3CHGA

The compatible solute-binding protein opuac from bacillus subtilis in complex with dmsa
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
NKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Compatible-Solute-Binding Protein OpuAC from Bacillus subtilis: Ligand Binding, Site-Directed Mutagenesis, and Crystallographic Studies
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligand binding protein
molecule keywords Glycine betaine-binding protein
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3chgA02
3.40.190.230 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3chgA01
3I5OA 3MVZA 1JEUA 1B0HA 4OFOA 1DPPA 1B1HA 4OEVA 4OEUA 4ZEDA 3DRJA 1B3GA 1B3LA 4DCXA 4PFTA 2O7IA 3MVYA 5KZTA 4PFUA 2WOLA 4GFRA 3TCHA 3MW0A 1B32A 3MZ9A 4QFNA 4ZEIA 1B46A 1OLCA 4JSDA 1B5IA 1JETA 4ZE9A 5ISUA 1B3FA 2RKMA 4XKPA 4DCYA 4ZEKA 1RKMA 4PFYA 1B4ZA 2D5WA 3RQTA 3LVUA 1B58A 3MZBA 1B52A 1B5HA 1B5JA 3RYAA 4QFKA 1UIVA 4FAJA 4OETA 4GF8A 1B7HA 4ZE8A 3T66A 1B9JA 1B4HA 3O9PA 4OERA 4XKNA 2GRVA 4WEDA 4I8CA 3DRGA 1VR5A 3DRKA 1B3HA 1XOCA 3CHGA 3DRFA 1ZTYA 4PFWA 4QFLA 4ONYA 3TCFA 3QIMA 4ZEBA 2B4LA 4OESA 3DRHA 3M8UA 4ZECA 1UIUA 5F1QA 3DP8A 1UQWA 3RYBA 4JSOA 1JEVA 5HM4B 1ZU0A 1ZLQA 1DPEA 3PAMA 1OLAA 1QKBA 2WOKA 3FTOA 4QFOA 4I9DA 3TCGA 3RY3A 1B05A 4XKQA 2NOOA 3DRIA 3MVXA 3O6PA 4OFJA 4RA1A 5ICQA 4QFPA 4GL8A 4XKRA 3MVWA 3ZS6A 2WOPA 1B6HA 2OLBA 1B2HA 2Z23A 5L8DA 3E3KA 1QKAA 2B4MA 3TPAA 4TOZA 1B40A 4OFLA 1B51A
chains in the Genus database with same CATH superfamily
1LAGE 3C35A 1QUKA 1FPKA 1IMDA 5TPAA 2F3DA 3LR1A 2F36A 4UACA 1EYJA 3FZVA 1FQCA 4MF3A 4AB5A 3A3UA 1M5FA 3U92A 4POWA 1MXYA 4ZEIA 1N3WA 2DWAA 4F3GA 2GFEA 2XXWA 1B3FA 4XKPA 1YZ0A 1FBPA 3AXFA 3PV0E 1UTHB 2D5WA 4BDMA 5DT6A 4Q30B 4HW8A 1Y4TA 1B7HA 2XA5A 3N6UA 4IGTA 3MBPA 3FJMA 1M5CA 3MYUA 1A8FA 3HO7A 1VR5A 4GOTA 1FBCA 1OMPA 1ZTYA 3VE1B 2OZZA 4OMBA 2Y7KA 4HCYA 3RLFE 2I3VA 3PTYA 1Z7ME 4HXVA 1UQWA 4N15A 2V3TA 1Y3NA 1SW4A 3K2DA 3MP1A 2NXOA 4NN3A 2VHAA 4GVOA 2DXYA 4AS4A 2A5SA 1QUIA 2RF1A 4P0IA 1PBPA 1F9BA 5I2NB 4OVRA 4DLDA 2G93A 1EZ9A 4PC9A 3MVXA 3ODBA 1INPA 1N7WA 3H6TA 4NWDA 4NX1A 3KZGA 2ZZWA 1IEJA 1LSTA 5L8DA 2WYKA 1LFHA 1QKAA 4Z7EA 1MY3A 2F7BA 3KSJA 4Z0IA 5BUUA 2OWTA 1D9YA 3C32A 1SDXA 4NF8B 2I6EA 3RT8A 1EZPA 1JEUA 1RDYA 4OEVA 3GZGA 2V3QA 2PX1A 3CVGA 2DVZA 1BK4A 3TTRA 3VVFA 4KYSA 4MEVA 2HAUA 5I2KA 4N07A 4I40A 2Z22A 3T0JA 1P1UA 2QVUA 4G68A 1MH4A 1XVYA 3K6VA 1MY4A 4G77A 4H1XA 1US5A 4YKIA 1JETA 4WXJA 3FVGA 3BIHA 4OTEA 2ONKE 2XXUA 3USDA 5L9MA 2F7AA 4H46A 1FTOA 5IAIA 2H5YA 2Q2AA 4DXCA 3IK6B 4YZZA 4GWWA 3PU5A 3IOUA 4YB5A 4G8MA 4F22A 4PFWA 2I4CA 1D9QA 1OIBA 3BFTA 4NF0A 3QIMA 3K6WA 3M3FA 2R6GE 2F35A 3W15C 3IL1B 2ZZVA 2DWIA 4PQJA 4ZECA 3HCQA 4H5FA 4EQ9A 5I2KB 1LGBC 4C1UA 4H8IA 4FIMA 3IB1A 3K1MA 1NNFA 5M2VA 2WOKA 1VFEA 4Q5TA 4N81A 2F5XA 3KGCA 4G8HA 2DQVA 4XKQA 1QULA 1UTBB 1ZJLA 2QL3A 5H8NB 5EHMA 4P47A 1S50A 1Y4CA 4LN5A 3S9MC 3FVKA 4OFLA 3UGWA 1ZBMA 2ZNTA 2XXQA 2I49A 3C31A 1H3DA 5EQ8A 5TU0A 4NF6A 1XHYA 4TLLB 1L5TA 5I2NA 5H8QB 1M5EA 1FRPA 5I58A 3QUFA 2NUVA 1FPLA 2QS3A 4RNSA 3T1BA 3EF7A 4DI4B 4GX4A 3OOAA 5J1DA 4X48A 1RDXA 3CRBA 3VLUA 5AA2B 1KZ8A 5ET6A 4N6DA 3A29A 4G61A 3U65A 4DXBA 3BFUA 3ILUB 4QSEA 3E13X 2F78A 3G3HA 2HQ0A 4FEBA 3DRGA 5A5XB 2O84X 5KCJA 2QSXA 2UXAA 4PE5B 1MPCA 3VXCA 5KCJB 3KFMA 2CEYA 1Y3QA 2I3WA 3O6GA 3CFLA 2HXWA 3MSTA 2QRYA 4ISUA 3CSBA 3H4ZA 5EYHA 3SEVA 1MPDA 2XHDA 3DELB 3UIFA 3MP8A 1RYXA 1K9ZA 4XXUA 4KCCA 1G0HA 4LUBA 3VVEA 2DE4A 1LB9A 3LC8A 1JW4A 3HHGA 5ET7A 4N8GA 5I84A 4GL8A 3PD9A 3ZS6A 5IZ1A 3E3KA 3TTMA 3TPAA 2QMXA 2H98A 4XTCQ 1ZMGA 4GBVA 5ITOA 4N6PA 4PGNA 4U4XA 2Q74A 2LAOA 2F97A 2Y5LA 1LBYA 3KBZA 4DCXA 2E1SA 3SEXA 3MVYA 5I57B 2AL5A 1IMBA 4ESWA 1RYOA 1NV4A 3OEMA 4R9GA 1IQ7A 1BP5A 1H44A 4ELQA 3K0VA 5BWJA 5ET8A 3TTKA 4F29A 4DCYA 1PB9A 2Y5KA 4FATA 1B52A 1YAEA 3T93B 3S4UA 1YTVA 4LZ7A 2XXRA 4QSDA 5H8FA 4WEDA 3M3LA 1S7YA 2WKYA 1D9VA 2B3BA 2UVGA 3U8QA 4G2ZA 4JWOA 1SW1A 5JK4A 4RPNA 4F3BA 4IO4A 3DRHA 4JSOA 3EQ1A 3S9LC 2D3IA 2RC8A 2MKZA 1ZKBA 3O28A 3V89B 3S9EA 4IY6A 4F3PA 5I59A 1LCFA 3IB2A 2VPOA 2PFZA 1PB7A 1MQDA 2ONRA 3IO4A 1B6HA 1LAFE 5LDZA 4RK2A 3LSFB 4QHQA 1OVBA 4R73A 4NF5A 4BDOA 4JWYA 3FJ7A 3MVZA 4X9TA 1VFDA 2KQZA 2OWSA 2Q8MA 3DRJA 5HPQA 3RUMA 1B3GA 3FD3A 4PAKA 1P1WA 4GD5A 3LSXA 1B7ZA 1AWBA 4N6KA 2YJPA 3EHSA 1USYH 5EQAA 4P56A 1Y9UA 4LA9A 1SI1A 1B5IA 4I3EA 1NUZA 1FJ9A 1CE2A 4ZEKA 3PUYE 2FBPA 3F11A 4LZ8A 1KA0A 2XXXA 4RK9A 3H6UA 1FSAA 4GWSA 2DDKA 4JVIA 4I8CA 4MNIA 4Q0CA 4NF5B 1IMEA 4YICA 4IGRA 5DEXA 4XF5A 3LUYA 1A99A 3R7XA 4M1VA 4PGPA 1A55A 4O3BA 2D21A 3OO7A 3A3CA 5K2YA 4MH5A 4PAIA 5F24A 2QS4A 2ZNSA 4O3AA 1VSOA 2V84A 3LBSA 4F19A 4NMYA 3MZ1A 1UTBA 1NNKA 3IFAA 4MNPA 3EN3A 5AA4A 4RY1A 2H4IA 4ZZEA 3G3IA 3CI8A 2DE2A 3KC0A 1LLSA 1FTMA 4GIZA 1SYHA 2XX7A 3RPLB 2O1LA 1FPIA 3CG1A 4P3LA 5TP9B 5JEIA 5I59B 2JJKA 4H8JA 1WODA 5JTYB 4N4UA 1SPIA 1EU8A 2F34A 5AA4B 3WAEA 1MQGA 1IMCA 4PDHA 3MW0A 5F7VA 1QVSA 2UVIA 2QS2A 1SQYA 4PFBA 3H6VA 3TAJA 3PUWE 4QBAA 4FBPA 4LQ2A 1B4ZA 3TKDA 4MAGA 3NOHA 2GH9A 3JV9A 4L17A 1P99A 2ZYMA 5EQ9A 3PMXA 5I7IA 2R9JA 1AH5A 2RC7A 4DZ1A 3QSLA 3O9PA 3T96B 5H8SA 3UA8A 3D4GA 5CMBA 1POY1 4MHFA 2PBWA 3T9VA 4PF6A 1TT1A 5H8NA 3LV0A 2B4LA 3T9HB 1DK4A 5AA1A 3ECRA 1UIUA 3DP8A 2P3NA 3QYTA 4I62A 2DP8A 2WBBA 2F7CA 3TUSA 2O1MA 2CZIA 1JVXA 3RT6B 2DXRA 3O6PA 4E0XA 3V5AA 1SW2A 1UTHA 2NWJA 1WDNA 4G68C 2M8CA 4JVDA 1I69A 2Z8FA 3MPLA 4G8NA 3U72A 1DCUA 4X04A 3VV5A 1B0LA 2Y84A 1B0HA 3IOTA 4GL0A 4GWXA 2PMSA 4NF4A 4EQ7A 3GBAA 3TTLA 4HS7A 4ESXA 2XXTA 4MNCA 1R1NA 3GLBA 4R74A 1GR2A 4ZE9A 2AL4A 3UORA 2G29A 4NE4A 2DSFA 3ZSFA 1RKMA 3OSQA 4F2OA 1B58A 1NV3A 3KN3A 4LP2B 4O94A 3I6VA 1B5JA 2H99A 3TYHA 1YPNA 1B40A 5L9OA 4GWUA 3CSGA 2OK2A 4GF8A 1B9JA 1B4HA 4U23A 1MQHA 5CBRA 4JWXA 2GRVA 1FBDA 1N3XA 2THIA 2OX3A 4IO7A 4QSCA 3RPWA 4NGUA 2B3FA 3IORA 4FJPA 4GQOA 2X7PA 4GX6A 1MQJA 3GBBA 1JP4A 3PAMA 4I9DA 3FBPA 1USYE 1MXWA 4EF2A 5CMMA 1NNTA 3MPKA 4P8BA 5FTHA 1FTKA 4EXKA 1SD3A 5AE4A 3KJTA 4C1TA 3K02A 1LAHE 2Y7PA 4E0WA 4TOZA 3GYYA 4R2FA 3KC1A 3K4UA 1N76A 2F3BA 4DE8A 4PBHA 3O2AA 1KWHA 5ET5A 4OEUA 4O7IA 4IY5A 2Y7WA 3TTNA 3T9UA 4PFTA 1ATGA 4BLAA 2XD3A 4PFUA 1MG1A 2R8TA 4H65A 4P1LA 2HEUA 4O7MA 1FTLA 4NHBA 3B50A 2YLNA 1IZ1A 3FVNA 4PFYA 1LB8A 2Q2CA 1MY0A 3E4RA 4HE0A 1ELJA 3OMBA 1NV6A 3MJNA 1UIVA 1DBZA 4OETA 3ILTB 4ZE8A 3T66A 5TP9A 4KYEA 4R6KA 3T22A 4ELRA 5TPAB 1MH3A 4KR5A 3DLNA 4PFIA 1XOCA 3DRFA 3PMVA 1NV2A 2P0SA 4OVTA 4YAHX 5J16A 4U4SA 4OENA 3KN8A 3SERA 4AQ4A 2W7YA 4EXLA 5K2XA 4I1DA 2RINA 3N5LA 4ZEFA 4F31B 1FTJA 5B70A 5IM2A 4THIA 3TCGA 1DSNA 2GHAA 3OD7A 4OFJA 4NF4B 4BDLA 2O7UA 2AYSA 1EYKA 3SEUA 4KQPA 2VP1A 3WAFA 3G3FA 3MVWA 1FW0A 3I3VA 2PFYA 1D4NA 2OLBA 4DXUA 1FTAA 2FA7A 4G68B 3MP6A 2DE3A 3I5OA 1QUJA 1K9YA 2AIXA 2F6GA 2QFLA 5T3JA 4R72A 2L5VA 2R71A 3OO9A 3LSWA 1IXCA 1MXXA 3DM0A 4ZEDA 2CEXA 3E9XA 5CMCA 2H9BA 5B7DA 4K3FA 2WOLA 2I0CA 3D1RA 1Q9DA 4GXAA 3Q29A 2ZXTA 3SKPA 1LEVA 3IJXB 2ZYKA 4H45A 1NV1A 1NV7A 3C9HA 1OQGA 2RCBA 1H45A 3E79A 3IJOB 3IB0A 2VGQA 4ZS9A 1SW5A 3VLWA 1PBQA 1R6ZA 3FXRA 3KEIA 1RDZA 3CHGA 3UP9A 4RYAA 3IFCA 4O3CA 1I6BA 4ONYA 3TCFA 3IX1A 3MAMA 4MJOA 4Q8RA 3FJGA 4QF9A 1NKXA 4PP0A 3O29A 1FBHA 5DW8A 2XXYA 2XXPA 1DPEA 2HXRA 3SESA 3TELA 5JTYA 1P1NA 3O97A 4PCDA 5I56B 5KDTA 1Q1KA 3O66A 2A5TB 5EYGA 5I58B 2REGA 3RPLA 2QJEA 2DWHA 3TMGA 1IITA 1NV5A 3H6WA 1HSLA 1P1OA 3G3JA 5CMKA 4OQOA 3VFJA 4POXA 4HE1A 3K01A 4IO3A 2P3VA 5KZTA 1LBZA 1T0KA 1NUXA 4X8RA 3FASA 2WEFA 1OLCA 4U22A 4NF8A 1QGXA 2RKMA 3LUZA 2HCAA 5DYHA 4BDQA 5I57A 1A40A 1XT8A 4OVPA 3PUXE 5IKBA 4U2RA 2UYEA 4H0WA 2O6AA 5CM6A 1II5A 2OBGA 1MXZA 4OERA 3ROJA 5DVJA 2BJJX 2Z8EA 4GWZA 5CC2A 3CR9A 1A7LA 1PB8A 2HAVA 3FXQA 2QS1A 4PE3A 1I6AA 2HZKA 4MFIA 1N7XA 3U1OA 3CG3A 5CRYA 5HM4B 1ZU0A 2XXVA 1SVXB 3JZJA 4KCDA 1TFAA 2ANJA 1LFIA 5ICTA 2NOOA 1DTGA 4H6DA 3TZAA 4OHNA 5ICQA 3OXNA 4XKRA 3JYRA 4IO6A 3HSTA 1B2HA 1YYZA 1BTJA 1DOTA 1D3KA 3IO6A 3W9WA 3TQWA 2XXKA 5ELVA 3O6IA 4TLMB 4RJZA 4QRZA 1NL5A 1EYIA 1LCTA 2XWKA 3HN0A 1LBCA 1GVCA 3OO6A 4DDDA 5H8QA 5H8HB 1JNFA 3R6UA 2PYYA 3QXMA 1NNPA 4KD5A 3PPPA 3G7WA 1NH7A 2XX8A 5AA2D 2HFBA 4R6YA 3IAZA 3B8BA 4YB7A 2Y7RA 5H8FB 4NG7A 4KPTA 1DMBA 2QVVA 2X7QA 1HSEA 2CZKA 1NV0A 3M3KA 5EHSA 4DIGA 2FHYA 4JB7A 3OELA 4QFKA 5IZ3B 3BIGA 3P7IA 1EH3A 2CZHA 4U21A 3Q25A 2I0BA 4DI3D 1IUDA 4OYVA 3BBRA 4HE2A 1BKAA 3MUQA 4QXDA 4YKJA 1NUWA 3KG2A 2UVHA 2FNCA 4LVQA 4F1VA 2PCRA 1A54A 1PC3A 3PPNA 4PETA 2O68A 1MQIA 5CI5A 3FTOA 2VOZA 3IR1A 1US4A 4F2QA 3MWBA 3T9XB 1M5DA 1Y3PA 3FXUA 4LONB 1XC1A 4MBPA 1Z7NE 3TFLA 4X1DA 3VDFA 1SI0A 2DWJA 4OVQA 3FUZA 4JBZA 1G0IA 1BIYA 3QK6A 4PTKA 1B1HA 4FORA 3ZKLA 5H8HA 1NFTA 3K1PA 2XXIA 3RNNA 1URGA 5I3SA 4KHZE 1Y1ZA 3C34A 1JW1A 1AL3A 5L9SA 1Y1MA 1S9TA 1O64A 4R2BA 1NMUA 4OANA 2ONSA 1POTA 2ZZXA 3GXAA 2DYXA 3MZBA 3ISPA 3TDJA 1O7TA 3W9VA 3RYAA 1ZIUA 1MM7A 5DTBA 4XKNA 3PGFA 3RTFB 4BDRA 5LOMA 1P1QA 4MLQA 1FQAA 4M4GA 4UA8A 2ZYNA 1PDAA 4EDPA 3EPEA 1SYIA 3O6HA 4ZEBA 3N26A 1FPBA 1IIWA 4OESA 3VVDA 4KFQA 1AMFA 2FIXA 2XWOA 3EKIA 1XVXA 2Q9TA 1LBXA 1A8EA 3V83A 1NUYA 3KOTA 4LQ5A 1OLAA 2ALUA 4NEDA 2KR0A 2X26A 4NQ8A 1FBFA 3QAXA 3V8XB 4PAFA 1QJMA 4RA1A 4GWYA 1URDA 3BKIB 4R6HA 1CB6A 2WOPA 1TWYA 3B7DA 4EUOA 4LATA 1FQFA 3Q28A 5ITPA 4MX6A 2DOJA 4I3YA 4GWOA 4NTLA 4P11A 1FPJA 4JDFA 4P9KA 4U1ZA 1KA1A 3ONMA 3PUZE 4XEQA 4YKPA 3SETA 5CBSA 2I48A 3RYDA 4N8YA 4GX3A 3OENA 1B1XA 1DTZA 1B46A 3B6WA 4PFRA 2IA4A 5ISUA 3QUJA 4N91A 4IB2A 1B7UA 4MCOA 1MS7A 4RXLA 2F6PA 4IO5A 4H67A 1GV8A 2O51A 4P1EA 5DVFA 2OJTA 5FHMA 4F1YA 3PUVE 5HBCA 1MXUA 3VXBA 3S2VA 2Q8JA 3TEPA 4QFLA 2QMWA 2IEEA 2ABHA 2QVRA 4ZZAA 5EYFA 2DVCA 1MDP1 5AA3A 1WVJA 3L6GA 2V93A 1MRPA 3FV1A 2CMOA 3RYBA 1JEVA 4KXPA 4GLIA 2HPGA 3FVOA 4KYDA 3H7MA 2CZLA 2VD3A 2XWVA 3KN7A 3HPIA 1LBWA 5AA2A 3KSXA 1CNQA 3E78A 1NH8A 1FBEA 2RCAA 3HFUA 4MIJA 2PVUA 1GTKA 4NAPA 2Z23A 1R9QA 1LFGA 3U94A 4JVCA 2REJA 1DPPA 3CFXA 3C33A 5IGAA 1IMAA 3THIA 4NF6B 3KBRA 3HV1A 1GGGA 1XS5A 1FBGA 4TQUQ 4YMAA 1YCJA 4QFNA 4JSDA 2KLFA 4KI0E 4PBQA 3SDFA 2PT1A 4HCWA 3RQTA 2NVUB 2HHMA 4R75A 4FECA 1OQHA 2GHBA 1FQEA 3QMFA 2HZLA 1FPEA 4YMBA 3B6QA 3SZPA 5EQ7A 1VDWA 2ZYOA 3FGSA 3K00A 3B6TA 4OXVA 2ZMBA 1N84A 3TODA 4ZDMA 3M8UA 5F1QA 3KJ7A 4YKKA 2V3UA 3DP6A 2F8DA 1ZLQA 1FCKA 5FHOA 3DP4A 3OO8A 2V25A 4P0GA 3DRIA 5FTIA 5ESYA 1I6QA 1R9LA 1AOVA 1IXGA 3VLVA 1FJ6A 1M5BA 3OEKA 3RN8A 4ND9A 1HSJA 4F39A 2ESNA 1MY1A 4MLVA 2B4MA 4OVSA 2BJIA 1AIVA 3RGYA 1B51A 4C0RA 1J1NA 5FHNA 4OFOA 4UABA 4F1UA 1JVYA 1IMFA 2O7IA 2FIEA 3S9NC 1H43A 2XXHA 4LZ5A 3A09A 5DEXB 2B65A 5A5LA 1B32A 5IZZA 3MZ9A 3U93A 3PPRA 2GQ1A 4OZ9A 2WYPA 1N04A 2QPQA 3LVUA 2VT5A 4ECFA 5IZ3A 3MC2A 1NI9A 4X1BA 3TQLA 3Q26A 4FAJA 3FATA 2I58A 1TFDA 3HHFA 1URSA 1Y20A 1LAXA 3G3KA 4PF8A 4F3SA 1LBBA 1B3HA 4WKMA 2WX9A 1QW0A 4GRKA 2I4BA 3H06B 3FV2A 4XFEA 1JQFA 1ANFA 3PD8A 4HTGA 1MPBA 4H5GA 1YXIA 2XX9A 5KDTB 1VE4A 3UK4A 5FBPA 2PT2A 2VPNA 1IXIA 1O63A 2Z8DA 4AS5A 2V4CA 4AB6A 2RC9A 4R9FA 1B3EA 4QFOA 2YPNA 3RY3A 5A5XA 3K1NA 3H03A 1IXHA 3OSRA 4BDNA 4EQBA 4QFPA 4YB6A 4PDDA 3UN6A 4OVJA 4O8MA 2DS9A 2OWZA 1FQDA 1JW5A 3LSLA 3C4MA 4F18A 1TXFA 1PEBA 4RPOA 1LBVA 5I5PA 3D4CA 3Q27A 1B3LA 2FYIA 4N13A 2XWIA 4U1OA 3ZKKA 3IOVA 2WBDA 3FIRA 1FPFA 1EZOA 4GFRA 3TCHA 3R26A 1SBPA 4FE8A 3MQ9A 3N6TA 1MXVA 4WEPA 4OWDA 2Q88A 2E0SA 4XIGQ 2Y7IA 1H76A 3KOSA 1B5HA 1MY2A 3EHTA 4GBWA 4YU0A 4ELOA 1FQBA 2H25A 3G3GA 2FVZA 3SEYA 4NWCA 3PPOA 4JXIA 2P2AA 4IR8A 5LTCA 3PPQA 3N94A 3DRKA 3PMWA 3L6HA 2P1SA 3FXBA 2UYFA 4G4PA 1Q35A 1MM6A 2A5TA 4MMPA 5DVIA 5I56A 3EHUA 1MDQA 3C36A 3H3GA 3K6XA 2ZNUA 3IOWA 3CIJA 1OVTA 4GXSB 4OA4A 2Q89A 2VD2A 2XD2A 1QKBA 4IO2A 1N0TA 3K6UA 2UVJA 3RTWB 1B05A 2OCUA 4EF1A 1FPGA 4N17A 1BLFA 3CFZA 4FEDA 2O69A 3SEWA 4ELPA 1FPDA 1XI6A
chains in the Genus database with same CATH topology
3I5OA 1K9YA 2QFLA 4MX6A 5T3JA 1FPKA 4I3YA 1IMDA 3MVZA 2L5VA 4X9TA 2Q8MA 2KQZA 2F3DA 1FPJA 4ZEDA 3DRJA 1B3GA 4P9KA 2CEXA 1KA1A 4PAKA 1EYJA 4XEQA 2WOLA 3RYDA 4N8YA 3D1RA 1Q9DA 4GX3A 1AWBA 1LEVA 4N6KA 4ZEIA 4H45A 1B46A 1NV1A 4P56A 5EQAA 1NV7A 4I3EA 1B5IA 4PFRA 5ISUA 1B3FA 1NUZA 1FJ9A 4XKPA 4N91A 1YZ0A 1FBPA 4ZEKA 4MCOA 2D5WA 3E79A 2FBPA 1KA0A 4P1EA 1B7HA 1FSAA 2XA5A 4GWSA 2DDKA 3MYUA 1RDZA 4JVIA 4I8CA 1VR5A 1FBCA 3CHGA 4MNIA 1ZTYA 4QFLA 3IFCA 4ONYA 3TCFA 2QVRA 1IMEA 4MJOA 4HCYA 4YICA 3PTYA 4HXVA 4XF5A 1FBHA 5DW8A 1UQWA 4M1VA 3RYBA 4N15A 4PGPA 1JEVA 4KXPA 2HPGA 4NN3A 1DPEA 4PAIA 5F24A 2HXRA 4AS4A 2XWVA 4OVRA 1LBWA 4F19A 4PC9A 3MVXA 1INPA 1CNQA 3E78A 4PCDA 3IFAA 4MNPA 1FBEA 3HFUA 4MIJA 2DE2A 4NX1A 5EYGA 4NAPA 2ZZWA 2Z23A 5L8DA 3KC0A 2WYKA 3RPLA 1QKAA 1NV5A 3RPLB 1FPIA 4P3LA 4JVCA 1JEUA 1RDYA 2JJKA 1DPPA 4HE1A 4OEVA 5IGAA 1IMAA 2V3QA 2DVZA 4N4UA 1BK4A 2P3VA 5KZTA 1SPIA 4MEVA 1LBZA 3T0JA 4I40A 1NUXA 2QVUA 1IMCA 1FBGA 4PDHA 3MW0A 4X8RA 4QFNA 2WEFA 1OLCA 4JSDA 1JETA 4PFBA 1QGXA 4QBAA 2RKMA 4FBPA 4PBQA 3BIHA 3LUZA 1B4ZA 4HCWA 3RQTA 2HHMA 4MAGA 3NOHA 4OVPA 5EQ9A 5I7IA 3QMFA 2HZLA 1FPEA 4H46A 5CM6A 3O9PA 3SZPA 5EQ7A 4OERA 1VDWA 3ROJA 4YZZA 4GWWA 4GWZA 4MHFA 4PFWA 1D9QA 4NF0A 4PF6A 3QIMA 4PE3A 3LV0A 2HZKA 2B4LA 1DK4A 2ZZVA 3M8UA 4ZECA 1UIUA 5F1QA 3DP8A 2P3NA 2WBBA 5HM4B 1ZU0A 1ZLQA 2WOKA 4N81A 2CZIA 2F5XA 4XKQA 2NOOA 3DRIA 3O6PA 5ICQA 5ESYA 4XKRA 1FJ6A 4P47A 4JVDA 1B2HA 4LN5A 1YYZA 2B4MA 4OVSA 2BJIA 3W9WA 4OFLA 1B51A 2XXKA 1DCUA 4X04A 5EQ8A 1B0HA 4OFOA 1EYIA 4UABA 4F1UA 2XWKA 4GWXA 1IMFA 2O7IA 2FIEA 1FRPA 1FPLA 5A5LA 1B32A 5IZZA 3MZ9A 3B8BA 4MNCA 3T1BA 4NG7A 4ZE9A 4DI4B 4GX4A 2GQ1A 5J1DA 1RKMA 2WYPA 2QVVA 2QPQA 3LVUA 1RDXA 2VT5A 2CZKA 1NV0A 1B58A 1NV3A 4O94A 1KZ8A 5ET6A 1B5JA 4N6DA 5IZ3A 2FHYA 3A29A 4G61A 1NI9A 3U65A 1B40A 4QFKA 4GWUA 4FAJA 5IZ3B 4GF8A 1B9JA 1B4HA 3BIGA 2GRVA 1FBDA 3DRGA 2CZHA 4PF8A 1B3HA 2WX9A 4DI3D 2OX3A 2CEYA 4HE2A 4XFEA 4QXDA 1NUWA 3MSTA 4NGUA 5EYHA 1YXIA 4F1VA 2PCRA 4PETA 4GX6A 5FBPA 2VPNA 1K9ZA 1JP4A 4AS5A 2V4CA 3PAMA 1G0HA 4QFOA 3FTOA 4I9DA 3FBPA 3RY3A 2DE4A 4P8BA 5ET7A 4QFPA 4N8GA 4GL8A 3ZS6A 4PDDA 5IZ1A 3E3KA 4O8MA 3TPAA 2OWZA 4TOZA 3GYYA 3KC1A 4GBVA 2F3BA 4PGNA 4OVQA 4PBHA 1G0IA 2Q74A 4F18A 4PTKA 1B1HA 5ET5A 4OEUA 1LBVA 2Y5LA 4O7IA 1LBYA 3KBZA 5I5PA 1B3LA 4DCXA 4PFTA 3MVYA 2XWIA 1IMBA 4PFUA 2WBDA 5I3SA 2R8TA 1FPFA 4GFRA 4O7MA 3TCHA 4P1LA 1NV4A 4NHBA 3B50A 5ET8A 4DCYA 4PFYA 4OANA 2Y5KA 2ZZXA 4HE0A 3MZBA 3ISPA 1B52A 1NV6A 1B5HA 3W9VA 4GBWA 3RYAA 1UIVA 1DBZA 2FVZA 4OETA 4ZE8A 3T66A 4IR8A 4XKNA 5LTCA 4WEDA 3DRKA 4PFIA 1XOCA 3DRFA 1NV2A 4OVTA 5J16A 3FXBA 4ZEBA 5JK4A 1FPBA 4MMPA 4OESA 3DRHA 2FIXA 4JSOA 2XWOA 3EKIA 2Q9TA 2MKZA 1LBXA 1NUYA 4OA4A 5IM2A 1OLAA 2KR0A 1QKBA 3TCGA 1B05A 4NQ8A 1FBFA 4PAFA 4OFJA 4RA1A 2VPOA 1EYKA 1FPGA 4GWYA 2PFZA 4N17A 3MVWA 2WOPA 1B6HA 2PFYA 2OLBA 1FTAA 1FPDA 1XI6A 5LDZA 2DE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5O A;  3MVZ A;  1JEU A;  1B0H A;  4OFO A;  1DPP A;  1B1H A;  4OEV A;  4OEU A;  4ZED A;  3DRJ A;  1B3G A;  1B3L A;  4DCX A;  4PFT A;  2O7I A;  3MVY A;  5KZT A;  4PFU A;  2WOL A;  4GFR A;  3TCH A;  3MW0 A;  1B32 A;  3MZ9 A;  4QFN A;  4ZEI A;  1B46 A;  1OLC A;  4JSD A;  1B5I A;  1JET A;  4ZE9 A;  5ISU A;  1B3F A;  2RKM A;  4XKP A;  4DCY A;  4ZEK A;  1RKM A;  4PFY A;  1B4Z A;  2D5W A;  3RQT A;  3LVU A;  1B58 A;  3MZB A;  1B52 A;  1B5H A;  1B5J A;  3RYA A;  4QFK A;  1UIV A;  4FAJ A;  4OET A;  4GF8 A;  1B7H A;  4ZE8 A;  3T66 A;  1B9J A;  1B4H A;  3O9P A;  4OER A;  4XKN A;  2GRV A;  4WED A;  4I8C A;  3DRG A;  1VR5 A;  3DRK A;  1B3H A;  1XOC A;  3CHG A;  3DRF A;  1ZTY A;  4PFW A;  4QFL A;  4ONY A;  3TCF A;  3QIM A;  4ZEB A;  2B4L A;  4OES A;  3DRH A;  3M8U A;  4ZEC A;  1UIU A;  5F1Q A;  3DP8 A;  1UQW A;  3RYB A;  4JSO A;  1JEV A;  5HM4 B;  1ZU0 A;  1ZLQ A;  1DPE A;  3PAM A;  1OLA A;  1QKB A;  2WOK A;  3FTO A;  4QFO A;  4I9D A;  3TCG A;  3RY3 A;  1B05 A;  4XKQ A;  2NOO A;  3DRI A;  3MVX A;  3O6P A;  4OFJ A;  4RA1 A;  5ICQ A;  4QFP A;  4GL8 A;  4XKR A;  3MVW A;  3ZS6 A;  2WOP A;  1B6H A;  2OLB A;  1B2H A;  2Z23 A;  5L8D A;  3E3K A;  1QKA A;  2B4M A;  3TPA A;  4TOZ A;  1B40 A;  4OFL A;  1B51 A; 
#chains in the Genus database with same CATH topology
 1LAG E;  3C35 A;  1QUK A;  1FPK A;  1IMD A;  5TPA A;  2F3D A;  3LR1 A;  2F36 A;  4UAC A;  1EYJ A;  3FZV A;  1FQC A;  4MF3 A;  4AB5 A;  3A3U A;  1M5F A;  3U92 A;  4POW A;  1MXY A;  4ZEI A;  1N3W A;  2DWA A;  4F3G A;  2GFE A;  2XXW A;  1B3F A;  4XKP A;  1YZ0 A;  1FBP A;  3AXF A;  3PV0 E;  1UTH B;  2D5W A;  4BDM A;  5DT6 A;  4Q30 B;  4HW8 A;  1Y4T A;  1B7H A;  2XA5 A;  3N6U A;  4IGT A;  3MBP A;  3FJM A;  1M5C A;  3MYU A;  1A8F A;  3HO7 A;  1VR5 A;  4GOT A;  1FBC A;  1OMP A;  1ZTY A;  3VE1 B;  2OZZ A;  4OMB A;  2Y7K A;  4HCY A;  3RLF E;  2I3V A;  3PTY A;  1Z7M E;  4HXV A;  1UQW A;  4N15 A;  2V3T A;  1Y3N A;  1SW4 A;  3K2D A;  3MP1 A;  2NXO A;  4NN3 A;  2VHA A;  4GVO A;  2DXY A;  4AS4 A;  2A5S A;  1QUI A;  2RF1 A;  4P0I A;  1PBP A;  1F9B A;  5I2N B;  4OVR A;  4DLD A;  2G93 A;  1EZ9 A;  4PC9 A;  3MVX A;  3ODB A;  1INP A;  1N7W A;  3H6T A;  4NWD A;  4NX1 A;  3KZG A;  2ZZW A;  1IEJ A;  1LST A;  5L8D A;  2WYK A;  1LFH A;  1QKA A;  4Z7E A;  1MY3 A;  2F7B A;  3KSJ A;  4Z0I A;  5BUU A;  2OWT A;  1D9Y A;  3C32 A;  1SDX A;  4NF8 B;  2I6E A;  3RT8 A;  1EZP A;  1JEU A;  1RDY A;  4OEV A;  3GZG A;  2V3Q A;  2PX1 A;  3CVG A;  2DVZ A;  1BK4 A;  3TTR A;  3VVF A;  4KYS A;  4MEV A;  2HAU A;  5I2K A;  4N07 A;  4I40 A;  2Z22 A;  3T0J A;  1P1U A;  2QVU A;  4G68 A;  1MH4 A;  1XVY A;  3K6V A;  1MY4 A;  4G77 A;  4H1X A;  1US5 A;  4YKI A;  1JET A;  4WXJ A;  3FVG A;  3BIH A;  4OTE A;  2ONK E;  2XXU A;  3USD A;  5L9M A;  2F7A A;  4H46 A;  1FTO A;  5IAI A;  2H5Y A;  2Q2A A;  4DXC A;  3IK6 B;  4YZZ A;  4GWW A;  3PU5 A;  3IOU A;  4YB5 A;  4G8M A;  4F22 A;  4PFW A;  2I4C A;  1D9Q A;  1OIB A;  3BFT A;  4NF0 A;  3QIM A;  3K6W A;  3M3F A;  2R6G E;  2F35 A;  3W15 C;  3IL1 B;  2ZZV A;  2DWI A;  4PQJ A;  4ZEC A;  3HCQ A;  4H5F A;  4EQ9 A;  5I2K B;  1LGB C;  4C1U A;  4H8I A;  4FIM A;  3IB1 A;  3K1M A;  1NNF A;  5M2V A;  2WOK A;  1VFE A;  4Q5T A;  4N81 A;  2F5X A;  3KGC A;  4G8H A;  2DQV A;  4XKQ A;  1QUL A;  1UTB B;  1ZJL A;  2QL3 A;  5H8N B;  5EHM A;  4P47 A;  1S50 A;  1Y4C A;  4LN5 A;  3S9M C;  3FVK A;  4OFL A;  3UGW A;  1ZBM A;  2ZNT A;  2XXQ A;  2I49 A;  3C31 A;  1H3D A;  5EQ8 A;  5TU0 A;  4NF6 A;  1XHY A;  4TLL B;  1L5T A;  5I2N A;  5H8Q B;  1M5E A;  1FRP A;  5I58 A;  3QUF A;  2NUV A;  1FPL A;  2QS3 A;  4RNS A;  3T1B A;  3EF7 A;  4DI4 B;  4GX4 A;  3OOA A;  5J1D A;  4X48 A;  1RDX A;  3CRB A;  3VLU A;  5AA2 B;  1KZ8 A;  5ET6 A;  4N6D A;  3A29 A;  4G61 A;  3U65 A;  4DXB A;  3BFU A;  3ILU B;  4QSE A;  3E13 X;  2F78 A;  3G3H A;  2HQ0 A;  4FEB A;  3DRG A;  5A5X B;  2O84 X;  5KCJ A;  2QSX A;  2UXA A;  4PE5 B;  1MPC A;  3VXC A;  5KCJ B;  3KFM A;  2CEY A;  1Y3Q A;  2I3W A;  3O6G A;  3CFL A;  2HXW A;  3MST A;  2QRY A;  4ISU A;  3CSB A;  3H4Z A;  5EYH A;  3SEV A;  1MPD A;  2XHD A;  3DEL B;  3UIF A;  3MP8 A;  1RYX A;  1K9Z A;  4XXU A;  4KCC A;  1G0H A;  4LUB A;  3VVE A;  2DE4 A;  1LB9 A;  3LC8 A;  1JW4 A;  3HHG A;  5ET7 A;  4N8G A;  5I84 A;  4GL8 A;  3PD9 A;  3ZS6 A;  5IZ1 A;  3E3K A;  3TTM A;  3TPA A;  2QMX A;  2H98 A;  4XTC Q;  1ZMG A;  4GBV A;  5ITO A;  4N6P A;  4PGN A;  4U4X A;  2Q74 A;  2LAO A;  2F97 A;  2Y5L A;  1LBY A;  3KBZ A;  4DCX A;  2E1S A;  3SEX A;  3MVY A;  5I57 B;  2AL5 A;  1IMB A;  4ESW A;  1RYO A;  1NV4 A;  3OEM A;  4R9G A;  1IQ7 A;  1BP5 A;  1H44 A;  4ELQ A;  3K0V A;  5BWJ A;  5ET8 A;  3TTK A;  4F29 A;  4DCY A;  1PB9 A;  2Y5K A;  4FAT A;  1B52 A;  1YAE A;  3T93 B;  3S4U A;  1YTV A;  4LZ7 A;  2XXR A;  4QSD A;  5H8F A;  4WED A;  3M3L A;  1S7Y A;  2WKY A;  1D9V A;  2B3B A;  2UVG A;  3U8Q A;  4G2Z A;  4JWO A;  1SW1 A;  5JK4 A;  4RPN A;  4F3B A;  4IO4 A;  3DRH A;  4JSO A;  3EQ1 A;  3S9L C;  2D3I A;  2RC8 A;  2MKZ A;  1ZKB A;  3O28 A;  3V89 B;  3S9E A;  4IY6 A;  4F3P A;  5I59 A;  1LCF A;  3IB2 A;  2VPO A;  2PFZ A;  1PB7 A;  1MQD A;  2ONR A;  3IO4 A;  1B6H A;  1LAF E;  5LDZ A;  4RK2 A;  3LSF B;  4QHQ A;  1OVB A;  4R73 A;  4NF5 A;  4BDO A;  4JWY A;  3FJ7 A;  3MVZ A;  4X9T A;  1VFD A;  2KQZ A;  2OWS A;  2Q8M A;  3DRJ A;  5HPQ A;  3RUM A;  1B3G A;  3FD3 A;  4PAK A;  1P1W A;  4GD5 A;  3LSX A;  1B7Z A;  1AWB A;  4N6K A;  2YJP A;  3EHS A;  1USY H;  5EQA A;  4P56 A;  1Y9U A;  4LA9 A;  1SI1 A;  1B5I A;  4I3E A;  1NUZ A;  1FJ9 A;  1CE2 A;  4ZEK A;  3PUY E;  2FBP A;  3F11 A;  4LZ8 A;  1KA0 A;  2XXX A;  4RK9 A;  3H6U A;  1FSA A;  4GWS A;  2DDK A;  4JVI A;  4I8C A;  4MNI A;  4Q0C A;  4NF5 B;  1IME A;  4YIC A;  4IGR A;  5DEX A;  4XF5 A;  3LUY A;  1A99 A;  3R7X A;  4M1V A;  4PGP A;  1A55 A;  4O3B A;  2D21 A;  3OO7 A;  3A3C A;  5K2Y A;  4MH5 A;  4PAI A;  5F24 A;  2QS4 A;  2ZNS A;  4O3A A;  1VSO A;  2V84 A;  3LBS A;  4F19 A;  4NMY A;  3MZ1 A;  1UTB A;  1NNK A;  3IFA A;  4MNP A;  3EN3 A;  5AA4 A;  4RY1 A;  2H4I A;  4ZZE A;  3G3I A;  3CI8 A;  2DE2 A;  3KC0 A;  1LLS A;  1FTM A;  4GIZ A;  1SYH A;  2XX7 A;  3RPL B;  2O1L A;  1FPI A;  3CG1 A;  4P3L A;  5TP9 B;  5JEI A;  5I59 B;  2JJK A;  4H8J A;  1WOD A;  5JTY B;  4N4U A;  1SPI A;  1EU8 A;  2F34 A;  5AA4 B;  3WAE A;  1MQG A;  1IMC A;  4PDH A;  3MW0 A;  5F7V A;  1QVS A;  2UVI A;  2QS2 A;  1SQY A;  4PFB A;  3H6V A;  3TAJ A;  3PUW E;  4QBA A;  4FBP A;  4LQ2 A;  1B4Z A;  3TKD A;  4MAG A;  3NOH A;  2GH9 A;  3JV9 A;  4L17 A;  1P99 A;  2ZYM A;  5EQ9 A;  3PMX A;  5I7I A;  2R9J A;  1AH5 A;  2RC7 A;  4DZ1 A;  3QSL A;  3O9P A;  3T96 B;  5H8S A;  3UA8 A;  3D4G A;  5CMB A;  1POY 1;  4MHF A;  2PBW A;  3T9V A;  4PF6 A;  1TT1 A;  5H8N A;  3LV0 A;  2B4L A;  3T9H B;  1DK4 A;  5AA1 A;  3ECR A;  1UIU A;  3DP8 A;  2P3N A;  3QYT A;  4I62 A;  2DP8 A;  2WBB A;  2F7C A;  3TUS A;  2O1M A;  2CZI A;  1JVX A;  3RT6 B;  2DXR A;  3O6P A;  4E0X A;  3V5A A;  1SW2 A;  1UTH A;  2NWJ A;  1WDN A;  4G68 C;  2M8C A;  4JVD A;  1I69 A;  2Z8F A;  3MPL A;  4G8N A;  3U72 A;  1DCU A;  4X04 A;  3VV5 A;  1B0L A;  2Y84 A;  1B0H A;  3IOT A;  4GL0 A;  4GWX A;  2PMS A;  4NF4 A;  4EQ7 A;  3GBA A;  3TTL A;  4HS7 A;  4ESX A;  2XXT A;  4MNC A;  1R1N A;  3GLB A;  4R74 A;  1GR2 A;  4ZE9 A;  2AL4 A;  3UOR A;  2G29 A;  4NE4 A;  2DSF A;  3ZSF A;  1RKM A;  3OSQ A;  4F2O A;  1B58 A;  1NV3 A;  3KN3 A;  4LP2 B;  4O94 A;  3I6V A;  1B5J A;  2H99 A;  3TYH A;  1YPN A;  1B40 A;  5L9O A;  4GWU A;  3CSG A;  2OK2 A;  4GF8 A;  1B9J A;  1B4H A;  4U23 A;  1MQH A;  5CBR A;  4JWX A;  2GRV A;  1FBD A;  1N3X A;  2THI A;  2OX3 A;  4IO7 A;  4QSC A;  3RPW A;  4NGU A;  2B3F A;  3IOR A;  4FJP A;  4GQO A;  2X7P A;  4GX6 A;  1MQJ A;  3GBB A;  1JP4 A;  3PAM A;  4I9D A;  3FBP A;  1USY E;  1MXW A;  4EF2 A;  5CMM A;  1NNT A;  3MPK A;  4P8B A;  5FTH A;  1FTK A;  4EXK A;  1SD3 A;  5AE4 A;  3KJT A;  4C1T A;  3K02 A;  1LAH E;  2Y7P A;  4E0W A;  4TOZ A;  3GYY A;  4R2F A;  3KC1 A;  3K4U A;  1N76 A;  2F3B A;  4DE8 A;  4PBH A;  3O2A A;  1KWH A;  5ET5 A;  4OEU A;  4O7I A;  4IY5 A;  2Y7W A;  3TTN A;  3T9U A;  4PFT A;  1ATG A;  4BLA A;  2XD3 A;  4PFU A;  1MG1 A;  2R8T A;  4H65 A;  4P1L A;  2HEU A;  4O7M A;  1FTL A;  4NHB A;  3B50 A;  2YLN A;  1IZ1 A;  3FVN A;  4PFY A;  1LB8 A;  2Q2C A;  1MY0 A;  3E4R A;  4HE0 A;  1ELJ A;  3OMB A;  1NV6 A;  3MJN A;  1UIV A;  1DBZ A;  4OET A;  3ILT B;  4ZE8 A;  3T66 A;  5TP9 A;  4KYE A;  4R6K A;  3T22 A;  4ELR A;  5TPA B;  1MH3 A;  4KR5 A;  3DLN A;  4PFI A;  1XOC A;  3DRF A;  3PMV A;  1NV2 A;  2P0S A;  4OVT A;  4YAH X;  5J16 A;  4U4S A;  4OEN A;  3KN8 A;  3SER A;  4AQ4 A;  2W7Y A;  4EXL A;  5K2X A;  4I1D A;  2RIN A;  3N5L A;  4ZEF A;  4F31 B;  1FTJ A;  5B70 A;  5IM2 A;  4THI A;  3TCG A;  1DSN A;  2GHA A;  3OD7 A;  4OFJ A;  4NF4 B;  4BDL A;  2O7U A;  2AYS A;  1EYK A;  3SEU A;  4KQP A;  2VP1 A;  3WAF A;  3G3F A;  3MVW A;  1FW0 A;  3I3V A;  2PFY A;  1D4N A;  2OLB A;  4DXU A;  1FTA A;  2FA7 A;  4G68 B;  3MP6 A;  2DE3 A;  3I5O A;  1QUJ A;  1K9Y A;  2AIX A;  2F6G A;  2QFL A;  5T3J A;  4R72 A;  2L5V A;  2R71 A;  3OO9 A;  3LSW A;  1IXC A;  1MXX A;  3DM0 A;  4ZED A;  2CEX A;  3E9X A;  5CMC A;  2H9B A;  5B7D A;  4K3F A;  2WOL A;  2I0C A;  3D1R A;  1Q9D A;  4GXA A;  3Q29 A;  2ZXT A;  3SKP A;  1LEV A;  3IJX B;  2ZYK A;  4H45 A;  1NV1 A;  1NV7 A;  3C9H A;  1OQG A;  2RCB A;  1H45 A;  3E79 A;  3IJO B;  3IB0 A;  2VGQ A;  4ZS9 A;  1SW5 A;  3VLW A;  1PBQ A;  1R6Z A;  3FXR A;  3KEI A;  1RDZ A;  3CHG A;  3UP9 A;  4RYA A;  3IFC A;  4O3C A;  1I6B A;  4ONY A;  3TCF A;  3IX1 A;  3MAM A;  4MJO A;  4Q8R A;  3FJG A;  4QF9 A;  1NKX A;  4PP0 A;  3O29 A;  1FBH A;  5DW8 A;  2XXY A;  2XXP A;  1DPE A;  2HXR A;  3SES A;  3TEL A;  5JTY A;  1P1N A;  3O97 A;  4PCD A;  5I56 B;  5KDT A;  1Q1K A;  3O66 A;  2A5T B;  5EYG A;  5I58 B;  2REG A;  3RPL A;  2QJE A;  2DWH A;  3TMG A;  1IIT A;  1NV5 A;  3H6W A;  1HSL A;  1P1O A;  3G3J A;  5CMK A;  4OQO A;  3VFJ A;  4POX A;  4HE1 A;  3K01 A;  4IO3 A;  2P3V A;  5KZT A;  1LBZ A;  1T0K A;  1NUX A;  4X8R A;  3FAS A;  2WEF A;  1OLC A;  4U22 A;  4NF8 A;  1QGX A;  2RKM A;  3LUZ A;  2HCA A;  5DYH A;  4BDQ A;  5I57 A;  1A40 A;  1XT8 A;  4OVP A;  3PUX E;  5IKB A;  4U2R A;  2UYE A;  4H0W A;  2O6A A;  5CM6 A;  1II5 A;  2OBG A;  1MXZ A;  4OER A;  3ROJ A;  5DVJ A;  2BJJ X;  2Z8E A;  4GWZ A;  5CC2 A;  3CR9 A;  1A7L A;  1PB8 A;  2HAV A;  3FXQ A;  2QS1 A;  4PE3 A;  1I6A A;  2HZK A;  4MFI A;  1N7X A;  3U1O A;  3CG3 A;  5CRY A;  5HM4 B;  1ZU0 A;  2XXV A;  1SVX B;  3JZJ A;  4KCD A;  1TFA A;  2ANJ A;  1LFI A;  5ICT A;  2NOO A;  1DTG A;  4H6D A;  3TZA A;  4OHN A;  5ICQ A;  3OXN A;  4XKR A;  3JYR A;  4IO6 A;  3HST A;  1B2H A;  1YYZ A;  1BTJ A;  1DOT A;  1D3K A;  3IO6 A;  3W9W A;  3TQW A;  2XXK A;  5ELV A;  3O6I A;  4TLM B;  4RJZ A;  4QRZ A;  1NL5 A;  1EYI A;  1LCT A;  2XWK A;  3HN0 A;  1LBC A;  1GVC A;  3OO6 A;  4DDD A;  5H8Q A;  5H8H B;  1JNF A;  3R6U A;  2PYY A;  3QXM A;  1NNP A;  4KD5 A;  3PPP A;  3G7W A;  1NH7 A;  2XX8 A;  5AA2 D;  2HFB A;  4R6Y A;  3IAZ A;  3B8B A;  4YB7 A;  2Y7R A;  5H8F B;  4NG7 A;  4KPT A;  1DMB A;  2QVV A;  2X7Q A;  1HSE A;  2CZK A;  1NV0 A;  3M3K A;  5EHS A;  4DIG A;  2FHY A;  4JB7 A;  3OEL A;  4QFK A;  5IZ3 B;  3BIG A;  3P7I A;  1EH3 A;  2CZH A;  4U21 A;  3Q25 A;  2I0B A;  4DI3 D;  1IUD A;  4OYV A;  3BBR A;  4HE2 A;  1BKA A;  3MUQ A;  4QXD A;  4YKJ A;  1NUW A;  3KG2 A;  2UVH A;  2FNC A;  4LVQ A;  4F1V A;  2PCR A;  1A54 A;  1PC3 A;  3PPN A;  4PET A;  2O68 A;  1MQI A;  5CI5 A;  3FTO A;  2VOZ A;  3IR1 A;  1US4 A;  4F2Q A;  3MWB A;  3T9X B;  1M5D A;  1Y3P A;  3FXU A;  4LON B;  1XC1 A;  4MBP A;  1Z7N E;  3TFL A;  4X1D A;  3VDF A;  1SI0 A;  2DWJ A;  4OVQ A;  3FUZ A;  4JBZ A;  1G0I A;  1BIY A;  3QK6 A;  4PTK A;  1B1H A;  4FOR A;  3ZKL A;  5H8H A;  1NFT A;  3K1P A;  2XXI A;  3RNN A;  1URG A;  5I3S A;  4KHZ E;  1Y1Z A;  3C34 A;  1JW1 A;  1AL3 A;  5L9S A;  1Y1M A;  1S9T A;  1O64 A;  4R2B A;  1NMU A;  4OAN A;  2ONS A;  1POT A;  2ZZX A;  3GXA A;  2DYX A;  3MZB A;  3ISP A;  3TDJ A;  1O7T A;  3W9V A;  3RYA A;  1ZIU A;  1MM7 A;  5DTB A;  4XKN A;  3PGF A;  3RTF B;  4BDR A;  5LOM A;  1P1Q A;  4MLQ A;  1FQA A;  4M4G A;  4UA8 A;  2ZYN A;  1PDA A;  4EDP A;  3EPE A;  1SYI A;  3O6H A;  4ZEB A;  3N26 A;  1FPB A;  1IIW A;  4OES A;  3VVD A;  4KFQ A;  1AMF A;  2FIX A;  2XWO A;  3EKI A;  1XVX A;  2Q9T A;  1LBX A;  1A8E A;  3V83 A;  1NUY A;  3KOT A;  4LQ5 A;  1OLA A;  2ALU A;  4NED A;  2KR0 A;  2X26 A;  4NQ8 A;  1FBF A;  3QAX A;  3V8X B;  4PAF A;  1QJM A;  4RA1 A;  4GWY A;  1URD A;  3BKI B;  4R6H A;  1CB6 A;  2WOP A;  1TWY A;  3B7D A;  4EUO A;  4LAT A;  1FQF A;  3Q28 A;  5ITP A;  4MX6 A;  2DOJ A;  4I3Y A;  4GWO A;  4NTL A;  4P11 A;  1FPJ A;  4JDF A;  4P9K A;  4U1Z A;  1KA1 A;  3ONM A;  3PUZ E;  4XEQ A;  4YKP A;  3SET A;  5CBS A;  2I48 A;  3RYD A;  4N8Y A;  4GX3 A;  3OEN A;  1B1X A;  1DTZ A;  1B46 A;  3B6W A;  4PFR A;  2IA4 A;  5ISU A;  3QUJ A;  4N91 A;  4IB2 A;  1B7U A;  4MCO A;  1MS7 A;  4RXL A;  2F6P A;  4IO5 A;  4H67 A;  1GV8 A;  2O51 A;  4P1E A;  5DVF A;  2OJT A;  5FHM A;  4F1Y A;  3PUV E;  5HBC A;  1MXU A;  3VXB A;  3S2V A;  2Q8J A;  3TEP A;  4QFL A;  2QMW A;  2IEE A;  2ABH A;  2QVR A;  4ZZA A;  5EYF A;  2DVC A;  1MDP 1;  5AA3 A;  1WVJ A;  3L6G A;  2V93 A;  1MRP A;  3FV1 A;  2CMO A;  3RYB A;  1JEV A;  4KXP A;  4GLI A;  2HPG A;  3FVO A;  4KYD A;  3H7M A;  2CZL A;  2VD3 A;  2XWV A;  3KN7 A;  3HPI A;  1LBW A;  5AA2 A;  3KSX A;  1CNQ A;  3E78 A;  1NH8 A;  1FBE A;  2RCA A;  3HFU A;  4MIJ A;  2PVU A;  1GTK A;  4NAP A;  2Z23 A;  1R9Q A;  1LFG A;  3U94 A;  4JVC A;  2REJ A;  1DPP A;  3CFX A;  3C33 A;  5IGA A;  1IMA A;  3THI A;  4NF6 B;  3KBR A;  3HV1 A;  1GGG A;  1XS5 A;  1FBG A;  4TQU Q;  4YMA A;  1YCJ A;  4QFN A;  4JSD A;  2KLF A;  4KI0 E;  4PBQ A;  3SDF A;  2PT1 A;  4HCW A;  3RQT A;  2NVU B;  2HHM A;  4R75 A;  4FEC A;  1OQH A;  2GHB A;  1FQE A;  3QMF A;  2HZL A;  1FPE A;  4YMB A;  3B6Q A;  3SZP A;  5EQ7 A;  1VDW A;  2ZYO A;  3FGS A;  3K00 A;  3B6T A;  4OXV A;  2ZMB A;  1N84 A;  3TOD A;  4ZDM A;  3M8U A;  5F1Q A;  3KJ7 A;  4YKK A;  2V3U A;  3DP6 A;  2F8D A;  1ZLQ A;  1FCK A;  5FHO A;  3DP4 A;  3OO8 A;  2V25 A;  4P0G A;  3DRI A;  5FTI A;  5ESY A;  1I6Q A;  1R9L A;  1AOV A;  1IXG A;  3VLV A;  1FJ6 A;  1M5B A;  3OEK A;  3RN8 A;  4ND9 A;  1HSJ A;  4F39 A;  2ESN A;  1MY1 A;  4MLV A;  2B4M A;  4OVS A;  2BJI A;  1AIV A;  3RGY A;  1B51 A;  4C0R A;  1J1N A;  5FHN A;  4OFO A;  4UAB A;  4F1U A;  1JVY A;  1IMF A;  2O7I A;  2FIE A;  3S9N C;  1H43 A;  2XXH A;  4LZ5 A;  3A09 A;  5DEX B;  2B65 A;  5A5L A;  1B32 A;  5IZZ A;  3MZ9 A;  3U93 A;  3PPR A;  2GQ1 A;  4OZ9 A;  2WYP A;  1N04 A;  2QPQ A;  3LVU A;  2VT5 A;  4ECF A;  5IZ3 A;  3MC2 A;  1NI9 A;  4X1B A;  3TQL A;  3Q26 A;  4FAJ A;  3FAT A;  2I58 A;  1TFD A;  3HHF A;  1URS A;  1Y20 A;  1LAX A;  3G3K A;  4PF8 A;  4F3S A;  1LBB A;  1B3H A;  4WKM A;  2WX9 A;  1QW0 A;  4GRK A;  2I4B A;  3H06 B;  3FV2 A;  4XFE A;  1JQF A;  1ANF A;  3PD8 A;  4HTG A;  1MPB A;  4H5G A;  1YXI A;  2XX9 A;  5KDT B;  1VE4 A;  3UK4 A;  5FBP A;  2PT2 A;  2VPN A;  1IXI A;  1O63 A;  2Z8D A;  4AS5 A;  2V4C A;  4AB6 A;  2RC9 A;  4R9F A;  1B3E A;  4QFO A;  2YPN A;  3RY3 A;  5A5X A;  3K1N A;  3H03 A;  1IXH A;  3OSR A;  4BDN A;  4EQB A;  4QFP A;  4YB6 A;  4PDD A;  3UN6 A;  4OVJ A;  4O8M A;  2DS9 A;  2OWZ A;  1FQD A;  1JW5 A;  3LSL A;  3C4M A;  4F18 A;  1TXF A;  1PEB A;  4RPO A;  1LBV A;  5I5P A;  3D4C A;  3Q27 A;  1B3L A;  2FYI A;  4N13 A;  2XWI A;  4U1O A;  3ZKK A;  3IOV A;  2WBD A;  3FIR A;  1FPF A;  1EZO A;  4GFR A;  3TCH A;  3R26 A;  1SBP A;  4FE8 A;  3MQ9 A;  3N6T A;  1MXV A;  4WEP A;  4OWD A;  2Q88 A;  2E0S A;  4XIG Q;  2Y7I A;  1H76 A;  3KOS A;  1B5H A;  1MY2 A;  3EHT A;  4GBW A;  4YU0 A;  4ELO A;  1FQB A;  2H25 A;  3G3G A;  2FVZ A;  3SEY A;  4NWC A;  3PPO A;  4JXI A;  2P2A A;  4IR8 A;  5LTC A;  3PPQ A;  3N94 A;  3DRK A;  3PMW A;  3L6H A;  2P1S A;  3FXB A;  2UYF A;  4G4P A;  1Q35 A;  1MM6 A;  2A5T A;  4MMP A;  5DVI A;  5I56 A;  3EHU A;  1MDQ A;  3C36 A;  3H3G A;  3K6X A;  2ZNU A;  3IOW A;  3CIJ A;  1OVT A;  4GXS B;  4OA4 A;  2Q89 A;  2VD2 A;  2XD2 A;  1QKB A;  4IO2 A;  1N0T A;  3K6U A;  2UVJ A;  3RTW B;  1B05 A;  2OCU A;  4EF1 A;  1FPG A;  4N17 A;  1BLF A;  3CFZ A;  4FED A;  2O69 A;  3SEW A;  4ELP A;  1FPD A;  1XI6 A; 
#chains in the Genus database with same CATH homology
 3I5O A;  1K9Y A;  2QFL A;  4MX6 A;  5T3J A;  1FPK A;  4I3Y A;  1IMD A;  3MVZ A;  2L5V A;  4X9T A;  2Q8M A;  2KQZ A;  2F3D A;  1FPJ A;  4ZED A;  3DRJ A;  1B3G A;  4P9K A;  2CEX A;  1KA1 A;  4PAK A;  1EYJ A;  4XEQ A;  2WOL A;  3RYD A;  4N8Y A;  3D1R A;  1Q9D A;  4GX3 A;  1AWB A;  1LEV A;  4N6K A;  4ZEI A;  4H45 A;  1B46 A;  1NV1 A;  4P56 A;  5EQA A;  1NV7 A;  4I3E A;  1B5I A;  4PFR A;  5ISU A;  1B3F A;  1NUZ A;  1FJ9 A;  4XKP A;  4N91 A;  1YZ0 A;  1FBP A;  4ZEK A;  4MCO A;  2D5W A;  3E79 A;  2FBP A;  1KA0 A;  4P1E A;  1B7H A;  1FSA A;  2XA5 A;  4GWS A;  2DDK A;  3MYU A;  1RDZ A;  4JVI A;  4I8C A;  1VR5 A;  1FBC A;  3CHG A;  4MNI A;  1ZTY A;  4QFL A;  3IFC A;  4ONY A;  3TCF A;  2QVR A;  1IME A;  4MJO A;  4HCY A;  4YIC A;  3PTY A;  4HXV A;  4XF5 A;  1FBH A;  5DW8 A;  1UQW A;  4M1V A;  3RYB A;  4N15 A;  4PGP A;  1JEV A;  4KXP A;  2HPG A;  4NN3 A;  1DPE A;  4PAI A;  5F24 A;  2HXR A;  4AS4 A;  2XWV A;  4OVR A;  1LBW A;  4F19 A;  4PC9 A;  3MVX A;  1INP A;  1CNQ A;  3E78 A;  4PCD A;  3IFA A;  4MNP A;  1FBE A;  3HFU A;  4MIJ A;  2DE2 A;  4NX1 A;  5EYG A;  4NAP A;  2ZZW A;  2Z23 A;  5L8D A;  3KC0 A;  2WYK A;  3RPL A;  1QKA A;  1NV5 A;  3RPL B;  1FPI A;  4P3L A;  4JVC A;  1JEU A;  1RDY A;  2JJK A;  1DPP A;  4HE1 A;  4OEV A;  5IGA A;  1IMA A;  2V3Q A;  2DVZ A;  4N4U A;  1BK4 A;  2P3V A;  5KZT A;  1SPI A;  4MEV A;  1LBZ A;  3T0J A;  4I40 A;  1NUX A;  2QVU A;  1IMC A;  1FBG A;  4PDH A;  3MW0 A;  4X8R A;  4QFN A;  2WEF A;  1OLC A;  4JSD A;  1JET A;  4PFB A;  1QGX A;  4QBA A;  2RKM A;  4FBP A;  4PBQ A;  3BIH A;  3LUZ A;  1B4Z A;  4HCW A;  3RQT A;  2HHM A;  4MAG A;  3NOH A;  4OVP A;  5EQ9 A;  5I7I A;  3QMF A;  2HZL A;  1FPE A;  4H46 A;  5CM6 A;  3O9P A;  3SZP A;  5EQ7 A;  4OER A;  1VDW A;  3ROJ A;  4YZZ A;  4GWW A;  4GWZ A;  4MHF A;  4PFW A;  1D9Q A;  4NF0 A;  4PF6 A;  3QIM A;  4PE3 A;  3LV0 A;  2HZK A;  2B4L A;  1DK4 A;  2ZZV A;  3M8U A;  4ZEC A;  1UIU A;  5F1Q A;  3DP8 A;  2P3N A;  2WBB A;  5HM4 B;  1ZU0 A;  1ZLQ A;  2WOK A;  4N81 A;  2CZI A;  2F5X A;  4XKQ A;  2NOO A;  3DRI A;  3O6P A;  5ICQ A;  5ESY A;  4XKR A;  1FJ6 A;  4P47 A;  4JVD A;  1B2H A;  4LN5 A;  1YYZ A;  2B4M A;  4OVS A;  2BJI A;  3W9W A;  4OFL A;  1B51 A;  2XXK A;  1DCU A;  4X04 A;  5EQ8 A;  1B0H A;  4OFO A;  1EYI A;  4UAB A;  4F1U A;  2XWK A;  4GWX A;  1IMF A;  2O7I A;  2FIE A;  1FRP A;  1FPL A;  5A5L A;  1B32 A;  5IZZ A;  3MZ9 A;  3B8B A;  4MNC A;  3T1B A;  4NG7 A;  4ZE9 A;  4DI4 B;  4GX4 A;  2GQ1 A;  5J1D A;  1RKM A;  2WYP A;  2QVV A;  2QPQ A;  3LVU A;  1RDX A;  2VT5 A;  2CZK A;  1NV0 A;  1B58 A;  1NV3 A;  4O94 A;  1KZ8 A;  5ET6 A;  1B5J A;  4N6D A;  5IZ3 A;  2FHY A;  3A29 A;  4G61 A;  1NI9 A;  3U65 A;  1B40 A;  4QFK A;  4GWU A;  4FAJ A;  5IZ3 B;  4GF8 A;  1B9J A;  1B4H A;  3BIG A;  2GRV A;  1FBD A;  3DRG A;  2CZH A;  4PF8 A;  1B3H A;  2WX9 A;  4DI3 D;  2OX3 A;  2CEY A;  4HE2 A;  4XFE A;  4QXD A;  1NUW A;  3MST A;  4NGU A;  5EYH A;  1YXI A;  4F1V A;  2PCR A;  4PET A;  4GX6 A;  5FBP A;  2VPN A;  1K9Z A;  1JP4 A;  4AS5 A;  2V4C A;  3PAM A;  1G0H A;  4QFO A;  3FTO A;  4I9D A;  3FBP A;  3RY3 A;  2DE4 A;  4P8B A;  5ET7 A;  4QFP A;  4N8G A;  4GL8 A;  3ZS6 A;  4PDD A;  5IZ1 A;  3E3K A;  4O8M A;  3TPA A;  2OWZ A;  4TOZ A;  3GYY A;  3KC1 A;  4GBV A;  2F3B A;  4PGN A;  4OVQ A;  4PBH A;  1G0I A;  2Q74 A;  4F18 A;  4PTK A;  1B1H A;  5ET5 A;  4OEU A;  1LBV A;  2Y5L A;  4O7I A;  1LBY A;  3KBZ A;  5I5P A;  1B3L A;  4DCX A;  4PFT A;  3MVY A;  2XWI A;  1IMB A;  4PFU A;  2WBD A;  5I3S A;  2R8T A;  1FPF A;  4GFR A;  4O7M A;  3TCH A;  4P1L A;  1NV4 A;  4NHB A;  3B50 A;  5ET8 A;  4DCY A;  4PFY A;  4OAN A;  2Y5K A;  2ZZX A;  4HE0 A;  3MZB A;  3ISP A;  1B52 A;  1NV6 A;  1B5H A;  3W9V A;  4GBW A;  3RYA A;  1UIV A;  1DBZ A;  2FVZ A;  4OET A;  4ZE8 A;  3T66 A;  4IR8 A;  4XKN A;  5LTC A;  4WED A;  3DRK A;  4PFI A;  1XOC A;  3DRF A;  1NV2 A;  4OVT A;  5J16 A;  3FXB A;  4ZEB A;  5JK4 A;  1FPB A;  4MMP A;  4OES A;  3DRH A;  2FIX A;  4JSO A;  2XWO A;  3EKI A;  2Q9T A;  2MKZ A;  1LBX A;  1NUY A;  4OA4 A;  5IM2 A;  1OLA A;  2KR0 A;  1QKB A;  3TCG A;  1B05 A;  4NQ8 A;  1FBF A;  4PAF A;  4OFJ A;  4RA1 A;  2VPO A;  1EYK A;  1FPG A;  4GWY A;  2PFZ A;  4N17 A;  3MVW A;  2WOP A;  1B6H A;  2PFY A;  2OLB A;  1FTA A;  1FPD A;  1XI6 A;  5LDZ A;  2DE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...