1B40A

Oligo-peptide binding protein (oppa) complexed with kfk
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 190
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b40A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b40A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b40A02
4YKPA 2RC9A 2B3BA 3OO6A 2OLBA 3FVGA 3OOAA 1N3XA 3MVWA 1MXWA 1MXZA 1LBCA 2DYXA 2H25A 1NL5A 5AA2B 3G3HA 4MBPA 5B70A 4EQ7A 3TYHA 3KJTA 2ZYKA 4DXCA 5JTYA 4R73A 4EQBA 3K1PA 4YMAA 4THIA 4Q5TA 2AYSA 2I4CA 1BKAA 4NF8A 3K01A 4IGRA 4NTLA 1B51A 3EHUA 2YLNA 3E9XA 3AXFA 2XXYA 4YMBA 1MM7A 1GV8A 1SI1A 3RYAA 4GFRA 5FHOA 4F3GA 1GR2A 1NNTA 2I48A 5TPAA 2HFBA 1DTGA 2I58A 4YB5A 4HCWA 1TT1A 2RC7A 4POWA 1Y3NA 4N13A 2DSFA 1A99A 1PB9A 2Z22A 3IOVA 3MPLA 4RPNA 1URDA 3I3VA 1Y20A 2O1LA 4QSDA 3SEWA 1LFHA 3FJ7A 1M5DA 4H5FA 3FJGA 1MY3A 2M8CA 4PE5B 1D9VA 2F36A 4OFLA 2OWTA 3FJMA 1JETA 3IR1A 5DYHA 2H9BA 3IB1A 1UTHA 1TFDA 3H6TA 5I2NB 4FORA 3OEMA 1US5A 5KDTA 3V8XB 1S7YA 3Q28A 5DVJA 5HBCA 3S9NC 3MQ9A 2V3UA 3N6TA 1H45A 3IOUA 5CBRA 3O9PA 1JW5A 5K2YA 4Q30B 4PP0A 1M5CA 5IKBA 4GWOA 3USDA 3SETA 2Z8EA 4YAHX 2E0SA 4KCDA 3K6XA 5A5XB 1N7XA 1Z7NE 3KN8A 2F34A 3IJXB 2O84X 2ZYNA 3GZGA 2AL5A 3CI8A 1MQIA 3MW0A 1QUIA 3K6VA 1OLAA 3DELB 3C31A 3VVEA 3T9HB 1B5JA 1TXFA 4G8MA 3RUMA 4GD5A 2P1SA 5AE4A 4RY1A 1Y3PA 2A5TA 2ONRA 2DXYA 2F8DA 1P1NA 1BIYA 3VLWA 3E13X 1NNPA 5TP9B 1LCTA 4KCCA 1MY4A 1USYH 4IB2A 2Y7IA 4FAJA 3A3UA 3EHSA 1QUJA 3DRKA 3Q29A 1B9JA 4DIGA 2I0CA 1WODA 1MXXA 4GL8A 4U21A 3HHGA 4X48A 2I4BA 3I6VA 4RPOA 4F3SA 2HCAA 4N07A 3H6VA 1O7TA 1MM6A 5FTHA 2QRYA 4X9TA 3GXAA 3KEIA 5KZTA 1ATGA 4F3PA 5ITOA 5H8FA 1FQAA 4EUOA 2RINA 2I3WA 3MBPA 4DZ1A 3JYRA 2DXRA 3VVFA 1EZ9A 1IZ1A 4ZZEA 2X7QA 3LSLA 3UORA 1AOVA 1HSLA 1HSEA 3CG1A 1IXHA 4POXA 3S9MC 5CM6A 4NF4A 1MQJA 2NWJA 5CMMA 3MP8A 3HPIA 1B0LA 3RT6B 2ALUA 2PMSA 3O6GA 4JSDA 5A5XA 1J1NA 2X7PA 4ZEFA 2OWSA 3K00A 2OJTA 4QF9A 3N94A 3SKPA 1SW2A 2PVUA 1JVXA 3K0VA 3C35A 3W9VA 3TTRA 1EU8A 1FCKA 5CMKA 1XC1A 2Q89A 1LGBC 4NWCA 1MRPA 4XKRA 4LUBA 4FEBA 3R7XA 5FHNA 3T9UA 4O3CA 1QULA 2X26A 3R6UA 1B3HA 4ZEDA 4C1TA 1OMPA 3QAXA 2V3QA 4DXUA 4QFPA 2XXXA 1AIVA 4LA9A 3SEYA 1N04A 4GVOA 5H8HA 1B1XA 2GFEA 4IGTA 4OXVA 1S50A 4HTGA 4KQPA 3JZJA 2O51A 2GHAA 3VFJA 1RKMA 4TQUQ 4Q0CA 4OMBA 3FUZA 5ICTA 3I5OA 3HN0A 3KOTA 3MPKA 4RNSA 4DCXA 4OENA 3M8UA 2ONKE 5DVFA 4H8IA 1I6AA 3TZAA 3ZSFA 3HO7A 1MQHA 3SEUA 4RK2A 1QW0A 4L17A 2ZXTA 2O7UA 4IO4A 3PPNA 5TPAB 3E4RA 3K1NA 1DOTA 4OFJA 2Z23A 1LCFA 3OELA 2NUVA 4F2OA 2IA4A 3MZ1A 5JEIA 2HXWA 3MVZA 3VLUA 4FJPA 3RGYA 3KBRA 2Q88A 1DTZA 1Z7ME 4NF5A 2XD2A 5BUUA 3Q26A 3MP6A 1ZU0A 1DPPA 3BFTA 4QSEA 4KR5A 2NXOA 4X1BA 2R9JA 3G7WA 1FQBA 2Y7WA 3S9LC 1MS7A 1MH4A 5I57A 3RT8A 1UTHB 2DVZA 1QUKA 2V3TA 5EYFA 5KDTB 1T0KA 2UVJA 1L5TA 5H8NA 1IIWA 1JNFA 5AA2D 3B7DA 2GH9A 4F39A 3MWBA 2AIXA 1OQHA 3FTOA 5ISUA 4OESA 4AB6A 2V84A 3SEXA 1IUDA 1D9YA 3UGWA 4KYSA 3RTFB 2DWAA 3LSXA 3V89B 1D4NA 2FNCA 3IO4A 4BDOA 3IL1B 3PMWA 3CFLA 1B5IA 5H8QA 3T9VA 1LFIA 4HW8A 3SERA 1JVYA 3ONMA 4FEDA 4OERA 4LVQA 1A8EA 4YB6A 4OEVA 1B32A 4U4XA 3LBSA 3OO7A 2H99A 1PC3A 2O68A 2A5TB 3B6WA 3IORA 3ZS6A 3D4CA 4IY6A 1LFGA 1N76A 4U4SA 2QL3A 3MVXA 3TCFA 3HV1A 3H03A 4GIZA 2V25A 4PETA 2H98A 4LZ8A 3C36A 3LVUA 4ESWA 4RYAA 4C1UA 4RA1A 4U22A 2QPQA 1PEBA 2RF1A 5FHMA 4Z0IA 1PDAA 1B3GA 1POY1 4BDNA 1UQWA 2REGA 4JWXA 3IJOB 3R26A 3QUJA 3EPEA 2XHDA 3WAEA 1H44A 3S2VA 1OLCA 1XT8A 1CE2A 2HZLA 2ZYMA 4NEDA 3UP9A 3VDFA 4JB7A 2ZNUA 4YKIA 1FQFA 3PD8A 2UVGA 4I9DA 5F7VA 4XXUA 3K2DA 5H8FB 3UK4A 4JWYA 3FXQA 1UTBB 1AH5A 3GBAA 3TUSA 4FATA 2O1MA 3QK6A 3O6HA 4Z7EA 3C32A 3OSRA 4TLMB 3EF7A 4NF4B 4PFYA 4R2BA 5DTBA 2VOZA 1H43A 3HCQA 3C34A 1B7HA 4LQ2A 1FQCA 1RYXA 2PBWA 3PD9A 1EH3A 2LAOA 2B4MA 1I6BA 5L9MA 3TODA 3OMBA 2H5YA 1FTMA 4DCYA 1B7UA 4ISUA 1P99A 1SQYA 2HZKA 3IB2A 2P2AA 3FV2A 1SVXB 3HSTA 2DVCA 2AL4A 5DEXA 1PB8A 2OCUA 4WKMA 2XXVA 4QFLA 1A54A 4I62A 1NFTA 1FW0A 2Y7PA 1LBBA 3V5AA 3QSLA 4U2RA 1B52A 1LAGE 3DP8A 4ELOA 4IY5A 1P1OA 1VR5A 4EXLA 3FATA 4H8JA 1LAXA 3C9HA 4ELQA 4NWDA 4BDMA 1FTJA 1SD3A 5AA4A 1MY1A 3IOTA 1SW1A 2F5XA 5H8HB 3K1MA 4OHNA 5CMCA 3UA8A 3PPRA 1TWYA 3THIA 4Q8RA 2O69A 5HPQA 3ODBA 5K2XA 3O66A 4ZEKA 3T22A 3PPPA 3U1OA 3ZKLA 3P7IA 1MQGA 2XXPA 3EQ1A 2R6GE 5L9OA 2XX9A 4ZEBA 4O3BA 3FZVA 2HAVA 2Y84A 1R6ZA 4KYDA 5J1DA 3N26A 2PX1A 4F1UA 1S9TA 1PB7A 2Y7KA 3S4UA 2F7BA 2DWJA 4RJZA 1MPDA 1MDP1 1SYIA 4LONB 3OEKA 3U72A 3DRIA 1XS5A 2Q2CA 1UTBA 3CSGA 3DP6A 3T93B 5ITPA 1O64A 2Q8JA 1FQDA 4WEPA 4ONYA 1VFDA 1N3WA 2XXUA 1OQGA 4QFOA 1H3DA 5EHMA 4EQ9A 1M5EA 3H06B 4NF5B 2F6GA 5AA1A 3KJ7A 2Z8FA 4R6YA 1Q35A 4XIGQ 4QRZA 4ZDMA 3BKIB 1POTA 3HHFA 3DRHA 4GLIA 3MVYA 4G8NA 3RY3A 5I57B 3VE1B 3DM0A 3PPQA 1YTVA 2B65A 4G68C 4JBZA 4YU0A 1US4A 1XVXA 4NF6A 1MXUA 1XHYA 5H8NB 1FTOA 2F97A 4OWDA 1HSJA 4JDFA 2DE2A 4U1OA 3FD3A 4G77A 4MLQA 1R1NA 2QS1A 4GRKA 4ZE8A 5B7DA 3VV5A 4EXKA 4PFWA 3OD7A 3OO8A 4R2FA 2OZZA 4BDRA 4O3AA 2HAUA 1BLFA 4UACA 3MZ9A 2QSXA 3K6UA 3BBRA 4JXIA 4RXLA 5ELVA 1NNKA 1OVTA 1MPCA 2BJJX 2VGQA 5H8QB 2XXIA 1DMBA 4H65A 2ABHA 1CB6A 4NMYA 4YB7A 2VD3A 1SW4A 1TFAA 3JV9A 3MP1A 1ZTYA 3U93A 3DLNA 4N6PA 3PV0E 1URGA 1Y4CA 3MJNA 2V93A 3FASA 3D4GA 3KGCA 3CR9A 2QS4A 5DT6A 3H6WA 1USYE 1LLSA 3IB0A 4OYVA 2DE3A 2QMWA 2UXAA 4KHZE 2CMOA 3TEPA 4LZ7A 2DE4A 4H6DA 3KSJA 1SDXA 2VD2A 3FIRA 4F22A 1Y1MA 5I56A 4F18A 5CBSA 3B6QA 2RCBA 4WXJA 1Y3QA 1II5A 3H4ZA 3DP4A 4ELPA 4GXSB 2F7AA 3UN6A 1ELJA 1A8FA 1B1HA 3TDJA 1ZLQA 4YKJA 3OENA 3MAMA 5EHSA 1URSA 1M5FA 3QXMA 1IXGA 3PMVA 1A55A 3UIFA 2I3VA 4ZZAA 3KOSA 3M3LA 4F1YA 3LSFB 2D5WA 3W15C 2I49A 1DPEA 2QMXA 1NKXA 4LP2B 4H0WA 4F3BA 2UYFA 1B40A 4BLAA 2QS3A 3H3GA 3OO9A 4KPTA 3TQWA 1B3EA 1YCJA 1ZKBA 3O28A 4H1XA 5HM4B 4H67A 4DE8A 3E3KA 4OFOA 3PMXA 4G68A 4ZEIA 1B3FA 3G3FA 3G3JA 4GL0A 2PYYA 4JWOA 3QUFA 4IO2A 5F1QA 3T96B 5CC2A 3W9WA 2UVHA 2G29A 2XD3A 4OEUA 1IXCA 5DEXB 3H6UA 3Q25A 3U92A 1MY2A 5CI5A 3PUYE 5I2KA 5I59A 1DSNA 1QVSA 5BWJA 4NE4A 4F1VA 2F6PA 3MZBA 4G4PA 4AQ4A 3OXNA 1QJMA 2XXHA 3VXCA 1SYHA 4UA8A 5AA4B 3KFMA 2ZNTA 3M3FA 1KWHA 1B7ZA 4P0GA 3BFUA 4IO5A 3LC8A 1YAEA 4XKPA 3K6WA 3G3GA 3PU5A 3SDFA 4U1ZA 2E1SA 1R9LA 1IITA 2DWIA 2XXTA 3L6GA 2DP8A 4HS7A 4R6KA 4DXBA 1NMUA 4AB5A 4KI0E 4EDPA 2W7YA 2QJEA 2OBGA 4BDQA 4F31B 2FYIA 2CZLA 4P0IA 3CHGA 2DWHA 4M4GA 1Q1KA 1JEVA 3U94A 1LAFE 3QIMA 3TTMA 5I58A 4PFUA 1SBPA 3FVNA 1N84A 3CIJA 2GHBA 4R9FA 4U23A 3O29A 4IO6A 2VHAA 5M2VA 1JEUA 4OQOA 4MLVA 3TCHA 1B05A 2GRVA 1IXIA 4F2QA 1LAHE 3SESA 4ZE9A 1JW4A 3DRFA 3TPAA 5I84A 1Y4TA 3RTWB 4QFKA 3GBBA 4NF6B 3TELA 1OIBA 4FE8A 3RQTA 5AA3A 5KCJA 4YKKA 2XXRA 2XXWA 1BP5A 3A3CA 1IEJA 2ESNA 2R71A 2ANJA 4GF8A 4DLDA 2PT2A 4IO3A 4X1DA 4ND9A 2VP1A 4RK9A 4JSOA 1FTKA 3KN7A 4QSCA 2DS9A 3LSWA 3CVGA 3FXUA 3CFZA 3PUXE 4F29A 5H8SA 1NNFA 1GGGA 5ICQA 4R9GA 2WOLA 4GOTA 1O63A 5FTIA 2IEEA 1MQDA 5AA2A 1VSOA 5LOMA 1H76A 1XOCA 4XKQA 5DVIA 1ZMGA 1VE4A 4XTCQ 3IOWA 4G8HA 4ELRA 3PUZE 1JQFA 1B46A 4I8CA 2P0SA 2D3IA 1YPNA 1MG1A 2F35A 3KG2A 3TTKA 3VVDA 4ESXA 3O6IA 1BTJA 1MY0A 2HQ0A 2ZYOA 3H7MA 2RC8A 1AMFA 2XX7A 3EHTA 3ECRA 1XVYA 3KZGA 4HCYA 4YZZA 1QKBA 4ECFA 2UVIA 3U8QA 1MXVA 2XX8A 4MF3A 5I56B 2B4LA 1RYOA 3ZKKA 2B3FA 1I6QA 1F9BA 2REJA 2QS2A 2A5SA 3FGSA 4XKNA 1PBPA 3TTLA 4MH5A 3T9XB 2HEUA 4E0XA 3C33A 4I1DA 3CRBA 5IAIA 5JK4A 1UIUA 3DRGA 1MH3A 3RYBA 3RLFE 3CSBA 3KN3A 5I2NA 2XXQA 4OTEA 2O7IA 1JW1A 1SI0A 2FA7A 3VLVA 3MC2A 4IO7A 1N0TA 4BDLA 4PFTA 1N7WA 1SW5A 3PUVE 4M1VA 2ZNSA 2UYEA 2THIA 2DOJA 4TOZA 3M3KA 2WKYA 4FECA 4LQ5A 2I0BA 3RNNA 4LATA 1B2HA 3TFLA 1LSTA 3PPOA 1WDNA 2ONSA 3IX1A 1PBQA 4G68B 2OK2A 3FVKA 1GVCA 2DQVA 3TMGA 3TAJA 2YJPA 4ZECA 2ZMBA 3PAMA 1MPBA 3V83A 4R75A 1A40A 1B0HA 4OZ9A 1GTKA 5I2KB 3B6TA 5I59B 1AL3A 5TP9A 2G93A 2F7CA 5TU0A 1ZJLA 3FV1A 1LB9A 3DRJA 4GXAA 4QHQA 1B4HA 4R74A 1WVJA 3ILUB 1MDQA 1A7LA 3LUYA 3QYTA 4WEDA 3A09A 1ZBMA 5JTYB 2I6EA 4DDDA 3PGFA 4P11A 5L9SA 3N6UA 3F11A 4LZ5A 3K02A 4NF8B 1P1QA 4E0WA 1ZIUA 3N5LA 3EN3A 1B3LA 3G3KA 4TLLB 2H4IA 3KSXA 3C4MA 4YICA 1Y9UA 4GQOA 3MUQA 1NH8A 3ILTB 3OSQA 3O6PA 3Q27A 3SEVA 2KLFA 1Y1ZA 1D3KA 2O6AA 1P1WA 2F78A 1QKAA 3TCGA 4G2ZA 4F19A 2WOKA 5I58B 2RKMA 3FVOA 1EZOA 1EZPA 3K4UA 3GLBA 3TQLA 1IQ7A 4K3FA 1M5BA 1NH7A 1OVBA 3CFXA 3FXRA 3T66A 4R72A 3VXBA 5L8DA 4OVJA 2YPNA 2Z8DA 3RPWA 3G3IA 3O2AA 3LR1A 5CMBA 1VFEA 1ANFA 1B5HA 4R6HA 2D21A 1I69A 3IK6B 3L6HA 3WAFA 4KD5A 2Y7RA 4H5GA 4ZS9A 1LB8A 2PT1A 4FIMA 1MXYA 3O97A 4KYEA 3IO6A 3TTNA 1B6HA 2Q2AA 4MFIA 2WOPA 4EF2A 3PUWE 4EF1A 1FQEA 5KCJB 1B58A 3IAZA 1P1UA 1UIVA 3RN8A 2NVUB 4QFNA 3TKDA 1B4ZA 2RCAA 2Q9TA 1R9QA 4PQJA 4KFQA 5CRYA 1FTLA 4C0RA 4OETA 3S9EA 2NOOA 3CG3A
chains in the Genus database with same CATH superfamily
4YKPA 2RC9A 2B3BA 3OO6A 2OLBA 3E79A 3FVGA 3OOAA 1N3XA 3MVWA 1MXWA 1MXZA 1LBCA 2DYXA 2H25A 1NL5A 5AA2B 3G3HA 4MBPA 5B70A 4EQ7A 3TYHA 3KJTA 3RPLA 2ZYKA 4DXCA 2Q8MA 5LTCA 5JTYA 4R73A 4EQBA 3K1PA 4YMAA 4THIA 4Q5TA 2AYSA 2I4CA 1BKAA 4NF8A 3K01A 4IGRA 1YXIA 4NTLA 1B51A 3EHUA 2YLNA 3E9XA 3AXFA 2XXYA 4YMBA 1MM7A 4NN3A 1GV8A 1SI1A 3RYAA 4GFRA 5FHOA 4DI4B 4F3GA 1GR2A 1NNTA 2I48A 5TPAA 2HFBA 1DTGA 2I58A 4YB5A 4HCWA 4JVIA 1TT1A 1JP4A 2RC7A 4POWA 1Y3NA 4N13A 2DSFA 1A99A 1PB9A 2Z22A 3IOVA 3MPLA 5I7IA 4RPNA 1URDA 1FPBA 3I3VA 1Y20A 2O1LA 4QSDA 3SEWA 1LFHA 3FJ7A 1M5DA 4H5FA 3FJGA 1MY3A 5ET8A 4O7IA 2M8CA 4PE5B 1D9VA 2WYKA 2F36A 4OFLA 2OWTA 3FJMA 1JETA 4MCOA 3IR1A 5DYHA 1INPA 2H9BA 3IB1A 1UTHA 1TFDA 3H6TA 5I2NB 4FORA 3OEMA 1US5A 5KDTA 3V8XB 1S7YA 3Q28A 5DVJA 5HBCA 2CZKA 3S9NC 3MQ9A 2V3UA 1NV6A 3N6TA 1H45A 3IOUA 5CBRA 3O9PA 1JW5A 5K2YA 3U65A 4Q30B 3IFAA 4PP0A 1M5CA 5IKBA 4GWOA 3USDA 3SETA 4OVQA 4MJOA 2Z8EA 4YAHX 4KCDA 2E0SA 3K6XA 5A5XB 1N7XA 1Z7NE 3KN8A 2F34A 4PFRA 3IJXB 2O84X 2ZYNA 3GZGA 2AL5A 1AWBA 3CI8A 1MQIA 3MW0A 1QUIA 3K6VA 1OLAA 3DELB 3C31A 3VVEA 3T9HB 4OVPA 1B5JA 1TXFA 4G8MA 3RUMA 4GD5A 2P1SA 5AE4A 4RY1A 4PBHA 4P47A 1LEVA 1Y3PA 2A5TA 2ONRA 2DXYA 2F8DA 1P1NA 1BIYA 3VLWA 3E13X 1NNPA 5TP9B 1LCTA 4KCCA 1EYIA 1MY4A 1USYH 4IB2A 5LDZA 4KXPA 2Y7IA 4FAJA 3KC1A 3A3UA 3EHSA 4PC9A 1QUJA 3DRKA 3Q29A 1B9JA 4DIGA 2I0CA 1WODA 3IFCA 1MXXA 4GL8A 4U21A 3HHGA 4X48A 2I4BA 3I6VA 4RPOA 4PBQA 4OA4A 4F3SA 2HCAA 4N07A 2XXKA 3H6VA 1O7TA 1FBHA 1MM6A 5FTHA 2QRYA 5IZZA 4X9TA 3GXAA 2P3NA 3KEIA 5KZTA 1FBFA 2VPNA 1ATGA 4F3PA 5ITOA 5H8FA 1FQAA 4EUOA 2RINA 3BIGA 2I3WA 3MBPA 4DZ1A 3JYRA 2DXRA 3VVFA 1EZ9A 1IZ1A 4ZZEA 4NG7A 2X7QA 3LSLA 3UORA 1AOVA 1HSLA 1HSEA 3CG1A 4N6KA 1IXHA 4POXA 3S9MC 5CM6A 4NF4A 1MQJA 2NWJA 5CMMA 1SPIA 4NGUA 3MP8A 3HPIA 1B0LA 5I5PA 1RDYA 3RT6B 2ALUA 2PMSA 3O6GA 4JSDA 5A5XA 1NUWA 4AS5A 1J1NA 2X7PA 4ZEFA 2OWSA 1IMDA 3K00A 2OJTA 4QF9A 3N94A 1DBZA 3SKPA 1SW2A 2PVUA 1JVXA 3K0VA 3C35A 1FPJA 2XA5A 3W9VA 2BJIA 3TTRA 1EU8A 1KA0A 1FCKA 5CMKA 1XC1A 2Q89A 1LGBC 4NWCA 1D9QA 1MRPA 4XKRA 4LUBA 4FEBA 3R7XA 4X8RA 5FHNA 3T9UA 4O3CA 1QULA 4P1EA 2X26A 3D1RA 3R6UA 1B3HA 4ZEDA 4C1TA 1OMPA 3QAXA 2V3QA 4DXUA 4QFPA 2XXXA 1AIVA 1IMBA 4LA9A 3SEYA 4O7MA 1N04A 4GVOA 5H8HA 1B1XA 2GFEA 4IGTA 4OXVA 1VDWA 1S50A 4HTGA 4G61A 4KQPA 3JZJA 1FPKA 2O51A 2GHAA 3VFJA 3RPLB 1RKMA 4TQUQ 4Q0CA 4OMBA 3FUZA 5ICTA 3I5OA 2CZHA 3HN0A 4HE1A 3KOTA 3MPKA 4RNSA 4DCXA 5EQAA 4OENA 3M8UA 2ONKE 5DVFA 1BK4A 4PFBA 4H8IA 1I6AA 3TZAA 3ZSFA 2XWKA 3HO7A 1MQHA 3SEUA 4RK2A 1QW0A 4L17A 2ZXTA 1IMFA 2O7UA 1NV3A 4IO4A 3PPNA 5TPAB 5ET7A 3E4RA 1YYZA 3K1NA 1DOTA 4OFJA 2Z23A 1LCFA 1FBEA 3OELA 2NUVA 4F2OA 2IA4A 3MZ1A 5JEIA 2HXWA 4GWXA 3MVZA 3VLUA 4FJPA 3RGYA 3KBRA 2Q88A 1DTZA 1Z7ME 4NF5A 5DW8A 2XD2A 5BUUA 3Q26A 3MP6A 1ZU0A 1DPPA 3BFTA 4QSEA 4KR5A 2NXOA 4X1BA 2R9JA 3G7WA 1FQBA 2Y7WA 3S9LC 1FBPA 1MS7A 1MH4A 5I57A 2KQZA 1QGXA 1FJ6A 3RT8A 1UTHB 4P56A 2DVZA 1QUKA 2V3TA 5EYFA 5KDTB 1T0KA 2UVJA 1L5TA 5H8NA 1IIWA 1JNFA 5AA2D 5IZ3A 3B7DA 2GH9A 4F39A 3MWBA 2AIXA 1OQHA 3FTOA 5ISUA 4OESA 4AB6A 2V84A 3SEXA 2VT5A 1NV0A 4H45A 1IUDA 1D9YA 3UGWA 4KYSA 3RTFB 2DWAA 3LSXA 3V89B 1D4NA 2FNCA 3IO4A 4BDOA 3IL1B 3PMWA 2WBBA 3CFLA 1B5IA 4MIJA 5H8QA 3T9VA 1LFIA 4HW8A 3SERA 1JVYA 3ONMA 4XF5A 4FEDA 1XI6A 4OERA 4LVQA 5IGAA 1A8EA 4YB6A 4OEVA 1B32A 4U4XA 1KZ8A 4O8MA 3LBSA 3OO7A 4GWZA 2H99A 4MMPA 1PC3A 2O68A 2A5TB 3B6WA 3IORA 3ZS6A 4PTKA 3D4CA 4IY6A 1LFGA 1N76A 4U4SA 2QL3A 3T1BA 3MVXA 3GYYA 3TCFA 3HV1A 3H03A 4GIZA 2V25A 4PETA 2H98A 4LZ8A 3C36A 5ET6A 3LVUA 3ROJA 4ESWA 4RYAA 5F24A 4C1UA 4RA1A 4U22A 2QPQA 1FBDA 1PEBA 2RF1A 5FHMA 4IR8A 4Z0IA 1PDAA 1B3GA 1POY1 4BDNA 1UQWA 2REGA 4JWXA 3IJOB 3R26A 3QUJA 3EPEA 4OVRA 2XHDA 3WAEA 1H44A 3S2VA 1OLCA 4P3LA 1XT8A 1CE2A 2HZLA 2ZYMA 4NEDA 3UP9A 3VDFA 4JB7A 2ZNUA 4YKIA 1IMCA 1FJ9A 1FQFA 3PD8A 2UVGA 4I9DA 5F7VA 4XXUA 3K2DA 5H8FB 4MNPA 3UK4A 4PE3A 4JWYA 3FXQA 1UTBB 4PGPA 2ZZXA 1AH5A 3GBAA 3TUSA 4FATA 2O1MA 3QK6A 3O6HA 4MAGA 4Z7EA 2PFYA 3C32A 3OSRA 4TLMB 1LBXA 3EF7A 2CEYA 4NF4B 4PFYA 2FHYA 4R2BA 5DTBA 2VOZA 1H43A 3HCQA 3C34A 1B7HA 4LQ2A 2WX9A 1FQCA 2QVUA 4O94A 1RYXA 2PBWA 3PD9A 1EH3A 5EQ8A 2XWOA 2LAOA 3A29A 2B4MA 1I6BA 5L9MA 3TODA 3OMBA 2H5YA 1FTMA 2HPGA 4DCYA 1B7UA 4H46A 4ISUA 1P99A 1SQYA 2HZKA 3IB2A 2P2AA 3FV2A 1SVXB 3HSTA 2DVCA 2AL4A 5DEXA 1PB8A 2OCUA 4WKMA 4PF6A 2XXVA 4QFLA 1A54A 4I62A 1NFTA 1FW0A 2Y7PA 1LBBA 4N91A 3V5AA 3QSLA 2HXRA 4U2RA 1B52A 1LAGE 3DP8A 4ELOA 2ZZVA 4IY5A 4MX6A 1P1OA 1VR5A 4EXLA 3FATA 4H8JA 1LAXA 2OWZA 3C9HA 4ELQA 4NWDA 4BDMA 1FTJA 1SD3A 5AA4A 2Y5LA 1MY1A 3IOTA 1SW1A 2F5XA 1NUZA 3LV0A 5H8HB 3K1MA 4OHNA 5CMCA 4GWSA 1K9ZA 3UA8A 3PPRA 1TWYA 3THIA 4Q8RA 2O69A 5HPQA 3ODBA 5K2XA 3O66A 4ZEKA 5T3JA 3PPPA 3T22A 3U1OA 3P7IA 3ZKLA 1IMEA 1MQGA 5IM2A 2XXPA 3EQ1A 2R6GE 4UABA 5L9OA 2XX9A 4ZEBA 4O3BA 3FZVA 2JJKA 2HAVA 2Y84A 1R6ZA 4KYDA 5J1DA 3N26A 2PX1A 4F1UA 1S9TA 1PB7A 2Y7KA 3S4UA 2F7BA 3BIHA 2DWJA 4RJZA 4PAIA 1MPDA 1MDP1 1SYIA 4LONB 3OEKA 3U72A 3DRIA 1XS5A 2Q2CA 1UTBA 3CSGA 3DP6A 3T93B 5ITPA 1O64A 2Q8JA 1FQDA 4WEPA 4ONYA 1VFDA 1N3WA 2XXUA 1OQGA 4QFOA 1H3DA 5EHMA 4EQ9A 1M5EA 3H06B 4NF5B 2F6GA 5AA1A 3KJ7A 2Z8FA 4R6YA 1Q35A 4XIGQ 4QRZA 4ZDMA 3BKIB 1POTA 3HHFA 3DRHA 5EQ7A 4GLIA 3MVYA 4G8NA 3RY3A 5I57B 3VE1B 3DM0A 3QMFA 3PPQA 1YTVA 2B65A 4G68C 4JBZA 4YU0A 1US4A 5ESYA 1XVXA 4NF6A 5FBPA 1MXUA 1XHYA 4OVSA 5H8NB 1FTOA 2F97A 1LBVA 4OWDA 1HSJA 4JDFA 5IZ3B 2DE2A 4U1OA 3FD3A 4G77A 3FXBA 4N17A 4MLQA 1R1NA 2QS1A 4GRKA 4ZE8A 5B7DA 3VV5A 4EXKA 4PFWA 3OD7A 2PFZA 3OO8A 4R2FA 3T0JA 2OZZA 4BDRA 2DDKA 4O3AA 2HAUA 1BLFA 4UACA 3MZ9A 2QSXA 2QFLA 2FBPA 3K6UA 3BBRA 1G0HA 4JXIA 4RXLA 5ELVA 1NNKA 1Q9DA 1OVTA 1MPCA 2BJJX 1FRPA 2VGQA 3MSTA 5H8QB 2XXIA 4I3YA 1DMBA 4H65A 2ABHA 1CB6A 4NMYA 4YB7A 2VD3A 1SW4A 1TFAA 4MNCA 3JV9A 3MP1A 3E78A 4OANA 5I3SA 1ZTYA 3U93A 3DLNA 1RDXA 4N6PA 3PV0E 1URGA 1Y4CA 3MJNA 2V93A 4PDDA 3FASA 3D4GA 3KGCA 3CR9A 2QS4A 5DT6A 3NOHA 3H6WA 1USYE 1LLSA 3IB0A 4OYVA 2DE3A 2QMWA 1FBCA 2UXAA 4KHZE 2CMOA 3TEPA 3RYDA 4LZ7A 2DE4A 4H6DA 3KSJA 1SDXA 2VD2A 3FIRA 4F22A 1Y1MA 5I56A 4F18A 2CZIA 5CBSA 3B6QA 2RCBA 4WXJA 1Y3QA 1II5A 3H4ZA 3DP4A 4ELPA 4GXSB 1NI9A 2QVRA 2F7AA 3UN6A 1ELJA 1A8FA 1B1HA 3TDJA 1ZLQA 4YKJA 3OENA 3MAMA 5EHSA 1NV1A 1URSA 4N8YA 1M5FA 3QXMA 1IXGA 3PMVA 1A55A 5ET5A 1CNQA 3UIFA 2I3VA 4GWUA 4ZZAA 3KOSA 3M3LA 4F1YA 3LSFB 2D5WA 4MEVA 3W15C 2I49A 1DPEA 2QMXA 1NKXA 4LP2B 4H0WA 4F3BA 4PDHA 2UYFA 1B40A 4BLAA 2QS3A 1FPGA 3H3GA 3OO9A 4KPTA 4HXVA 3TQWA 1B3EA 1YCJA 1ZKBA 1LBWA 3O28A 4H1XA 5HM4B 4H67A 4DE8A 3E3KA 4OFOA 3PMXA 4G68A 4ZEIA 1B3FA 3G3FA 2FVZA 3G3JA 4GL0A 2PYYA 4JWOA 3QUFA 4GBWA 4IO2A 5F1QA 3T96B 5CC2A 4QBAA 3W9WA 2UVHA 4LN5A 2G29A 1LBZA 2XD3A 1YZ0A 4OEUA 1IXCA 5DEXB 3H6UA 1FPEA 3Q25A 3U92A 1K9YA 1MY2A 5CI5A 3PUYE 5I2KA 5I59A 1DSNA 4HE2A 1QVSA 5BWJA 4NE4A 4F1VA 2F6PA 3MZBA 4G4PA 4AQ4A 3B8BA 3OXNA 3FBPA 5IZ1A 1QJMA 2XXHA 3VXCA 1SYHA 4UA8A 4N6DA 5AA4B 1NV5A 3KFMA 4PFIA 2OX3A 2ZNTA 4X04A 3M3FA 4XFEA 1KWHA 2MKZA 1B7ZA 4P0GA 3BFUA 4IO5A 3LC8A 1YAEA 3LUZA 4XKPA 3K6WA 3G3GA 3PU5A 3SDFA 4U1ZA 2E1SA 1R9LA 1IITA 2DWIA 2XXTA 3L6GA 2DP8A 4HS7A 4R6KA 4N8GA 4DXBA 1NMUA 4AB5A 4KI0E 4EDPA 2W7YA 2QJEA 4GWYA 2OBGA 4BDQA 4F31B 1FBGA 2FYIA 2CZLA 4JVDA 2V4CA 4P0IA 3CHGA 2DWHA 2F3DA 4M4GA 1Q1KA 1JEVA 3U94A 1LAFE 3QIMA 3TTMA 5I58A 4PFUA 1SBPA 3FVNA 1LBYA 3KBZA 1N84A 3CIJA 2GHBA 4R9FA 4HE0A 4U23A 3O29A 4IO6A 2VHAA 5M2VA 1JEUA 4OQOA 2WYPA 4NQ8A 4MLVA 3TCHA 1EYJA 1B05A 2GRVA 1IXIA 4F2QA 1LAHE 3SESA 4ZE9A 1JW4A 1DK4A 3DRFA 2Q74A 3TPAA 4JVCA 5I84A 4NAPA 1Y4TA 1NUXA 3RTWB 4QFKA 3GBBA 4NF6B 3TELA 1OIBA 4FE8A 3RQTA 5AA3A 5KCJA 4NHBA 4YKKA 2XXRA 2XXWA 1BP5A 1FTAA 3A3CA 1IEJA 2ESNA 2R71A 2ANJA 1NV4A 4GF8A 4DLDA 2VPOA 2PT2A 2WBDA 4IO3A 2HHMA 4X1DA 4ND9A 2VP1A 4RK9A 4JSOA 1FTKA 3KN7A 4QSCA 3KC0A 2DS9A 3LSWA 3CVGA 3FXUA 3CFZA 3PUXE 4F29A 5H8SA 1NNFA 1GGGA 5ICQA 4R9GA 2WOLA 2CEXA 4GOTA 1O63A 5FTIA 2IEEA 1MQDA 5AA2A 5EYHA 1VSOA 5LOMA 1H76A 1XOCA 4N81A 4XKQA 5DVIA 1ZMGA 1VE4A 4XTCQ 4GWWA 3IOWA 4G8HA 4ELRA 3PUZE 1JQFA 1B46A 4I8CA 2P0SA 2D3IA 1YPNA 1MG1A 2F35A 4GX3A 3KG2A 3TTKA 3VVDA 4ESXA 4PAKA 3O6IA 1BTJA 1MY0A 2HQ0A 2ZYOA 2F3BA 3H7MA 2RC8A 1AMFA 2XX7A 3EHTA 3ECRA 1XVYA 4PAFA 3KZGA 4HCYA 4P9KA 4YZZA 1QKBA 1FPFA 4ECFA 2WEFA 1FPIA 2UVIA 3U8QA 4MNIA 1MXVA 2XX8A 4MF3A 5I56B 2B4LA 4P1LA 1RYOA 3ZKKA 2B3FA 1NUYA 1I6QA 4PCDA 1F9BA 2Y5KA 2REJA 2QS2A 1FPDA 2A5SA 3FGSA 4XKNA 1PBPA 1NV2A 3TTLA 4MH5A 3T9XB 2HEUA 4E0XA 4N15A 3C33A 4I1DA 3CRBA 5IAIA 4P8BA 1UIUA 5JK4A 4NF0A 3DRGA 1MH3A 3RYBA 3RLFE 3CSBA 3KN3A 5I2NA 4OTEA 2XXQA 2O7IA 1JW1A 1SI0A 2FA7A 3VLVA 3MC2A 4IO7A 1N0TA 4I3EA 4BDLA 4PFTA 5EYGA 1N7WA 1SW5A 2XWIA 3PUVE 4M1VA 2ZNSA 4PGNA 1FPLA 2UYEA 2THIA 2DOJA 4MHFA 4TOZA 3ISPA 1G0IA 3M3KA 2WKYA 4FECA 4LQ5A 2I0BA 3RNNA 4LATA 1B2HA 3TFLA 1LSTA 3PPOA 1WDNA 2L5VA 2ONSA 3IX1A 1PBQA 2KR0A 4G68B 2OK2A 1NV7A 4I40A 3FVKA 1GVCA 2DQVA 3TMGA 3TAJA 4AS4A 2YJPA 4NX1A 4ZECA 2ZMBA 3PAMA 4N4UA 1KA1A 1MPBA 3V83A 4R75A 1A40A 1B0HA 4OZ9A 4QXDA 1GTKA 2XWVA 5I2KB 3B6TA 5I59B 1AL3A 5TP9A 2R8TA 4OVTA 3PTYA 2G93A 2F7CA 4GX4A 5TU0A 1ZJLA 3FV1A 1LB9A 3DRJA 4GXAA 4QHQA 1B4HA 4R74A 1WVJA 3ILUB 1MDQA 1A7LA 3LUYA 3QYTA 4GBVA 4WEDA 3A09A 1ZBMA 1FSAA 2I6EA 5JTYB 4DDDA 3HFUA 3PGFA 4P11A 5L9SA 3N6UA 3F11A 4LZ5A 3K02A 4NF8B 4PF8A 1P1QA 4E0WA 1ZIUA 3N5LA 3EN3A 1B3LA 3G3KA 4TLLB 2H4IA 3EKIA 3KSXA 3C4MA 4YICA 1Y9UA 1DCUA 4GQOA 3MUQA 4XEQA 1NH8A 3ILTB 3OSQA 3O6PA 3Q27A 3SEVA 2KLFA 1Y1ZA 1D3KA 1EYKA 2O6AA 1P1WA 2F78A 1QKAA 3TCGA 4G2ZA 4F19A 2WOKA 5I58B 2RKMA 3FVOA 1EZOA 5J16A 1EZPA 3K4UA 3GLBA 3TQLA 1IQ7A 2FIEA 5EQ9A 4K3FA 1M5BA 1NH7A 1OVBA 3CFXA 3FXRA 3T66A 4R72A 3B50A 3VXBA 5L8DA 4OVJA 2YPNA 2Z8DA 3RPWA 2PCRA 3G3IA 3O2AA 3LR1A 5CMBA 1VFEA 1ANFA 1B5HA 4R6HA 2D21A 1I69A 4FBPA 3IK6B 3L6HA 3WAFA 4KD5A 4GX6A 2Y7RA 4H5GA 4ZS9A 1LB8A 3MYUA 3SZPA 2PT1A 4FIMA 1MXYA 2ZZWA 3O97A 4KYEA 3IO6A 3TTNA 1B6HA 2Q2AA 4MFIA 5A5LA 2WOPA 4EF2A 3PUWE 4EF1A 1FQEA 5KCJB 1B58A 3IAZA 1P1UA 1UIVA 1RDZA 3RN8A 2NVUB 2QVVA 4QFNA 3TKDA 1B4ZA 2RCAA 2Q9TA 1R9QA 4PQJA 4DI3D 4KFQA 5CRYA 2P3VA 1IMAA 1FTLA 4C0RA 4OETA 3S9EA 2NOOA 3CG3A 2FIXA 2GQ1A
chains in the Genus database with same CATH topology
4YKPA 2RC9A 2B3BA 3OO6A 2OLBA 3FVGA 3OOAA 1N3XA 3MVWA 1MXWA 1MXZA 1LBCA 2DYXA 2H25A 1NL5A 5AA2B 3G3HA 4MBPA 5B70A 4EQ7A 3TYHA 3KJTA 2ZYKA 4DXCA 5JTYA 4R73A 4EQBA 3K1PA 4YMAA 4THIA 4Q5TA 2AYSA 2I4CA 1BKAA 4NF8A 3K01A 4IGRA 4NTLA 1B51A 3EHUA 2YLNA 3E9XA 3AXFA 2XXYA 4YMBA 1MM7A 1GV8A 1SI1A 3RYAA 4GFRA 5FHOA 4F3GA 1GR2A 1NNTA 2I48A 5TPAA 2HFBA 1DTGA 2I58A 4YB5A 4HCWA 1TT1A 2RC7A 4POWA 1Y3NA 4N13A 2DSFA 1A99A 1PB9A 2Z22A 3IOVA 3MPLA 4RPNA 1URDA 3I3VA 1Y20A 2O1LA 4QSDA 3SEWA 1LFHA 3FJ7A 1M5DA 4H5FA 3FJGA 1MY3A 2M8CA 4PE5B 1D9VA 2F36A 4OFLA 2OWTA 3FJMA 1JETA 3IR1A 5DYHA 2H9BA 3IB1A 1UTHA 1TFDA 3H6TA 5I2NB 4FORA 3OEMA 1US5A 5KDTA 3V8XB 1S7YA 3Q28A 5DVJA 5HBCA 3S9NC 3MQ9A 2V3UA 3N6TA 1H45A 3IOUA 5CBRA 3O9PA 1JW5A 5K2YA 4Q30B 4PP0A 1M5CA 5IKBA 4GWOA 3USDA 3SETA 2Z8EA 4YAHX 2E0SA 4KCDA 3K6XA 5A5XB 1N7XA 1Z7NE 3KN8A 2F34A 3IJXB 2O84X 2ZYNA 3GZGA 2AL5A 3CI8A 1MQIA 3MW0A 1QUIA 3K6VA 1OLAA 3DELB 3C31A 3VVEA 3T9HB 1B5JA 1TXFA 4G8MA 3RUMA 4GD5A 2P1SA 5AE4A 4RY1A 1Y3PA 2A5TA 2ONRA 2DXYA 2F8DA 1P1NA 1BIYA 3VLWA 3E13X 1NNPA 5TP9B 1LCTA 4KCCA 1MY4A 1USYH 4IB2A 2Y7IA 4FAJA 3A3UA 3EHSA 1QUJA 3DRKA 3Q29A 1B9JA 4DIGA 2I0CA 1WODA 1MXXA 4GL8A 4U21A 3HHGA 4X48A 2I4BA 3I6VA 4RPOA 4F3SA 2HCAA 4N07A 3H6VA 1O7TA 1MM6A 5FTHA 2QRYA 4X9TA 3GXAA 3KEIA 5KZTA 1ATGA 4F3PA 5ITOA 5H8FA 1FQAA 4EUOA 2RINA 2I3WA 3MBPA 4DZ1A 3JYRA 2DXRA 3VVFA 1EZ9A 1IZ1A 4ZZEA 2X7QA 3LSLA 3UORA 1AOVA 1HSLA 1HSEA 3CG1A 1IXHA 4POXA 3S9MC 5CM6A 4NF4A 1MQJA 2NWJA 5CMMA 3MP8A 3HPIA 1B0LA 3RT6B 2ALUA 2PMSA 3O6GA 4JSDA 5A5XA 1J1NA 2X7PA 4ZEFA 2OWSA 3K00A 2OJTA 4QF9A 3N94A 3SKPA 1SW2A 2PVUA 1JVXA 3K0VA 3C35A 3W9VA 3TTRA 1EU8A 1FCKA 5CMKA 1XC1A 2Q89A 1LGBC 4NWCA 1MRPA 4XKRA 4LUBA 4FEBA 3R7XA 5FHNA 3T9UA 4O3CA 1QULA 2X26A 3R6UA 1B3HA 4ZEDA 4C1TA 1OMPA 3QAXA 2V3QA 4DXUA 4QFPA 2XXXA 1AIVA 4LA9A 3SEYA 1N04A 4GVOA 5H8HA 1B1XA 2GFEA 4IGTA 4OXVA 1S50A 4HTGA 4KQPA 3JZJA 2O51A 2GHAA 3VFJA 1RKMA 4TQUQ 4Q0CA 4OMBA 3FUZA 5ICTA 3I5OA 3HN0A 3KOTA 3MPKA 4RNSA 4DCXA 4OENA 3M8UA 2ONKE 5DVFA 4H8IA 1I6AA 3TZAA 3ZSFA 3HO7A 1MQHA 3SEUA 4RK2A 1QW0A 4L17A 2ZXTA 2O7UA 4IO4A 3PPNA 5TPAB 3E4RA 3K1NA 1DOTA 4OFJA 2Z23A 1LCFA 3OELA 2NUVA 4F2OA 2IA4A 3MZ1A 5JEIA 2HXWA 3MVZA 3VLUA 4FJPA 3RGYA 3KBRA 2Q88A 1DTZA 1Z7ME 4NF5A 2XD2A 5BUUA 3Q26A 3MP6A 1ZU0A 1DPPA 3BFTA 4QSEA 4KR5A 2NXOA 4X1BA 2R9JA 3G7WA 1FQBA 2Y7WA 3S9LC 1MS7A 1MH4A 5I57A 3RT8A 1UTHB 2DVZA 1QUKA 2V3TA 5EYFA 5KDTB 1T0KA 2UVJA 1L5TA 5H8NA 1IIWA 1JNFA 5AA2D 3B7DA 2GH9A 4F39A 3MWBA 2AIXA 1OQHA 3FTOA 5ISUA 4OESA 4AB6A 2V84A 3SEXA 1IUDA 1D9YA 3UGWA 4KYSA 3RTFB 2DWAA 3LSXA 3V89B 1D4NA 2FNCA 3IO4A 4BDOA 3IL1B 3PMWA 3CFLA 1B5IA 5H8QA 3T9VA 1LFIA 4HW8A 3SERA 1JVYA 3ONMA 4FEDA 4OERA 4LVQA 1A8EA 4YB6A 4OEVA 1B32A 4U4XA 3LBSA 3OO7A 2H99A 1PC3A 2O68A 2A5TB 3B6WA 3IORA 3ZS6A 3D4CA 4IY6A 1LFGA 1N76A 4U4SA 2QL3A 3MVXA 3TCFA 3HV1A 3H03A 4GIZA 2V25A 4PETA 2H98A 4LZ8A 3C36A 3LVUA 4ESWA 4RYAA 4C1UA 4RA1A 4U22A 2QPQA 1PEBA 2RF1A 5FHMA 4Z0IA 1PDAA 1B3GA 1POY1 4BDNA 1UQWA 2REGA 4JWXA 3IJOB 3R26A 3QUJA 3EPEA 2XHDA 3WAEA 1H44A 3S2VA 1OLCA 1XT8A 1CE2A 2HZLA 2ZYMA 4NEDA 3UP9A 3VDFA 4JB7A 2ZNUA 4YKIA 1FQFA 3PD8A 2UVGA 4I9DA 5F7VA 4XXUA 3K2DA 5H8FB 3UK4A 4JWYA 3FXQA 1UTBB 1AH5A 3GBAA 3TUSA 4FATA 2O1MA 3QK6A 3O6HA 4Z7EA 3C32A 3OSRA 4TLMB 3EF7A 4NF4B 4PFYA 4R2BA 5DTBA 2VOZA 1H43A 3HCQA 3C34A 1B7HA 4LQ2A 1FQCA 1RYXA 2PBWA 3PD9A 1EH3A 2LAOA 2B4MA 1I6BA 5L9MA 3TODA 3OMBA 2H5YA 1FTMA 4DCYA 1B7UA 4ISUA 1P99A 1SQYA 2HZKA 3IB2A 2P2AA 3FV2A 1SVXB 3HSTA 2DVCA 2AL4A 5DEXA 1PB8A 2OCUA 4WKMA 2XXVA 4QFLA 1A54A 4I62A 1NFTA 1FW0A 2Y7PA 1LBBA 3V5AA 3QSLA 4U2RA 1B52A 1LAGE 3DP8A 4ELOA 4IY5A 1P1OA 1VR5A 4EXLA 3FATA 4H8JA 1LAXA 3C9HA 4ELQA 4NWDA 4BDMA 1FTJA 1SD3A 5AA4A 1MY1A 3IOTA 1SW1A 2F5XA 5H8HB 3K1MA 4OHNA 5CMCA 3UA8A 3PPRA 1TWYA 3THIA 4Q8RA 2O69A 5HPQA 3ODBA 5K2XA 3O66A 4ZEKA 3T22A 3PPPA 3U1OA 3ZKLA 3P7IA 1MQGA 2XXPA 3EQ1A 2R6GE 5L9OA 2XX9A 4ZEBA 4O3BA 3FZVA 2HAVA 2Y84A 1R6ZA 4KYDA 5J1DA 3N26A 2PX1A 4F1UA 1S9TA 1PB7A 2Y7KA 3S4UA 2F7BA 2DWJA 4RJZA 1MPDA 1MDP1 1SYIA 4LONB 3OEKA 3U72A 3DRIA 1XS5A 2Q2CA 1UTBA 3CSGA 3DP6A 3T93B 5ITPA 1O64A 2Q8JA 1FQDA 4WEPA 4ONYA 1VFDA 1N3WA 2XXUA 1OQGA 4QFOA 1H3DA 5EHMA 4EQ9A 1M5EA 3H06B 4NF5B 2F6GA 5AA1A 3KJ7A 2Z8FA 4R6YA 1Q35A 4XIGQ 4QRZA 4ZDMA 3BKIB 1POTA 3HHFA 3DRHA 4GLIA 3MVYA 4G8NA 3RY3A 5I57B 3VE1B 3DM0A 3PPQA 1YTVA 2B65A 4G68C 4JBZA 4YU0A 1US4A 1XVXA 4NF6A 1MXUA 1XHYA 5H8NB 1FTOA 2F97A 4OWDA 1HSJA 4JDFA 2DE2A 4U1OA 3FD3A 4G77A 4MLQA 1R1NA 2QS1A 4GRKA 4ZE8A 5B7DA 3VV5A 4EXKA 4PFWA 3OD7A 3OO8A 4R2FA 2OZZA 4BDRA 4O3AA 2HAUA 1BLFA 4UACA 3MZ9A 2QSXA 3K6UA 3BBRA 4JXIA 4RXLA 5ELVA 1NNKA 1OVTA 1MPCA 2BJJX 2VGQA 5H8QB 2XXIA 1DMBA 4H65A 2ABHA 1CB6A 4NMYA 4YB7A 2VD3A 1SW4A 1TFAA 3JV9A 3MP1A 1ZTYA 3U93A 3DLNA 4N6PA 3PV0E 1URGA 1Y4CA 3MJNA 2V93A 3FASA 3D4GA 3KGCA 3CR9A 2QS4A 5DT6A 3H6WA 1USYE 1LLSA 3IB0A 4OYVA 2DE3A 2QMWA 2UXAA 4KHZE 2CMOA 3TEPA 4LZ7A 2DE4A 4H6DA 3KSJA 1SDXA 2VD2A 3FIRA 4F22A 1Y1MA 5I56A 4F18A 5CBSA 3B6QA 2RCBA 4WXJA 1Y3QA 1II5A 3H4ZA 3DP4A 4ELPA 4GXSB 2F7AA 3UN6A 1ELJA 1A8FA 1B1HA 3TDJA 1ZLQA 4YKJA 3OENA 3MAMA 5EHSA 1URSA 1M5FA 3QXMA 1IXGA 3PMVA 1A55A 3UIFA 2I3VA 4ZZAA 3KOSA 3M3LA 4F1YA 3LSFB 2D5WA 3W15C 2I49A 1DPEA 2QMXA 1NKXA 4LP2B 4H0WA 4F3BA 2UYFA 1B40A 4BLAA 2QS3A 3H3GA 3OO9A 4KPTA 3TQWA 1B3EA 1YCJA 1ZKBA 3O28A 4H1XA 5HM4B 4H67A 4DE8A 3E3KA 4OFOA 3PMXA 4G68A 4ZEIA 1B3FA 3G3FA 3G3JA 4GL0A 2PYYA 4JWOA 3QUFA 4IO2A 5F1QA 3T96B 5CC2A 3W9WA 2UVHA 2G29A 2XD3A 4OEUA 1IXCA 5DEXB 3H6UA 3Q25A 3U92A 1MY2A 5CI5A 3PUYE 5I2KA 5I59A 1DSNA 1QVSA 5BWJA 4NE4A 4F1VA 2F6PA 3MZBA 4G4PA 4AQ4A 3OXNA 1QJMA 2XXHA 3VXCA 1SYHA 4UA8A 5AA4B 3KFMA 2ZNTA 3M3FA 1KWHA 1B7ZA 4P0GA 3BFUA 4IO5A 3LC8A 1YAEA 4XKPA 3K6WA 3G3GA 3PU5A 3SDFA 4U1ZA 2E1SA 1R9LA 1IITA 2DWIA 2XXTA 3L6GA 2DP8A 4HS7A 4R6KA 4DXBA 1NMUA 4AB5A 4KI0E 4EDPA 2W7YA 2QJEA 2OBGA 4BDQA 4F31B 2FYIA 2CZLA 4P0IA 3CHGA 2DWHA 4M4GA 1Q1KA 1JEVA 3U94A 1LAFE 3QIMA 3TTMA 5I58A 4PFUA 1SBPA 3FVNA 1N84A 3CIJA 2GHBA 4R9FA 4U23A 3O29A 4IO6A 2VHAA 5M2VA 1JEUA 4OQOA 4MLVA 3TCHA 1B05A 2GRVA 1IXIA 4F2QA 1LAHE 3SESA 4ZE9A 1JW4A 3DRFA 3TPAA 5I84A 1Y4TA 3RTWB 4QFKA 3GBBA 4NF6B 3TELA 1OIBA 4FE8A 3RQTA 5AA3A 5KCJA 4YKKA 2XXRA 2XXWA 1BP5A 3A3CA 1IEJA 2ESNA 2R71A 2ANJA 4GF8A 4DLDA 2PT2A 4IO3A 4X1DA 4ND9A 2VP1A 4RK9A 4JSOA 1FTKA 3KN7A 4QSCA 2DS9A 3LSWA 3CVGA 3FXUA 3CFZA 3PUXE 4F29A 5H8SA 1NNFA 1GGGA 5ICQA 4R9GA 2WOLA 4GOTA 1O63A 5FTIA 2IEEA 1MQDA 5AA2A 1VSOA 5LOMA 1H76A 1XOCA 4XKQA 5DVIA 1ZMGA 1VE4A 4XTCQ 3IOWA 4G8HA 4ELRA 3PUZE 1JQFA 1B46A 4I8CA 2P0SA 2D3IA 1YPNA 1MG1A 2F35A 3KG2A 3TTKA 3VVDA 4ESXA 3O6IA 1BTJA 1MY0A 2HQ0A 2ZYOA 3H7MA 2RC8A 1AMFA 2XX7A 3EHTA 3ECRA 1XVYA 3KZGA 4HCYA 4YZZA 1QKBA 4ECFA 2UVIA 3U8QA 1MXVA 2XX8A 4MF3A 5I56B 2B4LA 1RYOA 3ZKKA 2B3FA 1I6QA 1F9BA 2REJA 2QS2A 2A5SA 3FGSA 4XKNA 1PBPA 3TTLA 4MH5A 3T9XB 2HEUA 4E0XA 3C33A 4I1DA 3CRBA 5IAIA 5JK4A 1UIUA 3DRGA 1MH3A 3RYBA 3RLFE 3CSBA 3KN3A 5I2NA 2XXQA 4OTEA 2O7IA 1JW1A 1SI0A 2FA7A 3VLVA 3MC2A 4IO7A 1N0TA 4BDLA 4PFTA 1N7WA 1SW5A 3PUVE 4M1VA 2ZNSA 2UYEA 2THIA 2DOJA 4TOZA 3M3KA 2WKYA 4FECA 4LQ5A 2I0BA 3RNNA 4LATA 1B2HA 3TFLA 1LSTA 3PPOA 1WDNA 2ONSA 3IX1A 1PBQA 4G68B 2OK2A 3FVKA 1GVCA 2DQVA 3TMGA 3TAJA 2YJPA 4ZECA 2ZMBA 3PAMA 1MPBA 3V83A 4R75A 1A40A 1B0HA 4OZ9A 1GTKA 5I2KB 3B6TA 5I59B 1AL3A 5TP9A 2G93A 2F7CA 5TU0A 1ZJLA 3FV1A 1LB9A 3DRJA 4GXAA 4QHQA 1B4HA 4R74A 1WVJA 3ILUB 1MDQA 1A7LA 3LUYA 3QYTA 4WEDA 3A09A 1ZBMA 5JTYB 2I6EA 4DDDA 3PGFA 4P11A 5L9SA 3N6UA 3F11A 4LZ5A 3K02A 4NF8B 1P1QA 4E0WA 1ZIUA 3N5LA 3EN3A 1B3LA 3G3KA 4TLLB 2H4IA 3KSXA 3C4MA 4YICA 1Y9UA 4GQOA 3MUQA 1NH8A 3ILTB 3OSQA 3O6PA 3Q27A 3SEVA 2KLFA 1Y1ZA 1D3KA 2O6AA 1P1WA 2F78A 1QKAA 3TCGA 4G2ZA 4F19A 2WOKA 5I58B 2RKMA 3FVOA 1EZOA 1EZPA 3K4UA 3GLBA 3TQLA 1IQ7A 4K3FA 1M5BA 1NH7A 1OVBA 3CFXA 3FXRA 3T66A 4R72A 3VXBA 5L8DA 4OVJA 2YPNA 2Z8DA 3RPWA 3G3IA 3O2AA 3LR1A 5CMBA 1VFEA 1ANFA 1B5HA 4R6HA 2D21A 1I69A 3IK6B 3L6HA 3WAFA 4KD5A 2Y7RA 4H5GA 4ZS9A 1LB8A 2PT1A 4FIMA 1MXYA 3O97A 4KYEA 3IO6A 3TTNA 1B6HA 2Q2AA 4MFIA 2WOPA 4EF2A 3PUWE 4EF1A 1FQEA 5KCJB 1B58A 3IAZA 1P1UA 1UIVA 3RN8A 2NVUB 4QFNA 3TKDA 1B4ZA 2RCAA 2Q9TA 1R9QA 4PQJA 4KFQA 5CRYA 1FTLA 4C0RA 4OETA 3S9EA 2NOOA 3CG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKP A;  2RC9 A;  2B3B A;  3OO6 A;  2OLB A;  3FVG A;  3OOA A;  1N3X A;  3MVW A;  1MXW A;  1MXZ A;  1LBC A;  2DYX A;  2H25 A;  1NL5 A;  5AA2 B;  3G3H A;  4MBP A;  5B70 A;  4EQ7 A;  3TYH A;  3KJT A;  2ZYK A;  4DXC A;  5JTY A;  4R73 A;  4EQB A;  3K1P A;  4YMA A;  4THI A;  4Q5T A;  2AYS A;  2I4C A;  1BKA A;  4NF8 A;  3K01 A;  4IGR A;  4NTL A;  1B51 A;  3EHU A;  2YLN A;  3E9X A;  3AXF A;  2XXY A;  4YMB A;  1MM7 A;  1GV8 A;  1SI1 A;  3RYA A;  4GFR A;  5FHO A;  4F3G A;  1GR2 A;  1NNT A;  2I48 A;  5TPA A;  2HFB A;  1DTG A;  2I58 A;  4YB5 A;  4HCW A;  1TT1 A;  2RC7 A;  4POW A;  1Y3N A;  4N13 A;  2DSF A;  1A99 A;  1PB9 A;  2Z22 A;  3IOV A;  3MPL A;  4RPN A;  1URD A;  3I3V A;  1Y20 A;  2O1L A;  4QSD A;  3SEW A;  1LFH A;  3FJ7 A;  1M5D A;  4H5F A;  3FJG A;  1MY3 A;  2M8C A;  4PE5 B;  1D9V A;  2F36 A;  4OFL A;  2OWT A;  3FJM A;  1JET A;  3IR1 A;  5DYH A;  2H9B A;  3IB1 A;  1UTH A;  1TFD A;  3H6T A;  5I2N B;  4FOR A;  3OEM A;  1US5 A;  5KDT A;  3V8X B;  1S7Y A;  3Q28 A;  5DVJ A;  5HBC A;  3S9N C;  3MQ9 A;  2V3U A;  3N6T A;  1H45 A;  3IOU A;  5CBR A;  3O9P A;  1JW5 A;  5K2Y A;  4Q30 B;  4PP0 A;  1M5C A;  5IKB A;  4GWO A;  3USD A;  3SET A;  2Z8E A;  4YAH X;  2E0S A;  4KCD A;  3K6X A;  5A5X B;  1N7X A;  1Z7N E;  3KN8 A;  2F34 A;  3IJX B;  2O84 X;  2ZYN A;  3GZG A;  2AL5 A;  3CI8 A;  1MQI A;  3MW0 A;  1QUI A;  3K6V A;  1OLA A;  3DEL B;  3C31 A;  3VVE A;  3T9H B;  1B5J A;  1TXF A;  4G8M A;  3RUM A;  4GD5 A;  2P1S A;  5AE4 A;  4RY1 A;  1Y3P A;  2A5T A;  2ONR A;  2DXY A;  2F8D A;  1P1N A;  1BIY A;  3VLW A;  3E13 X;  1NNP A;  5TP9 B;  1LCT A;  4KCC A;  1MY4 A;  1USY H;  4IB2 A;  2Y7I A;  4FAJ A;  3A3U A;  3EHS A;  1QUJ A;  3DRK A;  3Q29 A;  1B9J A;  4DIG A;  2I0C A;  1WOD A;  1MXX A;  4GL8 A;  4U21 A;  3HHG A;  4X48 A;  2I4B A;  3I6V A;  4RPO A;  4F3S A;  2HCA A;  4N07 A;  3H6V A;  1O7T A;  1MM6 A;  5FTH A;  2QRY A;  4X9T A;  3GXA A;  3KEI A;  5KZT A;  1ATG A;  4F3P A;  5ITO A;  5H8F A;  1FQA A;  4EUO A;  2RIN A;  2I3W A;  3MBP A;  4DZ1 A;  3JYR A;  2DXR A;  3VVF A;  1EZ9 A;  1IZ1 A;  4ZZE A;  2X7Q A;  3LSL A;  3UOR A;  1AOV A;  1HSL A;  1HSE A;  3CG1 A;  1IXH A;  4POX A;  3S9M C;  5CM6 A;  4NF4 A;  1MQJ A;  2NWJ A;  5CMM A;  3MP8 A;  3HPI A;  1B0L A;  3RT6 B;  2ALU A;  2PMS A;  3O6G A;  4JSD A;  5A5X A;  1J1N A;  2X7P A;  4ZEF A;  2OWS A;  3K00 A;  2OJT A;  4QF9 A;  3N94 A;  3SKP A;  1SW2 A;  2PVU A;  1JVX A;  3K0V A;  3C35 A;  3W9V A;  3TTR A;  1EU8 A;  1FCK A;  5CMK A;  1XC1 A;  2Q89 A;  1LGB C;  4NWC A;  1MRP A;  4XKR A;  4LUB A;  4FEB A;  3R7X A;  5FHN A;  3T9U A;  4O3C A;  1QUL A;  2X26 A;  3R6U A;  1B3H A;  4ZED A;  4C1T A;  1OMP A;  3QAX A;  2V3Q A;  4DXU A;  4QFP A;  2XXX A;  1AIV A;  4LA9 A;  3SEY A;  1N04 A;  4GVO A;  5H8H A;  1B1X A;  2GFE A;  4IGT A;  4OXV A;  1S50 A;  4HTG A;  4KQP A;  3JZJ A;  2O51 A;  2GHA A;  3VFJ A;  1RKM A;  4TQU Q;  4Q0C A;  4OMB A;  3FUZ A;  5ICT A;  3I5O A;  3HN0 A;  3KOT A;  3MPK A;  4RNS A;  4DCX A;  4OEN A;  3M8U A;  2ONK E;  5DVF A;  4H8I A;  1I6A A;  3TZA A;  3ZSF A;  3HO7 A;  1MQH A;  3SEU A;  4RK2 A;  1QW0 A;  4L17 A;  2ZXT A;  2O7U A;  4IO4 A;  3PPN A;  5TPA B;  3E4R A;  3K1N A;  1DOT A;  4OFJ A;  2Z23 A;  1LCF A;  3OEL A;  2NUV A;  4F2O A;  2IA4 A;  3MZ1 A;  5JEI A;  2HXW A;  3MVZ A;  3VLU A;  4FJP A;  3RGY A;  3KBR A;  2Q88 A;  1DTZ A;  1Z7M E;  4NF5 A;  2XD2 A;  5BUU A;  3Q26 A;  3MP6 A;  1ZU0 A;  1DPP A;  3BFT A;  4QSE A;  4KR5 A;  2NXO A;  4X1B A;  2R9J A;  3G7W A;  1FQB A;  2Y7W A;  3S9L C;  1MS7 A;  1MH4 A;  5I57 A;  3RT8 A;  1UTH B;  2DVZ A;  1QUK A;  2V3T A;  5EYF A;  5KDT B;  1T0K A;  2UVJ A;  1L5T A;  5H8N A;  1IIW A;  1JNF A;  5AA2 D;  3B7D A;  2GH9 A;  4F39 A;  3MWB A;  2AIX A;  1OQH A;  3FTO A;  5ISU A;  4OES A;  4AB6 A;  2V84 A;  3SEX A;  1IUD A;  1D9Y A;  3UGW A;  4KYS A;  3RTF B;  2DWA A;  3LSX A;  3V89 B;  1D4N A;  2FNC A;  3IO4 A;  4BDO A;  3IL1 B;  3PMW A;  3CFL A;  1B5I A;  5H8Q A;  3T9V A;  1LFI A;  4HW8 A;  3SER A;  1JVY A;  3ONM A;  4FED A;  4OER A;  4LVQ A;  1A8E A;  4YB6 A;  4OEV A;  1B32 A;  4U4X A;  3LBS A;  3OO7 A;  2H99 A;  1PC3 A;  2O68 A;  2A5T B;  3B6W A;  3IOR A;  3ZS6 A;  3D4C A;  4IY6 A;  1LFG A;  1N76 A;  4U4S A;  2QL3 A;  3MVX A;  3TCF A;  3HV1 A;  3H03 A;  4GIZ A;  2V25 A;  4PET A;  2H98 A;  4LZ8 A;  3C36 A;  3LVU A;  4ESW A;  4RYA A;  4C1U A;  4RA1 A;  4U22 A;  2QPQ A;  1PEB A;  2RF1 A;  5FHM A;  4Z0I A;  1PDA A;  1B3G A;  1POY 1;  4BDN A;  1UQW A;  2REG A;  4JWX A;  3IJO B;  3R26 A;  3QUJ A;  3EPE A;  2XHD A;  3WAE A;  1H44 A;  3S2V A;  1OLC A;  1XT8 A;  1CE2 A;  2HZL A;  2ZYM A;  4NED A;  3UP9 A;  3VDF A;  4JB7 A;  2ZNU A;  4YKI A;  1FQF A;  3PD8 A;  2UVG A;  4I9D A;  5F7V A;  4XXU A;  3K2D A;  5H8F B;  3UK4 A;  4JWY A;  3FXQ A;  1UTB B;  1AH5 A;  3GBA A;  3TUS A;  4FAT A;  2O1M A;  3QK6 A;  3O6H A;  4Z7E A;  3C32 A;  3OSR A;  4TLM B;  3EF7 A;  4NF4 B;  4PFY A;  4R2B A;  5DTB A;  2VOZ A;  1H43 A;  3HCQ A;  3C34 A;  1B7H A;  4LQ2 A;  1FQC A;  1RYX A;  2PBW A;  3PD9 A;  1EH3 A;  2LAO A;  2B4M A;  1I6B A;  5L9M A;  3TOD A;  3OMB A;  2H5Y A;  1FTM A;  4DCY A;  1B7U A;  4ISU A;  1P99 A;  1SQY A;  2HZK A;  3IB2 A;  2P2A A;  3FV2 A;  1SVX B;  3HST A;  2DVC A;  2AL4 A;  5DEX A;  1PB8 A;  2OCU A;  4WKM A;  2XXV A;  4QFL A;  1A54 A;  4I62 A;  1NFT A;  1FW0 A;  2Y7P A;  1LBB A;  3V5A A;  3QSL A;  4U2R A;  1B52 A;  1LAG E;  3DP8 A;  4ELO A;  4IY5 A;  1P1O A;  1VR5 A;  4EXL A;  3FAT A;  4H8J A;  1LAX A;  3C9H A;  4ELQ A;  4NWD A;  4BDM A;  1FTJ A;  1SD3 A;  5AA4 A;  1MY1 A;  3IOT A;  1SW1 A;  2F5X A;  5H8H B;  3K1M A;  4OHN A;  5CMC A;  3UA8 A;  3PPR A;  1TWY A;  3THI A;  4Q8R A;  2O69 A;  5HPQ A;  3ODB A;  5K2X A;  3O66 A;  4ZEK A;  3T22 A;  3PPP A;  3U1O A;  3ZKL A;  3P7I A;  1MQG A;  2XXP A;  3EQ1 A;  2R6G E;  5L9O A;  2XX9 A;  4ZEB A;  4O3B A;  3FZV A;  2HAV A;  2Y84 A;  1R6Z A;  4KYD A;  5J1D A;  3N26 A;  2PX1 A;  4F1U A;  1S9T A;  1PB7 A;  2Y7K A;  3S4U A;  2F7B A;  2DWJ A;  4RJZ A;  1MPD A;  1MDP 1;  1SYI A;  4LON B;  3OEK A;  3U72 A;  3DRI A;  1XS5 A;  2Q2C A;  1UTB A;  3CSG A;  3DP6 A;  3T93 B;  5ITP A;  1O64 A;  2Q8J A;  1FQD A;  4WEP A;  4ONY A;  1VFD A;  1N3W A;  2XXU A;  1OQG A;  4QFO A;  1H3D A;  5EHM A;  4EQ9 A;  1M5E A;  3H06 B;  4NF5 B;  2F6G A;  5AA1 A;  3KJ7 A;  2Z8F A;  4R6Y A;  1Q35 A;  4XIG Q;  4QRZ A;  4ZDM A;  3BKI B;  1POT A;  3HHF A;  3DRH A;  4GLI A;  3MVY A;  4G8N A;  3RY3 A;  5I57 B;  3VE1 B;  3DM0 A;  3PPQ A;  1YTV A;  2B65 A;  4G68 C;  4JBZ A;  4YU0 A;  1US4 A;  1XVX A;  4NF6 A;  1MXU A;  1XHY A;  5H8N B;  1FTO A;  2F97 A;  4OWD A;  1HSJ A;  4JDF A;  2DE2 A;  4U1O A;  3FD3 A;  4G77 A;  4MLQ A;  1R1N A;  2QS1 A;  4GRK A;  4ZE8 A;  5B7D A;  3VV5 A;  4EXK A;  4PFW A;  3OD7 A;  3OO8 A;  4R2F A;  2OZZ A;  4BDR A;  4O3A A;  2HAU A;  1BLF A;  4UAC A;  3MZ9 A;  2QSX A;  3K6U A;  3BBR A;  4JXI A;  4RXL A;  5ELV A;  1NNK A;  1OVT A;  1MPC A;  2BJJ X;  2VGQ A;  5H8Q B;  2XXI A;  1DMB A;  4H65 A;  2ABH A;  1CB6 A;  4NMY A;  4YB7 A;  2VD3 A;  1SW4 A;  1TFA A;  3JV9 A;  3MP1 A;  1ZTY A;  3U93 A;  3DLN A;  4N6P A;  3PV0 E;  1URG A;  1Y4C A;  3MJN A;  2V93 A;  3FAS A;  3D4G A;  3KGC A;  3CR9 A;  2QS4 A;  5DT6 A;  3H6W A;  1USY E;  1LLS A;  3IB0 A;  4OYV A;  2DE3 A;  2QMW A;  2UXA A;  4KHZ E;  2CMO A;  3TEP A;  4LZ7 A;  2DE4 A;  4H6D A;  3KSJ A;  1SDX A;  2VD2 A;  3FIR A;  4F22 A;  1Y1M A;  5I56 A;  4F18 A;  5CBS A;  3B6Q A;  2RCB A;  4WXJ A;  1Y3Q A;  1II5 A;  3H4Z A;  3DP4 A;  4ELP A;  4GXS B;  2F7A A;  3UN6 A;  1ELJ A;  1A8F A;  1B1H A;  3TDJ A;  1ZLQ A;  4YKJ A;  3OEN A;  3MAM A;  5EHS A;  1URS A;  1M5F A;  3QXM A;  1IXG A;  3PMV A;  1A55 A;  3UIF A;  2I3V A;  4ZZA A;  3KOS A;  3M3L A;  4F1Y A;  3LSF B;  2D5W A;  3W15 C;  2I49 A;  1DPE A;  2QMX A;  1NKX A;  4LP2 B;  4H0W A;  4F3B A;  2UYF A;  1B40 A;  4BLA A;  2QS3 A;  3H3G A;  3OO9 A;  4KPT A;  3TQW A;  1B3E A;  1YCJ A;  1ZKB A;  3O28 A;  4H1X A;  5HM4 B;  4H67 A;  4DE8 A;  3E3K A;  4OFO A;  3PMX A;  4G68 A;  4ZEI A;  1B3F A;  3G3F A;  3G3J A;  4GL0 A;  2PYY A;  4JWO A;  3QUF A;  4IO2 A;  5F1Q A;  3T96 B;  5CC2 A;  3W9W A;  2UVH A;  2G29 A;  2XD3 A;  4OEU A;  1IXC A;  5DEX B;  3H6U A;  3Q25 A;  3U92 A;  1MY2 A;  5CI5 A;  3PUY E;  5I2K A;  5I59 A;  1DSN A;  1QVS A;  5BWJ A;  4NE4 A;  4F1V A;  2F6P A;  3MZB A;  4G4P A;  4AQ4 A;  3OXN A;  1QJM A;  2XXH A;  3VXC A;  1SYH A;  4UA8 A;  5AA4 B;  3KFM A;  2ZNT A;  3M3F A;  1KWH A;  1B7Z A;  4P0G A;  3BFU A;  4IO5 A;  3LC8 A;  1YAE A;  4XKP A;  3K6W A;  3G3G A;  3PU5 A;  3SDF A;  4U1Z A;  2E1S A;  1R9L A;  1IIT A;  2DWI A;  2XXT A;  3L6G A;  2DP8 A;  4HS7 A;  4R6K A;  4DXB A;  1NMU A;  4AB5 A;  4KI0 E;  4EDP A;  2W7Y A;  2QJE A;  2OBG A;  4BDQ A;  4F31 B;  2FYI A;  2CZL A;  4P0I A;  3CHG A;  2DWH A;  4M4G A;  1Q1K A;  1JEV A;  3U94 A;  1LAF E;  3QIM A;  3TTM A;  5I58 A;  4PFU A;  1SBP A;  3FVN A;  1N84 A;  3CIJ A;  2GHB A;  4R9F A;  4U23 A;  3O29 A;  4IO6 A;  2VHA A;  5M2V A;  1JEU A;  4OQO A;  4MLV A;  3TCH A;  1B05 A;  2GRV A;  1IXI A;  4F2Q A;  1LAH E;  3SES A;  4ZE9 A;  1JW4 A;  3DRF A;  3TPA A;  5I84 A;  1Y4T A;  3RTW B;  4QFK A;  3GBB A;  4NF6 B;  3TEL A;  1OIB A;  4FE8 A;  3RQT A;  5AA3 A;  5KCJ A;  4YKK A;  2XXR A;  2XXW A;  1BP5 A;  3A3C A;  1IEJ A;  2ESN A;  2R71 A;  2ANJ A;  4GF8 A;  4DLD A;  2PT2 A;  4IO3 A;  4X1D A;  4ND9 A;  2VP1 A;  4RK9 A;  4JSO A;  1FTK A;  3KN7 A;  4QSC A;  2DS9 A;  3LSW A;  3CVG A;  3FXU A;  3CFZ A;  3PUX E;  4F29 A;  5H8S A;  1NNF A;  1GGG A;  5ICQ A;  4R9G A;  2WOL A;  4GOT A;  1O63 A;  5FTI A;  2IEE A;  1MQD A;  5AA2 A;  1VSO A;  5LOM A;  1H76 A;  1XOC A;  4XKQ A;  5DVI A;  1ZMG A;  1VE4 A;  4XTC Q;  3IOW A;  4G8H A;  4ELR A;  3PUZ E;  1JQF A;  1B46 A;  4I8C A;  2P0S A;  2D3I A;  1YPN A;  1MG1 A;  2F35 A;  3KG2 A;  3TTK A;  3VVD A;  4ESX A;  3O6I A;  1BTJ A;  1MY0 A;  2HQ0 A;  2ZYO A;  3H7M A;  2RC8 A;  1AMF A;  2XX7 A;  3EHT A;  3ECR A;  1XVY A;  3KZG A;  4HCY A;  4YZZ A;  1QKB A;  4ECF A;  2UVI A;  3U8Q A;  1MXV A;  2XX8 A;  4MF3 A;  5I56 B;  2B4L A;  1RYO A;  3ZKK A;  2B3F A;  1I6Q A;  1F9B A;  2REJ A;  2QS2 A;  2A5S A;  3FGS A;  4XKN A;  1PBP A;  3TTL A;  4MH5 A;  3T9X B;  2HEU A;  4E0X A;  3C33 A;  4I1D A;  3CRB A;  5IAI A;  5JK4 A;  1UIU A;  3DRG A;  1MH3 A;  3RYB A;  3RLF E;  3CSB A;  3KN3 A;  5I2N A;  2XXQ A;  4OTE A;  2O7I A;  1JW1 A;  1SI0 A;  2FA7 A;  3VLV A;  3MC2 A;  4IO7 A;  1N0T A;  4BDL A;  4PFT A;  1N7W A;  1SW5 A;  3PUV E;  4M1V A;  2ZNS A;  2UYE A;  2THI A;  2DOJ A;  4TOZ A;  3M3K A;  2WKY A;  4FEC A;  4LQ5 A;  2I0B A;  3RNN A;  4LAT A;  1B2H A;  3TFL A;  1LST A;  3PPO A;  1WDN A;  2ONS A;  3IX1 A;  1PBQ A;  4G68 B;  2OK2 A;  3FVK A;  1GVC A;  2DQV A;  3TMG A;  3TAJ A;  2YJP A;  4ZEC A;  2ZMB A;  3PAM A;  1MPB A;  3V83 A;  4R75 A;  1A40 A;  1B0H A;  4OZ9 A;  1GTK A;  5I2K B;  3B6T A;  5I59 B;  1AL3 A;  5TP9 A;  2G93 A;  2F7C A;  5TU0 A;  1ZJL A;  3FV1 A;  1LB9 A;  3DRJ A;  4GXA A;  4QHQ A;  1B4H A;  4R74 A;  1WVJ A;  3ILU B;  1MDQ A;  1A7L A;  3LUY A;  3QYT A;  4WED A;  3A09 A;  1ZBM A;  5JTY B;  2I6E A;  4DDD A;  3PGF A;  4P11 A;  5L9S A;  3N6U A;  3F11 A;  4LZ5 A;  3K02 A;  4NF8 B;  1P1Q A;  4E0W A;  1ZIU A;  3N5L A;  3EN3 A;  1B3L A;  3G3K A;  4TLL B;  2H4I A;  3KSX A;  3C4M A;  4YIC A;  1Y9U A;  4GQO A;  3MUQ A;  1NH8 A;  3ILT B;  3OSQ A;  3O6P A;  3Q27 A;  3SEV A;  2KLF A;  1Y1Z A;  1D3K A;  2O6A A;  1P1W A;  2F78 A;  1QKA A;  3TCG A;  4G2Z A;  4F19 A;  2WOK A;  5I58 B;  2RKM A;  3FVO A;  1EZO A;  1EZP A;  3K4U A;  3GLB A;  3TQL A;  1IQ7 A;  4K3F A;  1M5B A;  1NH7 A;  1OVB A;  3CFX A;  3FXR A;  3T66 A;  4R72 A;  3VXB A;  5L8D A;  4OVJ A;  2YPN A;  2Z8D A;  3RPW A;  3G3I A;  3O2A A;  3LR1 A;  5CMB A;  1VFE A;  1ANF A;  1B5H A;  4R6H A;  2D21 A;  1I69 A;  3IK6 B;  3L6H A;  3WAF A;  4KD5 A;  2Y7R A;  4H5G A;  4ZS9 A;  1LB8 A;  2PT1 A;  4FIM A;  1MXY A;  3O97 A;  4KYE A;  3IO6 A;  3TTN A;  1B6H A;  2Q2A A;  4MFI A;  2WOP A;  4EF2 A;  3PUW E;  4EF1 A;  1FQE A;  5KCJ B;  1B58 A;  3IAZ A;  1P1U A;  1UIV A;  3RN8 A;  2NVU B;  4QFN A;  3TKD A;  1B4Z A;  2RCA A;  2Q9T A;  1R9Q A;  4PQJ A;  4KFQ A;  5CRY A;  1FTL A;  4C0R A;  4OET A;  3S9E A;  2NOO A;  3CG3 A; 
#chains in the Genus database with same CATH topology
 4YKP A;  2RC9 A;  2B3B A;  3OO6 A;  2OLB A;  3E79 A;  3FVG A;  3OOA A;  1N3X A;  3MVW A;  1MXW A;  1MXZ A;  1LBC A;  2DYX A;  2H25 A;  1NL5 A;  5AA2 B;  3G3H A;  4MBP A;  5B70 A;  4EQ7 A;  3TYH A;  3KJT A;  3RPL A;  2ZYK A;  4DXC A;  2Q8M A;  5LTC A;  5JTY A;  4R73 A;  4EQB A;  3K1P A;  4YMA A;  4THI A;  4Q5T A;  2AYS A;  2I4C A;  1BKA A;  4NF8 A;  3K01 A;  4IGR A;  1YXI A;  4NTL A;  1B51 A;  3EHU A;  2YLN A;  3E9X A;  3AXF A;  2XXY A;  4YMB A;  1MM7 A;  4NN3 A;  1GV8 A;  1SI1 A;  3RYA A;  4GFR A;  5FHO A;  4DI4 B;  4F3G A;  1GR2 A;  1NNT A;  2I48 A;  5TPA A;  2HFB A;  1DTG A;  2I58 A;  4YB5 A;  4HCW A;  4JVI A;  1TT1 A;  1JP4 A;  2RC7 A;  4POW A;  1Y3N A;  4N13 A;  2DSF A;  1A99 A;  1PB9 A;  2Z22 A;  3IOV A;  3MPL A;  5I7I A;  4RPN A;  1URD A;  1FPB A;  3I3V A;  1Y20 A;  2O1L A;  4QSD A;  3SEW A;  1LFH A;  3FJ7 A;  1M5D A;  4H5F A;  3FJG A;  1MY3 A;  5ET8 A;  4O7I A;  2M8C A;  4PE5 B;  1D9V A;  2WYK A;  2F36 A;  4OFL A;  2OWT A;  3FJM A;  1JET A;  4MCO A;  3IR1 A;  5DYH A;  1INP A;  2H9B A;  3IB1 A;  1UTH A;  1TFD A;  3H6T A;  5I2N B;  4FOR A;  3OEM A;  1US5 A;  5KDT A;  3V8X B;  1S7Y A;  3Q28 A;  5DVJ A;  5HBC A;  2CZK A;  3S9N C;  3MQ9 A;  2V3U A;  1NV6 A;  3N6T A;  1H45 A;  3IOU A;  5CBR A;  3O9P A;  1JW5 A;  5K2Y A;  3U65 A;  4Q30 B;  3IFA A;  4PP0 A;  1M5C A;  5IKB A;  4GWO A;  3USD A;  3SET A;  4OVQ A;  4MJO A;  2Z8E A;  4YAH X;  4KCD A;  2E0S A;  3K6X A;  5A5X B;  1N7X A;  1Z7N E;  3KN8 A;  2F34 A;  4PFR A;  3IJX B;  2O84 X;  2ZYN A;  3GZG A;  2AL5 A;  1AWB A;  3CI8 A;  1MQI A;  3MW0 A;  1QUI A;  3K6V A;  1OLA A;  3DEL B;  3C31 A;  3VVE A;  3T9H B;  4OVP A;  1B5J A;  1TXF A;  4G8M A;  3RUM A;  4GD5 A;  2P1S A;  5AE4 A;  4RY1 A;  4PBH A;  4P47 A;  1LEV A;  1Y3P A;  2A5T A;  2ONR A;  2DXY A;  2F8D A;  1P1N A;  1BIY A;  3VLW A;  3E13 X;  1NNP A;  5TP9 B;  1LCT A;  4KCC A;  1EYI A;  1MY4 A;  1USY H;  4IB2 A;  5LDZ A;  4KXP A;  2Y7I A;  4FAJ A;  3KC1 A;  3A3U A;  3EHS A;  4PC9 A;  1QUJ A;  3DRK A;  3Q29 A;  1B9J A;  4DIG A;  2I0C A;  1WOD A;  3IFC A;  1MXX A;  4GL8 A;  4U21 A;  3HHG A;  4X48 A;  2I4B A;  3I6V A;  4RPO A;  4PBQ A;  4OA4 A;  4F3S A;  2HCA A;  4N07 A;  2XXK A;  3H6V A;  1O7T A;  1FBH A;  1MM6 A;  5FTH A;  2QRY A;  5IZZ A;  4X9T A;  3GXA A;  2P3N A;  3KEI A;  5KZT A;  1FBF A;  2VPN A;  1ATG A;  4F3P A;  5ITO A;  5H8F A;  1FQA A;  4EUO A;  2RIN A;  3BIG A;  2I3W A;  3MBP A;  4DZ1 A;  3JYR A;  2DXR A;  3VVF A;  1EZ9 A;  1IZ1 A;  4ZZE A;  4NG7 A;  2X7Q A;  3LSL A;  3UOR A;  1AOV A;  1HSL A;  1HSE A;  3CG1 A;  4N6K A;  1IXH A;  4POX A;  3S9M C;  5CM6 A;  4NF4 A;  1MQJ A;  2NWJ A;  5CMM A;  1SPI A;  4NGU A;  3MP8 A;  3HPI A;  1B0L A;  5I5P A;  1RDY A;  3RT6 B;  2ALU A;  2PMS A;  3O6G A;  4JSD A;  5A5X A;  1NUW A;  4AS5 A;  1J1N A;  2X7P A;  4ZEF A;  2OWS A;  1IMD A;  3K00 A;  2OJT A;  4QF9 A;  3N94 A;  1DBZ A;  3SKP A;  1SW2 A;  2PVU A;  1JVX A;  3K0V A;  3C35 A;  1FPJ A;  2XA5 A;  3W9V A;  2BJI A;  3TTR A;  1EU8 A;  1KA0 A;  1FCK A;  5CMK A;  1XC1 A;  2Q89 A;  1LGB C;  4NWC A;  1D9Q A;  1MRP A;  4XKR A;  4LUB A;  4FEB A;  3R7X A;  4X8R A;  5FHN A;  3T9U A;  4O3C A;  1QUL A;  4P1E A;  2X26 A;  3D1R A;  3R6U A;  1B3H A;  4ZED A;  4C1T A;  1OMP A;  3QAX A;  2V3Q A;  4DXU A;  4QFP A;  2XXX A;  1AIV A;  1IMB A;  4LA9 A;  3SEY A;  4O7M A;  1N04 A;  4GVO A;  5H8H A;  1B1X A;  2GFE A;  4IGT A;  4OXV A;  1VDW A;  1S50 A;  4HTG A;  4G61 A;  4KQP A;  3JZJ A;  1FPK A;  2O51 A;  2GHA A;  3VFJ A;  3RPL B;  1RKM A;  4TQU Q;  4Q0C A;  4OMB A;  3FUZ A;  5ICT A;  3I5O A;  2CZH A;  3HN0 A;  4HE1 A;  3KOT A;  3MPK A;  4RNS A;  4DCX A;  5EQA A;  4OEN A;  3M8U A;  2ONK E;  5DVF A;  1BK4 A;  4PFB A;  4H8I A;  1I6A A;  3TZA A;  3ZSF A;  2XWK A;  3HO7 A;  1MQH A;  3SEU A;  4RK2 A;  1QW0 A;  4L17 A;  2ZXT A;  1IMF A;  2O7U A;  1NV3 A;  4IO4 A;  3PPN A;  5TPA B;  5ET7 A;  3E4R A;  1YYZ A;  3K1N A;  1DOT A;  4OFJ A;  2Z23 A;  1LCF A;  1FBE A;  3OEL A;  2NUV A;  4F2O A;  2IA4 A;  3MZ1 A;  5JEI A;  2HXW A;  4GWX A;  3MVZ A;  3VLU A;  4FJP A;  3RGY A;  3KBR A;  2Q88 A;  1DTZ A;  1Z7M E;  4NF5 A;  5DW8 A;  2XD2 A;  5BUU A;  3Q26 A;  3MP6 A;  1ZU0 A;  1DPP A;  3BFT A;  4QSE A;  4KR5 A;  2NXO A;  4X1B A;  2R9J A;  3G7W A;  1FQB A;  2Y7W A;  3S9L C;  1FBP A;  1MS7 A;  1MH4 A;  5I57 A;  2KQZ A;  1QGX A;  1FJ6 A;  3RT8 A;  1UTH B;  4P56 A;  2DVZ A;  1QUK A;  2V3T A;  5EYF A;  5KDT B;  1T0K A;  2UVJ A;  1L5T A;  5H8N A;  1IIW A;  1JNF A;  5AA2 D;  5IZ3 A;  3B7D A;  2GH9 A;  4F39 A;  3MWB A;  2AIX A;  1OQH A;  3FTO A;  5ISU A;  4OES A;  4AB6 A;  2V84 A;  3SEX A;  2VT5 A;  1NV0 A;  4H45 A;  1IUD A;  1D9Y A;  3UGW A;  4KYS A;  3RTF B;  2DWA A;  3LSX A;  3V89 B;  1D4N A;  2FNC A;  3IO4 A;  4BDO A;  3IL1 B;  3PMW A;  2WBB A;  3CFL A;  1B5I A;  4MIJ A;  5H8Q A;  3T9V A;  1LFI A;  4HW8 A;  3SER A;  1JVY A;  3ONM A;  4XF5 A;  4FED A;  1XI6 A;  4OER A;  4LVQ A;  5IGA A;  1A8E A;  4YB6 A;  4OEV A;  1B32 A;  4U4X A;  1KZ8 A;  4O8M A;  3LBS A;  3OO7 A;  4GWZ A;  2H99 A;  4MMP A;  1PC3 A;  2O68 A;  2A5T B;  3B6W A;  3IOR A;  3ZS6 A;  4PTK A;  3D4C A;  4IY6 A;  1LFG A;  1N76 A;  4U4S A;  2QL3 A;  3T1B A;  3MVX A;  3GYY A;  3TCF A;  3HV1 A;  3H03 A;  4GIZ A;  2V25 A;  4PET A;  2H98 A;  4LZ8 A;  3C36 A;  5ET6 A;  3LVU A;  3ROJ A;  4ESW A;  4RYA A;  5F24 A;  4C1U A;  4RA1 A;  4U22 A;  2QPQ A;  1FBD A;  1PEB A;  2RF1 A;  5FHM A;  4IR8 A;  4Z0I A;  1PDA A;  1B3G A;  1POY 1;  4BDN A;  1UQW A;  2REG A;  4JWX A;  3IJO B;  3R26 A;  3QUJ A;  3EPE A;  4OVR A;  2XHD A;  3WAE A;  1H44 A;  3S2V A;  1OLC A;  4P3L A;  1XT8 A;  1CE2 A;  2HZL A;  2ZYM A;  4NED A;  3UP9 A;  3VDF A;  4JB7 A;  2ZNU A;  4YKI A;  1IMC A;  1FJ9 A;  1FQF A;  3PD8 A;  2UVG A;  4I9D A;  5F7V A;  4XXU A;  3K2D A;  5H8F B;  4MNP A;  3UK4 A;  4PE3 A;  4JWY A;  3FXQ A;  1UTB B;  4PGP A;  2ZZX A;  1AH5 A;  3GBA A;  3TUS A;  4FAT A;  2O1M A;  3QK6 A;  3O6H A;  4MAG A;  4Z7E A;  2PFY A;  3C32 A;  3OSR A;  4TLM B;  1LBX A;  3EF7 A;  2CEY A;  4NF4 B;  4PFY A;  2FHY A;  4R2B A;  5DTB A;  2VOZ A;  1H43 A;  3HCQ A;  3C34 A;  1B7H A;  4LQ2 A;  2WX9 A;  1FQC A;  2QVU A;  4O94 A;  1RYX A;  2PBW A;  3PD9 A;  1EH3 A;  5EQ8 A;  2XWO A;  2LAO A;  3A29 A;  2B4M A;  1I6B A;  5L9M A;  3TOD A;  3OMB A;  2H5Y A;  1FTM A;  2HPG A;  4DCY A;  1B7U A;  4H46 A;  4ISU A;  1P99 A;  1SQY A;  2HZK A;  3IB2 A;  2P2A A;  3FV2 A;  1SVX B;  3HST A;  2DVC A;  2AL4 A;  5DEX A;  1PB8 A;  2OCU A;  4WKM A;  4PF6 A;  2XXV A;  4QFL A;  1A54 A;  4I62 A;  1NFT A;  1FW0 A;  2Y7P A;  1LBB A;  4N91 A;  3V5A A;  3QSL A;  2HXR A;  4U2R A;  1B52 A;  1LAG E;  3DP8 A;  4ELO A;  2ZZV A;  4IY5 A;  4MX6 A;  1P1O A;  1VR5 A;  4EXL A;  3FAT A;  4H8J A;  1LAX A;  2OWZ A;  3C9H A;  4ELQ A;  4NWD A;  4BDM A;  1FTJ A;  1SD3 A;  5AA4 A;  2Y5L A;  1MY1 A;  3IOT A;  1SW1 A;  2F5X A;  1NUZ A;  3LV0 A;  5H8H B;  3K1M A;  4OHN A;  5CMC A;  4GWS A;  1K9Z A;  3UA8 A;  3PPR A;  1TWY A;  3THI A;  4Q8R A;  2O69 A;  5HPQ A;  3ODB A;  5K2X A;  3O66 A;  4ZEK A;  5T3J A;  3PPP A;  3T22 A;  3U1O A;  3P7I A;  3ZKL A;  1IME A;  1MQG A;  5IM2 A;  2XXP A;  3EQ1 A;  2R6G E;  4UAB A;  5L9O A;  2XX9 A;  4ZEB A;  4O3B A;  3FZV A;  2JJK A;  2HAV A;  2Y84 A;  1R6Z A;  4KYD A;  5J1D A;  3N26 A;  2PX1 A;  4F1U A;  1S9T A;  1PB7 A;  2Y7K A;  3S4U A;  2F7B A;  3BIH A;  2DWJ A;  4RJZ A;  4PAI A;  1MPD A;  1MDP 1;  1SYI A;  4LON B;  3OEK A;  3U72 A;  3DRI A;  1XS5 A;  2Q2C A;  1UTB A;  3CSG A;  3DP6 A;  3T93 B;  5ITP A;  1O64 A;  2Q8J A;  1FQD A;  4WEP A;  4ONY A;  1VFD A;  1N3W A;  2XXU A;  1OQG A;  4QFO A;  1H3D A;  5EHM A;  4EQ9 A;  1M5E A;  3H06 B;  4NF5 B;  2F6G A;  5AA1 A;  3KJ7 A;  2Z8F A;  4R6Y A;  1Q35 A;  4XIG Q;  4QRZ A;  4ZDM A;  3BKI B;  1POT A;  3HHF A;  3DRH A;  5EQ7 A;  4GLI A;  3MVY A;  4G8N A;  3RY3 A;  5I57 B;  3VE1 B;  3DM0 A;  3QMF A;  3PPQ A;  1YTV A;  2B65 A;  4G68 C;  4JBZ A;  4YU0 A;  1US4 A;  5ESY A;  1XVX A;  4NF6 A;  5FBP A;  1MXU A;  1XHY A;  4OVS A;  5H8N B;  1FTO A;  2F97 A;  1LBV A;  4OWD A;  1HSJ A;  4JDF A;  5IZ3 B;  2DE2 A;  4U1O A;  3FD3 A;  4G77 A;  3FXB A;  4N17 A;  4MLQ A;  1R1N A;  2QS1 A;  4GRK A;  4ZE8 A;  5B7D A;  3VV5 A;  4EXK A;  4PFW A;  3OD7 A;  2PFZ A;  3OO8 A;  4R2F A;  3T0J A;  2OZZ A;  4BDR A;  2DDK A;  4O3A A;  2HAU A;  1BLF A;  4UAC A;  3MZ9 A;  2QSX A;  2QFL A;  2FBP A;  3K6U A;  3BBR A;  1G0H A;  4JXI A;  4RXL A;  5ELV A;  1NNK A;  1Q9D A;  1OVT A;  1MPC A;  2BJJ X;  1FRP A;  2VGQ A;  3MST A;  5H8Q B;  2XXI A;  4I3Y A;  1DMB A;  4H65 A;  2ABH A;  1CB6 A;  4NMY A;  4YB7 A;  2VD3 A;  1SW4 A;  1TFA A;  4MNC A;  3JV9 A;  3MP1 A;  3E78 A;  4OAN A;  5I3S A;  1ZTY A;  3U93 A;  3DLN A;  1RDX A;  4N6P A;  3PV0 E;  1URG A;  1Y4C A;  3MJN A;  2V93 A;  4PDD A;  3FAS A;  3D4G A;  3KGC A;  3CR9 A;  2QS4 A;  5DT6 A;  3NOH A;  3H6W A;  1USY E;  1LLS A;  3IB0 A;  4OYV A;  2DE3 A;  2QMW A;  1FBC A;  2UXA A;  4KHZ E;  2CMO A;  3TEP A;  3RYD A;  4LZ7 A;  2DE4 A;  4H6D A;  3KSJ A;  1SDX A;  2VD2 A;  3FIR A;  4F22 A;  1Y1M A;  5I56 A;  4F18 A;  2CZI A;  5CBS A;  3B6Q A;  2RCB A;  4WXJ A;  1Y3Q A;  1II5 A;  3H4Z A;  3DP4 A;  4ELP A;  4GXS B;  1NI9 A;  2QVR A;  2F7A A;  3UN6 A;  1ELJ A;  1A8F A;  1B1H A;  3TDJ A;  1ZLQ A;  4YKJ A;  3OEN A;  3MAM A;  5EHS A;  1NV1 A;  1URS A;  4N8Y A;  1M5F A;  3QXM A;  1IXG A;  3PMV A;  1A55 A;  5ET5 A;  1CNQ A;  3UIF A;  2I3V A;  4GWU A;  4ZZA A;  3KOS A;  3M3L A;  4F1Y A;  3LSF B;  2D5W A;  4MEV A;  3W15 C;  2I49 A;  1DPE A;  2QMX A;  1NKX A;  4LP2 B;  4H0W A;  4F3B A;  4PDH A;  2UYF A;  1B40 A;  4BLA A;  2QS3 A;  1FPG A;  3H3G A;  3OO9 A;  4KPT A;  4HXV A;  3TQW A;  1B3E A;  1YCJ A;  1ZKB A;  1LBW A;  3O28 A;  4H1X A;  5HM4 B;  4H67 A;  4DE8 A;  3E3K A;  4OFO A;  3PMX A;  4G68 A;  4ZEI A;  1B3F A;  3G3F A;  2FVZ A;  3G3J A;  4GL0 A;  2PYY A;  4JWO A;  3QUF A;  4GBW A;  4IO2 A;  5F1Q A;  3T96 B;  5CC2 A;  4QBA A;  3W9W A;  2UVH A;  4LN5 A;  2G29 A;  1LBZ A;  2XD3 A;  1YZ0 A;  4OEU A;  1IXC A;  5DEX B;  3H6U A;  1FPE A;  3Q25 A;  3U92 A;  1K9Y A;  1MY2 A;  5CI5 A;  3PUY E;  5I2K A;  5I59 A;  1DSN A;  4HE2 A;  1QVS A;  5BWJ A;  4NE4 A;  4F1V A;  2F6P A;  3MZB A;  4G4P A;  4AQ4 A;  3B8B A;  3OXN A;  3FBP A;  5IZ1 A;  1QJM A;  2XXH A;  3VXC A;  1SYH A;  4UA8 A;  4N6D A;  5AA4 B;  1NV5 A;  3KFM A;  4PFI A;  2OX3 A;  2ZNT A;  4X04 A;  3M3F A;  4XFE A;  1KWH A;  2MKZ A;  1B7Z A;  4P0G A;  3BFU A;  4IO5 A;  3LC8 A;  1YAE A;  3LUZ A;  4XKP A;  3K6W A;  3G3G A;  3PU5 A;  3SDF A;  4U1Z A;  2E1S A;  1R9L A;  1IIT A;  2DWI A;  2XXT A;  3L6G A;  2DP8 A;  4HS7 A;  4R6K A;  4N8G A;  4DXB A;  1NMU A;  4AB5 A;  4KI0 E;  4EDP A;  2W7Y A;  2QJE A;  4GWY A;  2OBG A;  4BDQ A;  4F31 B;  1FBG A;  2FYI A;  2CZL A;  4JVD A;  2V4C A;  4P0I A;  3CHG A;  2DWH A;  2F3D A;  4M4G A;  1Q1K A;  1JEV A;  3U94 A;  1LAF E;  3QIM A;  3TTM A;  5I58 A;  4PFU A;  1SBP A;  3FVN A;  1LBY A;  3KBZ A;  1N84 A;  3CIJ A;  2GHB A;  4R9F A;  4HE0 A;  4U23 A;  3O29 A;  4IO6 A;  2VHA A;  5M2V A;  1JEU A;  4OQO A;  2WYP A;  4NQ8 A;  4MLV A;  3TCH A;  1EYJ A;  1B05 A;  2GRV A;  1IXI A;  4F2Q A;  1LAH E;  3SES A;  4ZE9 A;  1JW4 A;  1DK4 A;  3DRF A;  2Q74 A;  3TPA A;  4JVC A;  5I84 A;  4NAP A;  1Y4T A;  1NUX A;  3RTW B;  4QFK A;  3GBB A;  4NF6 B;  3TEL A;  1OIB A;  4FE8 A;  3RQT A;  5AA3 A;  5KCJ A;  4NHB A;  4YKK A;  2XXR A;  2XXW A;  1BP5 A;  1FTA A;  3A3C A;  1IEJ A;  2ESN A;  2R71 A;  2ANJ A;  1NV4 A;  4GF8 A;  4DLD A;  2VPO A;  2PT2 A;  2WBD A;  4IO3 A;  2HHM A;  4X1D A;  4ND9 A;  2VP1 A;  4RK9 A;  4JSO A;  1FTK A;  3KN7 A;  4QSC A;  3KC0 A;  2DS9 A;  3LSW A;  3CVG A;  3FXU A;  3CFZ A;  3PUX E;  4F29 A;  5H8S A;  1NNF A;  1GGG A;  5ICQ A;  4R9G A;  2WOL A;  2CEX A;  4GOT A;  1O63 A;  5FTI A;  2IEE A;  1MQD A;  5AA2 A;  5EYH A;  1VSO A;  5LOM A;  1H76 A;  1XOC A;  4N81 A;  4XKQ A;  5DVI A;  1ZMG A;  1VE4 A;  4XTC Q;  4GWW A;  3IOW A;  4G8H A;  4ELR A;  3PUZ E;  1JQF A;  1B46 A;  4I8C A;  2P0S A;  2D3I A;  1YPN A;  1MG1 A;  2F35 A;  4GX3 A;  3KG2 A;  3TTK A;  3VVD A;  4ESX A;  4PAK A;  3O6I A;  1BTJ A;  1MY0 A;  2HQ0 A;  2ZYO A;  2F3B A;  3H7M A;  2RC8 A;  1AMF A;  2XX7 A;  3EHT A;  3ECR A;  1XVY A;  4PAF A;  3KZG A;  4HCY A;  4P9K A;  4YZZ A;  1QKB A;  1FPF A;  4ECF A;  2WEF A;  1FPI A;  2UVI A;  3U8Q A;  4MNI A;  1MXV A;  2XX8 A;  4MF3 A;  5I56 B;  2B4L A;  4P1L A;  1RYO A;  3ZKK A;  2B3F A;  1NUY A;  1I6Q A;  4PCD A;  1F9B A;  2Y5K A;  2REJ A;  2QS2 A;  1FPD A;  2A5S A;  3FGS A;  4XKN A;  1PBP A;  1NV2 A;  3TTL A;  4MH5 A;  3T9X B;  2HEU A;  4E0X A;  4N15 A;  3C33 A;  4I1D A;  3CRB A;  5IAI A;  4P8B A;  1UIU A;  5JK4 A;  4NF0 A;  3DRG A;  1MH3 A;  3RYB A;  3RLF E;  3CSB A;  3KN3 A;  5I2N A;  4OTE A;  2XXQ A;  2O7I A;  1JW1 A;  1SI0 A;  2FA7 A;  3VLV A;  3MC2 A;  4IO7 A;  1N0T A;  4I3E A;  4BDL A;  4PFT A;  5EYG A;  1N7W A;  1SW5 A;  2XWI A;  3PUV E;  4M1V A;  2ZNS A;  4PGN A;  1FPL A;  2UYE A;  2THI A;  2DOJ A;  4MHF A;  4TOZ A;  3ISP A;  1G0I A;  3M3K A;  2WKY A;  4FEC A;  4LQ5 A;  2I0B A;  3RNN A;  4LAT A;  1B2H A;  3TFL A;  1LST A;  3PPO A;  1WDN A;  2L5V A;  2ONS A;  3IX1 A;  1PBQ A;  2KR0 A;  4G68 B;  2OK2 A;  1NV7 A;  4I40 A;  3FVK A;  1GVC A;  2DQV A;  3TMG A;  3TAJ A;  4AS4 A;  2YJP A;  4NX1 A;  4ZEC A;  2ZMB A;  3PAM A;  4N4U A;  1KA1 A;  1MPB A;  3V83 A;  4R75 A;  1A40 A;  1B0H A;  4OZ9 A;  4QXD A;  1GTK A;  2XWV A;  5I2K B;  3B6T A;  5I59 B;  1AL3 A;  5TP9 A;  2R8T A;  4OVT A;  3PTY A;  2G93 A;  2F7C A;  4GX4 A;  5TU0 A;  1ZJL A;  3FV1 A;  1LB9 A;  3DRJ A;  4GXA A;  4QHQ A;  1B4H A;  4R74 A;  1WVJ A;  3ILU B;  1MDQ A;  1A7L A;  3LUY A;  3QYT A;  4GBV A;  4WED A;  3A09 A;  1ZBM A;  1FSA A;  2I6E A;  5JTY B;  4DDD A;  3HFU A;  3PGF A;  4P11 A;  5L9S A;  3N6U A;  3F11 A;  4LZ5 A;  3K02 A;  4NF8 B;  4PF8 A;  1P1Q A;  4E0W A;  1ZIU A;  3N5L A;  3EN3 A;  1B3L A;  3G3K A;  4TLL B;  2H4I A;  3EKI A;  3KSX A;  3C4M A;  4YIC A;  1Y9U A;  1DCU A;  4GQO A;  3MUQ A;  4XEQ A;  1NH8 A;  3ILT B;  3OSQ A;  3O6P A;  3Q27 A;  3SEV A;  2KLF A;  1Y1Z A;  1D3K A;  1EYK A;  2O6A A;  1P1W A;  2F78 A;  1QKA A;  3TCG A;  4G2Z A;  4F19 A;  2WOK A;  5I58 B;  2RKM A;  3FVO A;  1EZO A;  5J16 A;  1EZP A;  3K4U A;  3GLB A;  3TQL A;  1IQ7 A;  2FIE A;  5EQ9 A;  4K3F A;  1M5B A;  1NH7 A;  1OVB A;  3CFX A;  3FXR A;  3T66 A;  4R72 A;  3B50 A;  3VXB A;  5L8D A;  4OVJ A;  2YPN A;  2Z8D A;  3RPW A;  2PCR A;  3G3I A;  3O2A A;  3LR1 A;  5CMB A;  1VFE A;  1ANF A;  1B5H A;  4R6H A;  2D21 A;  1I69 A;  4FBP A;  3IK6 B;  3L6H A;  3WAF A;  4KD5 A;  4GX6 A;  2Y7R A;  4H5G A;  4ZS9 A;  1LB8 A;  3MYU A;  3SZP A;  2PT1 A;  4FIM A;  1MXY A;  2ZZW A;  3O97 A;  4KYE A;  3IO6 A;  3TTN A;  1B6H A;  2Q2A A;  4MFI A;  5A5L A;  2WOP A;  4EF2 A;  3PUW E;  4EF1 A;  1FQE A;  5KCJ B;  1B58 A;  3IAZ A;  1P1U A;  1UIV A;  1RDZ A;  3RN8 A;  2NVU B;  2QVV A;  4QFN A;  3TKD A;  1B4Z A;  2RCA A;  2Q9T A;  1R9Q A;  4PQJ A;  4DI3 D;  4KFQ A;  5CRY A;  2P3V A;  1IMA A;  1FTL A;  4C0R A;  4OET A;  3S9E A;  2NOO A;  3CG3 A;  2FIX A;  2GQ1 A; 
#chains in the Genus database with same CATH homology
 4YKP A;  2RC9 A;  2B3B A;  3OO6 A;  2OLB A;  3FVG A;  3OOA A;  1N3X A;  3MVW A;  1MXW A;  1MXZ A;  1LBC A;  2DYX A;  2H25 A;  1NL5 A;  5AA2 B;  3G3H A;  4MBP A;  5B70 A;  4EQ7 A;  3TYH A;  3KJT A;  2ZYK A;  4DXC A;  5JTY A;  4R73 A;  4EQB A;  3K1P A;  4YMA A;  4THI A;  4Q5T A;  2AYS A;  2I4C A;  1BKA A;  4NF8 A;  3K01 A;  4IGR A;  4NTL A;  1B51 A;  3EHU A;  2YLN A;  3E9X A;  3AXF A;  2XXY A;  4YMB A;  1MM7 A;  1GV8 A;  1SI1 A;  3RYA A;  4GFR A;  5FHO A;  4F3G A;  1GR2 A;  1NNT A;  2I48 A;  5TPA A;  2HFB A;  1DTG A;  2I58 A;  4YB5 A;  4HCW A;  1TT1 A;  2RC7 A;  4POW A;  1Y3N A;  4N13 A;  2DSF A;  1A99 A;  1PB9 A;  2Z22 A;  3IOV A;  3MPL A;  4RPN A;  1URD A;  3I3V A;  1Y20 A;  2O1L A;  4QSD A;  3SEW A;  1LFH A;  3FJ7 A;  1M5D A;  4H5F A;  3FJG A;  1MY3 A;  2M8C A;  4PE5 B;  1D9V A;  2F36 A;  4OFL A;  2OWT A;  3FJM A;  1JET A;  3IR1 A;  5DYH A;  2H9B A;  3IB1 A;  1UTH A;  1TFD A;  3H6T A;  5I2N B;  4FOR A;  3OEM A;  1US5 A;  5KDT A;  3V8X B;  1S7Y A;  3Q28 A;  5DVJ A;  5HBC A;  3S9N C;  3MQ9 A;  2V3U A;  3N6T A;  1H45 A;  3IOU A;  5CBR A;  3O9P A;  1JW5 A;  5K2Y A;  4Q30 B;  4PP0 A;  1M5C A;  5IKB A;  4GWO A;  3USD A;  3SET A;  2Z8E A;  4YAH X;  2E0S A;  4KCD A;  3K6X A;  5A5X B;  1N7X A;  1Z7N E;  3KN8 A;  2F34 A;  3IJX B;  2O84 X;  2ZYN A;  3GZG A;  2AL5 A;  3CI8 A;  1MQI A;  3MW0 A;  1QUI A;  3K6V A;  1OLA A;  3DEL B;  3C31 A;  3VVE A;  3T9H B;  1B5J A;  1TXF A;  4G8M A;  3RUM A;  4GD5 A;  2P1S A;  5AE4 A;  4RY1 A;  1Y3P A;  2A5T A;  2ONR A;  2DXY A;  2F8D A;  1P1N A;  1BIY A;  3VLW A;  3E13 X;  1NNP A;  5TP9 B;  1LCT A;  4KCC A;  1MY4 A;  1USY H;  4IB2 A;  2Y7I A;  4FAJ A;  3A3U A;  3EHS A;  1QUJ A;  3DRK A;  3Q29 A;  1B9J A;  4DIG A;  2I0C A;  1WOD A;  1MXX A;  4GL8 A;  4U21 A;  3HHG A;  4X48 A;  2I4B A;  3I6V A;  4RPO A;  4F3S A;  2HCA A;  4N07 A;  3H6V A;  1O7T A;  1MM6 A;  5FTH A;  2QRY A;  4X9T A;  3GXA A;  3KEI A;  5KZT A;  1ATG A;  4F3P A;  5ITO A;  5H8F A;  1FQA A;  4EUO A;  2RIN A;  2I3W A;  3MBP A;  4DZ1 A;  3JYR A;  2DXR A;  3VVF A;  1EZ9 A;  1IZ1 A;  4ZZE A;  2X7Q A;  3LSL A;  3UOR A;  1AOV A;  1HSL A;  1HSE A;  3CG1 A;  1IXH A;  4POX A;  3S9M C;  5CM6 A;  4NF4 A;  1MQJ A;  2NWJ A;  5CMM A;  3MP8 A;  3HPI A;  1B0L A;  3RT6 B;  2ALU A;  2PMS A;  3O6G A;  4JSD A;  5A5X A;  1J1N A;  2X7P A;  4ZEF A;  2OWS A;  3K00 A;  2OJT A;  4QF9 A;  3N94 A;  3SKP A;  1SW2 A;  2PVU A;  1JVX A;  3K0V A;  3C35 A;  3W9V A;  3TTR A;  1EU8 A;  1FCK A;  5CMK A;  1XC1 A;  2Q89 A;  1LGB C;  4NWC A;  1MRP A;  4XKR A;  4LUB A;  4FEB A;  3R7X A;  5FHN A;  3T9U A;  4O3C A;  1QUL A;  2X26 A;  3R6U A;  1B3H A;  4ZED A;  4C1T A;  1OMP A;  3QAX A;  2V3Q A;  4DXU A;  4QFP A;  2XXX A;  1AIV A;  4LA9 A;  3SEY A;  1N04 A;  4GVO A;  5H8H A;  1B1X A;  2GFE A;  4IGT A;  4OXV A;  1S50 A;  4HTG A;  4KQP A;  3JZJ A;  2O51 A;  2GHA A;  3VFJ A;  1RKM A;  4TQU Q;  4Q0C A;  4OMB A;  3FUZ A;  5ICT A;  3I5O A;  3HN0 A;  3KOT A;  3MPK A;  4RNS A;  4DCX A;  4OEN A;  3M8U A;  2ONK E;  5DVF A;  4H8I A;  1I6A A;  3TZA A;  3ZSF A;  3HO7 A;  1MQH A;  3SEU A;  4RK2 A;  1QW0 A;  4L17 A;  2ZXT A;  2O7U A;  4IO4 A;  3PPN A;  5TPA B;  3E4R A;  3K1N A;  1DOT A;  4OFJ A;  2Z23 A;  1LCF A;  3OEL A;  2NUV A;  4F2O A;  2IA4 A;  3MZ1 A;  5JEI A;  2HXW A;  3MVZ A;  3VLU A;  4FJP A;  3RGY A;  3KBR A;  2Q88 A;  1DTZ A;  1Z7M E;  4NF5 A;  2XD2 A;  5BUU A;  3Q26 A;  3MP6 A;  1ZU0 A;  1DPP A;  3BFT A;  4QSE A;  4KR5 A;  2NXO A;  4X1B A;  2R9J A;  3G7W A;  1FQB A;  2Y7W A;  3S9L C;  1MS7 A;  1MH4 A;  5I57 A;  3RT8 A;  1UTH B;  2DVZ A;  1QUK A;  2V3T A;  5EYF A;  5KDT B;  1T0K A;  2UVJ A;  1L5T A;  5H8N A;  1IIW A;  1JNF A;  5AA2 D;  3B7D A;  2GH9 A;  4F39 A;  3MWB A;  2AIX A;  1OQH A;  3FTO A;  5ISU A;  4OES A;  4AB6 A;  2V84 A;  3SEX A;  1IUD A;  1D9Y A;  3UGW A;  4KYS A;  3RTF B;  2DWA A;  3LSX A;  3V89 B;  1D4N A;  2FNC A;  3IO4 A;  4BDO A;  3IL1 B;  3PMW A;  3CFL A;  1B5I A;  5H8Q A;  3T9V A;  1LFI A;  4HW8 A;  3SER A;  1JVY A;  3ONM A;  4FED A;  4OER A;  4LVQ A;  1A8E A;  4YB6 A;  4OEV A;  1B32 A;  4U4X A;  3LBS A;  3OO7 A;  2H99 A;  1PC3 A;  2O68 A;  2A5T B;  3B6W A;  3IOR A;  3ZS6 A;  3D4C A;  4IY6 A;  1LFG A;  1N76 A;  4U4S A;  2QL3 A;  3MVX A;  3TCF A;  3HV1 A;  3H03 A;  4GIZ A;  2V25 A;  4PET A;  2H98 A;  4LZ8 A;  3C36 A;  3LVU A;  4ESW A;  4RYA A;  4C1U A;  4RA1 A;  4U22 A;  2QPQ A;  1PEB A;  2RF1 A;  5FHM A;  4Z0I A;  1PDA A;  1B3G A;  1POY 1;  4BDN A;  1UQW A;  2REG A;  4JWX A;  3IJO B;  3R26 A;  3QUJ A;  3EPE A;  2XHD A;  3WAE A;  1H44 A;  3S2V A;  1OLC A;  1XT8 A;  1CE2 A;  2HZL A;  2ZYM A;  4NED A;  3UP9 A;  3VDF A;  4JB7 A;  2ZNU A;  4YKI A;  1FQF A;  3PD8 A;  2UVG A;  4I9D A;  5F7V A;  4XXU A;  3K2D A;  5H8F B;  3UK4 A;  4JWY A;  3FXQ A;  1UTB B;  1AH5 A;  3GBA A;  3TUS A;  4FAT A;  2O1M A;  3QK6 A;  3O6H A;  4Z7E A;  3C32 A;  3OSR A;  4TLM B;  3EF7 A;  4NF4 B;  4PFY A;  4R2B A;  5DTB A;  2VOZ A;  1H43 A;  3HCQ A;  3C34 A;  1B7H A;  4LQ2 A;  1FQC A;  1RYX A;  2PBW A;  3PD9 A;  1EH3 A;  2LAO A;  2B4M A;  1I6B A;  5L9M A;  3TOD A;  3OMB A;  2H5Y A;  1FTM A;  4DCY A;  1B7U A;  4ISU A;  1P99 A;  1SQY A;  2HZK A;  3IB2 A;  2P2A A;  3FV2 A;  1SVX B;  3HST A;  2DVC A;  2AL4 A;  5DEX A;  1PB8 A;  2OCU A;  4WKM A;  2XXV A;  4QFL A;  1A54 A;  4I62 A;  1NFT A;  1FW0 A;  2Y7P A;  1LBB A;  3V5A A;  3QSL A;  4U2R A;  1B52 A;  1LAG E;  3DP8 A;  4ELO A;  4IY5 A;  1P1O A;  1VR5 A;  4EXL A;  3FAT A;  4H8J A;  1LAX A;  3C9H A;  4ELQ A;  4NWD A;  4BDM A;  1FTJ A;  1SD3 A;  5AA4 A;  1MY1 A;  3IOT A;  1SW1 A;  2F5X A;  5H8H B;  3K1M A;  4OHN A;  5CMC A;  3UA8 A;  3PPR A;  1TWY A;  3THI A;  4Q8R A;  2O69 A;  5HPQ A;  3ODB A;  5K2X A;  3O66 A;  4ZEK A;  3T22 A;  3PPP A;  3U1O A;  3ZKL A;  3P7I A;  1MQG A;  2XXP A;  3EQ1 A;  2R6G E;  5L9O A;  2XX9 A;  4ZEB A;  4O3B A;  3FZV A;  2HAV A;  2Y84 A;  1R6Z A;  4KYD A;  5J1D A;  3N26 A;  2PX1 A;  4F1U A;  1S9T A;  1PB7 A;  2Y7K A;  3S4U A;  2F7B A;  2DWJ A;  4RJZ A;  1MPD A;  1MDP 1;  1SYI A;  4LON B;  3OEK A;  3U72 A;  3DRI A;  1XS5 A;  2Q2C A;  1UTB A;  3CSG A;  3DP6 A;  3T93 B;  5ITP A;  1O64 A;  2Q8J A;  1FQD A;  4WEP A;  4ONY A;  1VFD A;  1N3W A;  2XXU A;  1OQG A;  4QFO A;  1H3D A;  5EHM A;  4EQ9 A;  1M5E A;  3H06 B;  4NF5 B;  2F6G A;  5AA1 A;  3KJ7 A;  2Z8F A;  4R6Y A;  1Q35 A;  4XIG Q;  4QRZ A;  4ZDM A;  3BKI B;  1POT A;  3HHF A;  3DRH A;  4GLI A;  3MVY A;  4G8N A;  3RY3 A;  5I57 B;  3VE1 B;  3DM0 A;  3PPQ A;  1YTV A;  2B65 A;  4G68 C;  4JBZ A;  4YU0 A;  1US4 A;  1XVX A;  4NF6 A;  1MXU A;  1XHY A;  5H8N B;  1FTO A;  2F97 A;  4OWD A;  1HSJ A;  4JDF A;  2DE2 A;  4U1O A;  3FD3 A;  4G77 A;  4MLQ A;  1R1N A;  2QS1 A;  4GRK A;  4ZE8 A;  5B7D A;  3VV5 A;  4EXK A;  4PFW A;  3OD7 A;  3OO8 A;  4R2F A;  2OZZ A;  4BDR A;  4O3A A;  2HAU A;  1BLF A;  4UAC A;  3MZ9 A;  2QSX A;  3K6U A;  3BBR A;  4JXI A;  4RXL A;  5ELV A;  1NNK A;  1OVT A;  1MPC A;  2BJJ X;  2VGQ A;  5H8Q B;  2XXI A;  1DMB A;  4H65 A;  2ABH A;  1CB6 A;  4NMY A;  4YB7 A;  2VD3 A;  1SW4 A;  1TFA A;  3JV9 A;  3MP1 A;  1ZTY A;  3U93 A;  3DLN A;  4N6P A;  3PV0 E;  1URG A;  1Y4C A;  3MJN A;  2V93 A;  3FAS A;  3D4G A;  3KGC A;  3CR9 A;  2QS4 A;  5DT6 A;  3H6W A;  1USY E;  1LLS A;  3IB0 A;  4OYV A;  2DE3 A;  2QMW A;  2UXA A;  4KHZ E;  2CMO A;  3TEP A;  4LZ7 A;  2DE4 A;  4H6D A;  3KSJ A;  1SDX A;  2VD2 A;  3FIR A;  4F22 A;  1Y1M A;  5I56 A;  4F18 A;  5CBS A;  3B6Q A;  2RCB A;  4WXJ A;  1Y3Q A;  1II5 A;  3H4Z A;  3DP4 A;  4ELP A;  4GXS B;  2F7A A;  3UN6 A;  1ELJ A;  1A8F A;  1B1H A;  3TDJ A;  1ZLQ A;  4YKJ A;  3OEN A;  3MAM A;  5EHS A;  1URS A;  1M5F A;  3QXM A;  1IXG A;  3PMV A;  1A55 A;  3UIF A;  2I3V A;  4ZZA A;  3KOS A;  3M3L A;  4F1Y A;  3LSF B;  2D5W A;  3W15 C;  2I49 A;  1DPE A;  2QMX A;  1NKX A;  4LP2 B;  4H0W A;  4F3B A;  2UYF A;  1B40 A;  4BLA A;  2QS3 A;  3H3G A;  3OO9 A;  4KPT A;  3TQW A;  1B3E A;  1YCJ A;  1ZKB A;  3O28 A;  4H1X A;  5HM4 B;  4H67 A;  4DE8 A;  3E3K A;  4OFO A;  3PMX A;  4G68 A;  4ZEI A;  1B3F A;  3G3F A;  3G3J A;  4GL0 A;  2PYY A;  4JWO A;  3QUF A;  4IO2 A;  5F1Q A;  3T96 B;  5CC2 A;  3W9W A;  2UVH A;  2G29 A;  2XD3 A;  4OEU A;  1IXC A;  5DEX B;  3H6U A;  3Q25 A;  3U92 A;  1MY2 A;  5CI5 A;  3PUY E;  5I2K A;  5I59 A;  1DSN A;  1QVS A;  5BWJ A;  4NE4 A;  4F1V A;  2F6P A;  3MZB A;  4G4P A;  4AQ4 A;  3OXN A;  1QJM A;  2XXH A;  3VXC A;  1SYH A;  4UA8 A;  5AA4 B;  3KFM A;  2ZNT A;  3M3F A;  1KWH A;  1B7Z A;  4P0G A;  3BFU A;  4IO5 A;  3LC8 A;  1YAE A;  4XKP A;  3K6W A;  3G3G A;  3PU5 A;  3SDF A;  4U1Z A;  2E1S A;  1R9L A;  1IIT A;  2DWI A;  2XXT A;  3L6G A;  2DP8 A;  4HS7 A;  4R6K A;  4DXB A;  1NMU A;  4AB5 A;  4KI0 E;  4EDP A;  2W7Y A;  2QJE A;  2OBG A;  4BDQ A;  4F31 B;  2FYI A;  2CZL A;  4P0I A;  3CHG A;  2DWH A;  4M4G A;  1Q1K A;  1JEV A;  3U94 A;  1LAF E;  3QIM A;  3TTM A;  5I58 A;  4PFU A;  1SBP A;  3FVN A;  1N84 A;  3CIJ A;  2GHB A;  4R9F A;  4U23 A;  3O29 A;  4IO6 A;  2VHA A;  5M2V A;  1JEU A;  4OQO A;  4MLV A;  3TCH A;  1B05 A;  2GRV A;  1IXI A;  4F2Q A;  1LAH E;  3SES A;  4ZE9 A;  1JW4 A;  3DRF A;  3TPA A;  5I84 A;  1Y4T A;  3RTW B;  4QFK A;  3GBB A;  4NF6 B;  3TEL A;  1OIB A;  4FE8 A;  3RQT A;  5AA3 A;  5KCJ A;  4YKK A;  2XXR A;  2XXW A;  1BP5 A;  3A3C A;  1IEJ A;  2ESN A;  2R71 A;  2ANJ A;  4GF8 A;  4DLD A;  2PT2 A;  4IO3 A;  4X1D A;  4ND9 A;  2VP1 A;  4RK9 A;  4JSO A;  1FTK A;  3KN7 A;  4QSC A;  2DS9 A;  3LSW A;  3CVG A;  3FXU A;  3CFZ A;  3PUX E;  4F29 A;  5H8S A;  1NNF A;  1GGG A;  5ICQ A;  4R9G A;  2WOL A;  4GOT A;  1O63 A;  5FTI A;  2IEE A;  1MQD A;  5AA2 A;  1VSO A;  5LOM A;  1H76 A;  1XOC A;  4XKQ A;  5DVI A;  1ZMG A;  1VE4 A;  4XTC Q;  3IOW A;  4G8H A;  4ELR A;  3PUZ E;  1JQF A;  1B46 A;  4I8C A;  2P0S A;  2D3I A;  1YPN A;  1MG1 A;  2F35 A;  3KG2 A;  3TTK A;  3VVD A;  4ESX A;  3O6I A;  1BTJ A;  1MY0 A;  2HQ0 A;  2ZYO A;  3H7M A;  2RC8 A;  1AMF A;  2XX7 A;  3EHT A;  3ECR A;  1XVY A;  3KZG A;  4HCY A;  4YZZ A;  1QKB A;  4ECF A;  2UVI A;  3U8Q A;  1MXV A;  2XX8 A;  4MF3 A;  5I56 B;  2B4L A;  1RYO A;  3ZKK A;  2B3F A;  1I6Q A;  1F9B A;  2REJ A;  2QS2 A;  2A5S A;  3FGS A;  4XKN A;  1PBP A;  3TTL A;  4MH5 A;  3T9X B;  2HEU A;  4E0X A;  3C33 A;  4I1D A;  3CRB A;  5IAI A;  5JK4 A;  1UIU A;  3DRG A;  1MH3 A;  3RYB A;  3RLF E;  3CSB A;  3KN3 A;  5I2N A;  2XXQ A;  4OTE A;  2O7I A;  1JW1 A;  1SI0 A;  2FA7 A;  3VLV A;  3MC2 A;  4IO7 A;  1N0T A;  4BDL A;  4PFT A;  1N7W A;  1SW5 A;  3PUV E;  4M1V A;  2ZNS A;  2UYE A;  2THI A;  2DOJ A;  4TOZ A;  3M3K A;  2WKY A;  4FEC A;  4LQ5 A;  2I0B A;  3RNN A;  4LAT A;  1B2H A;  3TFL A;  1LST A;  3PPO A;  1WDN A;  2ONS A;  3IX1 A;  1PBQ A;  4G68 B;  2OK2 A;  3FVK A;  1GVC A;  2DQV A;  3TMG A;  3TAJ A;  2YJP A;  4ZEC A;  2ZMB A;  3PAM A;  1MPB A;  3V83 A;  4R75 A;  1A40 A;  1B0H A;  4OZ9 A;  1GTK A;  5I2K B;  3B6T A;  5I59 B;  1AL3 A;  5TP9 A;  2G93 A;  2F7C A;  5TU0 A;  1ZJL A;  3FV1 A;  1LB9 A;  3DRJ A;  4GXA A;  4QHQ A;  1B4H A;  4R74 A;  1WVJ A;  3ILU B;  1MDQ A;  1A7L A;  3LUY A;  3QYT A;  4WED A;  3A09 A;  1ZBM A;  5JTY B;  2I6E A;  4DDD A;  3PGF A;  4P11 A;  5L9S A;  3N6U A;  3F11 A;  4LZ5 A;  3K02 A;  4NF8 B;  1P1Q A;  4E0W A;  1ZIU A;  3N5L A;  3EN3 A;  1B3L A;  3G3K A;  4TLL B;  2H4I A;  3KSX A;  3C4M A;  4YIC A;  1Y9U A;  4GQO A;  3MUQ A;  1NH8 A;  3ILT B;  3OSQ A;  3O6P A;  3Q27 A;  3SEV A;  2KLF A;  1Y1Z A;  1D3K A;  2O6A A;  1P1W A;  2F78 A;  1QKA A;  3TCG A;  4G2Z A;  4F19 A;  2WOK A;  5I58 B;  2RKM A;  3FVO A;  1EZO A;  1EZP A;  3K4U A;  3GLB A;  3TQL A;  1IQ7 A;  4K3F A;  1M5B A;  1NH7 A;  1OVB A;  3CFX A;  3FXR A;  3T66 A;  4R72 A;  3VXB A;  5L8D A;  4OVJ A;  2YPN A;  2Z8D A;  3RPW A;  3G3I A;  3O2A A;  3LR1 A;  5CMB A;  1VFE A;  1ANF A;  1B5H A;  4R6H A;  2D21 A;  1I69 A;  3IK6 B;  3L6H A;  3WAF A;  4KD5 A;  2Y7R A;  4H5G A;  4ZS9 A;  1LB8 A;  2PT1 A;  4FIM A;  1MXY A;  3O97 A;  4KYE A;  3IO6 A;  3TTN A;  1B6H A;  2Q2A A;  4MFI A;  2WOP A;  4EF2 A;  3PUW E;  4EF1 A;  1FQE A;  5KCJ B;  1B58 A;  3IAZ A;  1P1U A;  1UIV A;  3RN8 A;  2NVU B;  4QFN A;  3TKD A;  1B4Z A;  2RCA A;  2Q9T A;  1R9Q A;  4PQJ A;  4KFQ A;  5CRY A;  1FTL A;  4C0R A;  4OET A;  3S9E A;  2NOO A;  3CG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...