3CHGA

The compatible solute-binding protein opuac from bacillus subtilis in complex with dmsa
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
NKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords Glycine betaine-binding protein
publication title The Compatible-Solute-Binding Protein OpuAC from Bacillus subtilis: Ligand Binding, Site-Directed Mutagenesis, and Crystallographic Studies
pubmed doi rcsb
source organism Bacillus subtilis
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3chgA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3chgA01
3O9PA 3MVWA 4ZEKA 2NOOA 3DRGA 1B1HA 1B2HA 3LVUA 5F1QA 4RA1A 4OERA 3RQTA 3TCGA 3MZ9A 1VR5A 4XKNA 4FAJA 2D5WA 1B05A 3PAMA 4PFTA 4XKPA 4OEUA 5ISUA 1UQWA 1B52A 1B5JA 4XKQA 3M8UA 1ZLQA 1XOCA 1B40A 2B4MA 3TCHA 3CHGA 5KZTA 4XKRA 4ZE8A 1B3HA 1B5HA 1QKAA 5HM4B 3QIMA 3DRIA 2RKMA 2GRVA 4OESA 1DPPA 3DRFA 3O6PA 2WOKA 3RYBA 4DCXA 1B9JA 2O7IA 2OLBA 5L8DA 1B58A 4TOZA 5ICQA 3DRJA 1QKBA 3MVYA 4PFUA 4JSDA 4GF8A 1OLAA 4OFJA 1ZTYA 1JETA 3TCFA 2B4LA 4I8CA 1B4ZA 1B46A 3T66A 1UIUA 4QFLA 4ZEDA 4JSOA 4DCYA 1B0HA 3RY3A 4ZEBA 1JEVA 4GFRA 4I9DA 4QFPA 1B5IA 4ZECA 3RYAA 3TPAA 3DP8A 4GL8A 4ONYA 4PFWA 1B6HA 3E3KA 3DRHA 4OFOA 1UIVA 1B3GA 1B7HA 4QFNA 4QFOA 2WOLA 4PFYA 3MVXA 1JEUA 2WOPA 3DRKA 3ZS6A 3MW0A 4ZEIA 1B32A 1B51A 4QFKA 4ZE9A 3I5OA 4WEDA 1B3FA 1ZU0A 3FTOA 3MVZA 3MZBA 4OEVA 1B3LA 2Z23A 1B4HA 1DPEA 4OFLA 4OETA 1OLCA 1RKMA
chains in the Genus database with same CATH superfamily
2PFZA 1P1QA 3KEIA 4H6DA 5F1QA 2RC7A 3ODBA 3CFLA 3CSBA 3MZ9A 2O84X 3CSGA 5A5XA 3FIRA 4I62A 5I59A 4DDDA 4C0RA 3E79A 3TFLA 3QAXA 3M8UA 3HHFA 1MS7A 1EYIA 2H5YA 3LSLA 4IGRA 3EHTA 2F7CA 2HZLA 2I6EA 4Z7EA 1I69A 3FXUA 1AIVA 2WOKA 1MY2A 2QMWA 4HE2A 3OO8A 3T1BA 3IOVA 3CFZA 3T9HB 3U1OA 3K6VA 1RDZA 4GF8A 4HTGA 4ZEFA 1FRPA 2ONSA 4GWWA 4HCWA 3OO9A 3K6XA 2FHYA 1Z7ME 4IB2A 4DCYA 3K0VA 5I2NB 4GBWA 3PPRA 1G0HA 4GOTA 1ELJA 1P1UA 3TTMA 2KQZA 3CRBA 1LAHE 2PMSA 4GXSB 3DRHA 4U23A 3TTLA 1EH3A 4ZZEA 5TPAB 2WOLA 4ZEIA 1IEJA 4PAFA 3MZBA 2DWHA 3B8BA 1BTJA 4OEVA 3NOHA 1FPKA 4OETA 2IEEA 3TUSA 2NOOA 4U1OA 1Y3NA 3BBRA 2DYXA 3GXAA 1B2HA 1K9YA 4X8RA 4RA1A 4MX6A 3FVKA 2HAVA 5I2NA 5JK4A 1ZBMA 2HHMA 3D4CA 4NF6A 5ESYA 2KLFA 5KZTA 3TMGA 3H06B 5TPAA 2FYIA 2QJEA 2REJA 3PUYE 4MEVA 2WEFA 5CRYA 5ITOA 4QF9A 1MQDA 4OENA 1AWBA 2PX1A 5FHNA 1KA1A 1LAGE 3N5LA 3S9NC 1IZ1A 4PGPA 2F7BA 1MH3A 4WXJA 1B58A 4F1VA 1MXXA 4EQBA 4R2BA 5H8HB 3PPNA 3JYRA 4PGNA 1O63A 2Q2AA 1JETA 4U4SA 1NV4A 3HN0A 5EYHA 1Z7NE 3QK6A 1P1NA 4H0WA 4BDNA 4H45A 1MY1A 5H8NB 2P0SA 2ALUA 5B70A 3VVEA 4ZECA 4NF5B 2E1SA 1IUDA 3OSQA 4PBQA 2PVUA 1SBPA 2QVUA 2XXKA 4F3GA 4O94A 5CMKA 4OVPA 1QULA 1PDAA 4P0IA 3CG3A 4IO7A 1IXCA 1XT8A 4XIGQ 1NNTA 5KCJA 3TODA 4F3BA 2O1MA 4M1VA 1H76A 4P9KA 5CI5A 4JB7A 5H8HA 2Z22A 2F78A 3FGSA 4ZEKA 2XWKA 4N8YA 3O6IA 1A40A 4ND9A 2Y7PA 3FUZA 1B05A 2YJPA 4P0GA 1O64A 2ZNUA 1UQWA 3IR1A 1FQFA 4NF5A 3O29A 4MHFA 1Y9UA 1XOCA 1N7XA 4XKRA 4GVOA 4ZE8A 4PAIA 2X26A 1AOVA 1A7LA 2FIXA 4QSDA 1S9TA 3RYBA 1WVJA 1NH7A 1JP4A 3OEKA 4MJOA 3IX1A 1YYZA 1ZMGA 4IO5A 3TCFA 4QFLA 4PE5B 1QUKA 5IKBA 5EQAA 1SQYA 1KA0A 3PMXA 1POTA 1JEVA 3FD3A 4GWYA 4LUBA 4O8MA 4IY5A 1AMFA 5I84A 4GX3A 1SYIA 1YXIA 4G4PA 3U72A 2O51A 4NX1A 4R6KA 3U93A 3G3GA 1IQ7A 5JTYB 1A54A 4YKPA 2GQ1A 3PV0E 4DI3D 1QW0A 1R9QA 3JZJA 1MG1A 4N17A 4LN5A 5IAIA 2Y84A 4GRKA 2XX9A 4PCDA 4ELPA 2OWTA 3H6UA 1LB8A 1UTHB 1MQGA 4ESWA 5AA4A 2NXOA 4OERA 3FVGA 1VR5A 5LTCA 3G3IA 2DSFA 5ISUA 4PBHA 3OMBA 1FJ6A 2V84A 1B5JA 3EHUA 4PE3A 3RNNA 1N3WA 3BIHA 4O7MA 3UGWA 4R9GA 1NV0A 4PF6A 1BK4A 3CVGA 5JTYA 4F39A 2P2AA 1QKAA 2DXRA 1PBPA 2JJKA 4HE1A 2WBDA 4H8JA 1MXWA 1N76A 1JW4A 2OJTA 3U92A 5I58B 4RNSA 4DCXA 2XD3A 1SD3A 4TLMB 3EPEA 4DI4B 1JVYA 1A8EA 2AL4A 1AH5A 4NWDA 4QXDA 1MY4A 5JEIA 2ZZVA 5IZ3B 1LAFE 1UTHA 5H8FB 3T66A 2R9JA 4HE0A 1INPA 4DZ1A 2ZYKA 5TU0A 1L5TA 3C36A 4JSOA 4H67A 3OELA 4OA4A 1XVYA 2ZNTA 3GYYA 3DP8A 1OVTA 2O69A 1B7HA 3S9LC 4H5FA 1FTJA 3DLNA 2Q8MA 1HSEA 5IGAA 5I58A 4QFKA 3HHGA 5I57B 3TQLA 2I0CA 3M3KA 4I8CA 5IZ3A 4FAJA 5H8FA 4R6YA 2ZXTA 2NWJA 3DRGA 3MZ1A 2XXHA 4LZ5A 5AA2B 3FBPA 4GWZA 2DWAA 1DBZA 3PPQA 4MNPA 2V3UA 1NV2A 3O28A 2A5TA 2XXIA 1ZKBA 3S4UA 1FTLA 1LB9A 1FBEA 3OO6A 1URSA 2ONKE 1FQDA 4TLLB 2YLNA 2B65A 4POXA 3FATA 2QRYA 3U65A 4LP2B 1J1NA 3KFMA 2I58A 1R9LA 2DQVA 2I3VA 4HXVA 1CE2A 2OK2A 2QS2A 1LBYA 3O66A 2XD2A 3FV1A 4XEQA 3R7XA 3PD9A 3R26A 1B0LA 1VSOA 3IOWA 3SKPA 3FZVA 4KHZE 4PQJA 4F3SA 1SW2A 1LCTA 4NHBA 3HFUA 1TFDA 2ESNA 3THIA 3HPIA 3IL1B 4H5GA 4WEPA 4KI0E 4LZ7A 2PBWA 3O2AA 3H4ZA 1GV8A 1MDP1 4ZE9A 2PCRA 3VE1B 4MNCA 4UA8A 1GGGA 5DVJA 2VOZA 1NI9A 5I59B 2NVUB 3OSRA 3ILUB 3IB2A 4EXLA 2AIXA 1N0TA 4L17A 5A5LA 4OANA 2H9BA 2OBGA 2WYPA 1LCFA 1K9ZA 4OEUA 3N94A 1VE4A 4XKQA 2RINA 1PB8A 4Q0CA 1M5FA 3FJMA 2CZIA 3KSJA 3ILTB 5EHSA 2XXPA 4JBZA 4NN3A 2W7YA 5FBPA 1SVXB 2F6GA 3SEUA 3GBAA 4FIMA 4G2ZA 1T0KA 3USDA 5L8DA 3IB1A 5DVIA 1I6AA 3QSLA 4ELRA 3VLWA 2UYFA 1NNPA 2F3DA 4YMBA 4X48A 3VVFA 1QUIA 2HZKA 5FHOA 2VPNA 1Y1MA 2PT2A 4AB6A 2OZZA 5DW8A 2D3IA 1PEBA 1FBHA 4QFPA 3RYAA 4KD5A 5FTHA 4R6HA 3FVNA 5KDTB 3T93B 1P1OA 2H98A 2WX9A 1YAEA 1NFTA 1OQGA 3ZS6A 1PC3A 5ICTA 2M8CA 4NEDA 4IO4A 4PF8A 2Q8JA 4NGUA 4NF6B 1Y3QA 1FTKA 4KR5A 3DM0A 3FJ7A 2Z8FA 3T9XB 3CI8A 4FE8A 2R8TA 3VXCA 3O6HA 2OX3A 4U22A 4PFTA 1D3KA 3B7DA 4BDRA 4PFIA 3SDFA 4DXBA 1S50A 3M3FA 3IB0A 1Q35A 4PFBA 3K4UA 4FEDA 4PFRA 5KDTA 3SEXA 4X1BA 5EYGA 3OXNA 2XWOA 4KFQA 1N7WA 2RKMA 4OESA 1R6ZA 4GWSA 4MH5A 3TAJA 1FBCA 1B9JA 1UTBB 4KYSA 4OVRA 3Q26A 4O3AA 4PFUA 3BKIB 4AS5A 3BFUA 3U94A 3TTNA 1ZTYA 3H6WA 4H46A 1SDXA 3MAMA 1LAXA 1B46A 2HPGA 1VFDA 3HSTA 3A29A 5KCJB 3IO6A 2QFLA 1US5A 2RCAA 4RXLA 1N04A 1SI0A 4HS7A 1B3GA 4ELOA 4OVQA 3SERA 1F9BA 3FXBA 4R9FA 1LLSA 4KYEA 3DRKA 4MF3A 1VDWA 1B51A 4PETA 5BWJA 2ZZWA 4LZ8A 4WEDA 1UTBA 1XS5A 2P3NA 4DXCA 4F31B 1FBFA 1OVBA 5L9OA 4JVIA 4QRZA 1IMCA 3C31A 4YKKA 4C1TA 2F8DA 1IMBA 1LBZA 2VPOA 4G68A 2V3TA 4GQOA 4GWXA 4OMBA 1D9YA 3MQ9A 3ISPA 3KGCA 3AXFA 3DP4A 1IXGA 4YICA 5ET5A 3G3FA 2VD2A 2LAOA 4RK9A 3VV5A 3TCHA 4XF5A 2X7PA 3RPWA 1MXZA 2H4IA 5H8SA 1POY1 4MAGA 4KYDA 1DPPA 1XC1A 4RPOA 3C4MA 1MPDA 4OQOA 2Z8EA 1P1WA 3OENA 2O7IA 1Y3PA 2OLBA 2WBBA 5DYHA 5DVFA 2GHAA 4R72A 4N6PA 3A3UA 1TT1A 4JSDA 1MPCA 1IMDA 2DS9A 3G7WA 3K1PA 2F3BA 1MXYA 1A8FA 3IFCA 1S7YA 3CR9A 2V93A 3QUJA 1MXVA 3TZAA 2B3FA 1H3DA 3P7IA 4N91A 4AB5A 2I49A 4R73A 4PDDA 1AL3A 4HW8A 2F7AA 4PFWA 3GBBA 3E3KA 3RTFB 1H44A 4KQPA 2Y7IA 2YPNA 4I3EA 3RUMA 3IJXB 2UVIA 5I2KB 3S2VA 3T0JA 2X7QA 2XWIA 1H43A 3V89B 5AA4B 4G8MA 1B32A 3TYHA 2OCUA 3FTOA 2DWIA 5I3SA 2Q88A 3RLFE 4KXPA 5J1DA 1BKAA 4YKJA 4O3CA 1O7TA 1NNKA 4R74A 3MVWA 1B1HA 2HEUA 4IR8A 4F2OA 3LVUA 2ZMBA 3IFAA 3N6TA 4AQ4A 3B6TA 1OMPA 4E0XA 3PAMA 4XKPA 1QVSA 4ISUA 1B52A 3B6QA 3MSTA 5AE4A 2QS1A 3C34A 4F29A 1B40A 5L9SA 3H3GA 4IO2A 3B50A 5EQ9A 4GLIA 5I2KA 2MKZA 1CNQA 4QSEA 1FTOA 4Q30B 2FBPA 3DP6A 4GXAA 3MP6A 1HSJA 3I3VA 4N8GA 3Q28A 3PMWA 1FW0A 4NF8B 3W9VA 5LDZA 3UA8A 2B4LA 1US4A 3Q29A 1NH8A 2GFEA 4QHQA 3E4RA 3PMVA 1MRPA 4EF2A 5DT6A 3B6WA 3QYTA 4ELQA 4GFRA 3UIFA 3LV0A 3BIGA 5K2YA 1OIBA 4LATA 2QMXA 1GR2A 2VD3A 5FHMA 4ECFA 3KN7A 3C33A 4JWOA 1D4NA 2XHDA 3PUWE 1TWYA 3T9UA 1H45A 3DELB 4P47A 1ZU0A 4N15A 3MVZA 3SEYA 3KOSA 3V83A 1QJMA 2A5TB 1FBPA 2XXUA 2F5XA 2RC8A 2Q74A 2XXVA 4NWCA 1LBVA 1XHYA 1OLCA 4NF8A 2DE2A 2UVJA 1I6BA 3TQWA 4RK2A 5M2VA 3RQTA 1FPJA 3OEMA 1MY0A 2A5SA 2Y7KA 2XXRA 4H8IA 1B7UA 4Z0IA 3ZKKA 1NV1A 2O1LA 4DE8A 3FJGA 1FTAA 4FJPA 4I3YA 5IM2A 1URDA 2GRVA 1EZ9A 3MC2A 3O6PA 1URGA 2F36A 5ITPA 1II5A 1JW1A 2E0SA 2R6GE 2Q9TA 3M3LA 4NF0A 3CFXA 4YAHX 1MQJA 3PPOA 4MLQA 5I56B 2AYSA 1EZPA 4FEBA 1VFEA 2HAUA 2HCAA 4JDFA 3TPAA 3D4GA 3KBRA 3LBSA 1MDQA 2ZYMA 2V3QA 4QFOA 2DP8A 3C9HA 5EHMA 3PPPA 4BDMA 1JEUA 1RDYA 3LR1A 1FBGA 5CMCA 4ZZAA 3MBPA 2VT5A 3UK4A 1EU8A 2Y7WA 1QUJA 1Y4CA 3EN3A 1HSLA 1B4HA 4NTLA 4OFLA 3C32A 2P3VA 4XXUA 2R71A 4FECA 1SYHA 4THIA 3KBZA 3FXQA 5I56A 2DOJA 5J16A 4BDOA 4XKNA 1Y4TA 4YKIA 2D5WA 4G77A 2D21A 1DTZA 2I4CA 1ZLQA 4FORA 1NUWA 5K2XA 4RPNA 3CHGA 4Q8RA 4NF4B 1I6QA 3UORA 3G3KA 1ATGA 4AS4A 4OXVA 1USYE 4FATA 1NKXA 4PTKA 3KC1A 5BUUA 3V8XB 1NNFA 2XA5A 1MXUA 2H25A 1IMEA 2P1SA 2BJJX 2FVZA 1ANFA 4F18A 4EQ7A 3WAEA 2VGQA 1FPEA 5ET8A 2FIEA 1N84A 3RPLB 3O6GA 1NUYA 3IK6B 4JWYA 4I9DA 3K02A 4PDHA 2ABHA 4KCDA 4F2QA 4ONYA 1NV7A 2GHBA 4U21A 5EQ8A 1B6HA 5CBRA 4NF4A 4Q5TA 5CM6A 5CMBA 3KSXA 3LC8A 4QFNA 3VFJA 3KG2A 4PC9A 3MVXA 4OVJA 1DMBA 2IA4A 3IO4A 4MLVA 2Z8DA 2QVVA 2Y7RA 1WODA 1FQCA 3RYDA 4YU0A 2QVRA 5F7VA 1LSTA 3OO7A 2Z23A 3W15C 4JWXA 1DTGA 3HO7A 1MPBA 1EZOA 2CEXA 3R6UA 2G29A 1MY3A 4N4UA 1EYJA 2DVZA 2XXTA 3K01A 4U2RA 3TCGA 4HCYA 3UP9A 4QSCA 2DDKA 3RPLA 2ZNSA 4JVCA 1FSAA 2CZHA 2O6AA 1IIWA 3GLBA 1ZJLA 3LSWA 4GX4A 1FPLA 2F35A 3MYUA 4LONB 2H99A 3KN8A 4GD5A 4UABA 3DRIA 3U8QA 4R2FA 2ANJA 1G0IA 3H03A 3G3JA 1FJ9A 5CMMA 5EQ7A 1IXIA 3Q27A 4DXUA 2O7UA 4MMPA 4UACA 4ZEDA 4N13A 3RY3A 2I4BA 4ZEBA 5I7IA 3ECRA 1B5IA 1KWHA 3PU5A 4PAKA 4YZZA 1LGBC 1PBQA 3EF7A 3T9VA 1XI6A 4TQUQ 1FCKA 1UIVA 4G68B 3WAFA 1SW5A 2THIA 2HQ0A 4WKMA 2WOPA 3MW0A 2VP1A 1M5BA 2L5VA 4ZS9A 2HFBA 3KJ7A 3PUZE 1SI1A 1LBWA 1TXFA 5AA1A 4IGTA 3C35A 2QPQA 4EXKA 3OD7A 1LFHA 3LSFB 2CMOA 2V4CA 3O9PA 4PP0A 3BFTA 4GBVA 2G93A 5FTIA 2V25A 3ZKLA 4YB6A 4IO3A 1WDNA 1FPBA 1FBDA 4R75A 3ROJA 4ESXA 1FPIA 1FQBA 4O3BA 2F34A 4EUOA 1LEVA 1N3XA 4YMAA 4MIJA 1IMFA 1B3HA 5CC2A 3KOTA 2WYKA 3G3HA 4RJZA 4F3PA 4M4GA 3FV2A 1M5CA 3RGYA 1MM6A 1M5EA 3SEWA 2CZKA 4G8HA 3KJTA 4P3LA 3VVDA 5ICQA 4ZDMA 3S9EA 1QKBA 1YTVA 1IITA 3E78A 5DEXB 2I3WA 3LUZA 4OZ9A 1SW1A 3TTKA 5CBSA 4K3FA 1DK4A 2CEYA 4MCOA 3MWBA 3RTWB 2Y5LA 3IORA 5I5PA 4GL8A 5H8QB 3PUXE 4OFOA 2UVHA 4X9TA 3MPKA 2GH9A 5DTBA 5H8NA 1ZIUA 3LSXA 3L6GA 4G8NA 2DE3A 2UXAA 1NUXA 1PB9A 1B3LA 4DIGA 2HXRA 3EKIA 3MJNA 2WKYA 5DEXA 5B7DA 1M5DA 4P11A 1SW4A 2XXWA 4H1XA 1NUZA 4N6KA 2CZLA 4MFIA 1GVCA 4MBPA 1Q1KA 4YB5A 2REGA 3SZPA 1DOTA 1TFAA 4IO6A 1YPNA 3KZGA 4RYAA 1RYXA 5H8QA 2XX7A 4NE4A 4P56A 3T96B 3FXRA 4OVSA 1NMUA 2I0BA 1B5HA 4XTCQ 4GL0A 5TP9B 4IY6A 1P99A 4I1DA 3O97A 1SPIA 4BDQA 3DRFA 1DSNA 4G61A 1JQFA 4EQ9A 1EYKA 1YZ0A 4TOZA 1OQHA 1PB7A 2QS3A 3QXMA 4LQ2A 1IMAA 3MP8A 1D9QA 3CG1A 5EYFA 2ZYOA 1OLAA 4OFJA 2F6PA 4NAPA 1UIUA 4OTEA 3PGFA 1IXHA 3H6VA 4KCCA 2NUVA 3D1RA 4EDPA 3S9MC 2QL3A 4GIZA 3EHSA 3PTYA 4U4XA 3SESA 5F24A 3IJOB 2DXYA 4NQ8A 2Y5KA 1MQIA 3KN3A 2B3BA 5TP9A 3W9WA 4NG7A 4H65A 4PFYA 2DE4A 1A99A 3IAZA 1FQEA 3A3CA 4LA9A 3I5OA 3PD8A 4JXIA 3RT8A 4OYVA 1LFIA 3K6UA 2PFYA 3Q25A 2XXQA 3ONMA 3A09A 4F19A 4P1LA 3RT6B 3F11A 1D9VA 1BIYA 1Q9DA 4NMYA 1LBCA 3I6VA 3SEVA 1BP5A 2BJIA 1FPFA 1B7ZA 4MNIA 1JNFA 3TELA 4BDLA 5L9MA 4GWOA 2B4MA 4P1EA 4JVDA 4C1UA 1A55A 3VXBA 4XFEA 5HM4B 3QIMA 2FA7A 1Y1ZA 3UN6A 3TTRA 1JW5A 1MH4A 3LUYA 1LFGA 4X1DA 4F22A 4U1ZA 3K1MA 3N6UA 4I40A 2OWSA 5ET6A 3DRJA 1B1XA 1KZ8A 2XX8A 4N6DA 3FVOA 4FBPA 1R1NA 1NV5A 4OVTA 1GTKA 4OHNA 1CB6A 1B4ZA 2RCBA 1XVXA 2DWJA 2ONRA 3ZSFA 4N07A 4EF1A 3K1NA 1YCJA 2XWVA 4O7IA 2RF1A 3QUFA 1DCUA 1BLFA 5AA2D 3HCQA 4N81A 1MQHA 5ET7A 1FPGA 3L6HA 4LVQA 3QMFA 2RC9A 3K2DA 2FNCA 1LBBA 4F1YA 3IOTA 3OOAA 2Q89A 1DPEA 4GX6A 1JVXA 3H7MA 2ZYNA 4DLDA 1RKMA 4G68C 1FPDA 5T3JA 5ELVA 4YB7A 3T22A 1MM7A 2XXXA 4POWA 5HPQA 2XXYA 4KPTA 3VDFA 3MUQA 2F97A 5I57A 1NL5A 1LBXA 3PUVE 3CIJA 1NV6A 1RYOA 2QS4A 2I48A 3V5AA 3TKDA 2O68A 4BLAA 4P8BA 3FASA 1NV3A 5AA2A 2UVGA 3TEPA 4QBAA 2HXWA 2UYEA 3SETA 5AA3A 4LQ5A 3E9XA 3HV1A 3MVYA 1USYH 3VLUA 1FQAA 5HBCA 4RY1A 4X04A 1RDXA 2OWZA 2PYYA 1B0HA 2DVCA 5A5XB 5IZ1A 2VHAA 3MP1A 2QSXA 2ZZXA 4E0WA 4OWDA 1B3EA 3RN8A 4GWUA 2PT1A 3GZGA 3JV9A 3K00A 3IOUA 3H6TA 1Y20A 3VLVA 2AL5A 2KR0A 5IZZA 3MPLA 1B3FA 1QGXA 3K6WA 3E13X 4F1UA 3TDJA 3N26A 3KC0A 1FTMA 3EQ1A 5LOMA 2Q2CA
chains in the Genus database with same CATH topology
2PFZA 3O9PA 3MVWA 3DRGA 1B1HA 4GBVA 4IR8A 3LVUA 5F1QA 3FBPA 4GWZA 3IFAA 3MZ9A 1DBZA 4MNPA 3PAMA 1FPBA 4XKPA 1FBDA 1NV2A 3ROJA 1FPIA 1B52A 3MSTA 3E79A 1LEVA 3M8UA 1FBEA 1B40A 4MIJA 1EYIA 3B50A 5EQ9A 1IMFA 1B3HA 2WYKA 2HZLA 2MKZA 1CNQA 2WOKA 3U65A 2FBPA 2CZKA 4HE2A 4N8GA 4P3LA 4HXVA 3T1BA 5ICQA 1QKBA 1LBYA 1RDZA 3E78A 4GF8A 3W9VA 5LDZA 1FRPA 4XEQA 3LUZA 4GWWA 4HCWA 2B4LA 2FHYA 4DCYA 4NHBA 4GBWA 1DK4A 2CEYA 4GFRA 3HFUA 1G0HA 3LV0A 3BIGA 4MCOA 5I5PA 2Y5LA 2KQZA 4GL8A 3DRHA 4OFOA 2WOLA 4X9TA 4ZEIA 4P47A 4ZE9A 2PCRA 4MNCA 4PAFA 1ZU0A 3MZBA 4N15A 3MVZA 3B8BA 2DE3A 4OEVA 1NUXA 1FBPA 1NI9A 1B3LA 2F5XA 3NOHA 1FPKA 2HXRA 2Q74A 3EKIA 1LBVA 4OETA 1OLCA 2DE2A 2NOOA 1NUZA 4N6KA 5A5LA 4OANA 1B2HA 1K9YA 4X8RA 5IZ3A 4RA1A 4MX6A 3RQTA 1FPJA 2WYPA 1K9ZA 4OEUA 3SZPA 5JK4A 2HHMA 1NV1A 4XKQA 5ESYA 5KZTA 2CZIA 4P56A 4OVSA 4NN3A 1FTAA 1B5HA 4I3YA 5IM2A 5FBPA 2GRVA 4MEVA 1SPIA 2WEFA 3DRFA 3O6PA 1AWBA 1KA1A 4G61A 5L8DA 4PGPA 1EYKA 1B58A 1YZ0A 4F1VA 2Q9TA 4TOZA 1IMAA 4NF0A 2F3DA 1D9QA 4PGNA 1OLAA 4OFJA 1JETA 4NAPA 1NV4A 2HZKA 5EYHA 2VPNA 1UIUA 5DW8A 3D1RA 1FBHA 4H45A 3PTYA 4QFPA 4ZECA 3RYAA 3TPAA 5F24A 2V3QA 4NQ8A 4PBQA 2Y5KA 2QVUA 4QFOA 2XXKA 2WX9A 3W9WA 4O94A 4NG7A 4OVPA 4PFYA 1JEUA 1RDYA 1FBGA 3ZS6A 2DE4A 2VT5A 3I5OA 2PFYA 4M1VA 4PF8A 4P9KA 1B4HA 4NGUA 4OFLA 2P3VA 4F19A 4P1LA 4ZEKA 2XWKA 4N8YA 1Q9DA 3KBZA 5J16A 2BJIA 1FPFA 4XKNA 2R8TA 2D5WA 4MNIA 2OX3A 1B05A 4PFTA 1UQWA 4PFIA 4PFBA 4MHFA 1ZLQA 1XOCA 1NUWA 2B4MA 4PFRA 3CHGA 4XKRA 4P1EA 4JVDA 4ZE8A 4XFEA 5EYGA 4PAIA 5HM4B 2XWOA 3QIMA 2RKMA 4OESA 4AS4A 4GWSA 2FIXA 4PTKA 3KC1A 3RYBA 1FBCA 1B9JA 4OVRA 1JP4A 4I40A 5ET6A 4MJOA 3DRJA 1KZ8A 1YYZA 4PFUA 2XA5A 4AS5A 4N6DA 1IMEA 4FBPA 1ZTYA 3TCFA 1NV5A 2FVZA 4OVTA 4H46A 4F18A 1B4ZA 1B46A 2HPGA 1FPEA 4QFLA 5ET8A 3A29A 2FIEA 5EQAA 3RPLB 1NUYA 1KA0A 1JEVA 4I9DA 4GWYA 4O8MA 2QFLA 4PDHA 4GX3A 4ONYA 1NV7A 5EQ8A 1B6HA 1YXIA 2XWVA 4O7IA 4NX1A 1DCUA 5CM6A 1B3GA 4OVQA 4QFNA 4N81A 3FXBA 4PC9A 5ET7A 2GQ1A 1FPGA 3MVXA 4DI3D 3DRKA 1VDWA 1B51A 3QMFA 4PETA 2ZZWA 2QVVA 4WEDA 2P3NA 4N17A 4LN5A 3RYDA 2QVRA 1FBFA 4JVIA 1IMCA 2Z23A 1DPEA 4GX6A 4PCDA 2CEXA 1IMBA 1RKMA 1LBZA 2VPOA 1FPDA 4N4UA 5T3JA 1EYJA 2DVZA 4GWXA 4OERA 3TCGA 4HCYA 1VR5A 5LTCA 3ISPA 2DDKA 3RPLA 4JVCA 1LBXA 4YICA 5ISUA 1FSAA 5ET5A 4PBHA 2CZHA 1FJ6A 1B5JA 4PE3A 1NV6A 4GX4A 1FPLA 3BIHA 4O7MA 3TCHA 4XF5A 3MYUA 1NV0A 4PF6A 1BK4A 1QKAA 4UABA 4P8BA 3DRIA 4MAGA 1NV3A 1G0IA 2JJKA 4HE1A 4QBAA 2WBDA 1DPPA 4DCXA 2O7IA 1FJ9A 2OLBA 2WBBA 4DI4B 5EQ7A 4QXDA 3MVYA 4JSDA 2ZZVA 5IZ3B 1IMDA 4MMPA 2F3BA 3IFCA 3T66A 4HE0A 1INPA 4X04A 1RDXA 4ZEDA 2OWZA 4JSOA 1B0HA 3RY3A 4ZEBA 4N91A 5IZ1A 5I7IA 4OA4A 1B5IA 4PDDA 2ZZXA 3GYYA 3DP8A 4PFWA 3E3KA 4PAKA 4YZZA 1XI6A 4GWUA 1UIVA 4I3EA 1B7HA 3T0JA 2XWIA 2Q8MA 2KR0A 2WOPA 3MW0A 1B32A 5IZZA 5IGAA 4QFKA 2L5VA 1B3FA 3FTOA 1LBWA 5I3SA 1QGXA 4KXPA 5J1DA 4F1UA 2QPQA 3KC0A 4I8CA 2V4CA 4FAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9P A;  3MVW A;  4ZEK A;  2NOO A;  3DRG A;  1B1H A;  1B2H A;  3LVU A;  5F1Q A;  4RA1 A;  4OER A;  3RQT A;  3TCG A;  3MZ9 A;  1VR5 A;  4XKN A;  4FAJ A;  2D5W A;  1B05 A;  3PAM A;  4PFT A;  4XKP A;  4OEU A;  5ISU A;  1UQW A;  1B52 A;  1B5J A;  4XKQ A;  3M8U A;  1ZLQ A;  1XOC A;  1B40 A;  2B4M A;  3TCH A;  3CHG A;  5KZT A;  4XKR A;  4ZE8 A;  1B3H A;  1B5H A;  1QKA A;  5HM4 B;  3QIM A;  3DRI A;  2RKM A;  2GRV A;  4OES A;  1DPP A;  3DRF A;  3O6P A;  2WOK A;  3RYB A;  4DCX A;  1B9J A;  2O7I A;  2OLB A;  5L8D A;  1B58 A;  4TOZ A;  5ICQ A;  3DRJ A;  1QKB A;  3MVY A;  4PFU A;  4JSD A;  4GF8 A;  1OLA A;  4OFJ A;  1ZTY A;  1JET A;  3TCF A;  2B4L A;  4I8C A;  1B4Z A;  1B46 A;  3T66 A;  1UIU A;  4QFL A;  4ZED A;  4JSO A;  4DCY A;  1B0H A;  3RY3 A;  4ZEB A;  1JEV A;  4GFR A;  4I9D A;  4QFP A;  1B5I A;  4ZEC A;  3RYA A;  3TPA A;  3DP8 A;  4GL8 A;  4ONY A;  4PFW A;  1B6H A;  3E3K A;  3DRH A;  4OFO A;  1UIV A;  1B3G A;  1B7H A;  4QFN A;  4QFO A;  2WOL A;  4PFY A;  3MVX A;  1JEU A;  2WOP A;  3DRK A;  3ZS6 A;  3MW0 A;  4ZEI A;  1B32 A;  1B51 A;  4QFK A;  4ZE9 A;  3I5O A;  4WED A;  1B3F A;  1ZU0 A;  3FTO A;  3MVZ A;  3MZB A;  4OEV A;  1B3L A;  2Z23 A;  1B4H A;  1DPE A;  4OFL A;  4OET A;  1OLC A;  1RKM A; 
#chains in the Genus database with same CATH topology
 2PFZ A;  1P1Q A;  3KEI A;  4H6D A;  5F1Q A;  2RC7 A;  3ODB A;  3CFL A;  3CSB A;  3MZ9 A;  2O84 X;  3CSG A;  5A5X A;  3FIR A;  4I62 A;  5I59 A;  4DDD A;  4C0R A;  3E79 A;  3TFL A;  3QAX A;  3M8U A;  3HHF A;  1MS7 A;  1EYI A;  2H5Y A;  3LSL A;  4IGR A;  3EHT A;  2F7C A;  2HZL A;  2I6E A;  4Z7E A;  1I69 A;  3FXU A;  1AIV A;  2WOK A;  1MY2 A;  2QMW A;  4HE2 A;  3OO8 A;  3T1B A;  3IOV A;  3CFZ A;  3T9H B;  3U1O A;  3K6V A;  1RDZ A;  4GF8 A;  4HTG A;  4ZEF A;  1FRP A;  2ONS A;  4GWW A;  4HCW A;  3OO9 A;  3K6X A;  2FHY A;  1Z7M E;  4IB2 A;  4DCY A;  3K0V A;  5I2N B;  4GBW A;  3PPR A;  1G0H A;  4GOT A;  1ELJ A;  1P1U A;  3TTM A;  2KQZ A;  3CRB A;  1LAH E;  2PMS A;  4GXS B;  3DRH A;  4U23 A;  3TTL A;  1EH3 A;  4ZZE A;  5TPA B;  2WOL A;  4ZEI A;  1IEJ A;  4PAF A;  3MZB A;  2DWH A;  3B8B A;  1BTJ A;  4OEV A;  3NOH A;  1FPK A;  4OET A;  2IEE A;  3TUS A;  2NOO A;  4U1O A;  1Y3N A;  3BBR A;  2DYX A;  3GXA A;  1B2H A;  1K9Y A;  4X8R A;  4RA1 A;  4MX6 A;  3FVK A;  2HAV A;  5I2N A;  5JK4 A;  1ZBM A;  2HHM A;  3D4C A;  4NF6 A;  5ESY A;  2KLF A;  5KZT A;  3TMG A;  3H06 B;  5TPA A;  2FYI A;  2QJE A;  2REJ A;  3PUY E;  4MEV A;  2WEF A;  5CRY A;  5ITO A;  4QF9 A;  1MQD A;  4OEN A;  1AWB A;  2PX1 A;  5FHN A;  1KA1 A;  1LAG E;  3N5L A;  3S9N C;  1IZ1 A;  4PGP A;  2F7B A;  1MH3 A;  4WXJ A;  1B58 A;  4F1V A;  1MXX A;  4EQB A;  4R2B A;  5H8H B;  3PPN A;  3JYR A;  4PGN A;  1O63 A;  2Q2A A;  1JET A;  4U4S A;  1NV4 A;  3HN0 A;  5EYH A;  1Z7N E;  3QK6 A;  1P1N A;  4H0W A;  4BDN A;  4H45 A;  1MY1 A;  5H8N B;  2P0S A;  2ALU A;  5B70 A;  3VVE A;  4ZEC A;  4NF5 B;  2E1S A;  1IUD A;  3OSQ A;  4PBQ A;  2PVU A;  1SBP A;  2QVU A;  2XXK A;  4F3G A;  4O94 A;  5CMK A;  4OVP A;  1QUL A;  1PDA A;  4P0I A;  3CG3 A;  4IO7 A;  1IXC A;  1XT8 A;  4XIG Q;  1NNT A;  5KCJ A;  3TOD A;  4F3B A;  2O1M A;  4M1V A;  1H76 A;  4P9K A;  5CI5 A;  4JB7 A;  5H8H A;  2Z22 A;  2F78 A;  3FGS A;  4ZEK A;  2XWK A;  4N8Y A;  3O6I A;  1A40 A;  4ND9 A;  2Y7P A;  3FUZ A;  1B05 A;  2YJP A;  4P0G A;  1O64 A;  2ZNU A;  1UQW A;  3IR1 A;  1FQF A;  4NF5 A;  3O29 A;  4MHF A;  1Y9U A;  1XOC A;  1N7X A;  4XKR A;  4GVO A;  4ZE8 A;  4PAI A;  2X26 A;  1AOV A;  1A7L A;  2FIX A;  4QSD A;  1S9T A;  3RYB A;  1WVJ A;  1NH7 A;  1JP4 A;  3OEK A;  4MJO A;  3IX1 A;  1YYZ A;  1ZMG A;  4IO5 A;  3TCF A;  4QFL A;  4PE5 B;  1QUK A;  5IKB A;  5EQA A;  1SQY A;  1KA0 A;  3PMX A;  1POT A;  1JEV A;  3FD3 A;  4GWY A;  4LUB A;  4O8M A;  4IY5 A;  1AMF A;  5I84 A;  4GX3 A;  1SYI A;  1YXI A;  4G4P A;  3U72 A;  2O51 A;  4NX1 A;  4R6K A;  3U93 A;  3G3G A;  1IQ7 A;  5JTY B;  1A54 A;  4YKP A;  2GQ1 A;  3PV0 E;  4DI3 D;  1QW0 A;  1R9Q A;  3JZJ A;  1MG1 A;  4N17 A;  4LN5 A;  5IAI A;  2Y84 A;  4GRK A;  2XX9 A;  4PCD A;  4ELP A;  2OWT A;  3H6U A;  1LB8 A;  1UTH B;  1MQG A;  4ESW A;  5AA4 A;  2NXO A;  4OER A;  3FVG A;  1VR5 A;  5LTC A;  3G3I A;  2DSF A;  5ISU A;  4PBH A;  3OMB A;  1FJ6 A;  2V84 A;  1B5J A;  3EHU A;  4PE3 A;  3RNN A;  1N3W A;  3BIH A;  4O7M A;  3UGW A;  4R9G A;  1NV0 A;  4PF6 A;  1BK4 A;  3CVG A;  5JTY A;  4F39 A;  2P2A A;  1QKA A;  2DXR A;  1PBP A;  2JJK A;  4HE1 A;  2WBD A;  4H8J A;  1MXW A;  1N76 A;  1JW4 A;  2OJT A;  3U92 A;  5I58 B;  4RNS A;  4DCX A;  2XD3 A;  1SD3 A;  4TLM B;  3EPE A;  4DI4 B;  1JVY A;  1A8E A;  2AL4 A;  1AH5 A;  4NWD A;  4QXD A;  1MY4 A;  5JEI A;  2ZZV A;  5IZ3 B;  1LAF E;  1UTH A;  5H8F B;  3T66 A;  2R9J A;  4HE0 A;  1INP A;  4DZ1 A;  2ZYK A;  5TU0 A;  1L5T A;  3C36 A;  4JSO A;  4H67 A;  3OEL A;  4OA4 A;  1XVY A;  2ZNT A;  3GYY A;  3DP8 A;  1OVT A;  2O69 A;  1B7H A;  3S9L C;  4H5F A;  1FTJ A;  3DLN A;  2Q8M A;  1HSE A;  5IGA A;  5I58 A;  4QFK A;  3HHG A;  5I57 B;  3TQL A;  2I0C A;  3M3K A;  4I8C A;  5IZ3 A;  4FAJ A;  5H8F A;  4R6Y A;  2ZXT A;  2NWJ A;  3DRG A;  3MZ1 A;  2XXH A;  4LZ5 A;  5AA2 B;  3FBP A;  4GWZ A;  2DWA A;  1DBZ A;  3PPQ A;  4MNP A;  2V3U A;  1NV2 A;  3O28 A;  2A5T A;  2XXI A;  1ZKB A;  3S4U A;  1FTL A;  1LB9 A;  1FBE A;  3OO6 A;  1URS A;  2ONK E;  1FQD A;  4TLL B;  2YLN A;  2B65 A;  4POX A;  3FAT A;  2QRY A;  3U65 A;  4LP2 B;  1J1N A;  3KFM A;  2I58 A;  1R9L A;  2DQV A;  2I3V A;  4HXV A;  1CE2 A;  2OK2 A;  2QS2 A;  1LBY A;  3O66 A;  2XD2 A;  3FV1 A;  4XEQ A;  3R7X A;  3PD9 A;  3R26 A;  1B0L A;  1VSO A;  3IOW A;  3SKP A;  3FZV A;  4KHZ E;  4PQJ A;  4F3S A;  1SW2 A;  1LCT A;  4NHB A;  3HFU A;  1TFD A;  2ESN A;  3THI A;  3HPI A;  3IL1 B;  4H5G A;  4WEP A;  4KI0 E;  4LZ7 A;  2PBW A;  3O2A A;  3H4Z A;  1GV8 A;  1MDP 1;  4ZE9 A;  2PCR A;  3VE1 B;  4MNC A;  4UA8 A;  1GGG A;  5DVJ A;  2VOZ A;  1NI9 A;  5I59 B;  2NVU B;  3OSR A;  3ILU B;  3IB2 A;  4EXL A;  2AIX A;  1N0T A;  4L17 A;  5A5L A;  4OAN A;  2H9B A;  2OBG A;  2WYP A;  1LCF A;  1K9Z A;  4OEU A;  3N94 A;  1VE4 A;  4XKQ A;  2RIN A;  1PB8 A;  4Q0C A;  1M5F A;  3FJM A;  2CZI A;  3KSJ A;  3ILT B;  5EHS A;  2XXP A;  4JBZ A;  4NN3 A;  2W7Y A;  5FBP A;  1SVX B;  2F6G A;  3SEU A;  3GBA A;  4FIM A;  4G2Z A;  1T0K A;  3USD A;  5L8D A;  3IB1 A;  5DVI A;  1I6A A;  3QSL A;  4ELR A;  3VLW A;  2UYF A;  1NNP A;  2F3D A;  4YMB A;  4X48 A;  3VVF A;  1QUI A;  2HZK A;  5FHO A;  2VPN A;  1Y1M A;  2PT2 A;  4AB6 A;  2OZZ A;  5DW8 A;  2D3I A;  1PEB A;  1FBH A;  4QFP A;  3RYA A;  4KD5 A;  5FTH A;  4R6H A;  3FVN A;  5KDT B;  3T93 B;  1P1O A;  2H98 A;  2WX9 A;  1YAE A;  1NFT A;  1OQG A;  3ZS6 A;  1PC3 A;  5ICT A;  2M8C A;  4NED A;  4IO4 A;  4PF8 A;  2Q8J A;  4NGU A;  4NF6 B;  1Y3Q A;  1FTK A;  4KR5 A;  3DM0 A;  3FJ7 A;  2Z8F A;  3T9X B;  3CI8 A;  4FE8 A;  2R8T A;  3VXC A;  3O6H A;  2OX3 A;  4U22 A;  4PFT A;  1D3K A;  3B7D A;  4BDR A;  4PFI A;  3SDF A;  4DXB A;  1S50 A;  3M3F A;  3IB0 A;  1Q35 A;  4PFB A;  3K4U A;  4FED A;  4PFR A;  5KDT A;  3SEX A;  4X1B A;  5EYG A;  3OXN A;  2XWO A;  4KFQ A;  1N7W A;  2RKM A;  4OES A;  1R6Z A;  4GWS A;  4MH5 A;  3TAJ A;  1FBC A;  1B9J A;  1UTB B;  4KYS A;  4OVR A;  3Q26 A;  4O3A A;  4PFU A;  3BKI B;  4AS5 A;  3BFU A;  3U94 A;  3TTN A;  1ZTY A;  3H6W A;  4H46 A;  1SDX A;  3MAM A;  1LAX A;  1B46 A;  2HPG A;  1VFD A;  3HST A;  3A29 A;  5KCJ B;  3IO6 A;  2QFL A;  1US5 A;  2RCA A;  4RXL A;  1N04 A;  1SI0 A;  4HS7 A;  1B3G A;  4ELO A;  4OVQ A;  3SER A;  1F9B A;  3FXB A;  4R9F A;  1LLS A;  4KYE A;  3DRK A;  4MF3 A;  1VDW A;  1B51 A;  4PET A;  5BWJ A;  2ZZW A;  4LZ8 A;  4WED A;  1UTB A;  1XS5 A;  2P3N A;  4DXC A;  4F31 B;  1FBF A;  1OVB A;  5L9O A;  4JVI A;  4QRZ A;  1IMC A;  3C31 A;  4YKK A;  4C1T A;  2F8D A;  1IMB A;  1LBZ A;  2VPO A;  4G68 A;  2V3T A;  4GQO A;  4GWX A;  4OMB A;  1D9Y A;  3MQ9 A;  3ISP A;  3KGC A;  3AXF A;  3DP4 A;  1IXG A;  4YIC A;  5ET5 A;  3G3F A;  2VD2 A;  2LAO A;  4RK9 A;  3VV5 A;  3TCH A;  4XF5 A;  2X7P A;  3RPW A;  1MXZ A;  2H4I A;  5H8S A;  1POY 1;  4MAG A;  4KYD A;  1DPP A;  1XC1 A;  4RPO A;  3C4M A;  1MPD A;  4OQO A;  2Z8E A;  1P1W A;  3OEN A;  2O7I A;  1Y3P A;  2OLB A;  2WBB A;  5DYH A;  5DVF A;  2GHA A;  4R72 A;  4N6P A;  3A3U A;  1TT1 A;  4JSD A;  1MPC A;  1IMD A;  2DS9 A;  3G7W A;  3K1P A;  2F3B A;  1MXY A;  1A8F A;  3IFC A;  1S7Y A;  3CR9 A;  2V93 A;  3QUJ A;  1MXV A;  3TZA A;  2B3F A;  1H3D A;  3P7I A;  4N91 A;  4AB5 A;  2I49 A;  4R73 A;  4PDD A;  1AL3 A;  4HW8 A;  2F7A A;  4PFW A;  3GBB A;  3E3K A;  3RTF B;  1H44 A;  4KQP A;  2Y7I A;  2YPN A;  4I3E A;  3RUM A;  3IJX B;  2UVI A;  5I2K B;  3S2V A;  3T0J A;  2X7Q A;  2XWI A;  1H43 A;  3V89 B;  5AA4 B;  4G8M A;  1B32 A;  3TYH A;  2OCU A;  3FTO A;  2DWI A;  5I3S A;  2Q88 A;  3RLF E;  4KXP A;  5J1D A;  1BKA A;  4YKJ A;  4O3C A;  1O7T A;  1NNK A;  4R74 A;  3MVW A;  1B1H A;  2HEU A;  4IR8 A;  4F2O A;  3LVU A;  2ZMB A;  3IFA A;  3N6T A;  4AQ4 A;  3B6T A;  1OMP A;  4E0X A;  3PAM A;  4XKP A;  1QVS A;  4ISU A;  1B52 A;  3B6Q A;  3MST A;  5AE4 A;  2QS1 A;  3C34 A;  4F29 A;  1B40 A;  5L9S A;  3H3G A;  4IO2 A;  3B50 A;  5EQ9 A;  4GLI A;  5I2K A;  2MKZ A;  1CNQ A;  4QSE A;  1FTO A;  4Q30 B;  2FBP A;  3DP6 A;  4GXA A;  3MP6 A;  1HSJ A;  3I3V A;  4N8G A;  3Q28 A;  3PMW A;  1FW0 A;  4NF8 B;  3W9V A;  5LDZ A;  3UA8 A;  2B4L A;  1US4 A;  3Q29 A;  1NH8 A;  2GFE A;  4QHQ A;  3E4R A;  3PMV A;  1MRP A;  4EF2 A;  5DT6 A;  3B6W A;  3QYT A;  4ELQ A;  4GFR A;  3UIF A;  3LV0 A;  3BIG A;  5K2Y A;  1OIB A;  4LAT A;  2QMX A;  1GR2 A;  2VD3 A;  5FHM A;  4ECF A;  3KN7 A;  3C33 A;  4JWO A;  1D4N A;  2XHD A;  3PUW E;  1TWY A;  3T9U A;  1H45 A;  3DEL B;  4P47 A;  1ZU0 A;  4N15 A;  3MVZ A;  3SEY A;  3KOS A;  3V83 A;  1QJM A;  2A5T B;  1FBP A;  2XXU A;  2F5X A;  2RC8 A;  2Q74 A;  2XXV A;  4NWC A;  1LBV A;  1XHY A;  1OLC A;  4NF8 A;  2DE2 A;  2UVJ A;  1I6B A;  3TQW A;  4RK2 A;  5M2V A;  3RQT A;  1FPJ A;  3OEM A;  1MY0 A;  2A5S A;  2Y7K A;  2XXR A;  4H8I A;  1B7U A;  4Z0I A;  3ZKK A;  1NV1 A;  2O1L A;  4DE8 A;  3FJG A;  1FTA A;  4FJP A;  4I3Y A;  5IM2 A;  1URD A;  2GRV A;  1EZ9 A;  3MC2 A;  3O6P A;  1URG A;  2F36 A;  5ITP A;  1II5 A;  1JW1 A;  2E0S A;  2R6G E;  2Q9T A;  3M3L A;  4NF0 A;  3CFX A;  4YAH X;  1MQJ A;  3PPO A;  4MLQ A;  5I56 B;  2AYS A;  1EZP A;  4FEB A;  1VFE A;  2HAU A;  2HCA A;  4JDF A;  3TPA A;  3D4G A;  3KBR A;  3LBS A;  1MDQ A;  2ZYM A;  2V3Q A;  4QFO A;  2DP8 A;  3C9H A;  5EHM A;  3PPP A;  4BDM A;  1JEU A;  1RDY A;  3LR1 A;  1FBG A;  5CMC A;  4ZZA A;  3MBP A;  2VT5 A;  3UK4 A;  1EU8 A;  2Y7W A;  1QUJ A;  1Y4C A;  3EN3 A;  1HSL A;  1B4H A;  4NTL A;  4OFL A;  3C32 A;  2P3V A;  4XXU A;  2R71 A;  4FEC A;  1SYH A;  4THI A;  3KBZ A;  3FXQ A;  5I56 A;  2DOJ A;  5J16 A;  4BDO A;  4XKN A;  1Y4T A;  4YKI A;  2D5W A;  4G77 A;  2D21 A;  1DTZ A;  2I4C A;  1ZLQ A;  4FOR A;  1NUW A;  5K2X A;  4RPN A;  3CHG A;  4Q8R A;  4NF4 B;  1I6Q A;  3UOR A;  3G3K A;  1ATG A;  4AS4 A;  4OXV A;  1USY E;  4FAT A;  1NKX A;  4PTK A;  3KC1 A;  5BUU A;  3V8X B;  1NNF A;  2XA5 A;  1MXU A;  2H25 A;  1IME A;  2P1S A;  2BJJ X;  2FVZ A;  1ANF A;  4F18 A;  4EQ7 A;  3WAE A;  2VGQ A;  1FPE A;  5ET8 A;  2FIE A;  1N84 A;  3RPL B;  3O6G A;  1NUY A;  3IK6 B;  4JWY A;  4I9D A;  3K02 A;  4PDH A;  2ABH A;  4KCD A;  4F2Q A;  4ONY A;  1NV7 A;  2GHB A;  4U21 A;  5EQ8 A;  1B6H A;  5CBR A;  4NF4 A;  4Q5T A;  5CM6 A;  5CMB A;  3KSX A;  3LC8 A;  4QFN A;  3VFJ A;  3KG2 A;  4PC9 A;  3MVX A;  4OVJ A;  1DMB A;  2IA4 A;  3IO4 A;  4MLV A;  2Z8D A;  2QVV A;  2Y7R A;  1WOD A;  1FQC A;  3RYD A;  4YU0 A;  2QVR A;  5F7V A;  1LST A;  3OO7 A;  2Z23 A;  3W15 C;  4JWX A;  1DTG A;  3HO7 A;  1MPB A;  1EZO A;  2CEX A;  3R6U A;  2G29 A;  1MY3 A;  4N4U A;  1EYJ A;  2DVZ A;  2XXT A;  3K01 A;  4U2R A;  3TCG A;  4HCY A;  3UP9 A;  4QSC A;  2DDK A;  3RPL A;  2ZNS A;  4JVC A;  1FSA A;  2CZH A;  2O6A A;  1IIW A;  3GLB A;  1ZJL A;  3LSW A;  4GX4 A;  1FPL A;  2F35 A;  3MYU A;  4LON B;  2H99 A;  3KN8 A;  4GD5 A;  4UAB A;  3DRI A;  3U8Q A;  4R2F A;  2ANJ A;  1G0I A;  3H03 A;  3G3J A;  1FJ9 A;  5CMM A;  5EQ7 A;  1IXI A;  3Q27 A;  4DXU A;  2O7U A;  4MMP A;  4UAC A;  4ZED A;  4N13 A;  3RY3 A;  2I4B A;  4ZEB A;  5I7I A;  3ECR A;  1B5I A;  1KWH A;  3PU5 A;  4PAK A;  4YZZ A;  1LGB C;  1PBQ A;  3EF7 A;  3T9V A;  1XI6 A;  4TQU Q;  1FCK A;  1UIV A;  4G68 B;  3WAF A;  1SW5 A;  2THI A;  2HQ0 A;  4WKM A;  2WOP A;  3MW0 A;  2VP1 A;  1M5B A;  2L5V A;  4ZS9 A;  2HFB A;  3KJ7 A;  3PUZ E;  1SI1 A;  1LBW A;  1TXF A;  5AA1 A;  4IGT A;  3C35 A;  2QPQ A;  4EXK A;  3OD7 A;  1LFH A;  3LSF B;  2CMO A;  2V4C A;  3O9P A;  4PP0 A;  3BFT A;  4GBV A;  2G93 A;  5FTI A;  2V25 A;  3ZKL A;  4YB6 A;  4IO3 A;  1WDN A;  1FPB A;  1FBD A;  4R75 A;  3ROJ A;  4ESX A;  1FPI A;  1FQB A;  4O3B A;  2F34 A;  4EUO A;  1LEV A;  1N3X A;  4YMA A;  4MIJ A;  1IMF A;  1B3H A;  5CC2 A;  3KOT A;  2WYK A;  3G3H A;  4RJZ A;  4F3P A;  4M4G A;  3FV2 A;  1M5C A;  3RGY A;  1MM6 A;  1M5E A;  3SEW A;  2CZK A;  4G8H A;  3KJT A;  4P3L A;  3VVD A;  5ICQ A;  4ZDM A;  3S9E A;  1QKB A;  1YTV A;  1IIT A;  3E78 A;  5DEX B;  2I3W A;  3LUZ A;  4OZ9 A;  1SW1 A;  3TTK A;  5CBS A;  4K3F A;  1DK4 A;  2CEY A;  4MCO A;  3MWB A;  3RTW B;  2Y5L A;  3IOR A;  5I5P A;  4GL8 A;  5H8Q B;  3PUX E;  4OFO A;  2UVH A;  4X9T A;  3MPK A;  2GH9 A;  5DTB A;  5H8N A;  1ZIU A;  3LSX A;  3L6G A;  4G8N A;  2DE3 A;  2UXA A;  1NUX A;  1PB9 A;  1B3L A;  4DIG A;  2HXR A;  3EKI A;  3MJN A;  2WKY A;  5DEX A;  5B7D A;  1M5D A;  4P11 A;  1SW4 A;  2XXW A;  4H1X A;  1NUZ A;  4N6K A;  2CZL A;  4MFI A;  1GVC A;  4MBP A;  1Q1K A;  4YB5 A;  2REG A;  3SZP A;  1DOT A;  1TFA A;  4IO6 A;  1YPN A;  3KZG A;  4RYA A;  1RYX A;  5H8Q A;  2XX7 A;  4NE4 A;  4P56 A;  3T96 B;  3FXR A;  4OVS A;  1NMU A;  2I0B A;  1B5H A;  4XTC Q;  4GL0 A;  5TP9 B;  4IY6 A;  1P99 A;  4I1D A;  3O97 A;  1SPI A;  4BDQ A;  3DRF A;  1DSN A;  4G61 A;  1JQF A;  4EQ9 A;  1EYK A;  1YZ0 A;  4TOZ A;  1OQH A;  1PB7 A;  2QS3 A;  3QXM A;  4LQ2 A;  1IMA A;  3MP8 A;  1D9Q A;  3CG1 A;  5EYF A;  2ZYO A;  1OLA A;  4OFJ A;  2F6P A;  4NAP A;  1UIU A;  4OTE A;  3PGF A;  1IXH A;  3H6V A;  4KCC A;  2NUV A;  3D1R A;  4EDP A;  3S9M C;  2QL3 A;  4GIZ A;  3EHS A;  3PTY A;  4U4X A;  3SES A;  5F24 A;  3IJO B;  2DXY A;  4NQ8 A;  2Y5K A;  1MQI A;  3KN3 A;  2B3B A;  5TP9 A;  3W9W A;  4NG7 A;  4H65 A;  4PFY A;  2DE4 A;  1A99 A;  3IAZ A;  1FQE A;  3A3C A;  4LA9 A;  3I5O A;  3PD8 A;  4JXI A;  3RT8 A;  4OYV A;  1LFI A;  3K6U A;  2PFY A;  3Q25 A;  2XXQ A;  3ONM A;  3A09 A;  4F19 A;  4P1L A;  3RT6 B;  3F11 A;  1D9V A;  1BIY A;  1Q9D A;  4NMY A;  1LBC A;  3I6V A;  3SEV A;  1BP5 A;  2BJI A;  1FPF A;  1B7Z A;  4MNI A;  1JNF A;  3TEL A;  4BDL A;  5L9M A;  4GWO A;  2B4M A;  4P1E A;  4JVD A;  4C1U A;  1A55 A;  3VXB A;  4XFE A;  5HM4 B;  3QIM A;  2FA7 A;  1Y1Z A;  3UN6 A;  3TTR A;  1JW5 A;  1MH4 A;  3LUY A;  1LFG A;  4X1D A;  4F22 A;  4U1Z A;  3K1M A;  3N6U A;  4I40 A;  2OWS A;  5ET6 A;  3DRJ A;  1B1X A;  1KZ8 A;  2XX8 A;  4N6D A;  3FVO A;  4FBP A;  1R1N A;  1NV5 A;  4OVT A;  1GTK A;  4OHN A;  1CB6 A;  1B4Z A;  2RCB A;  1XVX A;  2DWJ A;  2ONR A;  3ZSF A;  4N07 A;  4EF1 A;  3K1N A;  1YCJ A;  2XWV A;  4O7I A;  2RF1 A;  3QUF A;  1DCU A;  1BLF A;  5AA2 D;  3HCQ A;  4N81 A;  1MQH A;  5ET7 A;  1FPG A;  3L6H A;  4LVQ A;  3QMF A;  2RC9 A;  3K2D A;  2FNC A;  1LBB A;  4F1Y A;  3IOT A;  3OOA A;  2Q89 A;  1DPE A;  4GX6 A;  1JVX A;  3H7M A;  2ZYN A;  4DLD A;  1RKM A;  4G68 C;  1FPD A;  5T3J A;  5ELV A;  4YB7 A;  3T22 A;  1MM7 A;  2XXX A;  4POW A;  5HPQ A;  2XXY A;  4KPT A;  3VDF A;  3MUQ A;  2F97 A;  5I57 A;  1NL5 A;  1LBX A;  3PUV E;  3CIJ A;  1NV6 A;  1RYO A;  2QS4 A;  2I48 A;  3V5A A;  3TKD A;  2O68 A;  4BLA A;  4P8B A;  3FAS A;  1NV3 A;  5AA2 A;  2UVG A;  3TEP A;  4QBA A;  2HXW A;  2UYE A;  3SET A;  5AA3 A;  4LQ5 A;  3E9X A;  3HV1 A;  3MVY A;  1USY H;  3VLU A;  1FQA A;  5HBC A;  4RY1 A;  4X04 A;  1RDX A;  2OWZ A;  2PYY A;  1B0H A;  2DVC A;  5A5X B;  5IZ1 A;  2VHA A;  3MP1 A;  2QSX A;  2ZZX A;  4E0W A;  4OWD A;  1B3E A;  3RN8 A;  4GWU A;  2PT1 A;  3GZG A;  3JV9 A;  3K00 A;  3IOU A;  3H6T A;  1Y20 A;  3VLV A;  2AL5 A;  2KR0 A;  5IZZ A;  3MPL A;  1B3F A;  1QGX A;  3K6W A;  3E13 X;  4F1U A;  3TDJ A;  3N26 A;  3KC0 A;  1FTM A;  3EQ1 A;  5LOM A;  2Q2C A; 
#chains in the Genus database with same CATH homology
 2PFZ A;  3O9P A;  3MVW A;  3DRG A;  1B1H A;  4GBV A;  4IR8 A;  3LVU A;  5F1Q A;  3FBP A;  4GWZ A;  3IFA A;  3MZ9 A;  1DBZ A;  4MNP A;  3PAM A;  1FPB A;  4XKP A;  1FBD A;  1NV2 A;  3ROJ A;  1FPI A;  1B52 A;  3MST A;  3E79 A;  1LEV A;  3M8U A;  1FBE A;  1B40 A;  4MIJ A;  1EYI A;  3B50 A;  5EQ9 A;  1IMF A;  1B3H A;  2WYK A;  2HZL A;  2MKZ A;  1CNQ A;  2WOK A;  3U65 A;  2FBP A;  2CZK A;  4HE2 A;  4N8G A;  4P3L A;  4HXV A;  3T1B A;  5ICQ A;  1QKB A;  1LBY A;  1RDZ A;  3E78 A;  4GF8 A;  3W9V A;  5LDZ A;  1FRP A;  4XEQ A;  3LUZ A;  4GWW A;  4HCW A;  2B4L A;  2FHY A;  4DCY A;  4NHB A;  4GBW A;  1DK4 A;  2CEY A;  4GFR A;  3HFU A;  1G0H A;  3LV0 A;  3BIG A;  4MCO A;  5I5P A;  2Y5L A;  2KQZ A;  4GL8 A;  3DRH A;  4OFO A;  2WOL A;  4X9T A;  4ZEI A;  4P47 A;  4ZE9 A;  2PCR A;  4MNC A;  4PAF A;  1ZU0 A;  3MZB A;  4N15 A;  3MVZ A;  3B8B A;  2DE3 A;  4OEV A;  1NUX A;  1FBP A;  1NI9 A;  1B3L A;  2F5X A;  3NOH A;  1FPK A;  2HXR A;  2Q74 A;  3EKI A;  1LBV A;  4OET A;  1OLC A;  2DE2 A;  2NOO A;  1NUZ A;  4N6K A;  5A5L A;  4OAN A;  1B2H A;  1K9Y A;  4X8R A;  5IZ3 A;  4RA1 A;  4MX6 A;  3RQT A;  1FPJ A;  2WYP A;  1K9Z A;  4OEU A;  3SZP A;  5JK4 A;  2HHM A;  1NV1 A;  4XKQ A;  5ESY A;  5KZT A;  2CZI A;  4P56 A;  4OVS A;  4NN3 A;  1FTA A;  1B5H A;  4I3Y A;  5IM2 A;  5FBP A;  2GRV A;  4MEV A;  1SPI A;  2WEF A;  3DRF A;  3O6P A;  1AWB A;  1KA1 A;  4G61 A;  5L8D A;  4PGP A;  1EYK A;  1B58 A;  1YZ0 A;  4F1V A;  2Q9T A;  4TOZ A;  1IMA A;  4NF0 A;  2F3D A;  1D9Q A;  4PGN A;  1OLA A;  4OFJ A;  1JET A;  4NAP A;  1NV4 A;  2HZK A;  5EYH A;  2VPN A;  1UIU A;  5DW8 A;  3D1R A;  1FBH A;  4H45 A;  3PTY A;  4QFP A;  4ZEC A;  3RYA A;  3TPA A;  5F24 A;  2V3Q A;  4NQ8 A;  4PBQ A;  2Y5K A;  2QVU A;  4QFO A;  2XXK A;  2WX9 A;  3W9W A;  4O94 A;  4NG7 A;  4OVP A;  4PFY A;  1JEU A;  1RDY A;  1FBG A;  3ZS6 A;  2DE4 A;  2VT5 A;  3I5O A;  2PFY A;  4M1V A;  4PF8 A;  4P9K A;  1B4H A;  4NGU A;  4OFL A;  2P3V A;  4F19 A;  4P1L A;  4ZEK A;  2XWK A;  4N8Y A;  1Q9D A;  3KBZ A;  5J16 A;  2BJI A;  1FPF A;  4XKN A;  2R8T A;  2D5W A;  4MNI A;  2OX3 A;  1B05 A;  4PFT A;  1UQW A;  4PFI A;  4PFB A;  4MHF A;  1ZLQ A;  1XOC A;  1NUW A;  2B4M A;  4PFR A;  3CHG A;  4XKR A;  4P1E A;  4JVD A;  4ZE8 A;  4XFE A;  5EYG A;  4PAI A;  5HM4 B;  2XWO A;  3QIM A;  2RKM A;  4OES A;  4AS4 A;  4GWS A;  2FIX A;  4PTK A;  3KC1 A;  3RYB A;  1FBC A;  1B9J A;  4OVR A;  1JP4 A;  4I40 A;  5ET6 A;  4MJO A;  3DRJ A;  1KZ8 A;  1YYZ A;  4PFU A;  2XA5 A;  4AS5 A;  4N6D A;  1IME A;  4FBP A;  1ZTY A;  3TCF A;  1NV5 A;  2FVZ A;  4OVT A;  4H46 A;  4F18 A;  1B4Z A;  1B46 A;  2HPG A;  1FPE A;  4QFL A;  5ET8 A;  3A29 A;  2FIE A;  5EQA A;  3RPL B;  1NUY A;  1KA0 A;  1JEV A;  4I9D A;  4GWY A;  4O8M A;  2QFL A;  4PDH A;  4GX3 A;  4ONY A;  1NV7 A;  5EQ8 A;  1B6H A;  1YXI A;  2XWV A;  4O7I A;  4NX1 A;  1DCU A;  5CM6 A;  1B3G A;  4OVQ A;  4QFN A;  4N81 A;  3FXB A;  4PC9 A;  5ET7 A;  2GQ1 A;  1FPG A;  3MVX A;  4DI3 D;  3DRK A;  1VDW A;  1B51 A;  3QMF A;  4PET A;  2ZZW A;  2QVV A;  4WED A;  2P3N A;  4N17 A;  4LN5 A;  3RYD A;  2QVR A;  1FBF A;  4JVI A;  1IMC A;  2Z23 A;  1DPE A;  4GX6 A;  4PCD A;  2CEX A;  1IMB A;  1RKM A;  1LBZ A;  2VPO A;  1FPD A;  4N4U A;  5T3J A;  1EYJ A;  2DVZ A;  4GWX A;  4OER A;  3TCG A;  4HCY A;  1VR5 A;  5LTC A;  3ISP A;  2DDK A;  3RPL A;  4JVC A;  1LBX A;  4YIC A;  5ISU A;  1FSA A;  5ET5 A;  4PBH A;  2CZH A;  1FJ6 A;  1B5J A;  4PE3 A;  1NV6 A;  4GX4 A;  1FPL A;  3BIH A;  4O7M A;  3TCH A;  4XF5 A;  3MYU A;  1NV0 A;  4PF6 A;  1BK4 A;  1QKA A;  4UAB A;  4P8B A;  3DRI A;  4MAG A;  1NV3 A;  1G0I A;  2JJK A;  4HE1 A;  4QBA A;  2WBD A;  1DPP A;  4DCX A;  2O7I A;  1FJ9 A;  2OLB A;  2WBB A;  4DI4 B;  5EQ7 A;  4QXD A;  3MVY A;  4JSD A;  2ZZV A;  5IZ3 B;  1IMD A;  4MMP A;  2F3B A;  3IFC A;  3T66 A;  4HE0 A;  1INP A;  4X04 A;  1RDX A;  4ZED A;  2OWZ A;  4JSO A;  1B0H A;  3RY3 A;  4ZEB A;  4N91 A;  5IZ1 A;  5I7I A;  4OA4 A;  1B5I A;  4PDD A;  2ZZX A;  3GYY A;  3DP8 A;  4PFW A;  3E3K A;  4PAK A;  4YZZ A;  1XI6 A;  4GWU A;  1UIV A;  4I3E A;  1B7H A;  3T0J A;  2XWI A;  2Q8M A;  2KR0 A;  2WOP A;  3MW0 A;  1B32 A;  5IZZ A;  5IGA A;  4QFK A;  2L5V A;  1B3F A;  3FTO A;  1LBW A;  5I3S A;  1QGX A;  4KXP A;  5J1D A;  4F1U A;  2QPQ A;  3KC0 A;  4I8C A;  2V4C A;  4FAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...