A7LA 2GFEA 4ZEIA 2I49A 2IA4A 3PGFA 3A09A 2QL3A 1EZ9A 1NV0A 1NUZA 1MPCA 4PF8A 1YYZA 4YAHX 5AA1A 3FXRA 1RDZA 5CBSA 3IOVA 1XI6A 2RINA 4PFRA 4G8NA 2ZZVA 2I4CA 4OZ9A 3SEXA 4F19A 4H5FA 3TTMA 1QUKA 3S9MC 1B3FA 3RQTA 4U4SA 1JW5A 1MY4A 3TYHA 4XKPA 1B58A 2CEYA 4GX6A 3RYAA 3SERA 2DQVA 3TCHA 4QSEA 5LOMA 5AA2B 3W15C 2HZKA 1LBWA 4O7MA 3IOTA 1DCUA 2CEXA 2QJEA 1ZJLA 1H43A 3LVUA 2GRVA 4GL8A 4Z7EA 4RYAA 3E78A 3S9NC 3A29A 2AL4A 1YZ0A 5F1QA 4M4GA 4DIGA 3BIGA 4ELPA 3ZS6A 3PPQA 1M5FA 2F7CA 4AS5A 4KCDA 5M2VA 4F18A 3FXBA 4YMBA 5JK4A 4F29A 1N3WA 2ALUA 3N26A 1B3EA 4NF6B 4FIMA 1GTKA 1B4ZA 4QXDA 4YKKA 3T9VA 1KA0A 3R26A 3KOSA 1N7WA 1FTLA 3OO6A 1LGBC 2DE2A 2F3BA 4ESXA 4MHFA 1WVJA 5I56A 2OWSA 4G77A 4IGRA 1B7ZA 1MQIA 3VXCA 4ZZAA 4ELRA 4KYSA 3H06B 5DYHA 3H6VA 1SW1A 1DBZA 1FRPA 1SYHA 2P3NA 2RC8A 1MPBA 2OLBA 2Y7KA 4PTKA 5A5LA 1HSLA 2VD3A 2PFZA 4GWOA 3EPEA 2P3VA 1B51A 4H6DA 2HPGA 4FATA 4XFEA 4Q5TA 4G8HA 3PUZE 4RY1A 1O64A 3PTYA 3KSXA 3K01A 1IIWA 5H8NB 3IOWA 4GBVA 3DP6A 4JDFA 2ZNTA 1Z7NE 3DRIA 2P0SA 1RYOA 4KYDA 4QFNA 3O2AA 3CVGA 1P1WA 1EU8A 2Z8FA 1O7TA 4XTCQ 3WAEA 1M5BA 3A3UA 1D4NA 3OO8A 1R6ZA 3QXMA 2HHMA 2YJPA 3O9PA 1H44A 1US5A 1A40A 4NQ8A 2XX9A 3K0VA 4EUOA 3FATA 3I6VA 3RN8A 3S9LC 4IO3A 4LN5A 3LSXA 5I59A 4X8RA 2Q74A 3ZSFA 3QYTA 1IITA 3OSRA 2DE3A 4G8MA 3HV1A 3C36A 1IEJA 4LA9A 4O94A 4IO4A 4H1XA 2B65A 2ZNSA 5AE4A 1H76A 2QS1A 3OO9A 1SW2A 2UVIA 3EKIA 4MBPA 3PV0E 1LAFE 2ZMBA 3LSWA 2V84A 4N17A 3H3GA 2I3WA 4JWYA 1H3DA 1IMCA 4GOTA 4M1VA 1USYH 3KBRA 4AS4A 3LSLA 4WXJA 2Q8MA 2PFYA 1P1OA 1PEBA 4RK9A 3MVYA 2FBPA 2CMOA 3CFLA 4R6YA 3RYDA 4GWWA 5ICTA 4P1EA 2GHBA 2Y84A 4LZ8A 2WOLA 3ZKKA 1JVYA 1NV5A 1S50A 1CB6A 1EZPA 4HE0A 4KYEA 3O6HA 2V3TA 3PUVE 1JETA 5DTBA 5A5XA 3KFMA 4G68B 4RK2A 2VHAA 1UTBB 1OLAA 4GIZA 1MG1A 4LQ2A 1MQGA 3FGSA 4R2FA 3B50A 5H8QA 5TPAB 1FCKA 3T66A 4HE2A 4JBZA 2XXRA 3TTLA 3KOTA 3RPLB 2Q9TA 1NFTA 3A3CA 1CNQA 5ELVA 3N6UA 1JW4A 5ET6A 1ZLQA 4EQ9A 3UIFA 2Y5KA 4OQOA 1ZBMA 1OQGA 5CMBA 4IO6A 1N0TA 2FHYA 4R74A 3THIA 4YKIA 2CZIA 2QFLA 1NV6A 5CMCA 4GQOA 3MZBA 1M5CA 4F39A 4NAPA 3DRJA 1B40A 1ATGA 4ZS9A 4HS7A 4F2QA 1B0LA 4MAGA 3HFUA 1KA1A 1FPKA 1IMDA 4OEUA 3LC8A 2REGA 3B6QA 3G3GA 1IXCA 4PFUA 4THIA 3EN3A 3MZ9A 4NF5A 3UP9A 2F35A 4FORA 3Q26A 3I3VA 1MQHA 1NUWA 2KLFA 1G0IA 4ELOA 2HEUA 4R9GA 1B6HA 4IY6A 4R6KA 5KCJA 3IR1A 3OENA 1MY3A 1IMBA 1I6AA 2PVUA 2UVGA 4GL0A 3ISPA 2F6GA 4JWXA 4GWYA 3S4UA 5I3SA 2B3BA 4PAFA 2DXYA 4PFYA 1PB8A 3FUZA 5H8HA 3KN7A 3IB2A 3CIJA 3RTFB 3BFUA 4MEVA 4P0GA 3PPRA 5HM4B 3IFAA 3UK4A 4P47A 4HW8A 4QFPA 4IY5A 3E79A 5TP9B 4O8MA 2R9JA 1DPPA 3V89B 3PAMA 2LAOA 5AA4A 3S9EA 4PP0A 2DWAA 2V25A 3C4MA 2NUVA 4MLVA 5I5PA 4U1OA 3FZVA 2E0SA 3Q25A 1IMAA 4PAKA 4ZZEA 1SW4A 2WBBA 1OQHA 4LP2B 4X1BA 3R6UA 2AYSA 1VDWA 4OVRA 5TU0A 1Y4TA 2WKYA 2Y5LA 4POWA 3MC2A 4JVCA 3LUZA 4N6DA 3PUYE 1QW0A 4X9TA 3AXFA 1A54A 1NL5A 3QSLA 4GVOA 5FHNA 1BLFA 2XD3A 3K02A 4QSCA 4U2RA 3TTNA 3RY3A 3GYYA 4FE8A 4JVIA 1MY2A 2Q2AA 2ZNUA 4GF8A 1XS5A 3DM0A 2PBWA 2FA7A 3IJOB 4Q8RA 2VPNA 4OESA 4I9DA 2RCBA 3RT6B 4R72A 4N07A 5JTYA 3PD9A 4H45A 3BIHA 3GBBA 4H5GA 5CMMA 3MYUA 1PB9A 3V83A 5EYGA 3O66A 1FBHA 1MM6A 5I57A 1NV3A 2DXRA 3EHTA 1MQJA 2Z8DA 2Q89A 4GD5A 1XT8A 3IB0A 4YKJA 4EDPA 1FPIA 4H67A 2HAUA 2ESNA 3DRGA 3JYRA 4HCWA 4UA8A 3OELA 3SEYA 3TPAA 2OBGA 1I6QA 2O84X 4FEDA 4Q0CA 4RNSA 5KDTA 4NWDA 3H7MA 5ET7A 4F2OA 4F3BA 4IR8A 4LATA 4PFTA 3LSFB 1WODA 2KR0A 3IORA 4ZEDA 1B05A 3FASA 2FVZA 1B5IA 3MUQA 4N81A 4ISUA 2MKZA 2ZXTA 5ET8A 2P1SA 1GR2A 2ZZXA 4LVQA 4TLLB 1EYKA 4KPTA 2I4BA 2HAVA 2DE4A 2UYEA 1TFDA 3RNNA 4N13A 4XKRA 4FEBA 2R8TA 1B1XA 3PU5A 4YKPA 2X7PA 4FJPA 1SI0A 1Y3NA 1TT1A 2VT5A 1OLCA 4GXAA 4X48A 4MNIA 1FPFA 4GWZA 5DW8A 3ECRA 3OMBA 2DVZA 3T22A 5J16A 3BKIB 1UQWA 3VVDA 2PT2A 2XWKA 2RCAA 1Y20A 2PX1A 3QIMA 1FJ9A 5I7IA 3NOHA 4N91A 4UABA 1TWYA 3OSQA 1N76A 3EHSA 3FV1A 1R1NA 4GRKA 3RPWA 3GBAA 5I58A 3CSBA 1VFEA 1MXVA 5I2KB 3FV2A 3HPIA 3H6UA 3FJMA 1ZU0A 1LBBA 3U94A 3IO4A 5HPQA 4I62A 4EF2A 3RT8A 4U23A 3TCGA 1B3LA 5ET5A 5CMKA 1IXHA 4ZECA 4I3EA 3MVWA 3P7IA 3FVNA 3K6VA 1FTKA 4Q30B 1FPBA 5L8DA 1JNFA 1Q35A 1AWBA 4MCOA 1NKXA 2CZHA 3KJTA 3TMGA 3IFCA 4NF8A 1NUYA 3DRHA 4OFOA 5DVFA 3MP8A 5H8SA 1A99A 4POXA 4QBAA 4DI4B 5H8FB 5CC2A 1XVXA 3CFZA 2QMWA 3D4CA 1YPNA 2B4LA 4PGPA 1FBFA 4H65A 3I5OA 3H03A 5LTCA 1BTJA 3R7XA 3H4ZA 4XIGQ 3E4RA 4OA4A 4X04A 2A5TB 1UTHA 1USYE 4PF6A 2WBDA 1PDAA 3K1MA 2D5WA 1SPIA 2DWIA 4PQJA 2ZYOA 2H5YA 3HN0A 1IMFA 3N94A 1SDXA 1BKAA 1D3KA 2F36A 3ZKLA 1N3XA 2X26A 3M3KA 4XEQA 1B32A 4TQUQ 3RLFE 3SEVA 3VE1B 1PC3A 2VP1A 1FW0A 3ODBA 2M8CA 1BP5A 2REJA 2Q2CA 3B6WA 1LBYA 5CM6A 2XXVA 5I2NA 3IOUA 2I58A 1FPDA 2Z23A 1QVSA 3MW0A 2O7IA 2KQZA 4PCDA 3FD3A 4PGNA 4NF4A 5DEXA 3T9XB 1ELJA 3PPPA 1TFAA 1FJ6A 1PBQA 4H8IA 2OWTA 1NMUA 3UN6A 1NUXA 4F3PA 5FTHA 3C9HA 3BFTA 5IZ3A 1K9YA 3ONMA 3TFLA 3KC1A 4DDDA 3GLBA 2W7YA 4XXUA 4C1TA 1FTOA 3TAJA 2GH9A 4R75A 3QK6A 3QMFA 1B1HA 1B9JA 1INPA 3FXQA 4WEPA 5AA3A 3H6WA 2HXRA 1VSOA 2XWOA 1HSEA 1N84A 4DZ1A 3ILTB 2WYPA 3FXUA 1RDYA 4BDNA 2RC9A 2QSXA 4I8CA 5EQ9A 4XKQA 3C32A 4JB7A 1XC1A 3C35A 1GVCA 1Q9DA 3TTKA 4ESWA 4GLIA 1NNFA 3U92A 5KZTA 5FHOA 3G3FA 3SEWA 4PAIA 1KWHA 2OZZA 3EHUA 4ZDMA 1B5JA 1PB7A 4ZE8A 5FTIA 3OEMA 4ZEFA 1QJMA 3C33A 4NF0A 2DVCA 1II5A 2HZLA 1EH3A 4EF1A 5IAIA 4NN3A 1FBEA 1WDNA 1Y3QA 1S9TA 1A55A 3T9HB 3TDJA 1GGGA 1MXZA 1FTAA 1AH5A 3VLUA 3HO7A 1MDP1 4O3BA 5T3JA 3U93A 4ZEKA 1YTVA 1B3GA 1POY1 2H98A 5EHMA 4KD5A 4QFOA 1Y3PA 3LR1A 5I56B 3MSTA 2QVVA 4L17A 4N6PA 2H9BA 1ZKBA 2D21A 1Z7ME 3TCFA 1B7HA 2ONRA 2XD2A 5F7VA 4GX4A 1VR5A 3MVZA 3T96B 2UVHA 2F5XA 3F11A 1NNTA 1N04A 1PBPA 4PFIA 3E9XA 3IAZA 1P1QA 3ROJA 5CBRA 4HTGA 4NWCA 2WX9A 1MY0A 1OMPA 1SVXB 2YPNA 3OO7A 2F3DA 2NOOA 2O1LA 2PCRA 4WKMA 1US4A 4YU0A 1MXYA 2VGQA 2I6EA 3DELB 1DTGA 1R9QA 1URDA 4P11A 4DE8A 4TLMB 1P99A 3S2VA 5ITOA 4YZZA 3MP6A 4LUBA 3T93B 5IZZA 2DP8A 1JEVA 1YXIA 4P8BA 2Q88A 4PBHA 3G7WA 5AA2A 1MPDA 1DSNA 4DCXA 1NH7A 2V3QA 1Y9UA 4OENA 4OANA 2OK2A 4BDRA 1ZMGA 4FBPA 4OVJA 3CG1A 1UIVA 1IUDA 4F3GA 4G68C 1GV8A 3DLNA 2H4IA 4QFKA 3T1BA 1IXGA 1POTA 3G3JA 1FQBA 3N6TA 1NI9A 4F1UA 4IO5A 2XA5A 5FHMA 4OWDA 3SDFA 3IX1A 5BWJA 1MH3A 1OVTA 4JVDA 3MJNA 3KSJA 4NF6A 1B4HA 2DOJA 3T9UA 2Z22A 1JQFA 3MAMA 3PD8A 4KXPA 1DOTA 2QS2A 5DT6A 5B70A 3JV9A 4IO7A 3MP1A 3TZAA 3LUYA 3OOAA 5F24A 4RA1A 2I0CA 3FJ7A 4ONYA 4OYVA 2QMXA 4XF5A 4C0RA 5LDZA 2E1SA 3PUWE 3G3IA 1F9BA 1JEUA 1J1NA 2H99A 3CG3A 3GZGA 4C1UA 4HE1A 4MIJA 4IB2A 5A5XB 2PT1A 4FAJA 5BUUA 1NV4A 4EQ7A 5H8QB 2AL5A 3FJGA 4AQ4A 1LAGE 2A5SA 3O6PA 4HCYA 3O28A 4DXCA 3O29A 4ZEBA 5J1DA 3B6TA 1UIUA 3TUSA 3USDA 5H8NA 2QVRA 2O69A 3GXAA 1QUIA 4OEVA 1LB8A 2F97A 3Q29A 5AA2D 4OFJA 4U22A 1SQYA 2FIXA 2WOKA 4YB7A 2WYKA 2QS3A 4OHNA 2I0BA 2UXAA 3BBRA 2F34A 3DP4A 1YAEA 4GXSB 3V5AA 4HXVA 4NG7A 3KZGA 3KJ7A 4U4XA 3CHGA 4OXVA 1DMBA 4NE4A 5JEIA 4OETA 1VFDA 2QPQA 4FECA 5DVJA 2XXIA 1YCJA 2THIA 3FIRA 3K1NA 2AIXA 3CFXA 3PPOA 4NF5B 3G3HA 3CRBA 1EYIA 1OIBA 3RUMA 4NMYA 1EYJA 4P56A 2XXXA 1D9VA 4N6KA 1XVYA 1NNPA 3K00A 1A8EA 3HHFA 1DTZA 1LBXA 1DPEA 4PC9A 2R71A 5KCJB 2F78A 2BJJX 2F7AA 3OEKA 1TXFA 4KFQA 5IKBA 1MXXA 2OWZA 3M3LA 3RGYA 2QS4A 1NNKA 1Y4CA 5H8HB 4ZE9A 2ANJA 1SW5A 2HFBA 5L9SA 3O6IA 1FBCA 1MXWA 4PDDA 1LFHA 3K6WA 4K3FA 3PPNA 2FYIA 1QULA 3PMVA 4DI3D 3KBZA 3UGWA 5K2YA 4H46A 2XXHA 5AA4B 4N15A 3FVGA 4AB5A 1JP4A 2Y7IA 4R2BA 4BDMA 1HSJA 4H0WA 1FSAA 5CRYA 2V3UA 4G68A 1UTBA 1MH4A 1IMEA 1FQFA 5TPAA 1FQDA 5DVIA 4ELQA 4MFIA 3O6GA 3RPLA 1K9ZA 4OVTA 1Y1ZA 4I40A 1IXIA 2ZZWA 2O6AA 1B3HA 3IO6A 5FBPA 5ICQA 4MNPA 5L9MA 1MM7A 1QGXA 2XHDA 3DP8A 3H6TA 1NV7A 2ZYKA 3DRKA 1MRPA 2B4MA 4YB6A 1A8FA 4DXUA 2F7BA 1SBPA 4P0IA 4YMAA 2HXWA 3KC0A 4PE3A 5EYHA 4BDLA 4F1VA 2XXTA 4QRZA 4PE5B 2XX7A 4P1LA 5JTYB 2I48A 2FNCA 4R9FA 3TQLA 3VDFA 2HQ0A 2Y7WA 4PBQA 4E0WA 3E13X 5I57B 1AOVA 2Y7RA 1JVXA 4QF9A 3U72A 3HHGA 4OFLA 4GWUA 1MY1A 1LB9A 1T0KA 4MNCA 4X1DA 3IL1B 2UVJA 4G61A 4EXKA 5KDTB 3QUFA 1M5DA 4QFLA 1Q1KA 1BK4A 4YICA 4QSDA 3V8XB 3TKDA 2NWJA 2GHAA 1LCTA 1B46A 1FTJA 2D3IA 3PMWA 3C34A 4MLQA 1ZIUA 2ONSA 2VOZA 3B7DA 3SKPA 3TODA 2CZLA 1AMFA 3U65A 2UYFA 4NTLA 2XWIA 3MQ9A 4OVPA 5TP9A 4DXBA 1M5EA 2DWJA 2XXWA 2NXOA 5CI5A 3CSGA 3KG2A 2X7QA 2XXUA 4MJOA 3TELA 2QRYA 1B7UA 4RJZA 2CZKA 1I6BA 2P2AA 3D1RA 3K4UA 1LBVA 1P1UA 3CI8A 2O51A 1L5TA 2XXPA 3KEIA 2NVUB 1LSTA 4U21A 5ISUA 5K2XA 3TEPA 1RDXA 3SESA 4PDHA 2BJIA 1G0HA 5EYFA 3MVXA 2ZYNA 5EQ8A 5EQAA 1FTMA 1EZOA 3LBSA 2OX3A 2VD2A 3HSTA 1FQEA 3MBPA 2DS9A 3M3FA 4O3CA 5IZ1A 4MX6A 3K2DA 3IJXB 1SD3A 4R6HA 3SEUA 5I58B 5HBCA 4QHQA 4GBWA 4I1DA 2RKMA 2PMSA 4BDOA 1LEVA 4LZ5A 2O68A 1LAHE 4N4UA 1LCFA 1LBCA 1KZ8A 4EXLA 3L6GA 4I3YA 4N8YA 2XXKA 5EHSA 1URSA 3VVFA 4F31B 5I84A 1D9YA 3FTOA 2ONKE 1P1NA 4MH5A 2PYYA 1H45A 3IB1A 4XKNA 1URGA 3D4GA 4JXIA 1QUJA 1AIVA 2ZYMA 1IQ7A 2L5VA 1FPGA 4EQBA 4NF8B 3T0JA 1FPEA 4OMBA 3MWBA 2RF1A 1LAXA 1QKBA 1D9QA 4H8JA 5B7DA 1VE4A 1RYXA 3K6XA 1RKMA 3VV5A 3IK6B 2VPOA 1NV2A 1FPJA 3U1OA 4GWXA 1DK4A 2O1MA 3VLVA 1LBZA 4RXLA 2F6PA 3QUJA 2GQ1A 4GWSA 1B0HA 1B52A 2F8DA 3EF7A 1UTHB 1XHYA 4E0XA 4F22A 2YLNA 3LV0A 2FIEA 4NGUA 2RC7A 1FBDA 4OVQA 3HCQA 1ANFA 4RPOA 4DCYA 2Q8JA 5IGAA 3G3KA 1O63A 3RTWB 3B8BA 3W9VA 3OXNA 4JSDA 4U1ZA 3UA8A 1Y1MA 3C31A 4RPNA 1FPLA 1R9LA 2DDKA 4IGTA 3JZJA 3KN8A 4DLDA 2Z8EA 3UORA 1S7YA 4OERA 5I2NB 1ZTYA 3FBPA 2DWHA 4MF3A 4F3SA 5I59B 4NF4B 1NH8A 5DEXB 4KHZE 2I3VA 3Q28A 4ECFA 4O3AA 4TOZA 2DYXA 1I69A 4OTEA 2DSFA 3E3KA 3EQ1A 4KR5A 2G29A 2WOPA 3KN3A 3K6UA 2G93A 4JSOA 2OCUA 5IZ3B 3MZ1A 1FQAA 3VLWA 5I2KA 1OVBA 1SYIA 4OVSA 5ESYA 3ILUB 4LZ7A 3O97A 4NHBA 4F1YA 4GX3A 3VXBA 4R73A 4BLAA 3M8UA 4LQ5A 4NX1A 4PFWA 3FVOA 3PMXA
chains in the Genus database with same CATH topology
1SI1A 3MPLA 3TTRA 1CE2A 1LLSA 3Q27A 1MS7A 1XOCA 3PUXE 5ITPA 3DRFA 3VVEA 2XXYA 3FVKA 4G4PA 1LFGA 2R6GE 2IEEA 4AB6A 3L6HA 1MQDA 3VFJA 4Z0IA 3TQWA 4WEDA 2V93A 3MPKA 2B3FA 2OJTA 2ABHA 1JW1A 3WAFA 1N7XA 3W9WA 5H8FA 4PETA 3U8QA 4G2ZA 1B5HA 1MDQA 2Y7PA 2HCAA 4LONB 1QKAA 4BDQA 1BIYA 4KQPA 1AL3A 4GFRA 2O7UA 3QAXA 4KCCA 4NEDA 3K1PA 2A5TA 2XXQA 3N5LA 3CR9A 3OD7A 1B2HA 5L9OA 2XX8A 1FQCA 4UACA 4IO2A 1MXUA 2H25A 4YB5A 3RYBA 4KI0E 3SETA 3KGCA 1LFIA 4ND9A 1IZ1A 4JWOA 1A7LA 2GFEA 4ZEIA 2I49A 2IA4A 3PGFA 3A09A 2QL3A 1EZ9A 1MPCA 4YAHX 5AA1A 3FXRA 5CBSA 3IOVA 2RINA 4G8NA 2I4CA 4OZ9A 3SEXA 4F19A 4H5FA 3TTMA 1QUKA 3S9MC 1B3FA 3RQTA 4U4SA 1JW5A 1MY4A 3TYHA 4XKPA 1B58A 3RYAA 3SERA 2DQVA 3TCHA 4QSEA 5LOMA 5AA2B 3W15C 2HZKA 3IOTA 2QJEA 1ZJLA 1H43A 3LVUA 2GRVA 4GL8A 4Z7EA 4RYAA 3S9NC 2AL4A 5F1QA 4M4GA 4DIGA 4ELPA 3ZS6A 3PPQA 1M5FA 2F7CA 4KCDA 5M2VA 4F18A 4YMBA 5JK4A 4F29A 1N3WA 2ALUA 3N26A 1B3EA 4NF6B 4FIMA 1GTKA 1B4ZA 4YKKA 3T9VA 3R26A 3KOSA 1N7WA 1FTLA 3OO6A 1LGBC 2DE2A 4ESXA 1WVJA 5I56A 2OWSA 4G77A 4IGRA 1B7ZA 1MQIA 3VXCA 4ZZAA 4ELRA 4KYSA 5DYHA 3H06B 3H6VA 1SW1A 2RC8A 1SYHA 1MPBA 2OLBA 2Y7KA 1HSLA 2VD3A 4GWOA 3EPEA 1B51A 4H6DA 4FATA 4Q5TA 4G8HA 3PUZE 4RY1A 1O64A 3KSXA 3K01A 1IIWA 5H8NB 3IOWA 3DP6A 4JDFA 2ZNTA 1Z7NE 3DRIA 2P0SA 1RYOA 4KYDA 4QFNA 3O2AA 3CVGA 1P1WA 1EU8A 2Z8FA 1O7TA 4XTCQ 3WAEA 1M5BA 3A3UA 1D4NA 3OO8A 1R6ZA 3QXMA 2YJPA 3O9PA 1H44A 1US5A 1A40A 2XX9A 3K0VA 4EUOA 3FATA 3I6VA 3RN8A 3S9LC 4IO3A 3LSXA 5I59A 3ZSFA 3QYTA 1IITA 3OSRA 2DE3A 4G8MA 3HV1A 3C36A 1IEJA 4LA9A 4IO4A 4H1XA 2B65A 2ZNSA 5AE4A 1H76A 2QS1A 3OO9A 1SW2A 2UVIA 4MBPA 3PV0E 1LAFE 2ZMBA 3LSWA 2V84A 3H3GA 2I3WA 4JWYA 1H3DA 4GOTA 4M1VA 1USYH 3KBRA 3LSLA 4WXJA 1P1OA 1PEBA 4RK9A 3MVYA 2CMOA 3CFLA 4R6YA 5ICTA 2GHBA 2Y84A 4LZ8A 2WOLA 3ZKKA 1JVYA 1S50A 1CB6A 1EZPA 4KYEA 3O6HA 2V3TA 3PUVE 1JETA 5DTBA 5A5XA 3KFMA 4G68B 4RK2A 2VHAA 1UTBB 1OLAA 4GIZA 1MG1A 4LQ2A 1MQGA 3FGSA 4R2FA 5H8QA 5TPAB 1FCKA 3T66A 4JBZA 2XXRA 3TTLA 3KOTA 2Q9TA 1NFTA 3A3CA 5ELVA 3N6UA 1JW4A 1ZLQA 4EQ9A 3UIFA 4OQOA 1ZBMA 1OQGA 5CMBA 4IO6A 1N0TA 4R74A 3THIA 4YKIA 5CMCA 4GQOA 3MZBA 1M5CA 4F39A 3DRJA 1B40A 1ATGA 4ZS9A 4HS7A 4F2QA 1B0LA 4OEUA 3LC8A 2REGA 3B6QA 3G3GA 1IXCA 4PFUA 4THIA 3EN3A 3MZ9A 4NF5A 3UP9A 2F35A 4FORA 3Q26A 3I3VA 1MQHA 2KLFA 4ELOA 2HEUA 4R9GA 1B6HA 4IY6A 4R6KA 5KCJA 3IR1A 3OENA 1MY3A 1I6AA 2PVUA 2UVGA 4GL0A 2F6GA 4JWXA 3S4UA 2B3BA 2DXYA 4PFYA 1PB8A 3FUZA 5H8HA 3KN7A 3IB2A 3CIJA 3RTFB 3BFUA 4P0GA 3PPRA 5HM4B 3UK4A 4HW8A 4QFPA 4IY5A 5TP9B 2R9JA 1DPPA 3V89B 3PAMA 2LAOA 5AA4A 3S9EA 4PP0A 2DWAA 2V25A 3C4MA 2NUVA 4MLVA 4U1OA 3FZVA 2E0SA 3Q25A 4ZZEA 1SW4A 1OQHA 4LP2B 4X1BA 3R6UA 2AYSA 5TU0A 1Y4TA 2WKYA 4POWA 3MC2A 3PUYE 1QW0A 4X9TA 3AXFA 1A54A 1NL5A 3QSLA 4GVOA 5FHNA 1BLFA 2XD3A 3K02A 4QSCA 4U2RA 3TTNA 3RY3A 4FE8A 1MY2A 2Q2AA 2ZNUA 4GF8A 1XS5A 3DM0A 2PBWA 2FA7A 3IJOB 4Q8RA 4OESA 4I9DA 2RCBA 3RT6B 4R72A 4N07A 5JTYA 3PD9A 3GBBA 4H5GA 5CMMA 1PB9A 3V83A 3O66A 1MM6A 5I57A 2DXRA 3EHTA 1MQJA 2Z8DA 2Q89A 4GD5A 1XT8A 3IB0A 4YKJA 4EDPA 4H67A 2HAUA 2ESNA 3DRGA 3JYRA 4HCWA 4UA8A 3OELA 3SEYA 3TPAA 2OBGA 1I6QA 2O84X 4FEDA 4Q0CA 4RNSA 5KDTA 4NWDA 3H7MA 4F2OA 4F3BA 4LATA 4PFTA 3LSFB 1WODA 3IORA 4ZEDA 1B05A 3FASA 1B5IA 3MUQA 4ISUA 2ZXTA 2P1SA 1GR2A 4LVQA 4TLLB 4KPTA 2I4BA 2HAVA 2DE4A 2UYEA 1TFDA 3RNNA 4N13A 4XKRA 4FEBA 1B1XA 3PU5A 4YKPA 2X7PA 4FJPA 1SI0A 1Y3NA 1TT1A 1OLCA 4GXAA 4X48A 3ECRA 3OMBA 2DVZA 3T22A 3BKIB 1UQWA 3VVDA 2PT2A 2RCAA 1Y20A 2PX1A 3QIMA 1TWYA 3OSQA 1N76A 3EHSA 3FV1A 1R1NA 4GRKA 3RPWA 3GBAA 5I58A 3CSBA 1VFEA 1MXVA 5I2KB 3FV2A 3HPIA 3H6UA 3FJMA 1ZU0A 1LBBA 3U94A 3IO4A 5HPQA 4I62A 4EF2A 3RT8A 4U23A 3TCGA 1B3LA 5CMKA 1IXHA 4ZECA 3MVWA 3P7IA 3FVNA 3K6VA 1FTKA 4Q30B 5L8DA 1JNFA 1Q35A 1NKXA 3KJTA 3TMGA 4NF8A 3DRHA 4OFOA 5DVFA 3MP8A 5H8SA 1A99A 4POXA 5H8FB 5CC2A 1XVXA 3CFZA 2QMWA 3D4CA 1YPNA 2B4LA 4H65A 3I5OA 3H03A 1BTJA 3R7XA 3H4ZA 4XIGQ 3E4RA 2A5TB 1UTHA 1USYE 1PDAA 3K1MA 2D5WA 2DWIA 4PQJA 2ZYOA 2H5YA 3HN0A 3N94A 1SDXA 1BKAA 1D3KA 2F36A 3ZKLA 1N3XA 2X26A 3M3KA 1B32A 4TQUQ 3RLFE 3SEVA 3VE1B 1PC3A 2VP1A 1FW0A 3ODBA 2M8CA 1BP5A 2REJA 2Q2CA 3B6WA 5CM6A 2XXVA 5I2NA 3IOUA 2I58A 2Z23A 1QVSA 3MW0A 2O7IA 3FD3A 4NF4A 5DEXA 3T9XB 1ELJA 3PPPA 1TFAA 1PBQA 4H8IA 2OWTA 1NMUA 3UN6A 4F3PA 5FTHA 3C9HA 3BFTA 3ONMA 3TFLA 4DDDA 3GLBA 2W7YA 4XXUA 4C1TA 1FTOA 3TAJA 2GH9A 4R75A 3QK6A 1B1HA 1B9JA 3FXQA 4WEPA 5AA3A 3H6WA 1VSOA 1HSEA 1N84A 4DZ1A 3ILTB 3FXUA 4BDNA 2RC9A 2QSXA 4I8CA 4XKQA 3C32A 4JB7A 1XC1A 3C35A 1GVCA 3TTKA 4ESWA 4GLIA 1NNFA 3U92A 5KZTA 5FHOA 3G3FA 3SEWA 1KWHA 2OZZA 3EHUA 4ZDMA 1B5JA 1PB7A 4ZE8A 5FTIA 3OEMA 4ZEFA 1QJMA 3C33A 2DVCA 1II5A 2HZLA 1EH3A 4EF1A 5IAIA 1WDNA 1Y3QA 1S9TA 1A55A 3T9HB 3TDJA 1GGGA 1MXZA 1AH5A 3VLUA 3HO7A 1MDP1 4O3BA 3U93A 4ZEKA 1YTVA 1B3GA 1POY1 2H98A 5EHMA 4KD5A 4QFOA 1Y3PA 3LR1A 5I56B 4L17A 4N6PA 2H9BA 1ZKBA 2D21A 1Z7ME 3TCFA 1B7HA 2ONRA 2XD2A 5F7VA 1VR5A 3MVZA 3T96B 2UVHA 2F5XA 3F11A 1NNTA 1N04A 1PBPA 3E9XA 3IAZA 1P1QA 5CBRA 4HTGA 4NWCA 1MY0A 1OMPA 1SVXB 2YPNA 3OO7A 2NOOA 2O1LA 4WKMA 1US4A 4YU0A 1MXYA 2VGQA 2I6EA 3DELB 1DTGA 1R9QA 1URDA 4P11A 4DE8A 4TLMB 1P99A 3S2VA 5ITOA 4YZZA 3MP6A 4LUBA 3T93B 2DP8A 1JEVA 2Q88A 3G7WA 5AA2A 1MPDA 1DSNA 4DCXA 1NH7A 2V3QA 1Y9UA 4OENA 2OK2A 4BDRA 1ZMGA 4OVJA 3CG1A 1UIVA 1IUDA 4F3GA 4G68C 1GV8A 3DLNA 2H4IA 4QFKA 1IXGA 1POTA 3G3JA 1FQBA 3N6TA 4F1UA 4IO5A 5FHMA 4OWDA 3SDFA 3IX1A 5BWJA 1MH3A 1OVTA 3MJNA 3KSJA 4NF6A 1B4HA 2DOJA 3T9UA 2Z22A 1JQFA 3MAMA 3PD8A 1DOTA 2QS2A 5DT6A 5B70A 3JV9A 4IO7A 3MP1A 3TZAA 3LUYA 3OOAA 4RA1A 2I0CA 3FJ7A 4ONYA 4OYVA 2QMXA 4C0RA 2E1SA 3PUWE 3G3IA 1F9BA 1JEUA 1J1NA 2H99A 3CG3A 3GZGA 4C1UA 4IB2A 5A5XB 2PT1A 4FAJA 5BUUA 4EQ7A 5H8QB 2AL5A 3FJGA 4AQ4A 1LAGE 2A5SA 3O6PA 4HCYA 3O28A 4DXCA 3O29A 4ZEBA 5J1DA 3B6TA 1UIUA 3TUSA 3USDA 5H8NA 2O69A 3GXAA 1QUIA 4OEVA 1LB8A 2F97A 3Q29A 5AA2D 4OFJA 4U22A 1SQYA 2WOKA 4YB7A 2QS3A 4OHNA 2I0BA 2UXAA 3BBRA 2F34A 3DP4A 1YAEA 4GXSB 3V5AA 3KZGA 3KJ7A 4U4XA 3CHGA 4OXVA 1DMBA 4NE4A 5JEIA 4OETA 1VFDA 2QPQA 4FECA 5DVJA 2XXIA 1YCJA 2THIA 3FIRA 3K1NA 2AIXA 3CFXA 3PPOA 4NF5B 3G3HA 3CRBA 1OIBA 3RUMA 4NMYA 2XXXA 1D9VA 1XVYA 1NNPA 3K00A 1A8EA 3HHFA 1DTZA 1DPEA 2R71A 5KCJB 2F78A 2BJJX 2F7AA 3OEKA 1TXFA 4KFQA 5IKBA 1MXXA 3M3LA 3RGYA 2QS4A 1NNKA 1Y4CA 5H8HB 4ZE9A 2ANJA 1SW5A 2HFBA 5L9SA 3O6IA 1MXWA 1LFHA 3K6WA 4K3FA 3PPNA 2FYIA 1QULA 3PMVA 3UGWA 5K2YA 2XXHA 5AA4B 3FVGA 4AB5A 2Y7IA 4R2BA 4BDMA 1HSJA 4H0WA 5CRYA 2V3UA 4G68A 1UTBA 1MH4A 1FQFA 5TPAA 1FQDA 5DVIA 4ELQA 4MFIA 3O6GA 1Y1ZA 1IXIA 2O6AA 1B3HA 3IO6A 5ICQA 5L9MA 1MM7A 2XHDA 3DP8A 3H6TA 2ZYKA 3DRKA 1MRPA 2B4MA 4YB6A 1A8FA 4DXUA 2F7BA 1SBPA 4P0IA 4YMAA 2HXWA 4BDLA 4F1VA 2XXTA 4QRZA 4PE5B 2XX7A 5JTYB 2I48A 2FNCA 4R9FA 3TQLA 3VDFA 2HQ0A 2Y7WA 4E0WA 3E13X 5I57B 1AOVA 2Y7RA 1JVXA 4QF9A 3U72A 3HHGA 4OFLA 1MY1A 1LB9A 1T0KA 4X1DA 3IL1B 2UVJA 4EXKA 5KDTB 3QUFA 1M5DA 4QFLA 1Q1KA 4YICA 4QSDA 3V8XB 3TKDA 2NWJA 2GHAA 1LCTA 1B46A 1FTJA 2D3IA 3PMWA 3C34A 4MLQA 1ZIUA 2ONSA 2VOZA 3B7DA 3SKPA 3TODA 2CZLA 1AMFA 2UYFA 4NTLA 3MQ9A 5TP9A 4DXBA 1M5EA 2DWJA 2XXWA 2NXOA 5CI5A 3CSGA 3KG2A 2X7QA 2XXUA 3TELA 2QRYA 1B7UA 4RJZA 1I6BA 2P2AA 3K4UA 1P1UA 3CI8A 2O51A 1L5TA 2XXPA 3KEIA 2NVUB 1LSTA 4U21A 5ISUA 5K2XA 3TEPA 3SESA 5EYFA 3MVXA 2ZYNA 1EZOA 1FTMA 3LBSA 2VD2A 3HSTA 1FQEA 3MBPA 2DS9A 3M3FA 4O3CA 3K2DA 3IJXB 1SD3A 4R6HA 3SEUA 5I58B 5HBCA 4QHQA 4I1DA 2RKMA 2PMSA 4BDOA 4LZ5A 2O68A 1LAHE 1LCFA 1LBCA 4EXLA 3L6GA 5EHSA 1URSA 3VVFA 4F31B 5I84A 1D9YA 3FTOA 2ONKE 1P1NA 4MH5A 2PYYA 1H45A 3IB1A 4XKNA 1URGA 3D4GA 4JXIA 1QUJA 1AIVA 2ZYMA 1IQ7A 4EQBA 4NF8B 4OMBA 3MWBA 2RF1A 1LAXA 1QKBA 4H8JA 5B7DA 1VE4A 1RYXA 3K6XA 1RKMA 3VV5A 3IK6B 3U1OA 2O1MA 3VLVA 4RXLA 2F6PA 3QUJA 1B0HA 1B52A 2F8DA 3EF7A 1UTHB 1XHYA 4E0XA 4F22A 2YLNA 2RC7A 3HCQA 1ANFA 4RPOA 4DCYA 2Q8JA 3G3KA 1O63A 3RTWB 3W9VA 3OXNA 4JSDA 4U1ZA 3UA8A 1Y1MA 3C31A 4RPNA 1R9LA 4IGTA 3JZJA 3KN8A 4DLDA 2Z8EA 3UORA 1S7YA 4OERA 5I2NB 1ZTYA 2DWHA 4MF3A 4F3SA 5I59B 4NF4B 1NH8A 5DEXB 4KHZE 2I3VA 3Q28A 4ECFA 4O3AA 4TOZA 2DYXA 1I69A 4OTEA 2DSFA 3E3KA 3EQ1A 4KR5A 2G29A 2WOPA 3KN3A 3K6UA 2G93A 4JSOA 2OCUA 3MZ1A 1FQAA 3VLWA 5I2KA 1OVBA 1SYIA 3ILUB 4LZ7A 3O97A 4F1YA 3VXBA 4R73A 4BLAA 3M8UA 4LQ5A 4PFWA 3FVOA 3PMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SI1 A;  3MPL A;  3TTR A;  1CE2 A;  1LLS A;  3Q27 A;  1MS7 A;  1XOC A;  3PUX E;  5ITP A;  3DRF A;  3VVE A;  2XXY A;  3FVK A;  4G4P A;  1LFG A;  2R6G E;  2IEE A;  4AB6 A;  3L6H A;  1MQD A;  3VFJ A;  4Z0I A;  3TQW A;  4WED A;  2V93 A;  3MPK A;  2B3F A;  2OJT A;  2ABH A;  1JW1 A;  3WAF A;  1N7X A;  3W9W A;  5H8F A;  4PET A;  3U8Q A;  4G2Z A;  1B5H A;  1MDQ A;  2Y7P A;  2HCA A;  4LON B;  1QKA A;  4BDQ A;  1BIY A;  4KQP A;  1AL3 A;  4GFR A;  2O7U A;  3QAX A;  4KCC A;  4NED A;  3K1P A;  2A5T A;  2XXQ A;  3N5L A;  3CR9 A;  3OD7 A;  1B2H A;  5L9O A;  2XX8 A;  1FQC A;  4UAC A;  4IO2 A;  1MXU A;  2H25 A;  4YB5 A;  3RYB A;  4KI0 E;  3SET A;  3KGC A;  1LFI A;  4ND9 A;  1IZ1 A;  4JWO A;  1A7L A;  2GFE A;  4ZEI A;  2I49 A;  2IA4 A;  3PGF A;  3A09 A;  2QL3 A;  1EZ9 A;  1MPC A;  4YAH X;  5AA1 A;  3FXR A;  5CBS A;  3IOV A;  2RIN A;  4G8N A;  2I4C A;  4OZ9 A;  3SEX A;  4F19 A;  4H5F A;  3TTM A;  1QUK A;  3S9M C;  1B3F A;  3RQT A;  4U4S A;  1JW5 A;  1MY4 A;  3TYH A;  4XKP A;  1B58 A;  3RYA A;  3SER A;  2DQV A;  3TCH A;  4QSE A;  5LOM A;  5AA2 B;  3W15 C;  2HZK A;  3IOT A;  2QJE A;  1ZJL A;  1H43 A;  3LVU A;  2GRV A;  4GL8 A;  4Z7E A;  4RYA A;  3S9N C;  2AL4 A;  5F1Q A;  4M4G A;  4DIG A;  4ELP A;  3ZS6 A;  3PPQ A;  1M5F A;  2F7C A;  4KCD A;  5M2V A;  4F18 A;  4YMB A;  5JK4 A;  4F29 A;  1N3W A;  2ALU A;  3N26 A;  1B3E A;  4NF6 B;  4FIM A;  1GTK A;  1B4Z A;  4YKK A;  3T9V A;  3R26 A;  3KOS A;  1N7W A;  1FTL A;  3OO6 A;  1LGB C;  2DE2 A;  4ESX A;  1WVJ A;  5I56 A;  2OWS A;  4G77 A;  4IGR A;  1B7Z A;  1MQI A;  3VXC A;  4ZZA A;  4ELR A;  4KYS A;  5DYH A;  3H06 B;  3H6V A;  1SW1 A;  2RC8 A;  1SYH A;  1MPB A;  2OLB A;  2Y7K A;  1HSL A;  2VD3 A;  4GWO A;  3EPE A;  1B51 A;  4H6D A;  4FAT A;  4Q5T A;  4G8H A;  3PUZ E;  4RY1 A;  1O64 A;  3KSX A;  3K01 A;  1IIW A;  5H8N B;  3IOW A;  3DP6 A;  4JDF A;  2ZNT A;  1Z7N E;  3DRI A;  2P0S A;  1RYO A;  4KYD A;  4QFN A;  3O2A A;  3CVG A;  1P1W A;  1EU8 A;  2Z8F A;  1O7T A;  4XTC Q;  3WAE A;  1M5B A;  3A3U A;  1D4N A;  3OO8 A;  1R6Z A;  3QXM A;  2YJP A;  3O9P A;  1H44 A;  1US5 A;  1A40 A;  2XX9 A;  3K0V A;  4EUO A;  3FAT A;  3I6V A;  3RN8 A;  3S9L C;  4IO3 A;  3LSX A;  5I59 A;  3ZSF A;  3QYT A;  1IIT A;  3OSR A;  2DE3 A;  4G8M A;  3HV1 A;  3C36 A;  1IEJ A;  4LA9 A;  4IO4 A;  4H1X A;  2B65 A;  2ZNS A;  5AE4 A;  1H76 A;  2QS1 A;  3OO9 A;  1SW2 A;  2UVI A;  4MBP A;  3PV0 E;  1LAF E;  2ZMB A;  3LSW A;  2V84 A;  3H3G A;  2I3W A;  4JWY A;  1H3D A;  4GOT A;  4M1V A;  1USY H;  3KBR A;  3LSL A;  4WXJ A;  1P1O A;  1PEB A;  4RK9 A;  3MVY A;  2CMO A;  3CFL A;  4R6Y A;  5ICT A;  2GHB A;  2Y84 A;  4LZ8 A;  2WOL A;  3ZKK A;  1JVY A;  1S50 A;  1CB6 A;  1EZP A;  4KYE A;  3O6H A;  2V3T A;  3PUV E;  1JET A;  5DTB A;  5A5X A;  3KFM A;  4G68 B;  4RK2 A;  2VHA A;  1UTB B;  1OLA A;  4GIZ A;  1MG1 A;  4LQ2 A;  1MQG A;  3FGS A;  4R2F A;  5H8Q A;  5TPA B;  1FCK A;  3T66 A;  4JBZ A;  2XXR A;  3TTL A;  3KOT A;  2Q9T A;  1NFT A;  3A3C A;  5ELV A;  3N6U A;  1JW4 A;  1ZLQ A;  4EQ9 A;  3UIF A;  4OQO A;  1ZBM A;  1OQG A;  5CMB A;  4IO6 A;  1N0T A;  4R74 A;  3THI A;  4YKI A;  5CMC A;  4GQO A;  3MZB A;  1M5C A;  4F39 A;  3DRJ A;  1B40 A;  1ATG A;  4ZS9 A;  4HS7 A;  4F2Q A;  1B0L A;  4OEU A;  3LC8 A;  2REG A;  3B6Q A;  3G3G A;  1IXC A;  4PFU A;  4THI A;  3EN3 A;  3MZ9 A;  4NF5 A;  3UP9 A;  2F35 A;  4FOR A;  3Q26 A;  3I3V A;  1MQH A;  2KLF A;  4ELO A;  2HEU A;  4R9G A;  1B6H A;  4IY6 A;  4R6K A;  5KCJ A;  3IR1 A;  3OEN A;  1MY3 A;  1I6A A;  2PVU A;  2UVG A;  4GL0 A;  2F6G A;  4JWX A;  3S4U A;  2B3B A;  2DXY A;  4PFY A;  1PB8 A;  3FUZ A;  5H8H A;  3KN7 A;  3IB2 A;  3CIJ A;  3RTF B;  3BFU A;  4P0G A;  3PPR A;  5HM4 B;  3UK4 A;  4HW8 A;  4QFP A;  4IY5 A;  5TP9 B;  2R9J A;  1DPP A;  3V89 B;  3PAM A;  2LAO A;  5AA4 A;  3S9E A;  4PP0 A;  2DWA A;  2V25 A;  3C4M A;  2NUV A;  4MLV A;  4U1O A;  3FZV A;  2E0S A;  3Q25 A;  4ZZE A;  1SW4 A;  1OQH A;  4LP2 B;  4X1B A;  3R6U A;  2AYS A;  5TU0 A;  1Y4T A;  2WKY A;  4POW A;  3MC2 A;  3PUY E;  1QW0 A;  4X9T A;  3AXF A;  1A54 A;  1NL5 A;  3QSL A;  4GVO A;  5FHN A;  1BLF A;  2XD3 A;  3K02 A;  4QSC A;  4U2R A;  3TTN A;  3RY3 A;  4FE8 A;  1MY2 A;  2Q2A A;  2ZNU A;  4GF8 A;  1XS5 A;  3DM0 A;  2PBW A;  2FA7 A;  3IJO B;  4Q8R A;  4OES A;  4I9D A;  2RCB A;  3RT6 B;  4R72 A;  4N07 A;  5JTY A;  3PD9 A;  3GBB A;  4H5G A;  5CMM A;  1PB9 A;  3V83 A;  3O66 A;  1MM6 A;  5I57 A;  2DXR A;  3EHT A;  1MQJ A;  2Z8D A;  2Q89 A;  4GD5 A;  1XT8 A;  3IB0 A;  4YKJ A;  4EDP A;  4H67 A;  2HAU A;  2ESN A;  3DRG A;  3JYR A;  4HCW A;  4UA8 A;  3OEL A;  3SEY A;  3TPA A;  2OBG A;  1I6Q A;  2O84 X;  4FED A;  4Q0C A;  4RNS A;  5KDT A;  4NWD A;  3H7M A;  4F2O A;  4F3B A;  4LAT A;  4PFT A;  3LSF B;  1WOD A;  3IOR A;  4ZED A;  1B05 A;  3FAS A;  1B5I A;  3MUQ A;  4ISU A;  2ZXT A;  2P1S A;  1GR2 A;  4LVQ A;  4TLL B;  4KPT A;  2I4B A;  2HAV A;  2DE4 A;  2UYE A;  1TFD A;  3RNN A;  4N13 A;  4XKR A;  4FEB A;  1B1X A;  3PU5 A;  4YKP A;  2X7P A;  4FJP A;  1SI0 A;  1Y3N A;  1TT1 A;  1OLC A;  4GXA A;  4X48 A;  3ECR A;  3OMB A;  2DVZ A;  3T22 A;  3BKI B;  1UQW A;  3VVD A;  2PT2 A;  2RCA A;  1Y20 A;  2PX1 A;  3QIM A;  1TWY A;  3OSQ A;  1N76 A;  3EHS A;  3FV1 A;  1R1N A;  4GRK A;  3RPW A;  3GBA A;  5I58 A;  3CSB A;  1VFE A;  1MXV A;  5I2K B;  3FV2 A;  3HPI A;  3H6U A;  3FJM A;  1ZU0 A;  1LBB A;  3U94 A;  3IO4 A;  5HPQ A;  4I62 A;  4EF2 A;  3RT8 A;  4U23 A;  3TCG A;  1B3L A;  5CMK A;  1IXH A;  4ZEC A;  3MVW A;  3P7I A;  3FVN A;  3K6V A;  1FTK A;  4Q30 B;  5L8D A;  1JNF A;  1Q35 A;  1NKX A;  3KJT A;  3TMG A;  4NF8 A;  3DRH A;  4OFO A;  5DVF A;  3MP8 A;  5H8S A;  1A99 A;  4POX A;  5H8F B;  5CC2 A;  1XVX A;  3CFZ A;  2QMW A;  3D4C A;  1YPN A;  2B4L A;  4H65 A;  3I5O A;  3H03 A;  1BTJ A;  3R7X A;  3H4Z A;  4XIG Q;  3E4R A;  2A5T B;  1UTH A;  1USY E;  1PDA A;  3K1M A;  2D5W A;  2DWI A;  4PQJ A;  2ZYO A;  2H5Y A;  3HN0 A;  3N94 A;  1SDX A;  1BKA A;  1D3K A;  2F36 A;  3ZKL A;  1N3X A;  2X26 A;  3M3K A;  1B32 A;  4TQU Q;  3RLF E;  3SEV A;  3VE1 B;  1PC3 A;  2VP1 A;  1FW0 A;  3ODB A;  2M8C A;  1BP5 A;  2REJ A;  2Q2C A;  3B6W A;  5CM6 A;  2XXV A;  5I2N A;  3IOU A;  2I58 A;  2Z23 A;  1QVS A;  3MW0 A;  2O7I A;  3FD3 A;  4NF4 A;  5DEX A;  3T9X B;  1ELJ A;  3PPP A;  1TFA A;  1PBQ A;  4H8I A;  2OWT A;  1NMU A;  3UN6 A;  4F3P A;  5FTH A;  3C9H A;  3BFT A;  3ONM A;  3TFL A;  4DDD A;  3GLB A;  2W7Y A;  4XXU A;  4C1T A;  1FTO A;  3TAJ A;  2GH9 A;  4R75 A;  3QK6 A;  1B1H A;  1B9J A;  3FXQ A;  4WEP A;  5AA3 A;  3H6W A;  1VSO A;  1HSE A;  1N84 A;  4DZ1 A;  3ILT B;  3FXU A;  4BDN A;  2RC9 A;  2QSX A;  4I8C A;  4XKQ A;  3C32 A;  4JB7 A;  1XC1 A;  3C35 A;  1GVC A;  3TTK A;  4ESW A;  4GLI A;  1NNF A;  3U92 A;  5KZT A;  5FHO A;  3G3F A;  3SEW A;  1KWH A;  2OZZ A;  3EHU A;  4ZDM A;  1B5J A;  1PB7 A;  4ZE8 A;  5FTI A;  3OEM A;  4ZEF A;  1QJM A;  3C33 A;  2DVC A;  1II5 A;  2HZL A;  1EH3 A;  4EF1 A;  5IAI A;  1WDN A;  1Y3Q A;  1S9T A;  1A55 A;  3T9H B;  3TDJ A;  1GGG A;  1MXZ A;  1AH5 A;  3VLU A;  3HO7 A;  1MDP 1;  4O3B A;  3U93 A;  4ZEK A;  1YTV A;  1B3G A;  1POY 1;  2H98 A;  5EHM A;  4KD5 A;  4QFO A;  1Y3P A;  3LR1 A;  5I56 B;  4L17 A;  4N6P A;  2H9B A;  1ZKB A;  2D21 A;  1Z7M E;  3TCF A;  1B7H A;  2ONR A;  2XD2 A;  5F7V A;  1VR5 A;  3MVZ A;  3T96 B;  2UVH A;  2F5X A;  3F11 A;  1NNT A;  1N04 A;  1PBP A;  3E9X A;  3IAZ A;  1P1Q A;  5CBR A;  4HTG A;  4NWC A;  1MY0 A;  1OMP A;  1SVX B;  2YPN A;  3OO7 A;  2NOO A;  2O1L A;  4WKM A;  1US4 A;  4YU0 A;  1MXY A;  2VGQ A;  2I6E A;  3DEL B;  1DTG A;  1R9Q A;  1URD A;  4P11 A;  4DE8 A;  4TLM B;  1P99 A;  3S2V A;  5ITO A;  4YZZ A;  3MP6 A;  4LUB A;  3T93 B;  2DP8 A;  1JEV A;  2Q88 A;  3G7W A;  5AA2 A;  1MPD A;  1DSN A;  4DCX A;  1NH7 A;  2V3Q A;  1Y9U A;  4OEN A;  2OK2 A;  4BDR A;  1ZMG A;  4OVJ A;  3CG1 A;  1UIV A;  1IUD A;  4F3G A;  4G68 C;  1GV8 A;  3DLN A;  2H4I A;  4QFK A;  1IXG A;  1POT A;  3G3J A;  1FQB A;  3N6T A;  4F1U A;  4IO5 A;  5FHM A;  4OWD A;  3SDF A;  3IX1 A;  5BWJ A;  1MH3 A;  1OVT A;  3MJN A;  3KSJ A;  4NF6 A;  1B4H A;  2DOJ A;  3T9U A;  2Z22 A;  1JQF A;  3MAM A;  3PD8 A;  1DOT A;  2QS2 A;  5DT6 A;  5B70 A;  3JV9 A;  4IO7 A;  3MP1 A;  3TZA A;  3LUY A;  3OOA A;  4RA1 A;  2I0C A;  3FJ7 A;  4ONY A;  4OYV A;  2QMX A;  4C0R A;  2E1S A;  3PUW E;  3G3I A;  1F9B A;  1JEU A;  1J1N A;  2H99 A;  3CG3 A;  3GZG A;  4C1U A;  4IB2 A;  5A5X B;  2PT1 A;  4FAJ A;  5BUU A;  4EQ7 A;  5H8Q B;  2AL5 A;  3FJG A;  4AQ4 A;  1LAG E;  2A5S A;  3O6P A;  4HCY A;  3O28 A;  4DXC A;  3O29 A;  4ZEB A;  5J1D A;  3B6T A;  1UIU A;  3TUS A;  3USD A;  5H8N A;  2O69 A;  3GXA A;  1QUI A;  4OEV A;  1LB8 A;  2F97 A;  3Q29 A;  5AA2 D;  4OFJ A;  4U22 A;  1SQY A;  2WOK A;  4YB7 A;  2QS3 A;  4OHN A;  2I0B A;  2UXA A;  3BBR A;  2F34 A;  3DP4 A;  1YAE A;  4GXS B;  3V5A A;  3KZG A;  3KJ7 A;  4U4X A;  3CHG A;  4OXV A;  1DMB A;  4NE4 A;  5JEI A;  4OET A;  1VFD A;  2QPQ A;  4FEC A;  5DVJ A;  2XXI A;  1YCJ A;  2THI A;  3FIR A;  3K1N A;  2AIX A;  3CFX A;  3PPO A;  4NF5 B;  3G3H A;  3CRB A;  1OIB A;  3RUM A;  4NMY A;  2XXX A;  1D9V A;  1XVY A;  1NNP A;  3K00 A;  1A8E A;  3HHF A;  1DTZ A;  1DPE A;  2R71 A;  5KCJ B;  2F78 A;  2BJJ X;  2F7A A;  3OEK A;  1TXF A;  4KFQ A;  5IKB A;  1MXX A;  3M3L A;  3RGY A;  2QS4 A;  1NNK A;  1Y4C A;  5H8H B;  4ZE9 A;  2ANJ A;  1SW5 A;  2HFB A;  5L9S A;  3O6I A;  1MXW A;  1LFH A;  3K6W A;  4K3F A;  3PPN A;  2FYI A;  1QUL A;  3PMV A;  3UGW A;  5K2Y A;  2XXH A;  5AA4 B;  3FVG A;  4AB5 A;  2Y7I A;  4R2B A;  4BDM A;  1HSJ A;  4H0W A;  5CRY A;  2V3U A;  4G68 A;  1UTB A;  1MH4 A;  1FQF A;  5TPA A;  1FQD A;  5DVI A;  4ELQ A;  4MFI A;  3O6G A;  1Y1Z A;  1IXI A;  2O6A A;  1B3H A;  3IO6 A;  5ICQ A;  5L9M A;  1MM7 A;  2XHD A;  3DP8 A;  3H6T A;  2ZYK A;  3DRK A;  1MRP A;  2B4M A;  4YB6 A;  1A8F A;  4DXU A;  2F7B A;  1SBP A;  4P0I A;  4YMA A;  2HXW A;  4BDL A;  4F1V A;  2XXT A;  4QRZ A;  4PE5 B;  2XX7 A;  5JTY B;  2I48 A;  2FNC A;  4R9F A;  3TQL A;  3VDF A;  2HQ0 A;  2Y7W A;  4E0W A;  3E13 X;  5I57 B;  1AOV A;  2Y7R A;  1JVX A;  4QF9 A;  3U72 A;  3HHG A;  4OFL A;  1MY1 A;  1LB9 A;  1T0K A;  4X1D A;  3IL1 B;  2UVJ A;  4EXK A;  5KDT B;  3QUF A;  1M5D A;  4QFL A;  1Q1K A;  4YIC A;  4QSD A;  3V8X B;  3TKD A;  2NWJ A;  2GHA A;  1LCT A;  1B46 A;  1FTJ A;  2D3I A;  3PMW A;  3C34 A;  4MLQ A;  1ZIU A;  2ONS A;  2VOZ A;  3B7D A;  3SKP A;  3TOD A;  2CZL A;  1AMF A;  2UYF A;  4NTL A;  3MQ9 A;  5TP9 A;  4DXB A;  1M5E A;  2DWJ A;  2XXW A;  2NXO A;  5CI5 A;  3CSG A;  3KG2 A;  2X7Q A;  2XXU A;  3TEL A;  2QRY A;  1B7U A;  4RJZ A;  1I6B A;  2P2A A;  3K4U A;  1P1U A;  3CI8 A;  2O51 A;  1L5T A;  2XXP A;  3KEI A;  2NVU B;  1LST A;  4U21 A;  5ISU A;  5K2X A;  3TEP A;  3SES A;  5EYF A;  3MVX A;  2ZYN A;  1EZO A;  1FTM A;  3LBS A;  2VD2 A;  3HST A;  1FQE A;  3MBP A;  2DS9 A;  3M3F A;  4O3C A;  3K2D A;  3IJX B;  1SD3 A;  4R6H A;  3SEU A;  5I58 B;  5HBC A;  4QHQ A;  4I1D A;  2RKM A;  2PMS A;  4BDO A;  4LZ5 A;  2O68 A;  1LAH E;  1LCF A;  1LBC A;  4EXL A;  3L6G A;  5EHS A;  1URS A;  3VVF A;  4F31 B;  5I84 A;  1D9Y A;  3FTO A;  2ONK E;  1P1N A;  4MH5 A;  2PYY A;  1H45 A;  3IB1 A;  4XKN A;  1URG A;  3D4G A;  4JXI A;  1QUJ A;  1AIV A;  2ZYM A;  1IQ7 A;  4EQB A;  4NF8 B;  4OMB A;  3MWB A;  2RF1 A;  1LAX A;  1QKB A;  4H8J A;  5B7D A;  1VE4 A;  1RYX A;  3K6X A;  1RKM A;  3VV5 A;  3IK6 B;  3U1O A;  2O1M A;  3VLV A;  4RXL A;  2F6P A;  3QUJ A;  1B0H A;  1B52 A;  2F8D A;  3EF7 A;  1UTH B;  1XHY A;  4E0X A;  4F22 A;  2YLN A;  2RC7 A;  3HCQ A;  1ANF A;  4RPO A;  4DCY A;  2Q8J A;  3G3K A;  1O63 A;  3RTW B;  3W9V A;  3OXN A;  4JSD A;  4U1Z A;  3UA8 A;  1Y1M A;  3C31 A;  4RPN A;  1R9L A;  4IGT A;  3JZJ A;  3KN8 A;  4DLD A;  2Z8E A;  3UOR A;  1S7Y A;  4OER A;  5I2N B;  1ZTY A;  2DWH A;  4MF3 A;  4F3S A;  5I59 B;  4NF4 B;  1NH8 A;  5DEX B;  4KHZ E;  2I3V A;  3Q28 A;  4ECF A;  4O3A A;  4TOZ A;  2DYX A;  1I69 A;  4OTE A;  2DSF A;  3E3K A;  3EQ1 A;  4KR5 A;  2G29 A;  2WOP A;  3KN3 A;  3K6U A;  2G93 A;  4JSO A;  2OCU A;  3MZ1 A;  1FQA A;  3VLW A;  5I2K A;  1OVB A;  1SYI A;  3ILU B;  4LZ7 A;  3O97 A;  4F1Y A;  3VXB A;  4R73 A;  4BLA A;  3M8U A;  4LQ5 A;  4PFW A;  3FVO A;  3PMX A; 
#chains in the Genus database with same CATH topology
 1SI1 A;  2QVU A;  3MPL A;  3TTR A;  1CE2 A;  1LLS A;  3Q27 A;  1MS7 A;  1XOC A;  3PUX E;  5ITP A;  3DRF A;  3VVE A;  2XXY A;  3FVK A;  4G4P A;  1LFG A;  2R6G E;  2IEE A;  4AB6 A;  3L6H A;  1MQD A;  2V4C A;  3VFJ A;  4Z0I A;  3TQW A;  4WED A;  1FBG A;  2V93 A;  3MPK A;  2B3F A;  2OJT A;  4P3L A;  2ABH A;  1JW1 A;  3WAF A;  1N7X A;  3W9W A;  5H8F A;  4PET A;  4N8G A;  3U8Q A;  4G2Z A;  3SZP A;  1B5H A;  1MDQ A;  4PFB A;  2Y7P A;  2HCA A;  4LON B;  1QKA A;  4BDQ A;  2JJK A;  1BIY A;  4KQP A;  1AL3 A;  4GFR A;  2O7U A;  3QAX A;  5EQ7 A;  4KCC A;  2WEF A;  4NED A;  3K1P A;  2A5T A;  2XXQ A;  4P9K A;  4O7I A;  3N5L A;  3CR9 A;  3OD7 A;  1B2H A;  5L9O A;  2XX8 A;  1FQC A;  4UAC A;  4IO2 A;  1NV1 A;  1MXU A;  2H25 A;  4YB5 A;  3RYB A;  5IM2 A;  4KI0 E;  4MMP A;  2XWV A;  3SET A;  3KGC A;  1LFI A;  4ND9 A;  1FBP A;  1IZ1 A;  4JWO A;  1A7L A;  2GFE A;  4ZEI A;  2I49 A;  2IA4 A;  3PGF A;  3A09 A;  2QL3 A;  1EZ9 A;  1NV0 A;  1NUZ A;  1MPC A;  4PF8 A;  1YYZ A;  4YAH X;  5AA1 A;  3FXR A;  1RDZ A;  5CBS A;  3IOV A;  1XI6 A;  2RIN A;  4PFR A;  4G8N A;  2ZZV A;  2I4C A;  4OZ9 A;  3SEX A;  4F19 A;  4H5F A;  3TTM A;  1QUK A;  3S9M C;  1B3F A;  3RQT A;  4U4S A;  1JW5 A;  1MY4 A;  3TYH A;  4XKP A;  1B58 A;  2CEY A;  4GX6 A;  3RYA A;  3SER A;  2DQV A;  3TCH A;  4QSE A;  5LOM A;  5AA2 B;  3W15 C;  2HZK A;  1LBW A;  4O7M A;  3IOT A;  1DCU A;  2CEX A;  2QJE A;  1ZJL A;  1H43 A;  3LVU A;  2GRV A;  4GL8 A;  4Z7E A;  4RYA A;  3E78 A;  3S9N C;  3A29 A;  2AL4 A;  1YZ0 A;  5F1Q A;  4M4G A;  4DIG A;  3BIG A;  4ELP A;  3ZS6 A;  3PPQ A;  1M5F A;  2F7C A;  4AS5 A;  4KCD A;  5M2V A;  4F18 A;  3FXB A;  4YMB A;  5JK4 A;  4F29 A;  1N3W A;  2ALU A;  3N26 A;  1B3E A;  4NF6 B;  4FIM A;  1GTK A;  1B4Z A;  4QXD A;  4YKK A;  3T9V A;  1KA0 A;  3R26 A;  3KOS A;  1N7W A;  1FTL A;  3OO6 A;  1LGB C;  2DE2 A;  2F3B A;  4ESX A;  4MHF A;  1WVJ A;  5I56 A;  2OWS A;  4G77 A;  4IGR A;  1B7Z A;  1MQI A;  3VXC A;  4ZZA A;  4ELR A;  4KYS A;  3H06 B;  5DYH A;  3H6V A;  1SW1 A;  1DBZ A;  1FRP A;  1SYH A;  2P3N A;  2RC8 A;  1MPB A;  2OLB A;  2Y7K A;  4PTK A;  5A5L A;  1HSL A;  2VD3 A;  2PFZ A;  4GWO A;  3EPE A;  2P3V A;  1B51 A;  4H6D A;  2HPG A;  4FAT A;  4XFE A;  4Q5T A;  4G8H A;  3PUZ E;  4RY1 A;  1O64 A;  3PTY A;  3KSX A;  3K01 A;  1IIW A;  5H8N B;  3IOW A;  4GBV A;  3DP6 A;  4JDF A;  2ZNT A;  1Z7N E;  3DRI A;  2P0S A;  1RYO A;  4KYD A;  4QFN A;  3O2A A;  3CVG A;  1P1W A;  1EU8 A;  2Z8F A;  1O7T A;  4XTC Q;  3WAE A;  1M5B A;  3A3U A;  1D4N A;  3OO8 A;  1R6Z A;  3QXM A;  2HHM A;  2YJP A;  3O9P A;  1H44 A;  1US5 A;  1A40 A;  4NQ8 A;  2XX9 A;  3K0V A;  4EUO A;  3FAT A;  3I6V A;  3RN8 A;  3S9L C;  4IO3 A;  4LN5 A;  3LSX A;  5I59 A;  4X8R A;  2Q74 A;  3ZSF A;  3QYT A;  1IIT A;  3OSR A;  2DE3 A;  4G8M A;  3HV1 A;  3C36 A;  1IEJ A;  4LA9 A;  4O94 A;  4IO4 A;  4H1X A;  2B65 A;  2ZNS A;  5AE4 A;  1H76 A;  2QS1 A;  3OO9 A;  1SW2 A;  2UVI A;  3EKI A;  4MBP A;  3PV0 E;  1LAF E;  2ZMB A;  3LSW A;  2V84 A;  4N17 A;  3H3G A;  2I3W A;  4JWY A;  1H3D A;  1IMC A;  4GOT A;  4M1V A;  1USY H;  3KBR A;  4AS4 A;  3LSL A;  4WXJ A;  2Q8M A;  2PFY A;  1P1O A;  1PEB A;  4RK9 A;  3MVY A;  2FBP A;  2CMO A;  3CFL A;  4R6Y A;  3RYD A;  4GWW A;  5ICT A;  4P1E A;  2GHB A;  2Y84 A;  4LZ8 A;  2WOL A;  3ZKK A;  1JVY A;  1NV5 A;  1S50 A;  1CB6 A;  1EZP A;  4HE0 A;  4KYE A;  3O6H A;  2V3T A;  3PUV E;  1JET A;  5DTB A;  5A5X A;  3KFM A;  4G68 B;  4RK2 A;  2VHA A;  1UTB B;  1OLA A;  4GIZ A;  1MG1 A;  4LQ2 A;  1MQG A;  3FGS A;  4R2F A;  3B50 A;  5H8Q A;  5TPA B;  1FCK A;  3T66 A;  4HE2 A;  4JBZ A;  2XXR A;  3TTL A;  3KOT A;  3RPL B;  2Q9T A;  1NFT A;  3A3C A;  1CNQ A;  5ELV A;  3N6U A;  1JW4 A;  5ET6 A;  1ZLQ A;  4EQ9 A;  3UIF A;  2Y5K A;  4OQO A;  1ZBM A;  1OQG A;  5CMB A;  4IO6 A;  1N0T A;  2FHY A;  4R74 A;  3THI A;  4YKI A;  2CZI A;  2QFL A;  1NV6 A;  5CMC A;  4GQO A;  3MZB A;  1M5C A;  4F39 A;  4NAP A;  3DRJ A;  1B40 A;  1ATG A;  4ZS9 A;  4HS7 A;  4F2Q A;  1B0L A;  4MAG A;  3HFU A;  1KA1 A;  1FPK A;  1IMD A;  4OEU A;  3LC8 A;  2REG A;  3B6Q A;  3G3G A;  1IXC A;  4PFU A;  4THI A;  3EN3 A;  3MZ9 A;  4NF5 A;  3UP9 A;  2F35 A;  4FOR A;  3Q26 A;  3I3V A;  1MQH A;  1NUW A;  2KLF A;  1G0I A;  4ELO A;  2HEU A;  4R9G A;  1B6H A;  4IY6 A;  4R6K A;  5KCJ A;  3IR1 A;  3OEN A;  1MY3 A;  1IMB A;  1I6A A;  2PVU A;  2UVG A;  4GL0 A;  3ISP A;  2F6G A;  4JWX A;  4GWY A;  3S4U A;  5I3S A;  2B3B A;  4PAF A;  2DXY A;  4PFY A;  1PB8 A;  3FUZ A;  5H8H A;  3KN7 A;  3IB2 A;  3CIJ A;  3RTF B;  3BFU A;  4MEV A;  4P0G A;  3PPR A;  5HM4 B;  3IFA A;  3UK4 A;  4P47 A;  4HW8 A;  4QFP A;  4IY5 A;  3E79 A;  5TP9 B;  4O8M A;  2R9J A;  1DPP A;  3V89 B;  3PAM A;  2LAO A;  5AA4 A;  3S9E A;  4PP0 A;  2DWA A;  2V25 A;  3C4M A;  2NUV A;  4MLV A;  5I5P A;  4U1O A;  3FZV A;  2E0S A;  3Q25 A;  1IMA A;  4PAK A;  4ZZE A;  1SW4 A;  2WBB A;  1OQH A;  4LP2 B;  4X1B A;  3R6U A;  2AYS A;  1VDW A;  4OVR A;  5TU0 A;  1Y4T A;  2WKY A;  2Y5L A;  4POW A;  3MC2 A;  4JVC A;  3LUZ A;  4N6D A;  3PUY E;  1QW0 A;  4X9T A;  3AXF A;  1A54 A;  1NL5 A;  3QSL A;  4GVO A;  5FHN A;  1BLF A;  2XD3 A;  3K02 A;  4QSC A;  4U2R A;  3TTN A;  3RY3 A;  3GYY A;  4FE8 A;  4JVI A;  1MY2 A;  2Q2A A;  2ZNU A;  4GF8 A;  1XS5 A;  3DM0 A;  2PBW A;  2FA7 A;  3IJO B;  4Q8R A;  2VPN A;  4OES A;  4I9D A;  2RCB A;  3RT6 B;  4R72 A;  4N07 A;  5JTY A;  3PD9 A;  4H45 A;  3BIH A;  3GBB A;  4H5G A;  5CMM A;  3MYU A;  1PB9 A;  3V83 A;  5EYG A;  3O66 A;  1FBH A;  1MM6 A;  5I57 A;  1NV3 A;  2DXR A;  3EHT A;  1MQJ A;  2Z8D A;  2Q89 A;  4GD5 A;  1XT8 A;  3IB0 A;  4YKJ A;  4EDP A;  1FPI A;  4H67 A;  2HAU A;  2ESN A;  3DRG A;  3JYR A;  4HCW A;  4UA8 A;  3OEL A;  3SEY A;  3TPA A;  2OBG A;  1I6Q A;  2O84 X;  4FED A;  4Q0C A;  4RNS A;  5KDT A;  4NWD A;  3H7M A;  5ET7 A;  4F2O A;  4F3B A;  4IR8 A;  4LAT A;  4PFT A;  3LSF B;  1WOD A;  2KR0 A;  3IOR A;  4ZED A;  1B05 A;  3FAS A;  2FVZ A;  1B5I A;  3MUQ A;  4N81 A;  4ISU A;  2MKZ A;  2ZXT A;  5ET8 A;  2P1S A;  1GR2 A;  2ZZX A;  4LVQ A;  4TLL B;  1EYK A;  4KPT A;  2I4B A;  2HAV A;  2DE4 A;  2UYE A;  1TFD A;  3RNN A;  4N13 A;  4XKR A;  4FEB A;  2R8T A;  1B1X A;  3PU5 A;  4YKP A;  2X7P A;  4FJP A;  1SI0 A;  1Y3N A;  1TT1 A;  2VT5 A;  1OLC A;  4GXA A;  4X48 A;  4MNI A;  1FPF A;  4GWZ A;  5DW8 A;  3ECR A;  3OMB A;  2DVZ A;  3T22 A;  5J16 A;  3BKI B;  1UQW A;  3VVD A;  2PT2 A;  2XWK A;  2RCA A;  1Y20 A;  2PX1 A;  3QIM A;  1FJ9 A;  5I7I A;  3NOH A;  4N91 A;  4UAB A;  1TWY A;  3OSQ A;  1N76 A;  3EHS A;  3FV1 A;  1R1N A;  4GRK A;  3RPW A;  3GBA A;  5I58 A;  3CSB A;  1VFE A;  1MXV A;  5I2K B;  3FV2 A;  3HPI A;  3H6U A;  3FJM A;  1ZU0 A;  1LBB A;  3U94 A;  3IO4 A;  5HPQ A;  4I62 A;  4EF2 A;  3RT8 A;  4U23 A;  3TCG A;  1B3L A;  5ET5 A;  5CMK A;  1IXH A;  4ZEC A;  4I3E A;  3MVW A;  3P7I A;  3FVN A;  3K6V A;  1FTK A;  4Q30 B;  1FPB A;  5L8D A;  1JNF A;  1Q35 A;  1AWB A;  4MCO A;  1NKX A;  2CZH A;  3KJT A;  3TMG A;  3IFC A;  4NF8 A;  1NUY A;  3DRH A;  4OFO A;  5DVF A;  3MP8 A;  5H8S A;  1A99 A;  4POX A;  4QBA A;  4DI4 B;  5H8F B;  5CC2 A;  1XVX A;  3CFZ A;  2QMW A;  3D4C A;  1YPN A;  2B4L A;  4PGP A;  1FBF A;  4H65 A;  3I5O A;  3H03 A;  5LTC A;  1BTJ A;  3R7X A;  3H4Z A;  4XIG Q;  3E4R A;  4OA4 A;  4X04 A;  2A5T B;  1UTH A;  1USY E;  4PF6 A;  2WBD A;  1PDA A;  3K1M A;  2D5W A;  1SPI A;  2DWI A;  4PQJ A;  2ZYO A;  2H5Y A;  3HN0 A;  1IMF A;  3N94 A;  1SDX A;  1BKA A;  1D3K A;  2F36 A;  3ZKL A;  1N3X A;  2X26 A;  3M3K A;  4XEQ A;  1B32 A;  4TQU Q;  3RLF E;  3SEV A;  3VE1 B;  1PC3 A;  2VP1 A;  1FW0 A;  3ODB A;  2M8C A;  1BP5 A;  2REJ A;  2Q2C A;  3B6W A;  1LBY A;  5CM6 A;  2XXV A;  5I2N A;  3IOU A;  2I58 A;  1FPD A;  2Z23 A;  1QVS A;  3MW0 A;  2O7I A;  2KQZ A;  4PCD A;  3FD3 A;  4PGN A;  4NF4 A;  5DEX A;  3T9X B;  1ELJ A;  3PPP A;  1TFA A;  1FJ6 A;  1PBQ A;  4H8I A;  2OWT A;  1NMU A;  3UN6 A;  1NUX A;  4F3P A;  5FTH A;  3C9H A;  3BFT A;  5IZ3 A;  1K9Y A;  3ONM A;  3TFL A;  3KC1 A;  4DDD A;  3GLB A;  2W7Y A;  4XXU A;  4C1T A;  1FTO A;  3TAJ A;  2GH9 A;  4R75 A;  3QK6 A;  3QMF A;  1B1H A;  1B9J A;  1INP A;  3FXQ A;  4WEP A;  5AA3 A;  3H6W A;  2HXR A;  1VSO A;  2XWO A;  1HSE A;  1N84 A;  4DZ1 A;  3ILT B;  2WYP A;  3FXU A;  1RDY A;  4BDN A;  2RC9 A;  2QSX A;  4I8C A;  5EQ9 A;  4XKQ A;  3C32 A;  4JB7 A;  1XC1 A;  3C35 A;  1GVC A;  1Q9D A;  3TTK A;  4ESW A;  4GLI A;  1NNF A;  3U92 A;  5KZT A;  5FHO A;  3G3F A;  3SEW A;  4PAI A;  1KWH A;  2OZZ A;  3EHU A;  4ZDM A;  1B5J A;  1PB7 A;  4ZE8 A;  5FTI A;  3OEM A;  4ZEF A;  1QJM A;  3C33 A;  4NF0 A;  2DVC A;  1II5 A;  2HZL A;  1EH3 A;  4EF1 A;  5IAI A;  4NN3 A;  1FBE A;  1WDN A;  1Y3Q A;  1S9T A;  1A55 A;  3T9H B;  3TDJ A;  1GGG A;  1MXZ A;  1FTA A;  1AH5 A;  3VLU A;  3HO7 A;  1MDP 1;  4O3B A;  5T3J A;  3U93 A;  4ZEK A;  1YTV A;  1B3G A;  1POY 1;  2H98 A;  5EHM A;  4KD5 A;  4QFO A;  1Y3P A;  3LR1 A;  5I56 B;  3MST A;  2QVV A;  4L17 A;  4N6P A;  2H9B A;  1ZKB A;  2D21 A;  1Z7M E;  3TCF A;  1B7H A;  2ONR A;  2XD2 A;  5F7V A;  4GX4 A;  1VR5 A;  3MVZ A;  3T96 B;  2UVH A;  2F5X A;  3F11 A;  1NNT A;  1N04 A;  1PBP A;  4PFI A;  3E9X A;  3IAZ A;  1P1Q A;  3ROJ A;  5CBR A;  4HTG A;  4NWC A;  2WX9 A;  1MY0 A;  1OMP A;  1SVX B;  2YPN A;  3OO7 A;  2F3D A;  2NOO A;  2O1L A;  2PCR A;  4WKM A;  1US4 A;  4YU0 A;  1MXY A;  2VGQ A;  2I6E A;  3DEL B;  1DTG A;  1R9Q A;  1URD A;  4P11 A;  4DE8 A;  4TLM B;  1P99 A;  3S2V A;  5ITO A;  4YZZ A;  3MP6 A;  4LUB A;  3T93 B;  5IZZ A;  2DP8 A;  1JEV A;  1YXI A;  4P8B A;  2Q88 A;  4PBH A;  3G7W A;  5AA2 A;  1MPD A;  1DSN A;  4DCX A;  1NH7 A;  2V3Q A;  1Y9U A;  4OEN A;  4OAN A;  2OK2 A;  4BDR A;  1ZMG A;  4FBP A;  4OVJ A;  3CG1 A;  1UIV A;  1IUD A;  4F3G A;  4G68 C;  1GV8 A;  3DLN A;  2H4I A;  4QFK A;  3T1B A;  1IXG A;  1POT A;  3G3J A;  1FQB A;  3N6T A;  1NI9 A;  4F1U A;  4IO5 A;  2XA5 A;  5FHM A;  4OWD A;  3SDF A;  3IX1 A;  5BWJ A;  1MH3 A;  1OVT A;  4JVD A;  3MJN A;  3KSJ A;  4NF6 A;  1B4H A;  2DOJ A;  3T9U A;  2Z22 A;  1JQF A;  3MAM A;  3PD8 A;  4KXP A;  1DOT A;  2QS2 A;  5DT6 A;  5B70 A;  3JV9 A;  4IO7 A;  3MP1 A;  3TZA A;  3LUY A;  3OOA A;  5F24 A;  4RA1 A;  2I0C A;  3FJ7 A;  4ONY A;  4OYV A;  2QMX A;  4XF5 A;  4C0R A;  5LDZ A;  2E1S A;  3PUW E;  3G3I A;  1F9B A;  1JEU A;  1J1N A;  2H99 A;  3CG3 A;  3GZG A;  4C1U A;  4HE1 A;  4MIJ A;  4IB2 A;  5A5X B;  2PT1 A;  4FAJ A;  5BUU A;  1NV4 A;  4EQ7 A;  5H8Q B;  2AL5 A;  3FJG A;  4AQ4 A;  1LAG E;  2A5S A;  3O6P A;  4HCY A;  3O28 A;  4DXC A;  3O29 A;  4ZEB A;  5J1D A;  3B6T A;  1UIU A;  3TUS A;  3USD A;  5H8N A;  2QVR A;  2O69 A;  3GXA A;  1QUI A;  4OEV A;  1LB8 A;  2F97 A;  3Q29 A;  5AA2 D;  4OFJ A;  4U22 A;  1SQY A;  2FIX A;  2WOK A;  4YB7 A;  2WYK A;  2QS3 A;  4OHN A;  2I0B A;  2UXA A;  3BBR A;  2F34 A;  3DP4 A;  1YAE A;  4GXS B;  3V5A A;  4HXV A;  4NG7 A;  3KZG A;  3KJ7 A;  4U4X A;  3CHG A;  4OXV A;  1DMB A;  4NE4 A;  5JEI A;  4OET A;  1VFD A;  2QPQ A;  4FEC A;  5DVJ A;  2XXI A;  1YCJ A;  2THI A;  3FIR A;  3K1N A;  2AIX A;  3CFX A;  3PPO A;  4NF5 B;  3G3H A;  3CRB A;  1EYI A;  1OIB A;  3RUM A;  4NMY A;  1EYJ A;  4P56 A;  2XXX A;  1D9V A;  4N6K A;  1XVY A;  1NNP A;  3K00 A;  1A8E A;  3HHF A;  1DTZ A;  1LBX A;  1DPE A;  4PC9 A;  2R71 A;  5KCJ B;  2F78 A;  2BJJ X;  2F7A A;  3OEK A;  1TXF A;  4KFQ A;  5IKB A;  1MXX A;  2OWZ A;  3M3L A;  3RGY A;  2QS4 A;  1NNK A;  1Y4C A;  5H8H B;  4ZE9 A;  2ANJ A;  1SW5 A;  2HFB A;  5L9S A;  3O6I A;  1FBC A;  1MXW A;  4PDD A;  1LFH A;  3K6W A;  4K3F A;  3PPN A;  2FYI A;  1QUL A;  3PMV A;  4DI3 D;  3KBZ A;  3UGW A;  5K2Y A;  4H46 A;  2XXH A;  5AA4 B;  4N15 A;  3FVG A;  4AB5 A;  1JP4 A;  2Y7I A;  4R2B A;  4BDM A;  1HSJ A;  4H0W A;  1FSA A;  5CRY A;  2V3U A;  4G68 A;  1UTB A;  1MH4 A;  1IME A;  1FQF A;  5TPA A;  1FQD A;  5DVI A;  4ELQ A;  4MFI A;  3O6G A;  3RPL A;  1K9Z A;  4OVT A;  1Y1Z A;  4I40 A;  1IXI A;  2ZZW A;  2O6A A;  1B3H A;  3IO6 A;  5FBP A;  5ICQ A;  4MNP A;  5L9M A;  1MM7 A;  1QGX A;  2XHD A;  3DP8 A;  3H6T A;  1NV7 A;  2ZYK A;  3DRK A;  1MRP A;  2B4M A;  4YB6 A;  1A8F A;  4DXU A;  2F7B A;  1SBP A;  4P0I A;  4YMA A;  2HXW A;  3KC0 A;  4PE3 A;  5EYH A;  4BDL A;  4F1V A;  2XXT A;  4QRZ A;  4PE5 B;  2XX7 A;  4P1L A;  5JTY B;  2I48 A;  2FNC A;  4R9F A;  3TQL A;  3VDF A;  2HQ0 A;  2Y7W A;  4PBQ A;  4E0W A;  3E13 X;  5I57 B;  1AOV A;  2Y7R A;  1JVX A;  4QF9 A;  3U72 A;  3HHG A;  4OFL A;  4GWU A;  1MY1 A;  1LB9 A;  1T0K A;  4MNC A;  4X1D A;  3IL1 B;  2UVJ A;  4G61 A;  4EXK A;  5KDT B;  3QUF A;  1M5D A;  4QFL A;  1Q1K A;  1BK4 A;  4YIC A;  4QSD A;  3V8X B;  3TKD A;  2NWJ A;  2GHA A;  1LCT A;  1B46 A;  1FTJ A;  2D3I A;  3PMW A;  3C34 A;  4MLQ A;  1ZIU A;  2ONS A;  2VOZ A;  3B7D A;  3SKP A;  3TOD A;  2CZL A;  1AMF A;  3U65 A;  2UYF A;  4NTL A;  2XWI A;  3MQ9 A;  4OVP A;  5TP9 A;  4DXB A;  1M5E A;  2DWJ A;  2XXW A;  2NXO A;  5CI5 A;  3CSG A;  3KG2 A;  2X7Q A;  2XXU A;  4MJO A;  3TEL A;  2QRY A;  1B7U A;  4RJZ A;  2CZK A;  1I6B A;  2P2A A;  3D1R A;  3K4U A;  1LBV A;  1P1U A;  3CI8 A;  2O51 A;  1L5T A;  2XXP A;  3KEI A;  2NVU B;  1LST A;  4U21 A;  5ISU A;  5K2X A;  3TEP A;  1RDX A;  3SES A;  4PDH A;  2BJI A;  1G0H A;  5EYF A;  3MVX A;  2ZYN A;  5EQ8 A;  5EQA A;  1FTM A;  1EZO A;  3LBS A;  2OX3 A;  2VD2 A;  3HST A;  1FQE A;  3MBP A;  2DS9 A;  3M3F A;  4O3C A;  5IZ1 A;  4MX6 A;  3K2D A;  3IJX B;  1SD3 A;  4R6H A;  3SEU A;  5I58 B;  5HBC A;  4QHQ A;  4GBW A;  4I1D A;  2RKM A;  2PMS A;  4BDO A;  1LEV A;  4LZ5 A;  2O68 A;  1LAH E;  4N4U A;  1LCF A;  1LBC A;  1KZ8 A;  4EXL A;  3L6G A;  4I3Y A;  4N8Y A;  2XXK A;  5EHS A;  1URS A;  3VVF A;  4F31 B;  5I84 A;  1D9Y A;  3FTO A;  2ONK E;  1P1N A;  4MH5 A;  2PYY A;  1H45 A;  3IB1 A;  4XKN A;  1URG A;  3D4G A;  4JXI A;  1QUJ A;  1AIV A;  2ZYM A;  1IQ7 A;  2L5V A;  1FPG A;  4EQB A;  4NF8 B;  3T0J A;  1FPE A;  4OMB A;  3MWB A;  2RF1 A;  1LAX A;  1QKB A;  1D9Q A;  4H8J A;  5B7D A;  1VE4 A;  1RYX A;  3K6X A;  1RKM A;  3VV5 A;  3IK6 B;  2VPO A;  1NV2 A;  1FPJ A;  3U1O A;  4GWX A;  1DK4 A;  2O1M A;  3VLV A;  1LBZ A;  4RXL A;  2F6P A;  3QUJ A;  2GQ1 A;  4GWS A;  1B0H A;  1B52 A;  2F8D A;  3EF7 A;  1UTH B;  1XHY A;  4E0X A;  4F22 A;  2YLN A;  3LV0 A;  2FIE A;  4NGU A;  2RC7 A;  1FBD A;  4OVQ A;  3HCQ A;  1ANF A;  4RPO A;  4DCY A;  2Q8J A;  5IGA A;  3G3K A;  1O63 A;  3RTW B;  3B8B A;  3W9V A;  3OXN A;  4JSD A;  4U1Z A;  3UA8 A;  1Y1M A;  3C31 A;  4RPN A;  1FPL A;  1R9L A;  2DDK A;  4IGT A;  3JZJ A;  3KN8 A;  4DLD A;  2Z8E A;  3UOR A;  1S7Y A;  4OER A;  5I2N B;  1ZTY A;  3FBP A;  2DWH A;  4MF3 A;  4F3S A;  5I59 B;  4NF4 B;  1NH8 A;  5DEX B;  4KHZ E;  2I3V A;  3Q28 A;  4ECF A;  4O3A A;  4TOZ A;  2DYX A;  1I69 A;  4OTE A;  2DSF A;  3E3K A;  3EQ1 A;  4KR5 A;  2G29 A;  2WOP A;  3KN3 A;  3K6U A;  2G93 A;  4JSO A;  2OCU A;  5IZ3 B;  3MZ1 A;  1FQA A;  3VLW A;  5I2K A;  1OVB A;  1SYI A;  4OVS A;  5ESY A;  3ILU B;  4LZ7 A;  3O97 A;  4NHB A;  4F1Y A;  4GX3 A;  3VXB A;  4R73 A;  4BLA A;  3M8U A;  4LQ5 A;  4NX1 A;  4PFW A;  3FVO A;  3PMX A; 
#chains in the Genus database with same CATH homology
 1SI1 A;  3MPL A;  3TTR A;  1CE2 A;  1LLS A;  3Q27 A;  1MS7 A;  1XOC A;  3PUX E;  5ITP A;  3DRF A;  3VVE A;  2XXY A;  3FVK A;  4G4P A;  1LFG A;  2R6G E;  2IEE A;  4AB6 A;  3L6H A;  1MQD A;  3VFJ A;  4Z0I A;  3TQW A;  4WED A;  2V93 A;  3MPK A;  2B3F A;  2OJT A;  2ABH A;  1JW1 A;  3WAF A;  1N7X A;  3W9W A;  5H8F A;  4PET A;  3U8Q A;  4G2Z A;  1B5H A;  1MDQ A;  2Y7P A;  2HCA A;  4LON B;  1QKA A;  4BDQ A;  1BIY A;  4KQP A;  1AL3 A;  4GFR A;  2O7U A;  3QAX A;  4KCC A;  4NED A;  3K1P A;  2A5T A;  2XXQ A;  3N5L A;  3CR9 A;  3OD7 A;  1B2H A;  5L9O A;  2XX8 A;  1FQC A;  4UAC A;  4IO2 A;  1MXU A;  2H25 A;  4YB5 A;  3RYB A;  4KI0 E;  3SET A;  3KGC A;  1LFI A;  4ND9 A;  1IZ1 A;  4JWO A;  1A7L A;  2GFE A;  4ZEI A;  2I49 A;  2IA4 A;  3PGF A;  3A09 A;  2QL3 A;  1EZ9 A;  1MPC A;  4YAH X;  5AA1 A;  3FXR A;  5CBS A;  3IOV A;  2RIN A;  4G8N A;  2I4C A;  4OZ9 A;  3SEX A;  4F19 A;  4H5F A;  3TTM A;  1QUK A;  3S9M C;  1B3F A;  3RQT A;  4U4S A;  1JW5 A;  1MY4 A;  3TYH A;  4XKP A;  1B58 A;  3RYA A;  3SER A;  2DQV A;  3TCH A;  4QSE A;  5LOM A;  5AA2 B;  3W15 C;  2HZK A;  3IOT A;  2QJE A;  1ZJL A;  1H43 A;  3LVU A;  2GRV A;  4GL8 A;  4Z7E A;  4RYA A;  3S9N C;  2AL4 A;  5F1Q A;  4M4G A;  4DIG A;  4ELP A;  3ZS6 A;  3PPQ A;  1M5F A;  2F7C A;  4KCD A;  5M2V A;  4F18 A;  4YMB A;  5JK4 A;  4F29 A;  1N3W A;  2ALU A;  3N26 A;  1B3E A;  4NF6 B;  4FIM A;  1GTK A;  1B4Z A;  4YKK A;  3T9V A;  3R26 A;  3KOS A;  1N7W A;  1FTL A;  3OO6 A;  1LGB C;  2DE2 A;  4ESX A;  1WVJ A;  5I56 A;  2OWS A;  4G77 A;  4IGR A;  1B7Z A;  1MQI A;  3VXC A;  4ZZA A;  4ELR A;  4KYS A;  5DYH A;  3H06 B;  3H6V A;  1SW1 A;  2RC8 A;  1SYH A;  1MPB A;  2OLB A;  2Y7K A;  1HSL A;  2VD3 A;  4GWO A;  3EPE A;  1B51 A;  4H6D A;  4FAT A;  4Q5T A;  4G8H A;  3PUZ E;  4RY1 A;  1O64 A;  3KSX A;  3K01 A;  1IIW A;  5H8N B;  3IOW A;  3DP6 A;  4JDF A;  2ZNT A;  1Z7N E;  3DRI A;  2P0S A;  1RYO A;  4KYD A;  4QFN A;  3O2A A;  3CVG A;  1P1W A;  1EU8 A;  2Z8F A;  1O7T A;  4XTC Q;  3WAE A;  1M5B A;  3A3U A;  1D4N A;  3OO8 A;  1R6Z A;  3QXM A;  2YJP A;  3O9P A;  1H44 A;  1US5 A;  1A40 A;  2XX9 A;  3K0V A;  4EUO A;  3FAT A;  3I6V A;  3RN8 A;  3S9L C;  4IO3 A;  3LSX A;  5I59 A;  3ZSF A;  3QYT A;  1IIT A;  3OSR A;  2DE3 A;  4G8M A;  3HV1 A;  3C36 A;  1IEJ A;  4LA9 A;  4IO4 A;  4H1X A;  2B65 A;  2ZNS A;  5AE4 A;  1H76 A;  2QS1 A;  3OO9 A;  1SW2 A;  2UVI A;  4MBP A;  3PV0 E;  1LAF E;  2ZMB A;  3LSW A;  2V84 A;  3H3G A;  2I3W A;  4JWY A;  1H3D A;  4GOT A;  4M1V A;  1USY H;  3KBR A;  3LSL A;  4WXJ A;  1P1O A;  1PEB A;  4RK9 A;  3MVY A;  2CMO A;  3CFL A;  4R6Y A;  5ICT A;  2GHB A;  2Y84 A;  4LZ8 A;  2WOL A;  3ZKK A;  1JVY A;  1S50 A;  1CB6 A;  1EZP A;  4KYE A;  3O6H A;  2V3T A;  3PUV E;  1JET A;  5DTB A;  5A5X A;  3KFM A;  4G68 B;  4RK2 A;  2VHA A;  1UTB B;  1OLA A;  4GIZ A;  1MG1 A;  4LQ2 A;  1MQG A;  3FGS A;  4R2F A;  5H8Q A;  5TPA B;  1FCK A;  3T66 A;  4JBZ A;  2XXR A;  3TTL A;  3KOT A;  2Q9T A;  1NFT A;  3A3C A;  5ELV A;  3N6U A;  1JW4 A;  1ZLQ A;  4EQ9 A;  3UIF A;  4OQO A;  1ZBM A;  1OQG A;  5CMB A;  4IO6 A;  1N0T A;  4R74 A;  3THI A;  4YKI A;  5CMC A;  4GQO A;  3MZB A;  1M5C A;  4F39 A;  3DRJ A;  1B40 A;  1ATG A;  4ZS9 A;  4HS7 A;  4F2Q A;  1B0L A;  4OEU A;  3LC8 A;  2REG A;  3B6Q A;  3G3G A;  1IXC A;  4PFU A;  4THI A;  3EN3 A;  3MZ9 A;  4NF5 A;  3UP9 A;  2F35 A;  4FOR A;  3Q26 A;  3I3V A;  1MQH A;  2KLF A;  4ELO A;  2HEU A;  4R9G A;  1B6H A;  4IY6 A;  4R6K A;  5KCJ A;  3IR1 A;  3OEN A;  1MY3 A;  1I6A A;  2PVU A;  2UVG A;  4GL0 A;  2F6G A;  4JWX A;  3S4U A;  2B3B A;  2DXY A;  4PFY A;  1PB8 A;  3FUZ A;  5H8H A;  3KN7 A;  3IB2 A;  3CIJ A;  3RTF B;  3BFU A;  4P0G A;  3PPR A;  5HM4 B;  3UK4 A;  4HW8 A;  4QFP A;  4IY5 A;  5TP9 B;  2R9J A;  1DPP A;  3V89 B;  3PAM A;  2LAO A;  5AA4 A;  3S9E A;  4PP0 A;  2DWA A;  2V25 A;  3C4M A;  2NUV A;  4MLV A;  4U1O A;  3FZV A;  2E0S A;  3Q25 A;  4ZZE A;  1SW4 A;  1OQH A;  4LP2 B;  4X1B A;  3R6U A;  2AYS A;  5TU0 A;  1Y4T A;  2WKY A;  4POW A;  3MC2 A;  3PUY E;  1QW0 A;  4X9T A;  3AXF A;  1A54 A;  1NL5 A;  3QSL A;  4GVO A;  5FHN A;  1BLF A;  2XD3 A;  3K02 A;  4QSC A;  4U2R A;  3TTN A;  3RY3 A;  4FE8 A;  1MY2 A;  2Q2A A;  2ZNU A;  4GF8 A;  1XS5 A;  3DM0 A;  2PBW A;  2FA7 A;  3IJO B;  4Q8R A;  4OES A;  4I9D A;  2RCB A;  3RT6 B;  4R72 A;  4N07 A;  5JTY A;  3PD9 A;  3GBB A;  4H5G A;  5CMM A;  1PB9 A;  3V83 A;  3O66 A;  1MM6 A;  5I57 A;  2DXR A;  3EHT A;  1MQJ A;  2Z8D A;  2Q89 A;  4GD5 A;  1XT8 A;  3IB0 A;  4YKJ A;  4EDP A;  4H67 A;  2HAU A;  2ESN A;  3DRG A;  3JYR A;  4HCW A;  4UA8 A;  3OEL A;  3SEY A;  3TPA A;  2OBG A;  1I6Q A;  2O84 X;  4FED A;  4Q0C A;  4RNS A;  5KDT A;  4NWD A;  3H7M A;  4F2O A;  4F3B A;  4LAT A;  4PFT A;  3LSF B;  1WOD A;  3IOR A;  4ZED A;  1B05 A;  3FAS A;  1B5I A;  3MUQ A;  4ISU A;  2ZXT A;  2P1S A;  1GR2 A;  4LVQ A;  4TLL B;  4KPT A;  2I4B A;  2HAV A;  2DE4 A;  2UYE A;  1TFD A;  3RNN A;  4N13 A;  4XKR A;  4FEB A;  1B1X A;  3PU5 A;  4YKP A;  2X7P A;  4FJP A;  1SI0 A;  1Y3N A;  1TT1 A;  1OLC A;  4GXA A;  4X48 A;  3ECR A;  3OMB A;  2DVZ A;  3T22 A;  3BKI B;  1UQW A;  3VVD A;  2PT2 A;  2RCA A;  1Y20 A;  2PX1 A;  3QIM A;  1TWY A;  3OSQ A;  1N76 A;  3EHS A;  3FV1 A;  1R1N A;  4GRK A;  3RPW A;  3GBA A;  5I58 A;  3CSB A;  1VFE A;  1MXV A;  5I2K B;  3FV2 A;  3HPI A;  3H6U A;  3FJM A;  1ZU0 A;  1LBB A;  3U94 A;  3IO4 A;  5HPQ A;  4I62 A;  4EF2 A;  3RT8 A;  4U23 A;  3TCG A;  1B3L A;  5CMK A;  1IXH A;  4ZEC A;  3MVW A;  3P7I A;  3FVN A;  3K6V A;  1FTK A;  4Q30 B;  5L8D A;  1JNF A;  1Q35 A;  1NKX A;  3KJT A;  3TMG A;  4NF8 A;  3DRH A;  4OFO A;  5DVF A;  3MP8 A;  5H8S A;  1A99 A;  4POX A;  5H8F B;  5CC2 A;  1XVX A;  3CFZ A;  2QMW A;  3D4C A;  1YPN A;  2B4L A;  4H65 A;  3I5O A;  3H03 A;  1BTJ A;  3R7X A;  3H4Z A;  4XIG Q;  3E4R A;  2A5T B;  1UTH A;  1USY E;  1PDA A;  3K1M A;  2D5W A;  2DWI A;  4PQJ A;  2ZYO A;  2H5Y A;  3HN0 A;  3N94 A;  1SDX A;  1BKA A;  1D3K A;  2F36 A;  3ZKL A;  1N3X A;  2X26 A;  3M3K A;  1B32 A;  4TQU Q;  3RLF E;  3SEV A;  3VE1 B;  1PC3 A;  2VP1 A;  1FW0 A;  3ODB A;  2M8C A;  1BP5 A;  2REJ A;  2Q2C A;  3B6W A;  5CM6 A;  2XXV A;  5I2N A;  3IOU A;  2I58 A;  2Z23 A;  1QVS A;  3MW0 A;  2O7I A;  3FD3 A;  4NF4 A;  5DEX A;  3T9X B;  1ELJ A;  3PPP A;  1TFA A;  1PBQ A;  4H8I A;  2OWT A;  1NMU A;  3UN6 A;  4F3P A;  5FTH A;  3C9H A;  3BFT A;  3ONM A;  3TFL A;  4DDD A;  3GLB A;  2W7Y A;  4XXU A;  4C1T A;  1FTO A;  3TAJ A;  2GH9 A;  4R75 A;  3QK6 A;  1B1H A;  1B9J A;  3FXQ A;  4WEP A;  5AA3 A;  3H6W A;  1VSO A;  1HSE A;  1N84 A;  4DZ1 A;  3ILT B;  3FXU A;  4BDN A;  2RC9 A;  2QSX A;  4I8C A;  4XKQ A;  3C32 A;  4JB7 A;  1XC1 A;  3C35 A;  1GVC A;  3TTK A;  4ESW A;  4GLI A;  1NNF A;  3U92 A;  5KZT A;  5FHO A;  3G3F A;  3SEW A;  1KWH A;  2OZZ A;  3EHU A;  4ZDM A;  1B5J A;  1PB7 A;  4ZE8 A;  5FTI A;  3OEM A;  4ZEF A;  1QJM A;  3C33 A;  2DVC A;  1II5 A;  2HZL A;  1EH3 A;  4EF1 A;  5IAI A;  1WDN A;  1Y3Q A;  1S9T A;  1A55 A;  3T9H B;  3TDJ A;  1GGG A;  1MXZ A;  1AH5 A;  3VLU A;  3HO7 A;  1MDP 1;  4O3B A;  3U93 A;  4ZEK A;  1YTV A;  1B3G A;  1POY 1;  2H98 A;  5EHM A;  4KD5 A;  4QFO A;  1Y3P A;  3LR1 A;  5I56 B;  4L17 A;  4N6P A;  2H9B A;  1ZKB A;  2D21 A;  1Z7M E;  3TCF A;  1B7H A;  2ONR A;  2XD2 A;  5F7V A;  1VR5 A;  3MVZ A;  3T96 B;  2UVH A;  2F5X A;  3F11 A;  1NNT A;  1N04 A;  1PBP A;  3E9X A;  3IAZ A;  1P1Q A;  5CBR A;  4HTG A;  4NWC A;  1MY0 A;  1OMP A;  1SVX B;  2YPN A;  3OO7 A;  2NOO A;  2O1L A;  4WKM A;  1US4 A;  4YU0 A;  1MXY A;  2VGQ A;  2I6E A;  3DEL B;  1DTG A;  1R9Q A;  1URD A;  4P11 A;  4DE8 A;  4TLM B;  1P99 A;  3S2V A;  5ITO A;  4YZZ A;  3MP6 A;  4LUB A;  3T93 B;  2DP8 A;  1JEV A;  2Q88 A;  3G7W A;  5AA2 A;  1MPD A;  1DSN A;  4DCX A;  1NH7 A;  2V3Q A;  1Y9U A;  4OEN A;  2OK2 A;  4BDR A;  1ZMG A;  4OVJ A;  3CG1 A;  1UIV A;  1IUD A;  4F3G A;  4G68 C;  1GV8 A;  3DLN A;  2H4I A;  4QFK A;  1IXG A;  1POT A;  3G3J A;  1FQB A;  3N6T A;  4F1U A;  4IO5 A;  5FHM A;  4OWD A;  3SDF A;  3IX1 A;  5BWJ A;  1MH3 A;  1OVT A;  3MJN A;  3KSJ A;  4NF6 A;  1B4H A;  2DOJ A;  3T9U A;  2Z22 A;  1JQF A;  3MAM A;  3PD8 A;  1DOT A;  2QS2 A;  5DT6 A;  5B70 A;  3JV9 A;  4IO7 A;  3MP1 A;  3TZA A;  3LUY A;  3OOA A;  4RA1 A;  2I0C A;  3FJ7 A;  4ONY A;  4OYV A;  2QMX A;  4C0R A;  2E1S A;  3PUW E;  3G3I A;  1F9B A;  1JEU A;  1J1N A;  2H99 A;  3CG3 A;  3GZG A;  4C1U A;  4IB2 A;  5A5X B;  2PT1 A;  4FAJ A;  5BUU A;  4EQ7 A;  5H8Q B;  2AL5 A;  3FJG A;  4AQ4 A;  1LAG E;  2A5S A;  3O6P A;  4HCY A;  3O28 A;  4DXC A;  3O29 A;  4ZEB A;  5J1D A;  3B6T A;  1UIU A;  3TUS A;  3USD A;  5H8N A;  2O69 A;  3GXA A;  1QUI A;  4OEV A;  1LB8 A;  2F97 A;  3Q29 A;  5AA2 D;  4OFJ A;  4U22 A;  1SQY A;  2WOK A;  4YB7 A;  2QS3 A;  4OHN A;  2I0B A;  2UXA A;  3BBR A;  2F34 A;  3DP4 A;  1YAE A;  4GXS B;  3V5A A;  3KZG A;  3KJ7 A;  4U4X A;  3CHG A;  4OXV A;  1DMB A;  4NE4 A;  5JEI A;  4OET A;  1VFD A;  2QPQ A;  4FEC A;  5DVJ A;  2XXI A;  1YCJ A;  2THI A;  3FIR A;  3K1N A;  2AIX A;  3CFX A;  3PPO A;  4NF5 B;  3G3H A;  3CRB A;  1OIB A;  3RUM A;  4NMY A;  2XXX A;  1D9V A;  1XVY A;  1NNP A;  3K00 A;  1A8E A;  3HHF A;  1DTZ A;  1DPE A;  2R71 A;  5KCJ B;  2F78 A;  2BJJ X;  2F7A A;  3OEK A;  1TXF A;  4KFQ A;  5IKB A;  1MXX A;  3M3L A;  3RGY A;  2QS4 A;  1NNK A;  1Y4C A;  5H8H B;  4ZE9 A;  2ANJ A;  1SW5 A;  2HFB A;  5L9S A;  3O6I A;  1MXW A;  1LFH A;  3K6W A;  4K3F A;  3PPN A;  2FYI A;  1QUL A;  3PMV A;  3UGW A;  5K2Y A;  2XXH A;  5AA4 B;  3FVG A;  4AB5 A;  2Y7I A;  4R2B A;  4BDM A;  1HSJ A;  4H0W A;  5CRY A;  2V3U A;  4G68 A;  1UTB A;  1MH4 A;  1FQF A;  5TPA A;  1FQD A;  5DVI A;  4ELQ A;  4MFI A;  3O6G A;  1Y1Z A;  1IXI A;  2O6A A;  1B3H A;  3IO6 A;  5ICQ A;  5L9M A;  1MM7 A;  2XHD A;  3DP8 A;  3H6T A;  2ZYK A;  3DRK A;  1MRP A;  2B4M A;  4YB6 A;  1A8F A;  4DXU A;  2F7B A;  1SBP A;  4P0I A;  4YMA A;  2HXW A;  4BDL A;  4F1V A;  2XXT A;  4QRZ A;  4PE5 B;  2XX7 A;  5JTY B;  2I48 A;  2FNC A;  4R9F A;  3TQL A;  3VDF A;  2HQ0 A;  2Y7W A;  4E0W A;  3E13 X;  5I57 B;  1AOV A;  2Y7R A;  1JVX A;  4QF9 A;  3U72 A;  3HHG A;  4OFL A;  1MY1 A;  1LB9 A;  1T0K A;  4X1D A;  3IL1 B;  2UVJ A;  4EXK A;  5KDT B;  3QUF A;  1M5D A;  4QFL A;  1Q1K A;  4YIC A;  4QSD A;  3V8X B;  3TKD A;  2NWJ A;  2GHA A;  1LCT A;  1B46 A;  1FTJ A;  2D3I A;  3PMW A;  3C34 A;  4MLQ A;  1ZIU A;  2ONS A;  2VOZ A;  3B7D A;  3SKP A;  3TOD A;  2CZL A;  1AMF A;  2UYF A;  4NTL A;  3MQ9 A;  5TP9 A;  4DXB A;  1M5E A;  2DWJ A;  2XXW A;  2NXO A;  5CI5 A;  3CSG A;  3KG2 A;  2X7Q A;  2XXU A;  3TEL A;  2QRY A;  1B7U A;  4RJZ A;  1I6B A;  2P2A A;  3K4U A;  1P1U A;  3CI8 A;  2O51 A;  1L5T A;  2XXP A;  3KEI A;  2NVU B;  1LST A;  4U21 A;  5ISU A;  5K2X A;  3TEP A;  3SES A;  5EYF A;  3MVX A;  2ZYN A;  1EZO A;  1FTM A;  3LBS A;  2VD2 A;  3HST A;  1FQE A;  3MBP A;  2DS9 A;  3M3F A;  4O3C A;  3K2D A;  3IJX B;  1SD3 A;  4R6H A;  3SEU A;  5I58 B;  5HBC A;  4QHQ A;  4I1D A;  2RKM A;  2PMS A;  4BDO A;  4LZ5 A;  2O68 A;  1LAH E;  1LCF A;  1LBC A;  4EXL A;  3L6G A;  5EHS A;  1URS A;  3VVF A;  4F31 B;  5I84 A;  1D9Y A;  3FTO A;  2ONK E;  1P1N A;  4MH5 A;  2PYY A;  1H45 A;  3IB1 A;  4XKN A;  1URG A;  3D4G A;  4JXI A;  1QUJ A;  1AIV A;  2ZYM A;  1IQ7 A;  4EQB A;  4NF8 B;  4OMB A;  3MWB A;  2RF1 A;  1LAX A;  1QKB A;  4H8J A;  5B7D A;  1VE4 A;  1RYX A;  3K6X A;  1RKM A;  3VV5 A;  3IK6 B;  3U1O A;  2O1M A;  3VLV A;  4RXL A;  2F6P A;  3QUJ A;  1B0H A;  1B52 A;  2F8D A;  3EF7 A;  1UTH B;  1XHY A;  4E0X A;  4F22 A;  2YLN A;  2RC7 A;  3HCQ A;  1ANF A;  4RPO A;  4DCY A;  2Q8J A;  3G3K A;  1O63 A;  3RTW B;  3W9V A;  3OXN A;  4JSD A;  4U1Z A;  3UA8 A;  1Y1M A;  3C31 A;  4RPN A;  1R9L A;  4IGT A;  3JZJ A;  3KN8 A;  4DLD A;  2Z8E A;  3UOR A;  1S7Y A;  4OER A;  5I2N B;  1ZTY A;  2DWH A;  4MF3 A;  4F3S A;  5I59 B;  4NF4 B;  1NH8 A;  5DEX B;  4KHZ E;  2I3V A;  3Q28 A;  4ECF A;  4O3A A;  4TOZ A;  2DYX A;  1I69 A;  4OTE A;  2DSF A;  3E3K A;  3EQ1 A;  4KR5 A;  2G29 A;  2WOP A;  3KN3 A;  3K6U A;  2G93 A;  4JSO A;  2OCU A;  3MZ1 A;  1FQA A;  3VLW A;  5I2K A;  1OVB A;  1SYI A;  3ILU B;  4LZ7 A;  3O97 A;  4F1Y A;  3VXB A;  4R73 A;  4BLA A;  3M8U A;  4LQ5 A;  4PFW A;  3FVO A;  3PMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...