3CHGA

The compatible solute-binding protein opuac from bacillus subtilis in complex with dmsa
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
NKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Compatible-Solute-Binding Protein OpuAC from Bacillus subtilis: Ligand Binding, Site-Directed Mutagenesis, and Crystallographic Studies
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligand binding protein
molecule keywords Glycine betaine-binding protein
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3chgA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3chgA01
4PFWA 4PFTA 4ZECA 4OEVA 4QFNA 3O9PA 2RKMA 5HM4B 4OFJA 1JEVA 1B52A 4ZEKA 4JSDA 1B5JA 3MZBA 4OESA 1B3FA 4GF8A 3TPAA 4QFLA 2OLBA 3QIMA 4OEUA 3T66A 1JEUA 1UIVA 3DP8A 4XKPA 5L8DA 2D5WA 4ONYA 2NOOA 1B4ZA 2WOPA 3E3KA 3PAMA 1OLCA 1B6HA 1B51A 4RA1A 4XKRA 4I9DA 3RYBA 1B40A 3MW0A 3RYAA 3MVWA 4OERA 4WEDA 1B5HA 1B3HA 3MVXA 4DCYA 4XKQA 1B32A 4QFPA 5F1QA 1ZTYA 3M8UA 1VR5A 1B7HA 1QKAA 2Z23A 1B05A 3RY3A 1B46A 4ZE8A 4XKNA 4ZEDA 1B1HA 3ZS6A 1ZU0A 2GRVA 1B0HA 4DCXA 1B4HA 1DPPA 3CHGA 4OETA 3DRKA 1ZLQA 3MVZA 4GL8A 1B9JA 4I8CA 3TCGA 3DRHA 3MVYA 4ZEBA 3TCHA 3LVUA 3DRIA 1JETA 3DRJA 2B4LA 4GFRA 1RKMA 4PFYA 4JSOA 3DRGA 3O6PA 5KZTA 1QKBA 1B3GA 3FTOA 1B3LA 1UIUA 4PFUA 4ZE9A 1B2HA 1B5IA 4OFLA 3DRFA 2WOKA 2WOLA 4QFKA 4ZEIA 2B4MA 4TOZA 1B58A 4OFOA 3TCFA 3RQTA 1DPEA 2O7IA 1OLAA 1UQWA 1XOCA 5ISUA 3I5OA 3MZ9A 4FAJA 4QFOA 5ICQA
chains in the Genus database with same CATH superfamily
3PPQA 2OCUA 5IM2A 1NUXA 3GLBA 4LATA 4IO4A 3PV0E 4JXIA 1NV3A 3MYUA 4U4SA 4JWYA 5KCJA 2HAVA 1XVXA 1B3FA 2CMOA 1T0KA 4N15A 3E13X 3K6XA 1EYIA 2O51A 2Z8DA 3ONMA 2CZIA 3RT8A 3CIJA 4G77A 3CFZA 1FBPA 2ESNA 1B4ZA 4OWDA 2XXYA 3V89B 1IZ1A 2WBDA 4LA9A 1EH3A 1FTKA 1US4A 3LSFB 1A55A 4KYSA 4PAFA 3OO6A 2VHAA 2XD3A 4HE1A 1M5CA 2Y84A 4DXCA 1BK4A 1MQGA 3FXUA 2XHDA 1SW5A 5AE4A 1KA1A 3HCQA 1NKXA 5EHMA 1MY3A 4X04A 4IO5A 3AXFA 5EYFA 4OANA 5H8HB 2P3NA 5I57B 3TEPA 3VVFA 1IMAA 4DE8A 3IJOB 1NNFA 2P1SA 5IGAA 2VOZA 3FTOA 2XWKA 4NEDA 1F9BA 5B7DA 3CRBA 3PU5A 4F3BA 1Y20A 3OXNA 3EKIA 4R9GA 4XF5A 3I3VA 4GX6A 1P1QA 5I56A 1S7YA 4PP0A 5L9OA 1P1WA 4OVQA 3MZ9A 4MCOA 2GHAA 5DTBA 1USYH 4QFNA 1MY4A 3ROJA 3O9PA 3K01A 3VV5A 1KA0A 3KC0A 4MLQA 1BTJA 2PYYA 3ODBA 4I3YA 5J1DA 1NH7A 4ESWA 1WVJA 1TWYA 1URDA 4NX1A 1JNFA 4N17A 1DSNA 4I3EA 1A7LA 1UTHB 4N6PA 1Y1MA 1MY2A 4EUOA 4P56A 1FTMA 4MAGA 3T9XB 4GWOA 1YZ0A 5F7VA 2ZZVA 3Q28A 4FIMA 1GV8A 1AL3A 4OVPA 4HW8A 4DLDA 3HSTA 3SEVA 1NFTA 3HFUA 1CB6A 2O6AA 4GWUA 5I2NB 4MBPA 1QVSA 2QL3A 4OZ9A 4DI4B 1NV2A 4OMBA 3G3FA 2QJEA 4PBHA 1MY1A 4N13A 5H8FA 4OVTA 1FTJA 3DRIA 2B4LA 2H99A 3PPOA 3HHGA 4G68B 2ZYMA 1PB8A 2G93A 4G68A 2F7AA 1DCUA 1IMBA 3V5AA 3OO7A 1SQYA 4KFQA 1B7UA 4MH5A 1OLAA 4YKIA 1NMUA 5AA2D 1JVYA 3OENA 4H45A 4LQ2A 4QRZA 5DVJA 4H8JA 4KQPA 4GWZA 5IZZA 3C32A 2FNCA 3OEKA 3CVGA 5FHOA 3B6WA 1VFEA 4WKMA 1LB9A 2DWIA 3PD9A 1MM7A 1LBZA 1O7TA 3T93B 3SZPA 1DBZA 1HSJA 4YU0A 4AS5A 4LQ5A 3KBZA 3FASA 4JVCA 4PFRA 4I9DA 3EPEA 3I6VA 5ET6A 5IZ1A 4QBAA 3SEWA 5TPAB 4N91A 4FEDA 3PUVE 1ZU0A 1LAHE 4C1UA 1II5A 4GX4A 3IB2A 3S9MC 5EHSA 4H1XA 1ZBMA 3RUMA 5L9SA 1DTGA 2E1SA 3UP9A 1DMBA 5IZ3B 5I58B 1QULA 1JQFA 3PUZE 4P0GA 2XXRA 5HPQA 3DELB 2Q8JA 4EF2A 1SYIA 2XX8A 3TTMA 1UIUA 1POY1 4ZE9A 1FJ6A 3TZAA 3K00A 3LBSA 3UK4A 4YB6A 3LSXA 1USYE 4F39A 1BP5A 3PD8A 1FBEA 4KI0E 3CG1A 5IAIA 3IB1A 2I6EA 3TODA 4G8HA 1LFGA 3O29A 1AIVA 2DS9A 3KG2A 1Q35A 1FJ9A 1FQDA 1SI0A 3D1RA 3H03A 4KD5A 4Z0IA 2XXVA 3TKDA 3FVGA 2RC9A 2H98A 4GXSB 1OVTA 2JJKA 2QS2A 2YLNA 4NF4A 5F1QA 5ET7A 1ZTYA 2VD3A 3VLWA 4NWCA 4ZZAA 4YKPA 4YB7A 1FPGA 4O7IA 3E78A 1N3WA 3H3GA 3UN6A 1B1XA 3RTFB 2GRVA 3PPRA 4RK9A 2H9BA 5CC2A 5ICTA 4OVJA 1FPDA 2F35A 1NI9A 3TTRA 4O7MA 4NGUA 1FQBA 3KEIA 4IGTA 4GWXA 3CG3A 2HCAA 2FA7A 4BDMA 2QRYA 1EZOA 2XXIA 4G2ZA 1MH4A 4PCDA 1B3GA 3QUFA 3BFUA 4PFUA 1QUKA 1IXIA 1N3XA 1Y4CA 3TTLA 3ZKKA 4X1DA 4TOZA 5FTIA 2F34A 4OYVA 2XXXA 4N6KA 3RQTA 4RXLA 2DXRA 3PUXE 5JK4A 3A29A 1OQHA 1YAEA 4XFEA 1HSEA 4GOTA 1BKAA 4ZECA 1IEJA 2ZMBA 4GXAA 3D4CA 1Q1KA 4PDHA 2GFEA 3O6IA 3B50A 5KDTA 3QMFA 2Z8EA 4ISUA 3E4RA 4GRKA 1RYXA 1EU8A 1JW5A 1JEUA 1Z7NE 1Y4TA 3C35A 1Y3PA 3C34A 1Y1ZA 2O84X 2HQ0A 1I6BA 3PAMA 3FUZA 4ELRA 1FPKA 3WAFA 2ZNTA 4DXUA 2Q2CA 3GYYA 4XKQA 3KGCA 4QFPA 3TTKA 3IK6B 1VR5A 3U65A 1IIWA 3LUZA 4M4GA 4BLAA 4P8BA 5AA4B 1B46A 1MXUA 4QHQA 3OO8A 5AA3A 2B3FA 4EXLA 4G68C 3H4ZA 3K1PA 4FECA 4DCXA 1UTBA 2RCAA 3KFMA 3SERA 2AL5A 4KPTA 4ZEBA 4H8IA 1VFDA 2W7YA 3IAZA 4NF6A 4HE0A 1LCFA 5H8NA 1FPLA 3ILUB 3BIHA 4XIGQ 2DOJA 2PVUA 1QGXA 4X48A 3U72A 2P3VA 3BKIB 2OX3A 2CZHA 3FATA 4I62A 1JW1A 1MPCA 3R26A 2UYFA 3H6WA 2ZZWA 3FVOA 2Y7RA 1M5EA 4F3SA 3K6WA 2PFZA 2GHBA 2V4CA 4YMAA 1JVXA 1B5JA 4PQJA 1WODA 4IO2A 3FD3A 2RINA 4PGNA 3E9XA 1XVYA 3GZGA 1LBYA 1O63A 2FVZA 4XKPA 2FYIA 3UORA 4OVSA 5H8QA 4F31B 3A3UA 3VVDA 4XKRA 1NV0A 1G0HA 1PBQA 2OK2A 3T9VA 2QS1A 1XHYA 4Q5TA 1P1NA 2REJA 4MNCA 3IFCA 2V3UA 4IY5A 2X26A 3FZVA 2R9JA 1PB9A 2UVJA 2WKYA 5I2KB 4OXVA 1KWHA 4LN5A 5H8HA 5I2KA 1I6AA 3FIRA 3SEUA 1B1HA 4ZZEA 3HV1A 1DPPA 3N5LA 4F2OA 3PUYE 4JWXA 4YB5A 4I8CA 2XD2A 4PF6A 1NUYA 2WBBA 5KZTA 1S9TA 1FPIA 1LBCA 3T22A 2KQZA 2DSFA 3TAJA 3OELA 2QS3A 3RPLA 5TP9A 1FBHA 3FXBA 3FJ7A 4FE8A 1MXXA 1EZ9A 3K6VA 4IO6A 1Y9UA 2CEYA 2P0SA 3O6GA 4NHBA 3EF7A 2RCBA 4RPNA 1D4NA 4ZS9A 5FBPA 5DVIA 3K6UA 1B3EA 2THIA 1DK4A 2VP1A 4Z7EA 2DE4A 1AOVA 4ELPA 3T9UA 3TUSA 1ZKBA 3LSWA 3T66A 1B0LA 1JW4A 3WAEA 4TLLB 2GH9A 1LCTA 2Y5KA 1FQFA 3ECRA 4ND9A 3O66A 4OTEA 2F8DA 2QSXA 4ONYA 1N04A 3EQ1A 3Q25A 4UACA 3PUWE 4LUBA 3RYBA 4PAIA 5JTYB 4RNSA 3MVXA 4DCYA 4IB2A 4HCWA 4UA8A 3CFXA 3RYDA 2Z23A 4F3GA 2Q9TA 1LB8A 1EYJA 2F3DA 5EQ9A 2O68A 3FJGA 2I3WA 4DIGA 1B0HA 2V93A 2YPNA 4NF8A 3TYHA 2HPGA 1QJMA 1QUIA 2ZXTA 4NF0A 3MVYA 2R71A 2ZZXA 4OA4A 4JSOA 1LBXA 2DDKA 4AB6A 4MNIA 4YAHX 4U1OA 2WYKA 3JYRA 2ZYOA 3KZGA 4O94A 3DRFA 1MDQA 4U23A 4QFKA 2FIXA 3KC1A 3MP8A 1SVXB 1MRPA 1EYKA 5FHMA 4MX6A 4GX3A 1K9YA 4POWA 1Z7ME 1Q9DA 3C9HA 2DWJA 1FW0A 2YJPA 4OFJA 1HSLA 2F97A 2DE2A 5H8FB 3T9HB 4RK2A 3RN8A 4PTKA 2ANJA 1SW2A 1NV7A 3EN3A 3OOAA 4R2BA 5ET5A 1D9QA 4P9KA 1YXIA 3PPPA 5L8DA 1FCKA 2F7CA 1IXHA 4F1VA 1B6HA 4RA1A 2UYEA 3MVWA 3E79A 1FBFA 2F5XA 2PMSA 4GBWA 3C33A 4LZ7A 3RY3A 3LV0A 1SYHA 4H65A 1US5A 4MMPA 1QUJA 3QYTA 3UA8A 2QS4A 1A54A 1MQDA 4OENA 3V8XB 1FPBA 4H67A 1N76A 2ONRA 3EHTA 5B70A 1IITA 4N6DA 1LAXA 1GGGA 4OETA 4LVQA 4DXBA 3MVZA 1N84A 2XXTA 1FPEA 4RYAA 1H43A 4QSEA 3TCHA 3HO7A 3DRJA 3IOUA 1M5DA 5H8QB 4PFYA 3SEYA 1NV5A 4X8RA 1B5IA 2WOKA 4LZ5A 4X1BA 3TCFA 4TLMB 4R6KA 1EZPA 3O28A 2O7IA 2H4IA 3MPKA 4O3BA 3MWBA 3K1MA 4PF8A 4Q30B 5EQAA 2DYXA 2CEXA 3IFAA 1IXCA 2VT5A 2CZLA 1NUWA 2IEEA 4P0IA 3GBAA 4R75A 2VGQA 1JEVA 1IQ7A 3SEXA 1NNKA 4IGRA 4OESA 3CSBA 3MUQA 1H76A 4YKJA 3DP8A 1FRPA 3QUJA 2PX1A 4MFIA 4GBVA 2V3TA 2OZZA 4P1EA 2XXWA 2XX7A 5CMCA 3V83A 4OVRA 1FQCA 3VFJA 4U21A 2X7QA 1PDAA 2WYPA 3FVNA 4QXDA 5CRYA 1G0IA 4MF3A 2M8CA 2I0CA 3FBPA 3VE1B 3TMGA 2H25A 3R6UA 3H06B 3TDJA 5I59B 1TT1A 1R9LA 4U2RA 3THIA 3SESA 1GTKA 3N6UA 5DVFA 2WX9A 4F19A 3M3LA 4GD5A 3LVUA 4ZDMA 2GQ1A 4GFRA 3PMVA 1P1UA 4BDLA 4DDDA 2DVCA 2V3QA 2HZLA 1LAFE 1H45A 3MP1A 3O6HA 2Q89A 3FVKA 2I0BA 1D9VA 4G61A 2DXYA 1MS7A 4H5FA 1N0TA 4M1VA 4GWYA 1FSAA 2O1LA 1UQWA 2RF1A 2BJIA 3I5OA 3R7XA 1M5FA 1PEBA 2G29A 3KJ7A 2Q8MA 3KOTA 3P7IA 1YPNA 4P11A 3FGSA 3T96B 1XC1A 3VXCA 1I6QA 2Y7IA 4GWSA 3A09A 5DEXB 4GF8A 4MNPA 4YICA 4THIA 3D4GA 3DP6A 1UTBB 3ZKLA 1BLFA 4P3LA 3C4MA 3LUYA 2Y7WA 5CBRA 2HXRA 2NOOA 4YKKA 4ELOA 1B51A 1A99A 1AMFA 4PFBA 3IL1B 3MAMA 1B5HA 4UABA 4EQBA 1IMCA 3M8UA 1KZ8A 5I2NA 3S2VA 5IKBA 1UTHA 2Q74A 1SPIA 4XKNA 3M3KA 1IMFA 3FV1A 5ITOA 1LLSA 2PBWA 1LBWA 3OEMA 1NNTA 2OWSA 3RPWA 4FORA 5I57A 3IOWA 2O1MA 3U93A 5ESYA 3PGFA 5DEXA 4JVDA 2L5VA 5DYHA 3EHSA 3N94A 3GBBA 3IOVA 1MQIA 3K0VA 1MPBA 4JBZA 1FPFA 1SDXA 3SETA 4HXVA 4GLIA 1FQAA 2F78A 2A5TA 5J16A 2WOLA 3ISPA 1MXZA 3O2AA 4KYEA 3QXMA 4Q8RA 2DWHA 4NF5B 3W9WA 4P47A 1DPEA 4KCCA 4F29A 2I48A 3BIGA 5ICQA 5BWJA 1P1OA 2R6GE 4AB5A 4PFTA 4OEVA 2UVGA 3OD7A 2ZYKA 4O3AA 2XA5A 3G3GA 5ELVA 2XXUA 1A8EA 1A40A 1PB7A 4DZ1A 2XWIA 1LAGE 3TPAA 3G3IA 5H8SA 5FHNA 2OLBA 3QIMA 1K9ZA 3RT6B 3B7DA 4N8GA 3CI8A 2D5WA 1IMEA 5I58A 5I7IA 4TQUQ 4WEDA 3QK6A 5M2VA 1SD3A 3L6GA 1JP4A 4PE3A 2BJJX 3NOHA 1LSTA 5TP9B 1CE2A 3PMXA 2UVIA 2FIEA 1M5BA 1NL5A 2QFLA 2QMXA 4PBQA 2I4BA 3T1BA 1Y3NA 4XTCQ 3FXRA 3KN3A 1NUZA 2Z22A 1B4HA 4H6DA 4NQ8A 4IY6A 4POXA 4GQOA 3HHFA 2B65A 2X7PA 3KSXA 1A8FA 4NTLA 4JB7A 1OIBA 1PBPA 4JDFA 4R72A 1OMPA 2XXKA 2RC7A 1AH5A 1QKBA 3DLNA 3TFLA 3U94A 3W9VA 2O69A 1MG1A 2B4MA 3IORA 3PPNA 3MBPA 4OFOA 4ELQA 2I58A 5CI5A 1FBGA 3TQWA 1NH8A 3MQ9A 1SW4A 5ISUA 5LOMA 1MH3A 4PFWA 5EYGA 2F6PA 3LR1A 4IR8A 3N26A 2ZNSA 1RDXA 1LFHA 3TQLA 3MZBA 5TU0A 3S4UA 4BDOA 5DT6A 3LC8A 4N81A 4NWDA 1TFDA 4KCDA 1CNQA 4OQOA 4ECFA 1PC3A 1OLCA 1FBCA 3MW0A 3RYAA 2LAOA 4F2QA 1B32A 4FATA 3BBRA 1MXYA 4RY1A 3RGYA 4NF8B 3QSLA 4NN3A 3FV2A 3JV9A 5I59A 4R9FA 3KN7A 2KLFA 2UVHA 1XS5A 3ZS6A 5KCJB 5I84A 2UXAA 2OBGA 3HN0A 1R6ZA 1YYZA 4O3CA 3C36A 5ET8A 2QVUA 3DM0A 4YZZA 1O64A 3ILTB 4GVOA 1ZLQA 3S9LC 1B9JA 3TCGA 1POTA 4XEQA 4N4UA 5CM6A 5JEIA 1URSA 2AL4A 4C0RA 2PT2A 4PAKA 3Q26A 4G8NA 3H6UA 4LP2B 3A3CA 1MQJA 4MLVA 4EXKA 1VDWA 5CMBA 4FAJA 1XT8A 4K3FA 2I3VA 3G3KA 2REGA 2RKMA 1RDYA 2E0SA 3VVEA 2Y7KA 1LBBA 2B3BA 2OWTA 2OWZA 5K2XA 2IA4A 3Q29A 3KN8A 3VLUA 3IJXB 1UIVA 4F1YA 1DTZA 3IB0A 5BUUA 3CSGA 5I5PA 1OQGA 1B7ZA 3G3JA 5T3JA 1IXGA 4FBPA 4PDDA 4XXUA 3M3FA 3TTNA 2XWOA 1ELJA 3EHUA 5H8NB 4R2FA 4E0WA 4PGPA 4Q0CA 2V25A 2HEUA 1RYOA 3KSJA 3T0JA 2HAUA 1MXVA 3MP6A 4AS4A 4FJPA 3F11A 3JZJA 1NV1A 4YMBA 3DRKA 3S9NC 1N7WA 4KR5A 3DRHA 3IO6A 2NUVA 2QMWA 3OSRA 2XXPA 1JETA 1H3DA 2NWJA 3B6TA 2Z8FA 4N07A 3DRGA 4R6YA 2A5TB 2F36A 2I4CA 4KHZE 5JTYA 4HTGA 3KBRA 1FTAA 2FBPA 1B58A 1MY0A 3OSQA 1S50A 5A5XA 4R6HA 1YTVA 3K4UA 2D3IA 3W15C 2XX9A 2AYSA 1TXFA 1LBVA 4GWWA 1FBDA 5CMKA 5DW8A 1I69A 2A5SA 3UGWA 1P99A 3SDFA 4R73A 2ALUA 4EQ7A 5CMMA 4JWOA 2VD2A 5I3SA 4NMYA 4RPOA 5ITPA 2F7BA 2NVUB 4NG7A 2WOPA 3E3KA 3MJNA 1IUDA 4I1DA 3K02A 1B3HA 4BDRA 2DWAA 1SBPA 4MIJA 5L9MA 2PCRA 4NF4B 3VDFA 4NAPA 4NF5A 1D3KA 2RC8A 3USDA 1URGA 4O8MA 1R9QA 4OHNA 2WEFA 4DI3D 3Q27A 5IZ3A 3VLVA 2Y7PA 3CHGA 4LZ8A 3GXAA 3RTWB 3KJTA 4HE2A 3RPLB 4IO7A 4F3PA 1D9YA 1AWBA 2XXQA 4MEVA 5AA1A 3CFLA 2ZNUA 4GIZA 1ANFA 2ONKE 1LEVA 1B2HA 2NXOA 4KXPA 4LONB 4PC9A 5LTCA 2HHMA 5TPAA 5I56B 4EF1A 3IX1A 3UIFA 4MJOA 2KR0A 4N8YA 1DOTA 1MPDA 3U1OA 1ZMGA 1SI1A 3RNNA 3OO9A 1NNPA 4P1LA 4F1UA 3IO4A 4PE5B 4RJZA 1B52A 4ZEKA 4JSDA 2PFYA 5KDTB 3K2DA 1QW0A 1GR2A 2AIXA 2Q88A 2F6GA 1XI6A 4NE4A 4ZEFA 2MKZA 4U1ZA 4QFLA 3CR9A 4U4XA 1J1NA 4OEUA 4NF6B 1VE4A 1L5TA 1MQHA 3LSLA 2FHYA 3H7MA 4L17A 1ATGA 3MSTA 1B40A 2DE3A 4H46A 3U8QA 3S9EA 3FXQA 1B7HA 1QKAA 4GL0A 4U22A 4X9TA 2DVZA 2H5YA 5LDZA 4PFIA 1Y3QA 4ZEDA 2R8TA 2Q2AA 4G8MA 4PETA 3H6VA 4KYDA 1SW1A 1LGBC 3MZ1A 4G4PA 5K2YA 4GL8A 2VPNA 3ZSFA 4EQ9A 2HZKA 1LFIA 3U92A 3B8BA 4H0WA 1NV6A 2XXHA 3O6PA 4WEPA 1MXWA 1FQEA 1H44A 4F18A 2V84A 2P2AA 5CBSA 4OFLA 2ABHA 5A5LA 3HPIA 4C1TA 3TELA 3KOSA 3IR1A 3O97A 3SKPA 4WXJA 1IMDA 5F24A 3OMBA 4BDNA 1INPA 1YCJA 1FPJA 5HM4B 1MDP1 4MHFA 3MPLA 5FTHA 2VPOA 1N7XA 3VXBA 2HXWA 2PT1A 1ZJLA 5AA2B 4BDQA 2D21A 5EYHA 4HS7A 1BIYA 3MC2A 5HBCA 3PTYA 5AA2A 2I49A 2DQVA 1VSOA 4QF9A 5EQ7A 2ZYNA 1RDZA 3DP4A 5A5XB 4OERA 4F22A 3FJMA 1TFAA 3L6HA 2QVVA 1GVCA 4I40A 1OVBA 1B05A 3IOTA 3RLFE 5EQ8A 2QPQA 2DP8A 4HCYA 3K1NA 4ZE8A 1FTOA 4H5GA 3B6QA 2O7UA 4ESXA 2XWVA 1ZIUA 4IO3A 4E0XA 2OJTA 4EDPA 1FTLA 2F3BA 2CZKA 4AQ4A 3BFTA 3H6TA 2HFBA 1MM6A 4JVIA 3G3HA 3PMWA 4FEBA 3QAXA 1RKMA 2QVRA 1B3LA 3G7WA 5AA4A 4ZEIA 1R1NA 1WDNA 3C31A 2Y5LA 2ONSA 1NV4A 1XOCA 4R74A 4QSDA 4QSCA 3N6TA 4QFOA
chains in the Genus database with same CATH topology
2CEXA 3IFAA 4ZECA 5IM2A 2VT5A 1NUXA 1NUWA 2RKMA 4PDHA 1RDYA 3B50A 1JEVA 1NV3A 3MYUA 3QMFA 2OWZA 4OESA 1B3FA 1JEUA 1UIVA 4N15A 5I5PA 3DP8A 1EYIA 1FRPA 5T3JA 2CZIA 4GBVA 4FBPA 1FBPA 4PDDA 1B4ZA 3PAMA 4P1EA 4OVRA 2XWOA 2WBDA 1FPKA 4PGPA 2WYPA 3GYYA 4XKQA 4QFPA 1VR5A 4QXDA 4PAFA 1G0IA 3U65A 3LUZA 4P8BA 4HE1A 1B46A 3FBPA 3T0JA 1BK4A 4AS4A 1KA1A 1NV1A 4X04A 4DCXA 4OANA 2P3NA 2WX9A 3DRKA 1IMAA 4F19A 3DRHA 4ZEBA 3LVUA 1JETA 2GQ1A 4GFRA 3DRGA 2V3QA 4HE0A 5IGAA 2HZLA 1FPLA 3FTOA 2XWKA 3BIHA 1QGXA 4G61A 3EKIA 4XF5A 2P3VA 4GX6A 2OX3A 2CZHA 1FTAA 2FBPA 1B58A 4M1VA 4GWYA 1FSAA 1UQWA 2BJIA 2ZZWA 4OVQA 3I5OA 3MZ9A 4MCOA 1LBVA 2Q8MA 4GWWA 4QFNA 1FBDA 5DW8A 3ROJA 3O9PA 2PFZA 2V4CA 1KA0A 3KC0A 4GWSA 1B5JA 4GF8A 4MNPA 4YICA 4PGNA 4I3YA 5J1DA 5I3SA 1LBYA 2FVZA 4XKPA 4P3LA 4OVSA 4NX1A 4N17A 2HXRA 2NOOA 4NG7A 2WOPA 3E3KA 4XKRA 1B51A 4I3EA 1NV0A 1G0HA 4PFBA 1B5HA 1B3HA 4UABA 4MIJA 1IMCA 3M8UA 4MNCA 3IFCA 1KZ8A 2PCRA 4NAPA 4P56A 4MAGA 1YZ0A 2Q74A 2ZZVA 4O8MA 4LN5A 1SPIA 4XKNA 4OVPA 1IMFA 2WEFA 1B1HA 4GWUA 3HFUA 4DI3D 1LBWA 5IZ3A 4DI4B 1DPPA 3CHGA 1NV2A 5ESYA 4PBHA 4I8CA 4JVDA 2L5VA 4OVTA 3DRIA 4PF6A 1NUYA 4HE2A 2B4LA 3RPLB 1AWBA 1FPFA 2WBBA 4MEVA 5KZTA 4HXVA 1FPIA 1LEVA 2KQZA 1B2HA 5J16A 1DCUA 1IMBA 4KXPA 3RPLA 2WOLA 3ISPA 1FBHA 4PC9A 5LTCA 3FXBA 2HHMA 3W9WA 4P47A 1DPEA 4MJOA 1OLAA 2KR0A 2CEYA 4N8YA 4H45A 3BIGA 5ICQA 4NHBA 4PFTA 4OEVA 4GWZA 4P1LA 5IZZA 5FBPA 4F1UA 2XA5A 1DK4A 1B52A 4ZEKA 4JSDA 2PFYA 2DE4A 2XWIA 1XI6A 3TPAA 1LBZA 2MKZA 4QFLA 3SZPA 2OLBA 3QIMA 1DBZA 4OEUA 3T66A 1K9ZA 2Y5KA 4N8GA 4AS5A 2D5WA 4ONYA 1IMEA 2FHYA 3KBZA 3MSTA 4JVCA 4PFRA 5I7IA 3RYBA 4I9DA 1B40A 4PAIA 4WEDA 2DE3A 3MVXA 4DCYA 4H46A 1B7HA 4HCWA 1JP4A 4PE3A 5ET6A 3RYDA 1QKAA 3NOHA 2Z23A 5IZ1A 4QBAA 4X9TA 2DVZA 5LDZA 4PFIA 2Q9TA 2FIEA 1EYJA 2F3DA 5EQ9A 4N91A 4PBQA 2QFLA 3T1BA 4ZEDA 2R8TA 1ZU0A 1NUZA 4GX4A 4PETA 1B0HA 2HPGA 1B4HA 4GL8A 4NQ8A 2VPNA 2HZKA 4NF0A 3MVYA 3B8BA 5IZ3B 2ZZXA 4OA4A 1NV6A 4JSOA 1LBXA 2DDKA 2XXKA 3O6PA 1QKBA 4MNIA 4F18A 1UIUA 4ZE9A 3W9VA 2WYKA 4O94A 4OFLA 3DRFA 1FJ6A 4QFKA 5A5LA 2FIXA 2B4MA 3KC1A 4OFOA 1FBEA 1FBGA 1EYKA 1IMDA 5F24A 5ISUA 4MX6A 4GX3A 1K9YA 4PFWA 5EYGA 1Q9DA 1INPA 4IR8A 1FPJA 5HM4B 4OFJA 4MHFA 2DE2A 1RDXA 3MZBA 2VPOA 4PTKA 1NV7A 1FJ9A 5ET5A 1D9QA 5EYHA 4P9KA 3D1RA 1YXIA 4N81A 3PTYA 5L8DA 1CNQA 5EQ7A 4F1VA 1RDZA 1OLCA 1B6HA 4RA1A 1FBCA 3MW0A 3RYAA 3MVWA 4OERA 3E79A 2JJKA 1FBFA 2F5XA 5F1QA 1B32A 5ET7A 1ZTYA 2QVVA 4I40A 4GBWA 1B05A 3RY3A 3LV0A 5EQ8A 2QPQA 4MMPA 4HCYA 1FPGA 4O7IA 4NN3A 3E78A 4ZE8A 1FPBA 3ZS6A 2XWVA 4XFEA 2GRVA 1YYZA 4N6DA 2F3BA 2QVUA 2CZKA 4YZZA 1FPDA 5ET8A 4OETA 1NI9A 4O7MA 1ZLQA 3MVZA 1FPEA 1B9JA 3TCGA 4JVIA 4NGUA 4XEQA 4N4UA 3TCHA 5CM6A 4GWXA 3DRJA 1RKMA 4PFYA 2QVRA 4PCDA 1B3GA 1NV5A 1B3LA 4PFUA 4X8RA 1B5IA 2WOKA 4ZEIA 4TOZA 3TCFA 4PAKA 4N6KA 3RQTA 2Y5LA 5JK4A 2O7IA 1NV4A 3A29A 1XOCA 1VDWA 4FAJA 4PF8A 4QFOA 5EQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFW A;  4PFT A;  4ZEC A;  4OEV A;  4QFN A;  3O9P A;  2RKM A;  5HM4 B;  4OFJ A;  1JEV A;  1B52 A;  4ZEK A;  4JSD A;  1B5J A;  3MZB A;  4OES A;  1B3F A;  4GF8 A;  3TPA A;  4QFL A;  2OLB A;  3QIM A;  4OEU A;  3T66 A;  1JEU A;  1UIV A;  3DP8 A;  4XKP A;  5L8D A;  2D5W A;  4ONY A;  2NOO A;  1B4Z A;  2WOP A;  3E3K A;  3PAM A;  1OLC A;  1B6H A;  1B51 A;  4RA1 A;  4XKR A;  4I9D A;  3RYB A;  1B40 A;  3MW0 A;  3RYA A;  3MVW A;  4OER A;  4WED A;  1B5H A;  1B3H A;  3MVX A;  4DCY A;  4XKQ A;  1B32 A;  4QFP A;  5F1Q A;  1ZTY A;  3M8U A;  1VR5 A;  1B7H A;  1QKA A;  2Z23 A;  1B05 A;  3RY3 A;  1B46 A;  4ZE8 A;  4XKN A;  4ZED A;  1B1H A;  3ZS6 A;  1ZU0 A;  2GRV A;  1B0H A;  4DCX A;  1B4H A;  1DPP A;  3CHG A;  4OET A;  3DRK A;  1ZLQ A;  3MVZ A;  4GL8 A;  1B9J A;  4I8C A;  3TCG A;  3DRH A;  3MVY A;  4ZEB A;  3TCH A;  3LVU A;  3DRI A;  1JET A;  3DRJ A;  2B4L A;  4GFR A;  1RKM A;  4PFY A;  4JSO A;  3DRG A;  3O6P A;  5KZT A;  1QKB A;  1B3G A;  3FTO A;  1B3L A;  1UIU A;  4PFU A;  4ZE9 A;  1B2H A;  1B5I A;  4OFL A;  3DRF A;  2WOK A;  2WOL A;  4QFK A;  4ZEI A;  2B4M A;  4TOZ A;  1B58 A;  4OFO A;  3TCF A;  3RQT A;  1DPE A;  2O7I A;  1OLA A;  1UQW A;  1XOC A;  5ISU A;  3I5O A;  3MZ9 A;  4FAJ A;  4QFO A;  5ICQ A; 
#chains in the Genus database with same CATH topology
 3PPQ A;  2OCU A;  5IM2 A;  1NUX A;  3GLB A;  4LAT A;  4IO4 A;  3PV0 E;  4JXI A;  1NV3 A;  3MYU A;  4U4S A;  4JWY A;  5KCJ A;  2HAV A;  1XVX A;  1B3F A;  2CMO A;  1T0K A;  4N15 A;  3E13 X;  3K6X A;  1EYI A;  2O51 A;  2Z8D A;  3ONM A;  2CZI A;  3RT8 A;  3CIJ A;  4G77 A;  3CFZ A;  1FBP A;  2ESN A;  1B4Z A;  4OWD A;  2XXY A;  3V89 B;  1IZ1 A;  2WBD A;  4LA9 A;  1EH3 A;  1FTK A;  1US4 A;  3LSF B;  1A55 A;  4KYS A;  4PAF A;  3OO6 A;  2VHA A;  2XD3 A;  4HE1 A;  1M5C A;  2Y84 A;  4DXC A;  1BK4 A;  1MQG A;  3FXU A;  2XHD A;  1SW5 A;  5AE4 A;  1KA1 A;  3HCQ A;  1NKX A;  5EHM A;  1MY3 A;  4X04 A;  4IO5 A;  3AXF A;  5EYF A;  4OAN A;  5H8H B;  2P3N A;  5I57 B;  3TEP A;  3VVF A;  1IMA A;  4DE8 A;  3IJO B;  1NNF A;  2P1S A;  5IGA A;  2VOZ A;  3FTO A;  2XWK A;  4NED A;  1F9B A;  5B7D A;  3CRB A;  3PU5 A;  4F3B A;  1Y20 A;  3OXN A;  3EKI A;  4R9G A;  4XF5 A;  3I3V A;  4GX6 A;  1P1Q A;  5I56 A;  1S7Y A;  4PP0 A;  5L9O A;  1P1W A;  4OVQ A;  3MZ9 A;  4MCO A;  2GHA A;  5DTB A;  1USY H;  4QFN A;  1MY4 A;  3ROJ A;  3O9P A;  3K01 A;  3VV5 A;  1KA0 A;  3KC0 A;  4MLQ A;  1BTJ A;  2PYY A;  3ODB A;  4I3Y A;  5J1D A;  1NH7 A;  4ESW A;  1WVJ A;  1TWY A;  1URD A;  4NX1 A;  1JNF A;  4N17 A;  1DSN A;  4I3E A;  1A7L A;  1UTH B;  4N6P A;  1Y1M A;  1MY2 A;  4EUO A;  4P56 A;  1FTM A;  4MAG A;  3T9X B;  4GWO A;  1YZ0 A;  5F7V A;  2ZZV A;  3Q28 A;  4FIM A;  1GV8 A;  1AL3 A;  4OVP A;  4HW8 A;  4DLD A;  3HST A;  3SEV A;  1NFT A;  3HFU A;  1CB6 A;  2O6A A;  4GWU A;  5I2N B;  4MBP A;  1QVS A;  2QL3 A;  4OZ9 A;  4DI4 B;  1NV2 A;  4OMB A;  3G3F A;  2QJE A;  4PBH A;  1MY1 A;  4N13 A;  5H8F A;  4OVT A;  1FTJ A;  3DRI A;  2B4L A;  2H99 A;  3PPO A;  3HHG A;  4G68 B;  2ZYM A;  1PB8 A;  2G93 A;  4G68 A;  2F7A A;  1DCU A;  1IMB A;  3V5A A;  3OO7 A;  1SQY A;  4KFQ A;  1B7U A;  4MH5 A;  1OLA A;  4YKI A;  1NMU A;  5AA2 D;  1JVY A;  3OEN A;  4H45 A;  4LQ2 A;  4QRZ A;  5DVJ A;  4H8J A;  4KQP A;  4GWZ A;  5IZZ A;  3C32 A;  2FNC A;  3OEK A;  3CVG A;  5FHO A;  3B6W A;  1VFE A;  4WKM A;  1LB9 A;  2DWI A;  3PD9 A;  1MM7 A;  1LBZ A;  1O7T A;  3T93 B;  3SZP A;  1DBZ A;  1HSJ A;  4YU0 A;  4AS5 A;  4LQ5 A;  3KBZ A;  3FAS A;  4JVC A;  4PFR A;  4I9D A;  3EPE A;  3I6V A;  5ET6 A;  5IZ1 A;  4QBA A;  3SEW A;  5TPA B;  4N91 A;  4FED A;  3PUV E;  1ZU0 A;  1LAH E;  4C1U A;  1II5 A;  4GX4 A;  3IB2 A;  3S9M C;  5EHS A;  4H1X A;  1ZBM A;  3RUM A;  5L9S A;  1DTG A;  2E1S A;  3UP9 A;  1DMB A;  5IZ3 B;  5I58 B;  1QUL A;  1JQF A;  3PUZ E;  4P0G A;  2XXR A;  5HPQ A;  3DEL B;  2Q8J A;  4EF2 A;  1SYI A;  2XX8 A;  3TTM A;  1UIU A;  1POY 1;  4ZE9 A;  1FJ6 A;  3TZA A;  3K00 A;  3LBS A;  3UK4 A;  4YB6 A;  3LSX A;  1USY E;  4F39 A;  1BP5 A;  3PD8 A;  1FBE A;  4KI0 E;  3CG1 A;  5IAI A;  3IB1 A;  2I6E A;  3TOD A;  4G8H A;  1LFG A;  3O29 A;  1AIV A;  2DS9 A;  3KG2 A;  1Q35 A;  1FJ9 A;  1FQD A;  1SI0 A;  3D1R A;  3H03 A;  4KD5 A;  4Z0I A;  2XXV A;  3TKD A;  3FVG A;  2RC9 A;  2H98 A;  4GXS B;  1OVT A;  2JJK A;  2QS2 A;  2YLN A;  4NF4 A;  5F1Q A;  5ET7 A;  1ZTY A;  2VD3 A;  3VLW A;  4NWC A;  4ZZA A;  4YKP A;  4YB7 A;  1FPG A;  4O7I A;  3E78 A;  1N3W A;  3H3G A;  3UN6 A;  1B1X A;  3RTF B;  2GRV A;  3PPR A;  4RK9 A;  2H9B A;  5CC2 A;  5ICT A;  4OVJ A;  1FPD A;  2F35 A;  1NI9 A;  3TTR A;  4O7M A;  4NGU A;  1FQB A;  3KEI A;  4IGT A;  4GWX A;  3CG3 A;  2HCA A;  2FA7 A;  4BDM A;  2QRY A;  1EZO A;  2XXI A;  4G2Z A;  1MH4 A;  4PCD A;  1B3G A;  3QUF A;  3BFU A;  4PFU A;  1QUK A;  1IXI A;  1N3X A;  1Y4C A;  3TTL A;  3ZKK A;  4X1D A;  4TOZ A;  5FTI A;  2F34 A;  4OYV A;  2XXX A;  4N6K A;  3RQT A;  4RXL A;  2DXR A;  3PUX E;  5JK4 A;  3A29 A;  1OQH A;  1YAE A;  4XFE A;  1HSE A;  4GOT A;  1BKA A;  4ZEC A;  1IEJ A;  2ZMB A;  4GXA A;  3D4C A;  1Q1K A;  4PDH A;  2GFE A;  3O6I A;  3B50 A;  5KDT A;  3QMF A;  2Z8E A;  4ISU A;  3E4R A;  4GRK A;  1RYX A;  1EU8 A;  1JW5 A;  1JEU A;  1Z7N E;  1Y4T A;  3C35 A;  1Y3P A;  3C34 A;  1Y1Z A;  2O84 X;  2HQ0 A;  1I6B A;  3PAM A;  3FUZ A;  4ELR A;  1FPK A;  3WAF A;  2ZNT A;  4DXU A;  2Q2C A;  3GYY A;  4XKQ A;  3KGC A;  4QFP A;  3TTK A;  3IK6 B;  1VR5 A;  3U65 A;  1IIW A;  3LUZ A;  4M4G A;  4BLA A;  4P8B A;  5AA4 B;  1B46 A;  1MXU A;  4QHQ A;  3OO8 A;  5AA3 A;  2B3F A;  4EXL A;  4G68 C;  3H4Z A;  3K1P A;  4FEC A;  4DCX A;  1UTB A;  2RCA A;  3KFM A;  3SER A;  2AL5 A;  4KPT A;  4ZEB A;  4H8I A;  1VFD A;  2W7Y A;  3IAZ A;  4NF6 A;  4HE0 A;  1LCF A;  5H8N A;  1FPL A;  3ILU B;  3BIH A;  4XIG Q;  2DOJ A;  2PVU A;  1QGX A;  4X48 A;  3U72 A;  2P3V A;  3BKI B;  2OX3 A;  2CZH A;  3FAT A;  4I62 A;  1JW1 A;  1MPC A;  3R26 A;  2UYF A;  3H6W A;  2ZZW A;  3FVO A;  2Y7R A;  1M5E A;  4F3S A;  3K6W A;  2PFZ A;  2GHB A;  2V4C A;  4YMA A;  1JVX A;  1B5J A;  4PQJ A;  1WOD A;  4IO2 A;  3FD3 A;  2RIN A;  4PGN A;  3E9X A;  1XVY A;  3GZG A;  1LBY A;  1O63 A;  2FVZ A;  4XKP A;  2FYI A;  3UOR A;  4OVS A;  5H8Q A;  4F31 B;  3A3U A;  3VVD A;  4XKR A;  1NV0 A;  1G0H A;  1PBQ A;  2OK2 A;  3T9V A;  2QS1 A;  1XHY A;  4Q5T A;  1P1N A;  2REJ A;  4MNC A;  3IFC A;  2V3U A;  4IY5 A;  2X26 A;  3FZV A;  2R9J A;  1PB9 A;  2UVJ A;  2WKY A;  5I2K B;  4OXV A;  1KWH A;  4LN5 A;  5H8H A;  5I2K A;  1I6A A;  3FIR A;  3SEU A;  1B1H A;  4ZZE A;  3HV1 A;  1DPP A;  3N5L A;  4F2O A;  3PUY E;  4JWX A;  4YB5 A;  4I8C A;  2XD2 A;  4PF6 A;  1NUY A;  2WBB A;  5KZT A;  1S9T A;  1FPI A;  1LBC A;  3T22 A;  2KQZ A;  2DSF A;  3TAJ A;  3OEL A;  2QS3 A;  3RPL A;  5TP9 A;  1FBH A;  3FXB A;  3FJ7 A;  4FE8 A;  1MXX A;  1EZ9 A;  3K6V A;  4IO6 A;  1Y9U A;  2CEY A;  2P0S A;  3O6G A;  4NHB A;  3EF7 A;  2RCB A;  4RPN A;  1D4N A;  4ZS9 A;  5FBP A;  5DVI A;  3K6U A;  1B3E A;  2THI A;  1DK4 A;  2VP1 A;  4Z7E A;  2DE4 A;  1AOV A;  4ELP A;  3T9U A;  3TUS A;  1ZKB A;  3LSW A;  3T66 A;  1B0L A;  1JW4 A;  3WAE A;  4TLL B;  2GH9 A;  1LCT A;  2Y5K A;  1FQF A;  3ECR A;  4ND9 A;  3O66 A;  4OTE A;  2F8D A;  2QSX A;  4ONY A;  1N04 A;  3EQ1 A;  3Q25 A;  4UAC A;  3PUW E;  4LUB A;  3RYB A;  4PAI A;  5JTY B;  4RNS A;  3MVX A;  4DCY A;  4IB2 A;  4HCW A;  4UA8 A;  3CFX A;  3RYD A;  2Z23 A;  4F3G A;  2Q9T A;  1LB8 A;  1EYJ A;  2F3D A;  5EQ9 A;  2O68 A;  3FJG A;  2I3W A;  4DIG A;  1B0H A;  2V93 A;  2YPN A;  4NF8 A;  3TYH A;  2HPG A;  1QJM A;  1QUI A;  2ZXT A;  4NF0 A;  3MVY A;  2R71 A;  2ZZX A;  4OA4 A;  4JSO A;  1LBX A;  2DDK A;  4AB6 A;  4MNI A;  4YAH X;  4U1O A;  2WYK A;  3JYR A;  2ZYO A;  3KZG A;  4O94 A;  3DRF A;  1MDQ A;  4U23 A;  4QFK A;  2FIX A;  3KC1 A;  3MP8 A;  1SVX B;  1MRP A;  1EYK A;  5FHM A;  4MX6 A;  4GX3 A;  1K9Y A;  4POW A;  1Z7M E;  1Q9D A;  3C9H A;  2DWJ A;  1FW0 A;  2YJP A;  4OFJ A;  1HSL A;  2F97 A;  2DE2 A;  5H8F B;  3T9H B;  4RK2 A;  3RN8 A;  4PTK A;  2ANJ A;  1SW2 A;  1NV7 A;  3EN3 A;  3OOA A;  4R2B A;  5ET5 A;  1D9Q A;  4P9K A;  1YXI A;  3PPP A;  5L8D A;  1FCK A;  2F7C A;  1IXH A;  4F1V A;  1B6H A;  4RA1 A;  2UYE A;  3MVW A;  3E79 A;  1FBF A;  2F5X A;  2PMS A;  4GBW A;  3C33 A;  4LZ7 A;  3RY3 A;  3LV0 A;  1SYH A;  4H65 A;  1US5 A;  4MMP A;  1QUJ A;  3QYT A;  3UA8 A;  2QS4 A;  1A54 A;  1MQD A;  4OEN A;  3V8X B;  1FPB A;  4H67 A;  1N76 A;  2ONR A;  3EHT A;  5B70 A;  1IIT A;  4N6D A;  1LAX A;  1GGG A;  4OET A;  4LVQ A;  4DXB A;  3MVZ A;  1N84 A;  2XXT A;  1FPE A;  4RYA A;  1H43 A;  4QSE A;  3TCH A;  3HO7 A;  3DRJ A;  3IOU A;  1M5D A;  5H8Q B;  4PFY A;  3SEY A;  1NV5 A;  4X8R A;  1B5I A;  2WOK A;  4LZ5 A;  4X1B A;  3TCF A;  4TLM B;  4R6K A;  1EZP A;  3O28 A;  2O7I A;  2H4I A;  3MPK A;  4O3B A;  3MWB A;  3K1M A;  4PF8 A;  4Q30 B;  5EQA A;  2DYX A;  2CEX A;  3IFA A;  1IXC A;  2VT5 A;  2CZL A;  1NUW A;  2IEE A;  4P0I A;  3GBA A;  4R75 A;  2VGQ A;  1JEV A;  1IQ7 A;  3SEX A;  1NNK A;  4IGR A;  4OES A;  3CSB A;  3MUQ A;  1H76 A;  4YKJ A;  3DP8 A;  1FRP A;  3QUJ A;  2PX1 A;  4MFI A;  4GBV A;  2V3T A;  2OZZ A;  4P1E A;  2XXW A;  2XX7 A;  5CMC A;  3V83 A;  4OVR A;  1FQC A;  3VFJ A;  4U21 A;  2X7Q A;  1PDA A;  2WYP A;  3FVN A;  4QXD A;  5CRY A;  1G0I A;  4MF3 A;  2M8C A;  2I0C A;  3FBP A;  3VE1 B;  3TMG A;  2H25 A;  3R6U A;  3H06 B;  3TDJ A;  5I59 B;  1TT1 A;  1R9L A;  4U2R A;  3THI A;  3SES A;  1GTK A;  3N6U A;  5DVF A;  2WX9 A;  4F19 A;  3M3L A;  4GD5 A;  3LVU A;  4ZDM A;  2GQ1 A;  4GFR A;  3PMV A;  1P1U A;  4BDL A;  4DDD A;  2DVC A;  2V3Q A;  2HZL A;  1LAF E;  1H45 A;  3MP1 A;  3O6H A;  2Q89 A;  3FVK A;  2I0B A;  1D9V A;  4G61 A;  2DXY A;  1MS7 A;  4H5F A;  1N0T A;  4M1V A;  4GWY A;  1FSA A;  2O1L A;  1UQW A;  2RF1 A;  2BJI A;  3I5O A;  3R7X A;  1M5F A;  1PEB A;  2G29 A;  3KJ7 A;  2Q8M A;  3KOT A;  3P7I A;  1YPN A;  4P11 A;  3FGS A;  3T96 B;  1XC1 A;  3VXC A;  1I6Q A;  2Y7I A;  4GWS A;  3A09 A;  5DEX B;  4GF8 A;  4MNP A;  4YIC A;  4THI A;  3D4G A;  3DP6 A;  1UTB B;  3ZKL A;  1BLF A;  4P3L A;  3C4M A;  3LUY A;  2Y7W A;  5CBR A;  2HXR A;  2NOO A;  4YKK A;  4ELO A;  1B51 A;  1A99 A;  1AMF A;  4PFB A;  3IL1 B;  3MAM A;  1B5H A;  4UAB A;  4EQB A;  1IMC A;  3M8U A;  1KZ8 A;  5I2N A;  3S2V A;  5IKB A;  1UTH A;  2Q74 A;  1SPI A;  4XKN A;  3M3K A;  1IMF A;  3FV1 A;  5ITO A;  1LLS A;  2PBW A;  1LBW A;  3OEM A;  1NNT A;  2OWS A;  3RPW A;  4FOR A;  5I57 A;  3IOW A;  2O1M A;  3U93 A;  5ESY A;  3PGF A;  5DEX A;  4JVD A;  2L5V A;  5DYH A;  3EHS A;  3N94 A;  3GBB A;  3IOV A;  1MQI A;  3K0V A;  1MPB A;  4JBZ A;  1FPF A;  1SDX A;  3SET A;  4HXV A;  4GLI A;  1FQA A;  2F78 A;  2A5T A;  5J16 A;  2WOL A;  3ISP A;  1MXZ A;  3O2A A;  4KYE A;  3QXM A;  4Q8R A;  2DWH A;  4NF5 B;  3W9W A;  4P47 A;  1DPE A;  4KCC A;  4F29 A;  2I48 A;  3BIG A;  5ICQ A;  5BWJ A;  1P1O A;  2R6G E;  4AB5 A;  4PFT A;  4OEV A;  2UVG A;  3OD7 A;  2ZYK A;  4O3A A;  2XA5 A;  3G3G A;  5ELV A;  2XXU A;  1A8E A;  1A40 A;  1PB7 A;  4DZ1 A;  2XWI A;  1LAG E;  3TPA A;  3G3I A;  5H8S A;  5FHN A;  2OLB A;  3QIM A;  1K9Z A;  3RT6 B;  3B7D A;  4N8G A;  3CI8 A;  2D5W A;  1IME A;  5I58 A;  5I7I A;  4TQU Q;  4WED A;  3QK6 A;  5M2V A;  1SD3 A;  3L6G A;  1JP4 A;  4PE3 A;  2BJJ X;  3NOH A;  1LST A;  5TP9 B;  1CE2 A;  3PMX A;  2UVI A;  2FIE A;  1M5B A;  1NL5 A;  2QFL A;  2QMX A;  4PBQ A;  2I4B A;  3T1B A;  1Y3N A;  4XTC Q;  3FXR A;  3KN3 A;  1NUZ A;  2Z22 A;  1B4H A;  4H6D A;  4NQ8 A;  4IY6 A;  4POX A;  4GQO A;  3HHF A;  2B65 A;  2X7P A;  3KSX A;  1A8F A;  4NTL A;  4JB7 A;  1OIB A;  1PBP A;  4JDF A;  4R72 A;  1OMP A;  2XXK A;  2RC7 A;  1AH5 A;  1QKB A;  3DLN A;  3TFL A;  3U94 A;  3W9V A;  2O69 A;  1MG1 A;  2B4M A;  3IOR A;  3PPN A;  3MBP A;  4OFO A;  4ELQ A;  2I58 A;  5CI5 A;  1FBG A;  3TQW A;  1NH8 A;  3MQ9 A;  1SW4 A;  5ISU A;  5LOM A;  1MH3 A;  4PFW A;  5EYG A;  2F6P A;  3LR1 A;  4IR8 A;  3N26 A;  2ZNS A;  1RDX A;  1LFH A;  3TQL A;  3MZB A;  5TU0 A;  3S4U A;  4BDO A;  5DT6 A;  3LC8 A;  4N81 A;  4NWD A;  1TFD A;  4KCD A;  1CNQ A;  4OQO A;  4ECF A;  1PC3 A;  1OLC A;  1FBC A;  3MW0 A;  3RYA A;  2LAO A;  4F2Q A;  1B32 A;  4FAT A;  3BBR A;  1MXY A;  4RY1 A;  3RGY A;  4NF8 B;  3QSL A;  4NN3 A;  3FV2 A;  3JV9 A;  5I59 A;  4R9F A;  3KN7 A;  2KLF A;  2UVH A;  1XS5 A;  3ZS6 A;  5KCJ B;  5I84 A;  2UXA A;  2OBG A;  3HN0 A;  1R6Z A;  1YYZ A;  4O3C A;  3C36 A;  5ET8 A;  2QVU A;  3DM0 A;  4YZZ A;  1O64 A;  3ILT B;  4GVO A;  1ZLQ A;  3S9L C;  1B9J A;  3TCG A;  1POT A;  4XEQ A;  4N4U A;  5CM6 A;  5JEI A;  1URS A;  2AL4 A;  4C0R A;  2PT2 A;  4PAK A;  3Q26 A;  4G8N A;  3H6U A;  4LP2 B;  3A3C A;  1MQJ A;  4MLV A;  4EXK A;  1VDW A;  5CMB A;  4FAJ A;  1XT8 A;  4K3F A;  2I3V A;  3G3K A;  2REG A;  2RKM A;  1RDY A;  2E0S A;  3VVE A;  2Y7K A;  1LBB A;  2B3B A;  2OWT A;  2OWZ A;  5K2X A;  2IA4 A;  3Q29 A;  3KN8 A;  3VLU A;  3IJX B;  1UIV A;  4F1Y A;  1DTZ A;  3IB0 A;  5BUU A;  3CSG A;  5I5P A;  1OQG A;  1B7Z A;  3G3J A;  5T3J A;  1IXG A;  4FBP A;  4PDD A;  4XXU A;  3M3F A;  3TTN A;  2XWO A;  1ELJ A;  3EHU A;  5H8N B;  4R2F A;  4E0W A;  4PGP A;  4Q0C A;  2V25 A;  2HEU A;  1RYO A;  3KSJ A;  3T0J A;  2HAU A;  1MXV A;  3MP6 A;  4AS4 A;  4FJP A;  3F11 A;  3JZJ A;  1NV1 A;  4YMB A;  3DRK A;  3S9N C;  1N7W A;  4KR5 A;  3DRH A;  3IO6 A;  2NUV A;  2QMW A;  3OSR A;  2XXP A;  1JET A;  1H3D A;  2NWJ A;  3B6T A;  2Z8F A;  4N07 A;  3DRG A;  4R6Y A;  2A5T B;  2F36 A;  2I4C A;  4KHZ E;  5JTY A;  4HTG A;  3KBR A;  1FTA A;  2FBP A;  1B58 A;  1MY0 A;  3OSQ A;  1S50 A;  5A5X A;  4R6H A;  1YTV A;  3K4U A;  2D3I A;  3W15 C;  2XX9 A;  2AYS A;  1TXF A;  1LBV A;  4GWW A;  1FBD A;  5CMK A;  5DW8 A;  1I69 A;  2A5S A;  3UGW A;  1P99 A;  3SDF A;  4R73 A;  2ALU A;  4EQ7 A;  5CMM A;  4JWO A;  2VD2 A;  5I3S A;  4NMY A;  4RPO A;  5ITP A;  2F7B A;  2NVU B;  4NG7 A;  2WOP A;  3E3K A;  3MJN A;  1IUD A;  4I1D A;  3K02 A;  1B3H A;  4BDR A;  2DWA A;  1SBP A;  4MIJ A;  5L9M A;  2PCR A;  4NF4 B;  3VDF A;  4NAP A;  4NF5 A;  1D3K A;  2RC8 A;  3USD A;  1URG A;  4O8M A;  1R9Q A;  4OHN A;  2WEF A;  4DI3 D;  3Q27 A;  5IZ3 A;  3VLV A;  2Y7P A;  3CHG A;  4LZ8 A;  3GXA A;  3RTW B;  3KJT A;  4HE2 A;  3RPL B;  4IO7 A;  4F3P A;  1D9Y A;  1AWB A;  2XXQ A;  4MEV A;  5AA1 A;  3CFL A;  2ZNU A;  4GIZ A;  1ANF A;  2ONK E;  1LEV A;  1B2H A;  2NXO A;  4KXP A;  4LON B;  4PC9 A;  5LTC A;  2HHM A;  5TPA A;  5I56 B;  4EF1 A;  3IX1 A;  3UIF A;  4MJO A;  2KR0 A;  4N8Y A;  1DOT A;  1MPD A;  3U1O A;  1ZMG A;  1SI1 A;  3RNN A;  3OO9 A;  1NNP A;  4P1L A;  4F1U A;  3IO4 A;  4PE5 B;  4RJZ A;  1B52 A;  4ZEK A;  4JSD A;  2PFY A;  5KDT B;  3K2D A;  1QW0 A;  1GR2 A;  2AIX A;  2Q88 A;  2F6G A;  1XI6 A;  4NE4 A;  4ZEF A;  2MKZ A;  4U1Z A;  4QFL A;  3CR9 A;  4U4X A;  1J1N A;  4OEU A;  4NF6 B;  1VE4 A;  1L5T A;  1MQH A;  3LSL A;  2FHY A;  3H7M A;  4L17 A;  1ATG A;  3MST A;  1B40 A;  2DE3 A;  4H46 A;  3U8Q A;  3S9E A;  3FXQ A;  1B7H A;  1QKA A;  4GL0 A;  4U22 A;  4X9T A;  2DVZ A;  2H5Y A;  5LDZ A;  4PFI A;  1Y3Q A;  4ZED A;  2R8T A;  2Q2A A;  4G8M A;  4PET A;  3H6V A;  4KYD A;  1SW1 A;  1LGB C;  3MZ1 A;  4G4P A;  5K2Y A;  4GL8 A;  2VPN A;  3ZSF A;  4EQ9 A;  2HZK A;  1LFI A;  3U92 A;  3B8B A;  4H0W A;  1NV6 A;  2XXH A;  3O6P A;  4WEP A;  1MXW A;  1FQE A;  1H44 A;  4F18 A;  2V84 A;  2P2A A;  5CBS A;  4OFL A;  2ABH A;  5A5L A;  3HPI A;  4C1T A;  3TEL A;  3KOS A;  3IR1 A;  3O97 A;  3SKP A;  4WXJ A;  1IMD A;  5F24 A;  3OMB A;  4BDN A;  1INP A;  1YCJ A;  1FPJ A;  5HM4 B;  1MDP 1;  4MHF A;  3MPL A;  5FTH A;  2VPO A;  1N7X A;  3VXB A;  2HXW A;  2PT1 A;  1ZJL A;  5AA2 B;  4BDQ A;  2D21 A;  5EYH A;  4HS7 A;  1BIY A;  3MC2 A;  5HBC A;  3PTY A;  5AA2 A;  2I49 A;  2DQV A;  1VSO A;  4QF9 A;  5EQ7 A;  2ZYN A;  1RDZ A;  3DP4 A;  5A5X B;  4OER A;  4F22 A;  3FJM A;  1TFA A;  3L6H A;  2QVV A;  1GVC A;  4I40 A;  1OVB A;  1B05 A;  3IOT A;  3RLF E;  5EQ8 A;  2QPQ A;  2DP8 A;  4HCY A;  3K1N A;  4ZE8 A;  1FTO A;  4H5G A;  3B6Q A;  2O7U A;  4ESX A;  2XWV A;  1ZIU A;  4IO3 A;  4E0X A;  2OJT A;  4EDP A;  1FTL A;  2F3B A;  2CZK A;  4AQ4 A;  3BFT A;  3H6T A;  2HFB A;  1MM6 A;  4JVI A;  3G3H A;  3PMW A;  4FEB A;  3QAX A;  1RKM A;  2QVR A;  1B3L A;  3G7W A;  5AA4 A;  4ZEI A;  1R1N A;  1WDN A;  3C31 A;  2Y5L A;  2ONS A;  1NV4 A;  1XOC A;  4R74 A;  4QSD A;  4QSC A;  3N6T A;  4QFO A; 
#chains in the Genus database with same CATH homology
 2CEX A;  3IFA A;  4ZEC A;  5IM2 A;  2VT5 A;  1NUX A;  1NUW A;  2RKM A;  4PDH A;  1RDY A;  3B50 A;  1JEV A;  1NV3 A;  3MYU A;  3QMF A;  2OWZ A;  4OES A;  1B3F A;  1JEU A;  1UIV A;  4N15 A;  5I5P A;  3DP8 A;  1EYI A;  1FRP A;  5T3J A;  2CZI A;  4GBV A;  4FBP A;  1FBP A;  4PDD A;  1B4Z A;  3PAM A;  4P1E A;  4OVR A;  2XWO A;  2WBD A;  1FPK A;  4PGP A;  2WYP A;  3GYY A;  4XKQ A;  4QFP A;  1VR5 A;  4QXD A;  4PAF A;  1G0I A;  3U65 A;  3LUZ A;  4P8B A;  4HE1 A;  1B46 A;  3FBP A;  3T0J A;  1BK4 A;  4AS4 A;  1KA1 A;  1NV1 A;  4X04 A;  4DCX A;  4OAN A;  2P3N A;  2WX9 A;  3DRK A;  1IMA A;  4F19 A;  3DRH A;  4ZEB A;  3LVU A;  1JET A;  2GQ1 A;  4GFR A;  3DRG A;  2V3Q A;  4HE0 A;  5IGA A;  2HZL A;  1FPL A;  3FTO A;  2XWK A;  3BIH A;  1QGX A;  4G61 A;  3EKI A;  4XF5 A;  2P3V A;  4GX6 A;  2OX3 A;  2CZH A;  1FTA A;  2FBP A;  1B58 A;  4M1V A;  4GWY A;  1FSA A;  1UQW A;  2BJI A;  2ZZW A;  4OVQ A;  3I5O A;  3MZ9 A;  4MCO A;  1LBV A;  2Q8M A;  4GWW A;  4QFN A;  1FBD A;  5DW8 A;  3ROJ A;  3O9P A;  2PFZ A;  2V4C A;  1KA0 A;  3KC0 A;  4GWS A;  1B5J A;  4GF8 A;  4MNP A;  4YIC A;  4PGN A;  4I3Y A;  5J1D A;  5I3S A;  1LBY A;  2FVZ A;  4XKP A;  4P3L A;  4OVS A;  4NX1 A;  4N17 A;  2HXR A;  2NOO A;  4NG7 A;  2WOP A;  3E3K A;  4XKR A;  1B51 A;  4I3E A;  1NV0 A;  1G0H A;  4PFB A;  1B5H A;  1B3H A;  4UAB A;  4MIJ A;  1IMC A;  3M8U A;  4MNC A;  3IFC A;  1KZ8 A;  2PCR A;  4NAP A;  4P56 A;  4MAG A;  1YZ0 A;  2Q74 A;  2ZZV A;  4O8M A;  4LN5 A;  1SPI A;  4XKN A;  4OVP A;  1IMF A;  2WEF A;  1B1H A;  4GWU A;  3HFU A;  4DI3 D;  1LBW A;  5IZ3 A;  4DI4 B;  1DPP A;  3CHG A;  1NV2 A;  5ESY A;  4PBH A;  4I8C A;  4JVD A;  2L5V A;  4OVT A;  3DRI A;  4PF6 A;  1NUY A;  4HE2 A;  2B4L A;  3RPL B;  1AWB A;  1FPF A;  2WBB A;  4MEV A;  5KZT A;  4HXV A;  1FPI A;  1LEV A;  2KQZ A;  1B2H A;  5J16 A;  1DCU A;  1IMB A;  4KXP A;  3RPL A;  2WOL A;  3ISP A;  1FBH A;  4PC9 A;  5LTC A;  3FXB A;  2HHM A;  3W9W A;  4P47 A;  1DPE A;  4MJO A;  1OLA A;  2KR0 A;  2CEY A;  4N8Y A;  4H45 A;  3BIG A;  5ICQ A;  4NHB A;  4PFT A;  4OEV A;  4GWZ A;  4P1L A;  5IZZ A;  5FBP A;  4F1U A;  2XA5 A;  1DK4 A;  1B52 A;  4ZEK A;  4JSD A;  2PFY A;  2DE4 A;  2XWI A;  1XI6 A;  3TPA A;  1LBZ A;  2MKZ A;  4QFL A;  3SZP A;  2OLB A;  3QIM A;  1DBZ A;  4OEU A;  3T66 A;  1K9Z A;  2Y5K A;  4N8G A;  4AS5 A;  2D5W A;  4ONY A;  1IME A;  2FHY A;  3KBZ A;  3MST A;  4JVC A;  4PFR A;  5I7I A;  3RYB A;  4I9D A;  1B40 A;  4PAI A;  4WED A;  2DE3 A;  3MVX A;  4DCY A;  4H46 A;  1B7H A;  4HCW A;  1JP4 A;  4PE3 A;  5ET6 A;  3RYD A;  1QKA A;  3NOH A;  2Z23 A;  5IZ1 A;  4QBA A;  4X9T A;  2DVZ A;  5LDZ A;  4PFI A;  2Q9T A;  2FIE A;  1EYJ A;  2F3D A;  5EQ9 A;  4N91 A;  4PBQ A;  2QFL A;  3T1B A;  4ZED A;  2R8T A;  1ZU0 A;  1NUZ A;  4GX4 A;  4PET A;  1B0H A;  2HPG A;  1B4H A;  4GL8 A;  4NQ8 A;  2VPN A;  2HZK A;  4NF0 A;  3MVY A;  3B8B A;  5IZ3 B;  2ZZX A;  4OA4 A;  1NV6 A;  4JSO A;  1LBX A;  2DDK A;  2XXK A;  3O6P A;  1QKB A;  4MNI A;  4F18 A;  1UIU A;  4ZE9 A;  3W9V A;  2WYK A;  4O94 A;  4OFL A;  3DRF A;  1FJ6 A;  4QFK A;  5A5L A;  2FIX A;  2B4M A;  3KC1 A;  4OFO A;  1FBE A;  1FBG A;  1EYK A;  1IMD A;  5F24 A;  5ISU A;  4MX6 A;  4GX3 A;  1K9Y A;  4PFW A;  5EYG A;  1Q9D A;  1INP A;  4IR8 A;  1FPJ A;  5HM4 B;  4OFJ A;  4MHF A;  2DE2 A;  1RDX A;  3MZB A;  2VPO A;  4PTK A;  1NV7 A;  1FJ9 A;  5ET5 A;  1D9Q A;  5EYH A;  4P9K A;  3D1R A;  1YXI A;  4N81 A;  3PTY A;  5L8D A;  1CNQ A;  5EQ7 A;  4F1V A;  1RDZ A;  1OLC A;  1B6H A;  4RA1 A;  1FBC A;  3MW0 A;  3RYA A;  3MVW A;  4OER A;  3E79 A;  2JJK A;  1FBF A;  2F5X A;  5F1Q A;  1B32 A;  5ET7 A;  1ZTY A;  2QVV A;  4I40 A;  4GBW A;  1B05 A;  3RY3 A;  3LV0 A;  5EQ8 A;  2QPQ A;  4MMP A;  4HCY A;  1FPG A;  4O7I A;  4NN3 A;  3E78 A;  4ZE8 A;  1FPB A;  3ZS6 A;  2XWV A;  4XFE A;  2GRV A;  1YYZ A;  4N6D A;  2F3B A;  2QVU A;  2CZK A;  4YZZ A;  1FPD A;  5ET8 A;  4OET A;  1NI9 A;  4O7M A;  1ZLQ A;  3MVZ A;  1FPE A;  1B9J A;  3TCG A;  4JVI A;  4NGU A;  4XEQ A;  4N4U A;  3TCH A;  5CM6 A;  4GWX A;  3DRJ A;  1RKM A;  4PFY A;  2QVR A;  4PCD A;  1B3G A;  1NV5 A;  1B3L A;  4PFU A;  4X8R A;  1B5I A;  2WOK A;  4ZEI A;  4TOZ A;  3TCF A;  4PAK A;  4N6K A;  3RQT A;  2Y5L A;  5JK4 A;  2O7I A;  1NV4 A;  3A29 A;  1XOC A;  1VDW A;  4FAJ A;  4PF8 A;  4QFO A;  5EQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...