1ZTYA

Crystal structure of the chitin oligasaccharide binding protein
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
528
structure length
528
Chain Sequence
RSELTIVPDFYPTMVRNFNPYLATNLRTTTDFIYEPLVVFNEMKGNTPVFRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRFRLSEANSNVPYEISLIPIVAEHVWKDVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQLLGKIVNSELDWTSSFVPDIDRTYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKKEALDNVDFRRAFSMALDRQTIIDIAFYGSGTVNDFASGLGYAFEAWSDEATHKKYKGFNTYDVEGSKKLLAKAGFKDVNGDGFVETPSGKSFELLIQSPNGWTDFNNTVQLAVEQLQEVGIKAKARTPEFAVYNQAMLEGTYDVAYTNYFHGADPFTYWNSGYNSALQSGDGMPRFAMHYFTDKKLDGLLDSFYKTADKNEQLAIAHGIQKIIAENQVTIPVMSGAWMYQYNTTRFTGWWSEENPKGRPSVWAGIPERLLHVLDLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the liganded and unliganded periplasmic Chitin oligosaccharide binding protein.
rcsb
source organism Vibrio cholerae
molecule tags Sugar binding protein, signaling protein
molecule keywords Chitin Oligosaccharide Binding Protein
total genus 157
structure length 528
sequence length 528
ec nomenclature
pdb deposition date 2005-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1ztyA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ztyA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1ztyA02
3Q27A 4H65A 5HM4B 3SERA 4YKIA 1VFDA 3FXRA 4KR5A 2VP1A 1A8FA 1URDA 3LUYA 3C33A 4DLDA 1AL3A 2A5TB 4KD5A 1AH5A 1NKXA 1URGA 2O6AA 1NH7A 4GQOA 4WXJA 1FTOA 2OZZA 5HBCA 3RLFE 3HO7A 1B1HA 4QSEA 4ELRA 3V83A 1B0LA 3DP8A 2DOJA 2RKMA 3C34A 1HSEA 2OJTA 3ILTB 3QK6A 1FQEA 3M8UA 3MVYA 4LATA 3TTKA 4DZ1A 4Q8RA 3S9LC 3Q29A 1N84A 3DRGA 4OEUA 4BDQA 1Y4CA 3OSQA 1FTLA 1N76A 1SVXB 4JWXA 2Z8EA 1SW1A 2CMOA 4YB7A 3V8XB 1WDNA 3SEVA 1SW5A 4OERA 3MAMA 4JSOA 2XX9A 1IEJA 1Y20A 4N6PA 3HV1A 5FHNA 2GHAA 4YZZA 1MDP1 1XHYA 4R9FA 4U4SA 4OFOA 4WEPA 4HS7A 4DDDA 1B7HA 2NUVA 4RYAA 4ONYA 1NFTA 1B46A 1QVSA 4ELPA 1B3HA 4ECFA 1OIBA 1POTA 3JYRA 3CR9A 4OETA 3OD7A 3TEPA 1QUIA 4FECA 3FXUA 3HHFA 2PVUA 4H8JA 5JTYA 4LQ5A 4R6KA 2GFEA 4ZZEA 3TAJA 3MWBA 3PV0E 4QSDA 1JVXA 1NNFA 1T0KA 1MM7A 1MY0A 2RINA 3DM0A 3TCFA 1A40A 3FJ7A 3EF7A 1OMPA 4MF3A 4YKJA 2F97A 3KZGA 3H6TA 4U22A 5TU0A 3UORA 1O63A 4DXCA 4P11A 1FTJA 1JETA 5A5XA 2DYXA 3IK6B 3T22A 4NF8A 4QFNA 1B3EA 1Y1MA 2PYYA 4G4PA 4NEDA 3DRFA 3U94A 4EDPA 1EZ9A 2Y7WA 4H6DA 3H4ZA 4F22A 2I0CA 4XKRA 1JVYA 3EHUA 3U8QA 2OWTA 1B5JA 5I59B 3O66A 1XOCA 2XXPA 5I58B 4H5GA 2V93A 1B05A 4H67A 3VLWA 4PFWA 4EQBA 2F36A 4G8NA 5BUUA 3FTOA 2PBWA 3IB1A 4F31B 1XS5A 4Z0IA 2UVJA 5L8DA 3C36A 1USYE 3S4UA 1B0HA 3PAMA 1QULA 4OWDA 1MH3A 4ZEBA 4JBZA 4JSDA 3G3JA 4G8HA 5TP9B 4I9DA 2V25A 4X1DA 4GIZA 4IO4A 2IEEA 2REJA 2NWJA 4GXAA 3U93A 3USDA 1US4A 1WODA 3GXAA 1MXUA 2PT1A 3E4RA 3G3FA 4MH5A 2Y84A 4RPOA 2H9BA 2Q2CA 1SQYA 1NNPA 3T9XB 4L17A 1RKMA 4OYVA 3TTLA 1MQHA 4R74A 2F34A 3BKIB 3QAXA 4TLMB 1LB8A 1IITA 5B7DA 5H8QA 2G29A 3ECRA 1SD3A 4YMBA 2O69A 5CMMA 4JWYA 3IO6A 3Q28A 4U1ZA 4JXIA 1QKAA 5I84A 4RPNA 4FJPA 5IKBA 1UTBB 4U2RA 2Y7IA 3DELB 3GZGA 3ONMA 4ZDMA 1LB9A 1AMFA 2ZNSA 3K6UA 1PB7A 2WOPA 5CBSA 1TFDA 2F6PA 3ZKKA 2XD3A 3VV5A 3LSWA 1SW4A 1MS7A 1UTHA 3GLBA 2B4MA 4HCWA 2HZLA 1EU8A 3V89B 1NNKA 2I4CA 2XXTA 5AA2B 3QUFA 2THIA 5KDTB 2OLBA 1VSOA 2M8CA 2ZYOA 4X9TA 4MBPA 1HSJA 4XTCQ 2B4LA 4H8IA 1M5DA 4F1VA 2NVUB 3SESA 3VLUA 1ZBMA 3A3CA 2O1LA 4TLLB 1MXVA 3TZAA 2ONKE 1P1UA 4AB5A 3DRJA 3B6WA 4LZ8A 5JTYB 1PC3A 2O1MA 1UIUA 5I56A 4XXUA 1D9VA 5FHOA 3G7WA 3K01A 3KN3A 2HAUA 1B1XA 1B3FA 3C31A 2RF1A 3CG1A 5KDTA 2DVZA 3KSXA 1MM6A 2DE3A 2DWIA 1Y3QA 3KOSA 1QKBA 3CHGA 4TOZA 1P1NA 1MQGA 2I49A 3P7IA 3PUZE 4O3CA 4RK2A 1XT8A 3B7DA 5DVIA 3IX1A 3O6PA 2HXWA 1IIWA 3FATA 5I2NB 3WAFA 5IAIA 1H43A 3UN6A 1PDAA 2RCAA 2XXUA 5L9OA 3H3GA 3CFZA 5M2VA 2Y7PA 1Q1KA 1QUJA 4G68A 3LSLA 4H1XA 2V3UA 3VFJA 3TFLA 3T9VA 2E1SA 3RTWB 2XX8A 3PUXE 2B65A 3GBAA 3TCHA 3OENA 4THIA 5H8NA 3U72A 4ZZAA 1US5A 5K2XA 2W7YA 3PD8A 3PMXA 4UACA 3TTMA 4R72A 3S9EA 4O3AA 1JEVA 1S50A 4MLQA 2ESNA 4GVOA 2DE2A 3CVGA 3O28A 1NNTA 4G77A 2BJJX 2DXRA 1R6ZA 3OELA 4RK9A 2O7IA 4X1BA 5DEXA 5FTIA 1VE4A 5KCJA 3RYAA 5DVJA 4LQ2A 4EXKA 1Y1ZA 2V3QA 4N13A 1O7TA 1BTJA 3QUJA 4PP0A 3MP8A 4MFIA 1LBCA 4I1DA 4UA8A 3VDFA 4C0RA 2I48A 4Q5TA 2GRVA 2I6EA 3K6VA 1XVYA 3F11A 3VXBA 2XXWA 2D3IA 3O9PA 3EQ1A 3EPEA 1ANFA 5AE4A 1YPNA 1P1OA 4JB7A 1DTGA 4OESA 4QFOA 1TT1A 2QS3A 3ZS6A 1LCFA 2HQ0A 3ODBA 3UGWA 3L6GA 2KLFA 1IZ1A 2X7QA 2A5TA 4QHQA 3CG3A 2Q8JA 3FXQA 4AQ4A 1II5A 3KSJA 2QL3A 1B5IA 1UTHB 2XXQA 3PUVE 4WEDA 4P0GA 5EYFA 5K2YA 3BFUA 2QSXA 1B40A 1IQ7A 2ZNTA 1ELJA 3EHSA 2DSFA 2GHBA 3MJNA 4NMYA 4F1YA 3MP1A 3OSRA 3WAEA 3KGCA 2DWAA 1FQAA 4BDRA 2O7UA 3FJMA 1IXCA 4FORA 3E9XA 1LFGA 1ZU0A 4PFUA 1MQIA 1KWHA 4YB5A 2E0SA 3KFMA 4IO3A 5I56B 4QFPA 1SW2A 4PETA 2Q89A 4IB2A 3E3KA 1R9LA 3I6VA 4HTGA 4KYEA 4R9GA 4DE8A 4NE4A 3DRKA 2OBGA 2WOLA 1LFIA 4O3BA 3RTFB 3SDFA 3MQ9A 1GVCA 3MUQA 2I3VA 5CMBA 3PD9A 4OXVA 2UVIA 3ZSFA 3CSBA 3O97A 1ZMGA 4HCYA 4IY5A 4M4GA 3FVOA 3N5LA 1F9BA 5ICQA 2QS1A 5TP9A 4DCXA 4OHNA 3FIRA 1I6QA 1IXGA 3S9NC 3TODA 3T9HB 4QFLA 3CI8A 3MPKA 3DLNA 3KJ7A 3IOUA 2NXOA 4U21A 1QJMA 1B32A 3E13X 1MPDA 1QW0A 2ABHA 1ZLQA 2H99A 2V84A 3H6WA 3MC2A 3OEMA 4KQPA 5F7VA 4IY6A 3I5OA 3VXCA 2YPNA 1FTMA 1QUKA 1HSLA 4AB6A 2IA4A 4K3FA 3O29A 4PQJA 3LVUA 1JW5A 3W9WA 1DSNA 3TTRA 3K2DA 1B51A 5KZTA 1FQFA 2DWJA 3FUZA 3TKDA 1H3DA 1H44A 3C9HA 3KJTA 3QSLA 2QS4A 1PB8A 4NF6A 1SYIA 4H0WA 3W15C 4IO2A 5EHSA 3I3VA 3K4UA 2VHAA 4OQOA 1JNFA 2F7CA 3FD3A 3IAZA 4YKKA 3S2VA 3KOTA 3MZ1A 1MG1A 2DXYA 3KEIA 4G68C 4PE5B 4ESXA 1M5EA 3IB2A 1L5TA 3PMWA 2F7AA 1LGBC 3IORA 1SYHA 4GXSB 1RYOA 4IO5A 2QMWA 3K1NA 3FJGA 1B3GA 2FYIA 2DVCA 3PPRA 4KI0E 1MXXA 3VLVA 1IXHA 3G3HA 1H45A 1LAGE 2RC7A 2FA7A 2DQVA 3CFLA 1N7XA 1Z7ME 2HFBA 2Z8FA 4ZECA 1LAFE 3N6TA 3V5AA 4FE8A 4U1OA 1B7UA 2WOKA 1TXFA 4GWOA 1AIVA 3FVKA 4E0XA 4ESWA 4ZEIA 2G93A 4F18A 1MH4A 3MP6A 4BLAA 2H5YA 4FIMA 1B6HA 3RNNA 4POWA 5JK4A 1GV8A 2HEUA 4GL8A 4H5FA 1BLFA 2A5SA 3RYBA 2XXVA 5DVFA 5LOMA 3TMGA 1A55A 3LSFB 1S9TA 2XX7A 2DP8A 2QRYA 2ANJA 2ZNUA 3DRHA 1N7WA 1URSA 1MXZA 3K02A 4Q30B 2Q9TA 2P0SA 1BKAA 2DWHA 1PBQA 3C32A 1TFAA 1B7ZA 2Q88A 3OOAA 3MVXA 1MRPA 2P2AA 3PPQA 3QYTA 3T9UA 4OVJA 3H03A 2I4BA 3FGSA 4ND9A 5DT6A 3M3FA 4DIGA 1GR2A 1I6BA 3RQTA 2XXYA 1B58A 2PT2A 4YKPA 4F3GA 3H6UA 1MQDA 3RUMA 5CBRA 2ZYMA 5FTHA 1I6AA 1SI0A 4Q0CA 3Q25A 4BDNA 1YTVA 3B6TA 1NL5A 4ELOA 4R2BA 3FZVA 2RC8A 3M3KA 3ZKLA 3T93B 3CIJA 3G3IA 2B3BA 4BDMA 3VVDA 3T96B 4C1TA 4I62A 5CI5A 3HSTA 1EZOA 3A09A 3MW0A 1JW4A 4ISUA 3IB0A 3U1OA 5AA2D 1B52A 3K6WA 4F39A 1UQWA 1PEBA 3C4MA 2OWSA 3SETA 1LFHA 4XKPA 4P0IA 1NMUA 4FATA 2V3TA 1RYXA 5I57B 1P1QA 1DTZA 1Q35A 5CM6A 3HCQA 3RT8A 4HW8A 4F3PA 2PX1A 3IOVA 1B2HA 3LBSA 5H8HB 5L9MA 3SKPA 1CB6A 2Z22A 3TYHA 3JZJA 4FEDA 5JEIA 3DP6A 5I59A 1XVXA 2R71A 2UVGA 4EQ9A 2Z23A 1M5CA 4R6HA 2DE4A 1ATGA 2QMXA 2ZYNA 3A3UA 3LC8A 4JDFA 4KFQA 2AL4A 4BDOA 1JW1A 1N0TA 4YU0A 5TPAB 1B4HA 1N04A 1OLCA 3QIMA 4I8CA 2DS9A 2VD2A 3IR1A 3BFTA 2YLNA 4XIGQ 4EUOA 4G8MA 1VR5A 3B6QA 3BBRA 4GL0A 4LP2B 1PBPA 1USYH 5B70A 2Z8DA 2ZXTA 4RY1A 3UA8A 5AA2A 2VOZA 1M5BA 2WKYA 4GFRA 4OZ9A 3VVFA 1S7YA 2X26A 1SDXA 3CRBA 1LLSA 2X7PA 3CSGA 3K0VA 4GD5A 4GLIA 4QSCA 4R6YA 3THIA 4C1UA 2XXIA 5CRYA 1P1WA 3K00A 3R7XA 5AA3A 1ZTYA 3LSXA 1Y3NA 5H8NB 1Y4TA 1MPCA 2AL5A 3PPOA 4BDLA 2AYSA 4YAHX 5H8FA 2QS2A 3TELA 3H06B 1P99A 1PB9A 3MZBA 3K6XA 4KYDA 4NTLA 3OO8A 1NH8A 1WVJA 5H8QB 1FCKA 5I2KA 3RY3A 4YB6A 4LVQA 1UIVA 1IXIA 4QFKA 4DXUA 4E0WA 3CFXA 5I57A 2HAVA 5EHMA 1UTBA 3HHGA 4OEVA 2FNCA 2ZMBA 3DRIA 2VD3A 3RPWA 4KCDA 3SEYA 3SEXA 1JQFA 2I0BA 1CE2A 2LAOA 3EN3A 3G3GA 4GOTA 1POY1 3MBPA 3O6HA 4NF5B 4OMBA 5H8FB 2O51A 3IOTA 4EQ7A 4ZE9A 2QPQA 2I3WA 1YCJA 1D3KA 2UXAA 4KYSA 4FEBA 4EXLA 2UYFA 1AOVA 4RNSA 4F2OA 4IGTA 1FTKA 3MPLA 3N94A 2F78A 3H7MA 5TPAA 3OXNA 1DPPA 2ALUA 2HZKA 1JEUA 1MY2A 1N3XA 4LZ7A 3VVEA 2AIXA 3UP9A 2XXXA 1GGGA 3EHTA 4DCYA 3TTNA 3HN0A 4NF5A 2P1SA 1A99A 1DPEA 5DEXB 1GTKA 1ZJLA 3O6IA 5I58A 2F6GA 1LCTA 3SEWA 1MXYA 1Y9UA 3PPPA 5ISUA 5HPQA 4OTEA 4F3SA 2CZLA 3W9VA 3FV1A 4F19A 5H8SA 2R9JA 4GF8A 4OFJA 2D21A 3FVGA 3IJOB 1MY1A 3IOWA 4TQUQ 1EZPA 2F5XA 2XXHA 3OO7A 3O2AA 3QXMA 1OQGA 2UVHA 3UK4A 4QF9A 1H76A 5ITOA 1BIYA 3MVZA 2RCBA 2REGA 4NF6B 4IGRA 4QRZA 4KCCA 2I58A 1O64A 4G68B 4U23A 1FQCA 1LAXA 4MLVA 2ZYKA 4IO7A 1N3WA 3HPIA 3KN8A 5DTBA 3N26A 4KHZE 1LBBA 4OENA 2D5WA 3K1MA 4EF2A 2RC9A 5ITPA 3IL1B 3D4GA 4DXBA 1LAHE 5KCJB 3S9MC 3KN7A 3OEKA 1EH3A 2XD2A 4R2FA 4LA9A 3RN8A 4F29A 3Q26A 4ZEDA 2Q2AA 3MZ9A 2F8DA 2ONRA 3U92A 4PFTA 1OVTA 3UIFA 1DMBA 5H8HA 4PFYA 1LSTA 3TPAA 3OO6A 4NWDA 3R6UA 4ZEFA 1DOTA 1D4NA 3VE1B 3PUWE 5F1QA 1TWYA 3PUYE 4F1UA 3FVNA 4LUBA 1OLAA 1A7LA 3O6GA 3TCGA 1VFEA 2H4IA 1MY3A 2O68A 3RGYA 2VGQA 2HCAA 3G3KA 3L6HA 3MVWA 2GH9A 3R26A 5DYHA 3KBRA 1A54A 2Y7KA 3JV9A 3PMVA 3TUSA 5A5XB 1SI1A 1MQJA 4RA1A 1Z7NE 3TQLA 3T66A 4ELQA 2ONSA 1OVBA 4FAJA 2UYEA 3ILUB 4G2ZA 1FW0A 4F3BA 2OCUA 3KG2A 1M5FA 3H6VA 3SEUA 1BP5A 1FQDA 3FASA 3FV2A 3PPNA 1B5HA 3PGFA 3GBBA 2F35A 4GRKA 4LONB 1ZKBA 3TDJA 2H98A 1FQBA 4Z7EA 5AA4B 4EF1A 4POXA 5CMKA 4RXLA 4N07A 1R1NA 3N6UA 5CC2A 4ZE8A 4LZ5A 3RT6B 5I2KB 3TQWA 1Y3PA 3M3LA 3IO4A 1MPBA 2QJEA 4ZEKA 5ELVA 1A8EA 3K1PA 2Y7RA 5BWJA 5L9SA 3AXFA 4NF8B 4NWCA 4R75A 3OO9A 4RJZA 4JWOA 4XKQA 4WKMA 4F2QA 5AA4A 1ZIUA 4YICA 5CMCA 5ICTA 4ZS9A 1OQHA 2H25A 3C35A 3OMBA 2OK2A 1I69A 4R73A 5J1DA 5I2NA 2YJPA 1MY4A 5FHMA 4NF4A 2B3FA 1D9YA 4YMAA 2XHDA 1B9JA 1R9QA 1YAEA 2XXRA 3LR1A 1B4ZA 2NOOA 3PU5A 1XC1A 3DP4A 4IO6A 4M1VA 3IJXB 1J1NA 5AA1A 2PMSA 1MXWA 2O84X 4U4XA 1IUDA 2R6GE 1MDQA 1SBPA 2F7BA 4KPTA 4X48A 3D4CA 1B3LA 4XKNA 4OFLA 4NF4B
chains in the Genus database with same CATH superfamily
3SERA 1VFDA 3C33A 1URGA 4GQOA 4WXJA 4ELRA 1LBYA 1RDYA 3C34A 3MVYA 4Q8RA 4DZ1A 3OSQA 1FTLA 4JWXA 4JSOA 4PGPA 4YZZA 4R9FA 5ET7A 1NV4A 1QVSA 4ELPA 4ECFA 1OIBA 1FBCA 3JYRA 4OETA 3TEPA 4H8JA 3RPLB 4P9KA 2RINA 3DM0A 3TCFA 1A40A 5I2KA 4PBQA 4DXCA 1O63A 4P11A 1FTJA 5A5XA 3IK6B 1Y1MA 1FJ6A 4H6DA 4F22A 2I0CA 3EHUA 3O66A 1XOCA 4H5GA 4IR8A 2V93A 1B0HA 4OWDA 4ZEBA 3G3JA 2REJA 4GXAA 3USDA 1WODA 3U65A 4RPOA 2OX3A 1NNPA 4OYVA 4OVRA 3TTLA 1MQHA 4R74A 1IITA 2G29A 4PC9A 2QVUA 3IO6A 4FJPA 5IKBA 3GZGA 4AS5A 3K6UA 3VV5A 1MS7A 5AA2B 2THIA 1VSOA 1HSJA 2B4LA 4H8IA 3SESA 2O1LA 4TLLB 1MXVA 2ONKE 5I56A 4XXUA 4PAIA 4N6DA 3C31A 1MM6A 1QKBA 4O3CA 1P1NA 1XT8A 3O6PA 5IAIA 3UN6A 1PDAA 2RCAA 2Y7PA 4G68A 1QUJA 3LSLA 3TFLA 3T9VA 3RTWB 2B65A 3U72A 4P1EA 5K2XA 2W7YA 3T1BA 1G0HA 2DE2A 3SEVA 2BJJX 3OELA 5KCJA 4DI3D 1VE4A 4P56A 3HFUA 3QUJA 4MFIA 4I1DA 1IMEA 3VXBA 2XXWA 2D3IA 5ET6A 1IMCA 3UGWA 2X7QA 3CG3A 4AQ4A 3FXQA 4P47A 3RPLA 3KSJA 1B5IA 5EYFA 2QSXA 1IQ7A 4NGUA 2ZNTA 1ELJA 3MP1A 3KGCA 1FQAA 4FORA 1LFGA 4YB5A 3KFMA 4QFPA 1SW2A 4PETA 3I6VA 4HTGA 4O3BA 3SDFA 3MQ9A 1GVCA 3ZSFA 2UVIA 4LN5A 4GWYA 4M4GA 3IFCA 4OHNA 1IXGA 4N6KA 1MPDA 1QW0A 2H99A 2V84A 3BIGA 3MC2A 3OEMA 2P3VA 4IY6A 3I5OA 4K3FA 3LVUA 3W9WA 3K2DA 1B51A 1FBFA 3FUZA 4NF6A 2QS4A 4H0WA 3I3VA 2VHAA 2F7CA 3IAZA 3ISPA 1MG1A 3KEIA 1NI9A 4GXSB 2QMWA 3FJGA 1MXXA 1IXHA 3G3HA 4FBPA 2RC7A 1DCUA 1Z7ME 2HFBA 3MYUA 4U1OA 1TXFA 3FVKA 4BLAA 1XI6A 4POWA 2HEUA 4H5FA 2A5SA 3TMGA 3LSFB 1S9TA 2DP8A 2ZNUA 1URSA 1MXZA 2WEFA 3TZAA 1B7ZA 3FBPA 3QYTA 4ND9A 1GR2A 1I6BA 3RQTA 4F3GA 1MQDA 4BDNA 3B6TA 1NL5A 2B3BA 4MMPA 3T96B 4I62A 1EZOA 3MW0A 1JW4A 3U1OA 3IB0A 1B52A 2ZZVA 3SZPA 2OWSA 4XKPA 4P0IA 4FATA 2V3TA 1RYXA 5FBPA 3HCQA 3RT8A 3IOVA 3LBSA 3TYHA 2Z22A 4FEDA 4H45A 1JP4A 3LUZA 4KFQA 3IR1A 5EQ7A 3BFTA 4PFRA 3BBRA 4GL0A 1USYH 2ZXTA 5AA2A 1S7YA 1SDXA 3CRBA 2CZKA 2X7PA 4PGNA 3FXBA 5H8NB 2QS2A 3H06B 3MZBA 3OO8A 1NH8A 4DXUA 4LVQA 4E0WA 5EHMA 1UTBA 4OEVA 2ZMBA 4KCDA 3SEXA 1JQFA 1CE2A 3EN3A 3G3GA 4NF5B 3IOTA 4ZE9A 2QPQA 2P3NA 4OVQA 4PAKA 4FEBA 4IGTA 3MPLA 4PBHA 4OVPA 2FVZA 2HZKA 1N3XA 3VVEA 3ROJA 4DCYA 3HN0A 1FPDA 1DPEA 1ZJLA 3O6IA 1LCTA 2PFZA 2CZLA 3FV1A 3IJOB 1MY1A 4TQUQ 1EZPA 2F5XA 3QXMA 4QF9A 2I58A 1O64A 1RDXA 4QBAA 2KQZA 4KHZE 1LBBA 3K1MA 4DXBA 1LAHE 2F3BA 1EH3A 4NG7A 4R2FA 3RN8A 4F29A 3Q26A 2ONRA 3UIFA 4PFYA 3R6UA 4ZEFA 3PUWE 3PUYE 4LZ7A 3UP9A 1OLAA 1A7LA 2O68A 3MVWA 2Y7KA 3JV9A 3PMVA 1FPBA 3TUSA 1Z7NE 3T66A 1OVBA 3ILUB 4G2ZA 3SEUA 4GWWA 3FASA 2F35A 4N15A 1R1NA 3N6UA 5CC2A 3M3LA 2QJEA 4ZEKA 5BWJA 3K1PA 2Y7RA 5L9SA 4R75A 4WKMA 5AA4A 2XWKA 4ZS9A 4R73A 2FIXA 5I2NA 2B3FA 5ET8A 1B9JA 2XXRA 3PU5A 1XC1A 4IO6A 1MXWA 2O84X 2R6GE 4KPTA 1B3LA 2IEEA 1NV3A 4XKNA 4OFLA 4H65A 4KR5A 4KD5A 1NH7A 5HBCA 2OJTA 3M8UA 3S9LC 1N84A 3DRGA 4BDQA 4NHBA 1Y4CA 1N76A 1NUYA 1WDNA 2XX9A 4N6PA 5FHNA 1MDP1 1XHYA 4I40A 4DDDA 1B7HA 2NUVA 4ONYA 1NFTA 1B46A 2FHYA 1POTA 4FECA 4LQ5A 4R6KA 2GFEA 5T3JA 1JVXA 1NNFA 1T0KA 3FJ7A 4YKJA 5TU0A 3UORA 2F97A 3KZGA 2XWIA 1JETA 2Y5LA 1B3EA 2PYYA 4G4PA 4NEDA 1EZ9A 3H4ZA 3U8QA 1IMAA 2XXPA 1B05A 3RYDA 4EQBA 4PFWA 5BUUA 2PBWA 1SPIA 3IB1A 4HE2A 1USYE 4JBZA 4GIZA 4IO4A 2NWJA 2FBPA 1US4A 3G3FA 4MH5A 2Y84A 1SQYA 1FBHA 4TLMB 4YMBA 5EQ8A 1QKAA 2HHMA 1UTBB 4U2RA 3DELB 1LB9A 1AMFA 2WOPA 5CBSA 2XD3A 4HCWA 2HZLA 1FPFA 3QUFA 5KDTB 2OLBA 4PFBA 1M5DA 4AB5A 4LZ8A 5ET5A 5JTYB 1UIUA 3K01A 3KN3A 3CG1A 2RF1A 2DVZA 3KOSA 2I49A 4TOZA 5DTBA 1MQGA 1NV7A 5LDZA 2HXWA 1H43A 2XXUA 2XX8A 3OENA 4THIA 4ZZAA 3S9EA 4O3AA 4NN3A 5DEXA 2O7IA 1DBZA 4N13A 4PP0A 1BTJA 1FBDA 3MP8A 1KA1A 4Q5TA 5A5LA 1XVYA 3O9PA 1ANFA 5AE4A 1P1OA 1DTGA 1TT1A 2HQ0A 2A5TA 4QHQA 3KC0A 1UTHB 2XXQA 4P0GA 4WEDA 5K2YA 1B40A 3EHSA 4NMYA 3BIHA 3FJMA 3E9XA 1MQIA 2Q89A 4IB2A 4R9GA 4O7IA 4NE4A 2OBGA 1LFIA 3RTFB 3MUQA 4GX4A 4UABA 3O97A 1BK4A 2QS1A 4DCXA 3FIRA 3MPKA 3DLNA 3IOUA 2NXOA 1FSAA 2ABHA 1ZLQA 3H6WA 4KQPA 4AB6A 4PQJA 1JW5A 4N8YA 4N8GA 1DSNA 3TTRA 5KZTA 3TKDA 1H44A 1PB8A 3NOHA 3S2VA 4G68C 1M5EA 1L5TA 2F7AA 2FA7A 1N7XA 3V5AA 1B7UA 4GWSA 4E0XA 1EYIA 1NV2A 1LBWA 5JK4A 1GV8A 1BLFA 5DVFA 5IM2A 2Q9TA 2P0SA 3C32A 3PPQA 1MRPA 2P2AA 4OVJA 1NV1A 2I4BA 3FGSA 3H03A 4GWXA 4DIGA 2XXYA 1B58A 3H6UA 3RUMA 5CBRA 5FTHA 4Q0CA 1YTVA 4R2BA 2RC8A 4XEQA 4C1TA 4BDMA 4XFEA 4F39A 1UQWA 1NUZA 1P1QA 2PCRA 2PX1A 5H8HB 2R71A 4R6HA 2Z23A 1M5CA 1NV6A 1ATGA 2DE4A 2QMXA 2ZYNA 5I3SA 2AL4A 5IGAA 2KR0A 4XIGQ 4LP2B 2Z8DA 2VOZA 2WKYA 4MCOA 4GLIA 4QSCA 3K00A 3R7XA 3EKIA 1ZTYA 1Y3NA 3PPOA 2AL5A 5H8FA 2AYSA 4NX1A 3TELA 1PB9A 3K6XA 4KYDA 4NTLA 1WVJA 5H8QB 1UIVA 4QFKA 2HAVA 3DRIA 2LAOA 4ESXA 1K9ZA 2I3WA 1D3KA 2GQ1A 2UXAA 4KYSA 2UYFA 1EYJA 1AOVA 5EYGA 3MSTA 1JEUA 1DK4A 1MY2A 1GGGA 3EHTA 3TTNA 4NF5A 5DEXB 3SEWA 5HPQA 5H8SA 2R9JA 4GF8A 3IOWA 2UVHA 1H76A 2RCBA 4IGRA 4U23A 1LAXA 3KN8A 4EF2A 5ITPA 3S9MC 1FPJA 2XD2A 4GWUA 4LA9A 3U92A 1LSTA 3OO6A 4PDDA 5F1QA 1TWYA 5DYHA 5I5PA 5A5XB 1MQJA 4RA1A 4FAJA 3KG2A 3H6VA 3FV2A 3PPNA 1IMDA 1LBVA 4JVCA 4GRKA 4EF1A 4POXA 4LZ5A 1FBPA 4OVSA 5I2KB 3IFAA 2DDKA 5ELVA 1A8EA 3AXFA 4F2QA 1ZIUA 4YICA 5CMCA 2QFLA 1OQHA 5J1DA 2YJPA 1MY4A 4NF4A 1D9YA 3LR1A 1B4ZA 2NOOA 2XWOA 1SBPA 2F7BA 1NV0A 4P8BA 5I2NB 2CMOA 4EUOA 4YKIA 2VP1A 1A8FA 1AL3A 2A5TB 1AH5A 2O6AA 4MNCA 2Q74A 1B1HA 3V83A 3QK6A 3DP8A 2DOJA 1HSEA 3ILTB 1FQEA 4LATA 3Q29A 4OEUA 2Z8EA 1SW1A 3V8XB 4MJOA 3MAMA 1Y20A 3HV1A 2GHAA 4U4SA 4OFOA 4WEPA 4HS7A 5LTCA 4RYAA 1B3HA 2CZIA 3CR9A 2WYKA 1QUIA 3FXUA 3HHFA 2CEYA 3MWBA 3PV0E 1MM7A 4MF3A 3H6TA 4U22A 3T22A 4NF8A 4QFNA 4PE3A 3A29A 2Y7WA 1JVYA 2OWTA 1B5JA 5I58B 3FTOA 4F31B 5L8DA 3C36A 1MH3A 5TP9B 4G8HA 4MNPA 4X1DA 2V25A 3E4RA 4P3LA 2Q2CA 1CNQA 3BKIB 2L5VA 1LB8A 5H8QA 3ECRA 4GBWA 2O69A 5CMMA 4JWYA 3Q28A 4JXIA 3ONMA 2ZNSA 1PB7A 2F6PA 2CEXA 1YZ0A 2M8CA 2ZYOA 4MBPA 4XTCQ 4F1VA 2NVUB 1ZBMA 4O94A 4NQ8A 1B1XA 4PFIA 5KDTA 2QVVA 2DE3A 2DWIA 3CHGA 3PUZE 3B7DA 3FATA 1KZ8A 3WAFA 3H3GA 1AWBA 2QVRA 3VFJA 1FRPA 3PUXE 3PD8A 4UACA 4R72A 1JEVA 1S50A 3CVGA 3O28A 4RK9A 4X1BA 2DXRA 5FTIA 1R6ZA 4LQ2A 4EXKA 1Y1ZA 2V3QA 4PTKA 3VDFA 1LBCA 5EQAA 3K6VA 3F11A 4HE0A 3EPEA 2JJKA 4JB7A 4OESA 2QS3A 3ZS6A 4KXPA 3L6GA 1IZ1A 2Q8JA 1II5A 2QL3A 3PUVE 2DSFA 2GHBA 2DWAA 2VPOA 2O7UA 1IXCA 4PFUA 2E0SA 5I56B 4ELOA 2WOLA 5CMBA 3PD9A 3CSBA 1ZMGA 4IY5A 3FVOA 3N5LA 1F9BA 4GX6A 5TP9A 3CI8A 3KJ7A 3E13X 5DW8A 3VXCA 2VPNA 2IA4A 2DWJA 1FQFA 3KJTA 3C9HA 4N91A 3QSLA 1SYIA 4IO2A 5EHSA 3K4UA 4YKKA 4OQOA 1JNFA 1YXIA 3FD3A 3KOTA 2DXYA 4PE5B 1FPGA 1SYHA 3KC1A 1B3GA 4KI0E 1G0IA 3VLVA 1H45A 1LAGE 3CFLA 3QMFA 3N6TA 4FE8A 2WOKA 4GWOA 1QGXA 4ESWA 4F18A 3MP6A 2H5YA 4FIMA 3RNNA 3KBZA 4GL8A 5LOMA 2XX7A 2ANJA 3E79A 4Q30B 2DWHA 3OOAA 2Q88A 2F3DA 5DT6A 3M3FA 4YKPA 3Q25A 3FZVA 3M3KA 3T93B 3VVDA 3HSTA 1FPIA 3K6WA 1PEBA 3C4MA 3SETA 1NMUA 4N17A 1DTZA 4HW8A 1B2HA 5L9MA 3DP6A 5I59A 2UVGA 3LC8A 3A3UA 4JDFA 1JW1A 1N04A 1B4HA 1OLCA 3QIMA 4I8CA 3TDJA 4G8MA 1VR5A 3B6QA 5B70A 1M5BA 4GD5A 3K0VA 1LLSA 5AA3A 4YAHX 4X8RA 4YB6A 1IXIA 3CFXA 4G61A 3HHGA 2FNCA 3RPWA 5H8FB 4GOTA 1LEVA 2O51A 4EXLA 4RNSA 2F78A 3H7MA 1DPPA 5IZ3A 2AIXA 2XXXA 1FBGA 2P1SA 4PCDA 5I58A 1MXYA 3PPPA 4X04A 4OTEA 3W9VA 4F19A 3OO7A 3O2AA 5EQ9A 1OQGA 5ITOA 3MVZA 2REGA 4KCCA 1N3WA 3HPIA 3N26A 4OENA 2D5WA 2RC9A 3IL1B 3D4GA 3T0JA 3KN7A 3OEKA 4ZEDA 2Q2AA 3MZ9A 2F8DA 1OVTA 3TPAA 1DOTA 1VDWA 4N81A 1D4NA 3VE1B 4F1UA 3FVNA 3TCGA 1VFEA 3RGYA 2HCAA 3L6HA 3R26A 2GH9A 3KBRA 1A54A 3TQLA 4N4UA 1FW0A 5I7IA 5ESYA 1M5FA 4HE1A 1ZKBA 2H98A 1FQBA 4RXLA 3TQWA 1Y3PA 3IO4A 5ICTA 3C35A 3OMBA 4MEVA 2OK2A 1I69A 4QXDA 5FHMA 2XHDA 1R9QA 1YAEA 2HPGA 4I3YA 4O8MA 3IJXB 1J1NA 4HXVA 2PMSA 4U4XA 1IUDA 1MDQA 4X48A 4I3EA 3D4CA 4NF4B 3Q27A 5HM4B 4NF0A 3FXRA 1URDA 3LUYA 4DLDA 1NKXA 1FTOA 2OZZA 3RLFE 3HO7A 2XXKA 4QSEA 3B8BA 1B0LA 2RKMA 3TTKA 4OANA 5IZ3B 1SVXB 4YB7A 1SW5A 4OERA 1IEJA 2OWZA 3LV0A 3OD7A 2PVUA 5JTYA 1FPLA 4ZZEA 3TAJA 4QSDA 1MY0A 3EF7A 1OMPA 2DYXA 2CZHA 4EDPA 3U94A 3DRFA 4XKRA 5I59B 2WBDA 3VLWA 4H67A 4PDHA 2F36A 4G8NA 1XS5A 4Z0IA 2UVJA 3S4UA 3E78A 3PAMA 1QULA 2HXRA 4JSDA 4I9DA 3U93A 3GXAA 1NUWA 1MXUA 2PT1A 4OVTA 2H9BA 3T9XB 4L17A 1RKMA 4NAPA 2ZZXA 1FBEA 5J16A 2F34A 3QAXA 5B7DA 1SD3A 4U1ZA 5I84A 4RPNA 2Y7IA 4ZDMA 1TFDA 3ZKKA 3LSWA 1SW4A 1UTHA 3GLBA 2B4MA 1EU8A 3V89B 1NNKA 2I4CA 2XXTA 4X9TA 3VLUA 3A3CA 1P1UA 3DRJA 3B6WA 1PC3A 2XA5A 2O1MA 5FHOA 1D9VA 3G7WA 2HAUA 1B3FA 3KSXA 4MX6A 1Y3QA 2VT5A 3P7IA 4RK2A 5DVIA 4OA4A 3IX1A 1IIWA 5L9OA 3CFZA 5M2VA 1Q1KA 3D1RA 4H1XA 2V3UA 2E1SA 3GBAA 3TCHA 5H8NA 1US5A 3PMXA 3TTMA 4MLQA 2ESNA 4GVOA 4G77A 1NNTA 3RYAA 5DVJA 1FPKA 1FTAA 1O7TA 4C0RA 4UA8A 2I48A 2GRVA 2I6EA 3EQ1A 1YPNA 4QFOA 1LCFA 3GYYA 1D9QA 3ODBA 2KLFA 3BFUA 1NUXA 3MJNA 4F1YA 3OSRA 3WAEA 4BDRA 4AS4A 1ZU0A 1KWHA 4IO3A 4DE8A 3E3KA 1R9LA 4KYEA 3DRKA 2I3VA 4OXVA 4HCYA 2WX9A 2PFYA 5ICQA 1I6QA 3S9NC 3TODA 3T9HB 4QFLA 4P1LA 4U21A 1QJMA 1B32A 5F7VA 2YPNA 1FTMA 1QUKA 1HSLA 3O29A 2Q8MA 3PTYA 1H3DA 3W15C 1LBXA 4MIJA 3MZ1A 3IB2A 3PMWA 1LGBC 3IORA 1LBZA 1RYOA 4IO5A 3K1NA 2FYIA 2DVCA 3PPRA 2DQVA 2Z8FA 4ZECA 1LAFE 4GBVA 1AIVA 4ZEIA 2G93A 1MH4A 4H46A 4JVIA 1B6HA 3RYBA 2XXVA 1A55A 2QRYA 3DRHA 1N7WA 3K02A 4DI4B 1BKAA 1Q9DA 1PBQA 1TFAA 3MVXA 3T9UA 2PT2A 2ZYMA 1I6AA 1SI0A 3ZKLA 3CIJA 3G3IA 5CI5A 3A09A 5AA2D 4ISUA 4JVDA 1LFHA 5I57B 1Q35A 5CM6A 4F3PA 1NV5A 3SKPA 1CB6A 5JEIA 3JZJA 1XVXA 4EQ9A 4BDOA 1N0TA 4YU0A 5TPAB 2DS9A 2VD2A 2YLNA 5EYHA 1PBPA 4RY1A 3UA8A 4GFRA 4OZ9A 3VVFA 2X26A 3CSGA 4R6YA 5IZZA 3THIA 4C1UA 2XXIA 5CRYA 1P1WA 3LSXA 1Y4TA 1MPCA 4BDLA 1P99A 4MAGA 1FCKA 3RY3A 2MKZA 5I57A 1FPEA 3SEYA 2WYPA 2VD3A 2I0BA 1POY1 3MBPA 3O6HA 4OMBA 4EQ7A 1YCJA 4GX3A 4F2OA 1FTKA 3N94A 5TPAA 3OXNA 2ALUA 4PAFA 1A99A 1GTKA 2F6GA 1Y9UA 5ISUA 4F3SA 3B50A 4OFJA 2D21A 3FVGA 1K9YA 2XXHA 3UK4A 5IZ1A 1BIYA 4NF6B 4QRZA 1EYKA 4G68B 1FQCA 4MLVA 2ZYKA 4IO7A 1INPA 2FIEA 4GWZA 1YYZA 5KCJB 4MNIA 1FJ9A 4PFTA 1DMBA 5H8HA 4NWDA 4LUBA 1KA0A 3O6GA 2H4IA 1MY3A 2VGQA 3G3KA 1SI1A 4ELQA 2ONSA 2XWVA 2UYEA 4F3BA 2OCUA 2ZZWA 1BP5A 1FQDA 1B5HA 3PGFA 1IMFA 3GBBA 4LONB 5AA4B 4Z7EA 2R8TA 5CMKA 4N07A 4ZE8A 2Y5KA 3RT6B 1RDZA 1MPBA 4NF8B 4MHFA 4NWCA 3OO9A 4RJZA 4JWOA 4XKQA 4PF6A 4PF8A 2H25A 4O7MA 4XF5A 4YMAA 2V4CA 2WBBA 2BJIA 5F24A 3DP4A 5AA1A 4M1VA 1IMBA
chains in the Genus database with same CATH topology
3Q27A 4H65A 5HM4B 3SERA 4YKIA 1VFDA 3FXRA 4KR5A 2VP1A 1A8FA 1URDA 3LUYA 3C33A 4DLDA 1AL3A 2A5TB 4KD5A 1AH5A 1NKXA 1URGA 2O6AA 1NH7A 4GQOA 4WXJA 1FTOA 2OZZA 5HBCA 3RLFE 3HO7A 1B1HA 4QSEA 4ELRA 3V83A 1B0LA 3DP8A 2DOJA 2RKMA 3C34A 1HSEA 2OJTA 3ILTB 3QK6A 1FQEA 3M8UA 3MVYA 4LATA 3TTKA 4DZ1A 4Q8RA 3S9LC 3Q29A 1N84A 3DRGA 4OEUA 4BDQA 1Y4CA 3OSQA 1FTLA 1N76A 1SVXB 4JWXA 2Z8EA 1SW1A 2CMOA 4YB7A 3V8XB 1WDNA 3SEVA 1SW5A 4OERA 3MAMA 4JSOA 2XX9A 1IEJA 1Y20A 4N6PA 3HV1A 5FHNA 2GHAA 4YZZA 1MDP1 1XHYA 4R9FA 4U4SA 4OFOA 4WEPA 4HS7A 4DDDA 1B7HA 2NUVA 4RYAA 4ONYA 1NFTA 1B46A 1QVSA 4ELPA 1B3HA 4ECFA 1OIBA 1POTA 3JYRA 3CR9A 4OETA 3OD7A 3TEPA 1QUIA 4FECA 3FXUA 3HHFA 2PVUA 4H8JA 5JTYA 4LQ5A 4R6KA 2GFEA 4ZZEA 3TAJA 3MWBA 3PV0E 4QSDA 1JVXA 1NNFA 1T0KA 1MM7A 1MY0A 2RINA 3DM0A 3TCFA 1A40A 3FJ7A 3EF7A 1OMPA 4MF3A 4YKJA 2F97A 3KZGA 3H6TA 4U22A 5TU0A 3UORA 1O63A 4DXCA 4P11A 1FTJA 1JETA 5A5XA 2DYXA 3IK6B 3T22A 4NF8A 4QFNA 1B3EA 1Y1MA 2PYYA 4G4PA 4NEDA 3DRFA 3U94A 4EDPA 1EZ9A 2Y7WA 4H6DA 3H4ZA 4F22A 2I0CA 4XKRA 1JVYA 3EHUA 3U8QA 2OWTA 1B5JA 5I59B 3O66A 1XOCA 2XXPA 5I58B 4H5GA 2V93A 1B05A 4H67A 3VLWA 4PFWA 4EQBA 2F36A 4G8NA 5BUUA 3FTOA 2PBWA 3IB1A 4F31B 1XS5A 4Z0IA 2UVJA 5L8DA 3C36A 1USYE 3S4UA 1B0HA 3PAMA 1QULA 4OWDA 1MH3A 4ZEBA 4JBZA 4JSDA 3G3JA 4G8HA 5TP9B 4I9DA 2V25A 4X1DA 4GIZA 4IO4A 2IEEA 2REJA 2NWJA 4GXAA 3U93A 3USDA 1US4A 1WODA 3GXAA 1MXUA 2PT1A 3E4RA 3G3FA 4MH5A 2Y84A 4RPOA 2H9BA 2Q2CA 1SQYA 1NNPA 3T9XB 4L17A 1RKMA 4OYVA 3TTLA 1MQHA 4R74A 2F34A 3BKIB 3QAXA 4TLMB 1LB8A 1IITA 5B7DA 5H8QA 2G29A 3ECRA 1SD3A 4YMBA 2O69A 5CMMA 4JWYA 3IO6A 3Q28A 4U1ZA 4JXIA 1QKAA 5I84A 4RPNA 4FJPA 5IKBA 1UTBB 4U2RA 2Y7IA 3DELB 3GZGA 3ONMA 4ZDMA 1LB9A 1AMFA 2ZNSA 3K6UA 1PB7A 2WOPA 5CBSA 1TFDA 2F6PA 3ZKKA 2XD3A 3VV5A 3LSWA 1SW4A 1MS7A 1UTHA 3GLBA 2B4MA 4HCWA 2HZLA 1EU8A 3V89B 1NNKA 2I4CA 2XXTA 5AA2B 3QUFA 2THIA 5KDTB 2OLBA 1VSOA 2M8CA 2ZYOA 4X9TA 4MBPA 1HSJA 4XTCQ 2B4LA 4H8IA 1M5DA 4F1VA 2NVUB 3SESA 3VLUA 1ZBMA 3A3CA 2O1LA 4TLLB 1MXVA 3TZAA 2ONKE 1P1UA 4AB5A 3DRJA 3B6WA 4LZ8A 5JTYB 1PC3A 2O1MA 1UIUA 5I56A 4XXUA 1D9VA 5FHOA 3G7WA 3K01A 3KN3A 2HAUA 1B1XA 1B3FA 3C31A 2RF1A 3CG1A 5KDTA 2DVZA 3KSXA 1MM6A 2DE3A 2DWIA 1Y3QA 3KOSA 1QKBA 3CHGA 4TOZA 1P1NA 1MQGA 2I49A 3P7IA 3PUZE 4O3CA 4RK2A 1XT8A 3B7DA 5DVIA 3IX1A 3O6PA 2HXWA 1IIWA 3FATA 5I2NB 3WAFA 5IAIA 1H43A 3UN6A 1PDAA 2RCAA 2XXUA 5L9OA 3H3GA 3CFZA 5M2VA 2Y7PA 1Q1KA 1QUJA 4G68A 3LSLA 4H1XA 2V3UA 3VFJA 3TFLA 3T9VA 2E1SA 3RTWB 2XX8A 3PUXE 2B65A 3GBAA 3TCHA 3OENA 4THIA 5H8NA 3U72A 4ZZAA 1US5A 5K2XA 2W7YA 3PD8A 3PMXA 4UACA 3TTMA 4R72A 3S9EA 4O3AA 1JEVA 1S50A 4MLQA 2ESNA 4GVOA 2DE2A 3CVGA 3O28A 1NNTA 4G77A 2BJJX 2DXRA 1R6ZA 3OELA 4RK9A 2O7IA 4X1BA 5DEXA 5FTIA 1VE4A 5KCJA 3RYAA 5DVJA 4LQ2A 4EXKA 1Y1ZA 2V3QA 4N13A 1O7TA 1BTJA 3QUJA 4PP0A 3MP8A 4MFIA 1LBCA 4I1DA 4UA8A 3VDFA 4C0RA 2I48A 4Q5TA 2GRVA 2I6EA 3K6VA 1XVYA 3F11A 3VXBA 2XXWA 2D3IA 3O9PA 3EQ1A 3EPEA 1ANFA 5AE4A 1YPNA 1P1OA 4JB7A 1DTGA 4OESA 4QFOA 1TT1A 2QS3A 3ZS6A 1LCFA 2HQ0A 3ODBA 3UGWA 3L6GA 2KLFA 1IZ1A 2X7QA 2A5TA 4QHQA 3CG3A 2Q8JA 3FXQA 4AQ4A 1II5A 3KSJA 2QL3A 1B5IA 1UTHB 2XXQA 3PUVE 4WEDA 4P0GA 5EYFA 5K2YA 3BFUA 2QSXA 1B40A 1IQ7A 2ZNTA 1ELJA 3EHSA 2DSFA 2GHBA 3MJNA 4NMYA 4F1YA 3MP1A 3OSRA 3WAEA 3KGCA 2DWAA 1FQAA 4BDRA 2O7UA 3FJMA 1IXCA 4FORA 3E9XA 1LFGA 1ZU0A 4PFUA 1MQIA 1KWHA 4YB5A 2E0SA 3KFMA 4IO3A 5I56B 4QFPA 1SW2A 4PETA 2Q89A 4IB2A 3E3KA 1R9LA 3I6VA 4HTGA 4KYEA 4R9GA 4DE8A 4NE4A 3DRKA 2OBGA 2WOLA 1LFIA 4O3BA 3RTFB 3SDFA 3MQ9A 1GVCA 3MUQA 2I3VA 5CMBA 3PD9A 4OXVA 2UVIA 3ZSFA 3CSBA 3O97A 1ZMGA 4HCYA 4IY5A 4M4GA 3FVOA 3N5LA 1F9BA 5ICQA 2QS1A 5TP9A 4DCXA 4OHNA 3FIRA 1I6QA 1IXGA 3S9NC 3TODA 3T9HB 4QFLA 3CI8A 3MPKA 3DLNA 3KJ7A 3IOUA 2NXOA 4U21A 1QJMA 1B32A 3E13X 1MPDA 1QW0A 2ABHA 1ZLQA 2H99A 2V84A 3H6WA 3MC2A 3OEMA 4KQPA 5F7VA 4IY6A 3I5OA 3VXCA 2YPNA 1FTMA 1QUKA 1HSLA 4AB6A 2IA4A 4K3FA 3O29A 4PQJA 3LVUA 1JW5A 3W9WA 1DSNA 3TTRA 3K2DA 1B51A 5KZTA 1FQFA 2DWJA 3FUZA 3TKDA 1H3DA 1H44A 3C9HA 3KJTA 3QSLA 2QS4A 1PB8A 4NF6A 1SYIA 4H0WA 3W15C 4IO2A 5EHSA 3I3VA 3K4UA 2VHAA 4OQOA 1JNFA 2F7CA 3FD3A 3IAZA 4YKKA 3S2VA 3KOTA 3MZ1A 1MG1A 2DXYA 3KEIA 4G68C 4PE5B 4ESXA 1M5EA 3IB2A 1L5TA 3PMWA 2F7AA 1LGBC 3IORA 1SYHA 4GXSB 1RYOA 4IO5A 2QMWA 3K1NA 3FJGA 1B3GA 2FYIA 2DVCA 3PPRA 4KI0E 1MXXA 3VLVA 1IXHA 3G3HA 1H45A 1LAGE 2RC7A 2FA7A 2DQVA 3CFLA 1N7XA 1Z7ME 2HFBA 2Z8FA 4ZECA 1LAFE 3N6TA 3V5AA 4FE8A 4U1OA 1B7UA 2WOKA 1TXFA 4GWOA 1AIVA 3FVKA 4E0XA 4ESWA 4ZEIA 2G93A 4F18A 1MH4A 3MP6A 4BLAA 2H5YA 4FIMA 1B6HA 3RNNA 4POWA 5JK4A 1GV8A 2HEUA 4GL8A 4H5FA 1BLFA 2A5SA 3RYBA 2XXVA 5DVFA 5LOMA 3TMGA 1A55A 3LSFB 1S9TA 2XX7A 2DP8A 2QRYA 2ANJA 2ZNUA 3DRHA 1N7WA 1URSA 1MXZA 3K02A 4Q30B 2Q9TA 2P0SA 1BKAA 2DWHA 1PBQA 3C32A 1TFAA 1B7ZA 2Q88A 3OOAA 3MVXA 1MRPA 2P2AA 3PPQA 3QYTA 3T9UA 4OVJA 3H03A 2I4BA 3FGSA 4ND9A 5DT6A 3M3FA 4DIGA 1GR2A 1I6BA 3RQTA 2XXYA 1B58A 2PT2A 4YKPA 4F3GA 3H6UA 1MQDA 3RUMA 5CBRA 2ZYMA 5FTHA 1I6AA 1SI0A 4Q0CA 3Q25A 4BDNA 1YTVA 3B6TA 1NL5A 4ELOA 4R2BA 3FZVA 2RC8A 3M3KA 3ZKLA 3T93B 3CIJA 3G3IA 2B3BA 4BDMA 3VVDA 3T96B 4C1TA 4I62A 5CI5A 3HSTA 1EZOA 3A09A 3MW0A 1JW4A 4ISUA 3IB0A 3U1OA 5AA2D 1B52A 3K6WA 4F39A 1UQWA 1PEBA 3C4MA 2OWSA 3SETA 1LFHA 4XKPA 4P0IA 1NMUA 4FATA 2V3TA 1RYXA 5I57B 1P1QA 1DTZA 1Q35A 5CM6A 3HCQA 3RT8A 4HW8A 4F3PA 2PX1A 3IOVA 1B2HA 3LBSA 5H8HB 5L9MA 3SKPA 1CB6A 2Z22A 3TYHA 3JZJA 4FEDA 5JEIA 3DP6A 5I59A 1XVXA 2R71A 2UVGA 4EQ9A 2Z23A 1M5CA 4R6HA 2DE4A 1ATGA 2QMXA 2ZYNA 3A3UA 3LC8A 4JDFA 4KFQA 2AL4A 4BDOA 1JW1A 1N0TA 4YU0A 5TPAB 1B4HA 1N04A 1OLCA 3QIMA 4I8CA 2DS9A 2VD2A 3IR1A 3BFTA 2YLNA 4XIGQ 4EUOA 4G8MA 1VR5A 3B6QA 3BBRA 4GL0A 4LP2B 1PBPA 1USYH 5B70A 2Z8DA 2ZXTA 4RY1A 3UA8A 5AA2A 2VOZA 1M5BA 2WKYA 4GFRA 4OZ9A 3VVFA 1S7YA 2X26A 1SDXA 3CRBA 1LLSA 2X7PA 3CSGA 3K0VA 4GD5A 4GLIA 4QSCA 4R6YA 3THIA 4C1UA 2XXIA 5CRYA 1P1WA 3K00A 3R7XA 5AA3A 1ZTYA 3LSXA 1Y3NA 5H8NB 1Y4TA 1MPCA 2AL5A 3PPOA 4BDLA 2AYSA 4YAHX 5H8FA 2QS2A 3TELA 3H06B 1P99A 1PB9A 3MZBA 3K6XA 4KYDA 4NTLA 3OO8A 1NH8A 1WVJA 5H8QB 1FCKA 5I2KA 3RY3A 4YB6A 4LVQA 1UIVA 1IXIA 4QFKA 4DXUA 4E0WA 3CFXA 5I57A 2HAVA 5EHMA 1UTBA 3HHGA 4OEVA 2FNCA 2ZMBA 3DRIA 2VD3A 3RPWA 4KCDA 3SEYA 3SEXA 1JQFA 2I0BA 1CE2A 2LAOA 3EN3A 3G3GA 4GOTA 1POY1 3MBPA 3O6HA 4NF5B 4OMBA 5H8FB 2O51A 3IOTA 4EQ7A 4ZE9A 2QPQA 2I3WA 1YCJA 1D3KA 2UXAA 4KYSA 4FEBA 4EXLA 2UYFA 1AOVA 4RNSA 4F2OA 4IGTA 1FTKA 3MPLA 3N94A 2F78A 3H7MA 5TPAA 3OXNA 1DPPA 2ALUA 2HZKA 1JEUA 1MY2A 1N3XA 4LZ7A 3VVEA 2AIXA 3UP9A 2XXXA 1GGGA 3EHTA 4DCYA 3TTNA 3HN0A 4NF5A 2P1SA 1A99A 1DPEA 5DEXB 1GTKA 1ZJLA 3O6IA 5I58A 2F6GA 1LCTA 3SEWA 1MXYA 1Y9UA 3PPPA 5ISUA 5HPQA 4OTEA 4F3SA 2CZLA 3W9VA 3FV1A 4F19A 5H8SA 2R9JA 4GF8A 4OFJA 2D21A 3FVGA 3IJOB 1MY1A 3IOWA 4TQUQ 1EZPA 2F5XA 2XXHA 3OO7A 3O2AA 3QXMA 1OQGA 2UVHA 3UK4A 4QF9A 1H76A 5ITOA 1BIYA 3MVZA 2RCBA 2REGA 4NF6B 4IGRA 4QRZA 4KCCA 2I58A 1O64A 4G68B 4U23A 1FQCA 1LAXA 4MLVA 2ZYKA 4IO7A 1N3WA 3HPIA 3KN8A 5DTBA 3N26A 4KHZE 1LBBA 4OENA 2D5WA 3K1MA 4EF2A 2RC9A 5ITPA 3IL1B 3D4GA 4DXBA 1LAHE 5KCJB 3S9MC 3KN7A 3OEKA 1EH3A 2XD2A 4R2FA 4LA9A 3RN8A 4F29A 3Q26A 4ZEDA 2Q2AA 3MZ9A 2F8DA 2ONRA 3U92A 4PFTA 1OVTA 3UIFA 1DMBA 5H8HA 4PFYA 1LSTA 3TPAA 3OO6A 4NWDA 3R6UA 4ZEFA 1DOTA 1D4NA 3VE1B 3PUWE 5F1QA 1TWYA 3PUYE 4F1UA 3FVNA 4LUBA 1OLAA 1A7LA 3O6GA 3TCGA 1VFEA 2H4IA 1MY3A 2O68A 3RGYA 2VGQA 2HCAA 3G3KA 3L6HA 3MVWA 2GH9A 3R26A 5DYHA 3KBRA 1A54A 2Y7KA 3JV9A 3PMVA 3TUSA 5A5XB 1SI1A 1MQJA 4RA1A 1Z7NE 3TQLA 3T66A 4ELQA 2ONSA 1OVBA 4FAJA 2UYEA 3ILUB 4G2ZA 1FW0A 4F3BA 2OCUA 3KG2A 1M5FA 3H6VA 3SEUA 1BP5A 1FQDA 3FASA 3FV2A 3PPNA 1B5HA 3PGFA 3GBBA 2F35A 4GRKA 4LONB 1ZKBA 3TDJA 2H98A 1FQBA 4Z7EA 5AA4B 4EF1A 4POXA 5CMKA 4RXLA 4N07A 1R1NA 3N6UA 5CC2A 4ZE8A 4LZ5A 3RT6B 5I2KB 3TQWA 1Y3PA 3M3LA 3IO4A 1MPBA 2QJEA 4ZEKA 5ELVA 1A8EA 3K1PA 2Y7RA 5BWJA 5L9SA 3AXFA 4NF8B 4NWCA 4R75A 3OO9A 4RJZA 4JWOA 4XKQA 4WKMA 4F2QA 5AA4A 1ZIUA 4YICA 5CMCA 5ICTA 4ZS9A 1OQHA 2H25A 3C35A 3OMBA 2OK2A 1I69A 4R73A 5J1DA 5I2NA 2YJPA 1MY4A 5FHMA 4NF4A 2B3FA 1D9YA 4YMAA 2XHDA 1B9JA 1R9QA 1YAEA 2XXRA 3LR1A 1B4ZA 2NOOA 3PU5A 1XC1A 3DP4A 4IO6A 4M1VA 3IJXB 1J1NA 5AA1A 2PMSA 1MXWA 2O84X 4U4XA 1IUDA 2R6GE 1MDQA 1SBPA 2F7BA 4KPTA 4X48A 3D4CA 1B3LA 4XKNA 4OFLA 4NF4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q27 A;  4H65 A;  5HM4 B;  3SER A;  4YKI A;  1VFD A;  3FXR A;  4KR5 A;  2VP1 A;  1A8F A;  1URD A;  3LUY A;  3C33 A;  4DLD A;  1AL3 A;  2A5T B;  4KD5 A;  1AH5 A;  1NKX A;  1URG A;  2O6A A;  1NH7 A;  4GQO A;  4WXJ A;  1FTO A;  2OZZ A;  5HBC A;  3RLF E;  3HO7 A;  1B1H A;  4QSE A;  4ELR A;  3V83 A;  1B0L A;  3DP8 A;  2DOJ A;  2RKM A;  3C34 A;  1HSE A;  2OJT A;  3ILT B;  3QK6 A;  1FQE A;  3M8U A;  3MVY A;  4LAT A;  3TTK A;  4DZ1 A;  4Q8R A;  3S9L C;  3Q29 A;  1N84 A;  3DRG A;  4OEU A;  4BDQ A;  1Y4C A;  3OSQ A;  1FTL A;  1N76 A;  1SVX B;  4JWX A;  2Z8E A;  1SW1 A;  2CMO A;  4YB7 A;  3V8X B;  1WDN A;  3SEV A;  1SW5 A;  4OER A;  3MAM A;  4JSO A;  2XX9 A;  1IEJ A;  1Y20 A;  4N6P A;  3HV1 A;  5FHN A;  2GHA A;  4YZZ A;  1MDP 1;  1XHY A;  4R9F A;  4U4S A;  4OFO A;  4WEP A;  4HS7 A;  4DDD A;  1B7H A;  2NUV A;  4RYA A;  4ONY A;  1NFT A;  1B46 A;  1QVS A;  4ELP A;  1B3H A;  4ECF A;  1OIB A;  1POT A;  3JYR A;  3CR9 A;  4OET A;  3OD7 A;  3TEP A;  1QUI A;  4FEC A;  3FXU A;  3HHF A;  2PVU A;  4H8J A;  5JTY A;  4LQ5 A;  4R6K A;  2GFE A;  4ZZE A;  3TAJ A;  3MWB A;  3PV0 E;  4QSD A;  1JVX A;  1NNF A;  1T0K A;  1MM7 A;  1MY0 A;  2RIN A;  3DM0 A;  3TCF A;  1A40 A;  3FJ7 A;  3EF7 A;  1OMP A;  4MF3 A;  4YKJ A;  2F97 A;  3KZG A;  3H6T A;  4U22 A;  5TU0 A;  3UOR A;  1O63 A;  4DXC A;  4P11 A;  1FTJ A;  1JET A;  5A5X A;  2DYX A;  3IK6 B;  3T22 A;  4NF8 A;  4QFN A;  1B3E A;  1Y1M A;  2PYY A;  4G4P A;  4NED A;  3DRF A;  3U94 A;  4EDP A;  1EZ9 A;  2Y7W A;  4H6D A;  3H4Z A;  4F22 A;  2I0C A;  4XKR A;  1JVY A;  3EHU A;  3U8Q A;  2OWT A;  1B5J A;  5I59 B;  3O66 A;  1XOC A;  2XXP A;  5I58 B;  4H5G A;  2V93 A;  1B05 A;  4H67 A;  3VLW A;  4PFW A;  4EQB A;  2F36 A;  4G8N A;  5BUU A;  3FTO A;  2PBW A;  3IB1 A;  4F31 B;  1XS5 A;  4Z0I A;  2UVJ A;  5L8D A;  3C36 A;  1USY E;  3S4U A;  1B0H A;  3PAM A;  1QUL A;  4OWD A;  1MH3 A;  4ZEB A;  4JBZ A;  4JSD A;  3G3J A;  4G8H A;  5TP9 B;  4I9D A;  2V25 A;  4X1D A;  4GIZ A;  4IO4 A;  2IEE A;  2REJ A;  2NWJ A;  4GXA A;  3U93 A;  3USD A;  1US4 A;  1WOD A;  3GXA A;  1MXU A;  2PT1 A;  3E4R A;  3G3F A;  4MH5 A;  2Y84 A;  4RPO A;  2H9B A;  2Q2C A;  1SQY A;  1NNP A;  3T9X B;  4L17 A;  1RKM A;  4OYV A;  3TTL A;  1MQH A;  4R74 A;  2F34 A;  3BKI B;  3QAX A;  4TLM B;  1LB8 A;  1IIT A;  5B7D A;  5H8Q A;  2G29 A;  3ECR A;  1SD3 A;  4YMB A;  2O69 A;  5CMM A;  4JWY A;  3IO6 A;  3Q28 A;  4U1Z A;  4JXI A;  1QKA A;  5I84 A;  4RPN A;  4FJP A;  5IKB A;  1UTB B;  4U2R A;  2Y7I A;  3DEL B;  3GZG A;  3ONM A;  4ZDM A;  1LB9 A;  1AMF A;  2ZNS A;  3K6U A;  1PB7 A;  2WOP A;  5CBS A;  1TFD A;  2F6P A;  3ZKK A;  2XD3 A;  3VV5 A;  3LSW A;  1SW4 A;  1MS7 A;  1UTH A;  3GLB A;  2B4M A;  4HCW A;  2HZL A;  1EU8 A;  3V89 B;  1NNK A;  2I4C A;  2XXT A;  5AA2 B;  3QUF A;  2THI A;  5KDT B;  2OLB A;  1VSO A;  2M8C A;  2ZYO A;  4X9T A;  4MBP A;  1HSJ A;  4XTC Q;  2B4L A;  4H8I A;  1M5D A;  4F1V A;  2NVU B;  3SES A;  3VLU A;  1ZBM A;  3A3C A;  2O1L A;  4TLL B;  1MXV A;  3TZA A;  2ONK E;  1P1U A;  4AB5 A;  3DRJ A;  3B6W A;  4LZ8 A;  5JTY B;  1PC3 A;  2O1M A;  1UIU A;  5I56 A;  4XXU A;  1D9V A;  5FHO A;  3G7W A;  3K01 A;  3KN3 A;  2HAU A;  1B1X A;  1B3F A;  3C31 A;  2RF1 A;  3CG1 A;  5KDT A;  2DVZ A;  3KSX A;  1MM6 A;  2DE3 A;  2DWI A;  1Y3Q A;  3KOS A;  1QKB A;  3CHG A;  4TOZ A;  1P1N A;  1MQG A;  2I49 A;  3P7I A;  3PUZ E;  4O3C A;  4RK2 A;  1XT8 A;  3B7D A;  5DVI A;  3IX1 A;  3O6P A;  2HXW A;  1IIW A;  3FAT A;  5I2N B;  3WAF A;  5IAI A;  1H43 A;  3UN6 A;  1PDA A;  2RCA A;  2XXU A;  5L9O A;  3H3G A;  3CFZ A;  5M2V A;  2Y7P A;  1Q1K A;  1QUJ A;  4G68 A;  3LSL A;  4H1X A;  2V3U A;  3VFJ A;  3TFL A;  3T9V A;  2E1S A;  3RTW B;  2XX8 A;  3PUX E;  2B65 A;  3GBA A;  3TCH A;  3OEN A;  4THI A;  5H8N A;  3U72 A;  4ZZA A;  1US5 A;  5K2X A;  2W7Y A;  3PD8 A;  3PMX A;  4UAC A;  3TTM A;  4R72 A;  3S9E A;  4O3A A;  1JEV A;  1S50 A;  4MLQ A;  2ESN A;  4GVO A;  2DE2 A;  3CVG A;  3O28 A;  1NNT A;  4G77 A;  2BJJ X;  2DXR A;  1R6Z A;  3OEL A;  4RK9 A;  2O7I A;  4X1B A;  5DEX A;  5FTI A;  1VE4 A;  5KCJ A;  3RYA A;  5DVJ A;  4LQ2 A;  4EXK A;  1Y1Z A;  2V3Q A;  4N13 A;  1O7T A;  1BTJ A;  3QUJ A;  4PP0 A;  3MP8 A;  4MFI A;  1LBC A;  4I1D A;  4UA8 A;  3VDF A;  4C0R A;  2I48 A;  4Q5T A;  2GRV A;  2I6E A;  3K6V A;  1XVY A;  3F11 A;  3VXB A;  2XXW A;  2D3I A;  3O9P A;  3EQ1 A;  3EPE A;  1ANF A;  5AE4 A;  1YPN A;  1P1O A;  4JB7 A;  1DTG A;  4OES A;  4QFO A;  1TT1 A;  2QS3 A;  3ZS6 A;  1LCF A;  2HQ0 A;  3ODB A;  3UGW A;  3L6G A;  2KLF A;  1IZ1 A;  2X7Q A;  2A5T A;  4QHQ A;  3CG3 A;  2Q8J A;  3FXQ A;  4AQ4 A;  1II5 A;  3KSJ A;  2QL3 A;  1B5I A;  1UTH B;  2XXQ A;  3PUV E;  4WED A;  4P0G A;  5EYF A;  5K2Y A;  3BFU A;  2QSX A;  1B40 A;  1IQ7 A;  2ZNT A;  1ELJ A;  3EHS A;  2DSF A;  2GHB A;  3MJN A;  4NMY A;  4F1Y A;  3MP1 A;  3OSR A;  3WAE A;  3KGC A;  2DWA A;  1FQA A;  4BDR A;  2O7U A;  3FJM A;  1IXC A;  4FOR A;  3E9X A;  1LFG A;  1ZU0 A;  4PFU A;  1MQI A;  1KWH A;  4YB5 A;  2E0S A;  3KFM A;  4IO3 A;  5I56 B;  4QFP A;  1SW2 A;  4PET A;  2Q89 A;  4IB2 A;  3E3K A;  1R9L A;  3I6V A;  4HTG A;  4KYE A;  4R9G A;  4DE8 A;  4NE4 A;  3DRK A;  2OBG A;  2WOL A;  1LFI A;  4O3B A;  3RTF B;  3SDF A;  3MQ9 A;  1GVC A;  3MUQ A;  2I3V A;  5CMB A;  3PD9 A;  4OXV A;  2UVI A;  3ZSF A;  3CSB A;  3O97 A;  1ZMG A;  4HCY A;  4IY5 A;  4M4G A;  3FVO A;  3N5L A;  1F9B A;  5ICQ A;  2QS1 A;  5TP9 A;  4DCX A;  4OHN A;  3FIR A;  1I6Q A;  1IXG A;  3S9N C;  3TOD A;  3T9H B;  4QFL A;  3CI8 A;  3MPK A;  3DLN A;  3KJ7 A;  3IOU A;  2NXO A;  4U21 A;  1QJM A;  1B32 A;  3E13 X;  1MPD A;  1QW0 A;  2ABH A;  1ZLQ A;  2H99 A;  2V84 A;  3H6W A;  3MC2 A;  3OEM A;  4KQP A;  5F7V A;  4IY6 A;  3I5O A;  3VXC A;  2YPN A;  1FTM A;  1QUK A;  1HSL A;  4AB6 A;  2IA4 A;  4K3F A;  3O29 A;  4PQJ A;  3LVU A;  1JW5 A;  3W9W A;  1DSN A;  3TTR A;  3K2D A;  1B51 A;  5KZT A;  1FQF A;  2DWJ A;  3FUZ A;  3TKD A;  1H3D A;  1H44 A;  3C9H A;  3KJT A;  3QSL A;  2QS4 A;  1PB8 A;  4NF6 A;  1SYI A;  4H0W A;  3W15 C;  4IO2 A;  5EHS A;  3I3V A;  3K4U A;  2VHA A;  4OQO A;  1JNF A;  2F7C A;  3FD3 A;  3IAZ A;  4YKK A;  3S2V A;  3KOT A;  3MZ1 A;  1MG1 A;  2DXY A;  3KEI A;  4G68 C;  4PE5 B;  4ESX A;  1M5E A;  3IB2 A;  1L5T A;  3PMW A;  2F7A A;  1LGB C;  3IOR A;  1SYH A;  4GXS B;  1RYO A;  4IO5 A;  2QMW A;  3K1N A;  3FJG A;  1B3G A;  2FYI A;  2DVC A;  3PPR A;  4KI0 E;  1MXX A;  3VLV A;  1IXH A;  3G3H A;  1H45 A;  1LAG E;  2RC7 A;  2FA7 A;  2DQV A;  3CFL A;  1N7X A;  1Z7M E;  2HFB A;  2Z8F A;  4ZEC A;  1LAF E;  3N6T A;  3V5A A;  4FE8 A;  4U1O A;  1B7U A;  2WOK A;  1TXF A;  4GWO A;  1AIV A;  3FVK A;  4E0X A;  4ESW A;  4ZEI A;  2G93 A;  4F18 A;  1MH4 A;  3MP6 A;  4BLA A;  2H5Y A;  4FIM A;  1B6H A;  3RNN A;  4POW A;  5JK4 A;  1GV8 A;  2HEU A;  4GL8 A;  4H5F A;  1BLF A;  2A5S A;  3RYB A;  2XXV A;  5DVF A;  5LOM A;  3TMG A;  1A55 A;  3LSF B;  1S9T A;  2XX7 A;  2DP8 A;  2QRY A;  2ANJ A;  2ZNU A;  3DRH A;  1N7W A;  1URS A;  1MXZ A;  3K02 A;  4Q30 B;  2Q9T A;  2P0S A;  1BKA A;  2DWH A;  1PBQ A;  3C32 A;  1TFA A;  1B7Z A;  2Q88 A;  3OOA A;  3MVX A;  1MRP A;  2P2A A;  3PPQ A;  3QYT A;  3T9U A;  4OVJ A;  3H03 A;  2I4B A;  3FGS A;  4ND9 A;  5DT6 A;  3M3F A;  4DIG A;  1GR2 A;  1I6B A;  3RQT A;  2XXY A;  1B58 A;  2PT2 A;  4YKP A;  4F3G A;  3H6U A;  1MQD A;  3RUM A;  5CBR A;  2ZYM A;  5FTH A;  1I6A A;  1SI0 A;  4Q0C A;  3Q25 A;  4BDN A;  1YTV A;  3B6T A;  1NL5 A;  4ELO A;  4R2B A;  3FZV A;  2RC8 A;  3M3K A;  3ZKL A;  3T93 B;  3CIJ A;  3G3I A;  2B3B A;  4BDM A;  3VVD A;  3T96 B;  4C1T A;  4I62 A;  5CI5 A;  3HST A;  1EZO A;  3A09 A;  3MW0 A;  1JW4 A;  4ISU A;  3IB0 A;  3U1O A;  5AA2 D;  1B52 A;  3K6W A;  4F39 A;  1UQW A;  1PEB A;  3C4M A;  2OWS A;  3SET A;  1LFH A;  4XKP A;  4P0I A;  1NMU A;  4FAT A;  2V3T A;  1RYX A;  5I57 B;  1P1Q A;  1DTZ A;  1Q35 A;  5CM6 A;  3HCQ A;  3RT8 A;  4HW8 A;  4F3P A;  2PX1 A;  3IOV A;  1B2H A;  3LBS A;  5H8H B;  5L9M A;  3SKP A;  1CB6 A;  2Z22 A;  3TYH A;  3JZJ A;  4FED A;  5JEI A;  3DP6 A;  5I59 A;  1XVX A;  2R71 A;  2UVG A;  4EQ9 A;  2Z23 A;  1M5C A;  4R6H A;  2DE4 A;  1ATG A;  2QMX A;  2ZYN A;  3A3U A;  3LC8 A;  4JDF A;  4KFQ A;  2AL4 A;  4BDO A;  1JW1 A;  1N0T A;  4YU0 A;  5TPA B;  1B4H A;  1N04 A;  1OLC A;  3QIM A;  4I8C A;  2DS9 A;  2VD2 A;  3IR1 A;  3BFT A;  2YLN A;  4XIG Q;  4EUO A;  4G8M A;  1VR5 A;  3B6Q A;  3BBR A;  4GL0 A;  4LP2 B;  1PBP A;  1USY H;  5B70 A;  2Z8D A;  2ZXT A;  4RY1 A;  3UA8 A;  5AA2 A;  2VOZ A;  1M5B A;  2WKY A;  4GFR A;  4OZ9 A;  3VVF A;  1S7Y A;  2X26 A;  1SDX A;  3CRB A;  1LLS A;  2X7P A;  3CSG A;  3K0V A;  4GD5 A;  4GLI A;  4QSC A;  4R6Y A;  3THI A;  4C1U A;  2XXI A;  5CRY A;  1P1W A;  3K00 A;  3R7X A;  5AA3 A;  1ZTY A;  3LSX A;  1Y3N A;  5H8N B;  1Y4T A;  1MPC A;  2AL5 A;  3PPO A;  4BDL A;  2AYS A;  4YAH X;  5H8F A;  2QS2 A;  3TEL A;  3H06 B;  1P99 A;  1PB9 A;  3MZB A;  3K6X A;  4KYD A;  4NTL A;  3OO8 A;  1NH8 A;  1WVJ A;  5H8Q B;  1FCK A;  5I2K A;  3RY3 A;  4YB6 A;  4LVQ A;  1UIV A;  1IXI A;  4QFK A;  4DXU A;  4E0W A;  3CFX A;  5I57 A;  2HAV A;  5EHM A;  1UTB A;  3HHG A;  4OEV A;  2FNC A;  2ZMB A;  3DRI A;  2VD3 A;  3RPW A;  4KCD A;  3SEY A;  3SEX A;  1JQF A;  2I0B A;  1CE2 A;  2LAO A;  3EN3 A;  3G3G A;  4GOT A;  1POY 1;  3MBP A;  3O6H A;  4NF5 B;  4OMB A;  5H8F B;  2O51 A;  3IOT A;  4EQ7 A;  4ZE9 A;  2QPQ A;  2I3W A;  1YCJ A;  1D3K A;  2UXA A;  4KYS A;  4FEB A;  4EXL A;  2UYF A;  1AOV A;  4RNS A;  4F2O A;  4IGT A;  1FTK A;  3MPL A;  3N94 A;  2F78 A;  3H7M A;  5TPA A;  3OXN A;  1DPP A;  2ALU A;  2HZK A;  1JEU A;  1MY2 A;  1N3X A;  4LZ7 A;  3VVE A;  2AIX A;  3UP9 A;  2XXX A;  1GGG A;  3EHT A;  4DCY A;  3TTN A;  3HN0 A;  4NF5 A;  2P1S A;  1A99 A;  1DPE A;  5DEX B;  1GTK A;  1ZJL A;  3O6I A;  5I58 A;  2F6G A;  1LCT A;  3SEW A;  1MXY A;  1Y9U A;  3PPP A;  5ISU A;  5HPQ A;  4OTE A;  4F3S A;  2CZL A;  3W9V A;  3FV1 A;  4F19 A;  5H8S A;  2R9J A;  4GF8 A;  4OFJ A;  2D21 A;  3FVG A;  3IJO B;  1MY1 A;  3IOW A;  4TQU Q;  1EZP A;  2F5X A;  2XXH A;  3OO7 A;  3O2A A;  3QXM A;  1OQG A;  2UVH A;  3UK4 A;  4QF9 A;  1H76 A;  5ITO A;  1BIY A;  3MVZ A;  2RCB A;  2REG A;  4NF6 B;  4IGR A;  4QRZ A;  4KCC A;  2I58 A;  1O64 A;  4G68 B;  4U23 A;  1FQC A;  1LAX A;  4MLV A;  2ZYK A;  4IO7 A;  1N3W A;  3HPI A;  3KN8 A;  5DTB A;  3N26 A;  4KHZ E;  1LBB A;  4OEN A;  2D5W A;  3K1M A;  4EF2 A;  2RC9 A;  5ITP A;  3IL1 B;  3D4G A;  4DXB A;  1LAH E;  5KCJ B;  3S9M C;  3KN7 A;  3OEK A;  1EH3 A;  2XD2 A;  4R2F A;  4LA9 A;  3RN8 A;  4F29 A;  3Q26 A;  4ZED A;  2Q2A A;  3MZ9 A;  2F8D A;  2ONR A;  3U92 A;  4PFT A;  1OVT A;  3UIF A;  1DMB A;  5H8H A;  4PFY A;  1LST A;  3TPA A;  3OO6 A;  4NWD A;  3R6U A;  4ZEF A;  1DOT A;  1D4N A;  3VE1 B;  3PUW E;  5F1Q A;  1TWY A;  3PUY E;  4F1U A;  3FVN A;  4LUB A;  1OLA A;  1A7L A;  3O6G A;  3TCG A;  1VFE A;  2H4I A;  1MY3 A;  2O68 A;  3RGY A;  2VGQ A;  2HCA A;  3G3K A;  3L6H A;  3MVW A;  2GH9 A;  3R26 A;  5DYH A;  3KBR A;  1A54 A;  2Y7K A;  3JV9 A;  3PMV A;  3TUS A;  5A5X B;  1SI1 A;  1MQJ A;  4RA1 A;  1Z7N E;  3TQL A;  3T66 A;  4ELQ A;  2ONS A;  1OVB A;  4FAJ A;  2UYE A;  3ILU B;  4G2Z A;  1FW0 A;  4F3B A;  2OCU A;  3KG2 A;  1M5F A;  3H6V A;  3SEU A;  1BP5 A;  1FQD A;  3FAS A;  3FV2 A;  3PPN A;  1B5H A;  3PGF A;  3GBB A;  2F35 A;  4GRK A;  4LON B;  1ZKB A;  3TDJ A;  2H98 A;  1FQB A;  4Z7E A;  5AA4 B;  4EF1 A;  4POX A;  5CMK A;  4RXL A;  4N07 A;  1R1N A;  3N6U A;  5CC2 A;  4ZE8 A;  4LZ5 A;  3RT6 B;  5I2K B;  3TQW A;  1Y3P A;  3M3L A;  3IO4 A;  1MPB A;  2QJE A;  4ZEK A;  5ELV A;  1A8E A;  3K1P A;  2Y7R A;  5BWJ A;  5L9S A;  3AXF A;  4NF8 B;  4NWC A;  4R75 A;  3OO9 A;  4RJZ A;  4JWO A;  4XKQ A;  4WKM A;  4F2Q A;  5AA4 A;  1ZIU A;  4YIC A;  5CMC A;  5ICT A;  4ZS9 A;  1OQH A;  2H25 A;  3C35 A;  3OMB A;  2OK2 A;  1I69 A;  4R73 A;  5J1D A;  5I2N A;  2YJP A;  1MY4 A;  5FHM A;  4NF4 A;  2B3F A;  1D9Y A;  4YMA A;  2XHD A;  1B9J A;  1R9Q A;  1YAE A;  2XXR A;  3LR1 A;  1B4Z A;  2NOO A;  3PU5 A;  1XC1 A;  3DP4 A;  4IO6 A;  4M1V A;  3IJX B;  1J1N A;  5AA1 A;  2PMS A;  1MXW A;  2O84 X;  4U4X A;  1IUD A;  2R6G E;  1MDQ A;  1SBP A;  2F7B A;  4KPT A;  4X48 A;  3D4C A;  1B3L A;  4XKN A;  4OFL A;  4NF4 B; 
#chains in the Genus database with same CATH topology
 3SER A;  1VFD A;  3C33 A;  1URG A;  4GQO A;  4WXJ A;  4ELR A;  1LBY A;  1RDY A;  3C34 A;  3MVY A;  4Q8R A;  4DZ1 A;  3OSQ A;  1FTL A;  4JWX A;  4JSO A;  4PGP A;  4YZZ A;  4R9F A;  5ET7 A;  1NV4 A;  1QVS A;  4ELP A;  4ECF A;  1OIB A;  1FBC A;  3JYR A;  4OET A;  3TEP A;  4H8J A;  3RPL B;  4P9K A;  2RIN A;  3DM0 A;  3TCF A;  1A40 A;  5I2K A;  4PBQ A;  4DXC A;  1O63 A;  4P11 A;  1FTJ A;  5A5X A;  3IK6 B;  1Y1M A;  1FJ6 A;  4H6D A;  4F22 A;  2I0C A;  3EHU A;  3O66 A;  1XOC A;  4H5G A;  4IR8 A;  2V93 A;  1B0H A;  4OWD A;  4ZEB A;  3G3J A;  2REJ A;  4GXA A;  3USD A;  1WOD A;  3U65 A;  4RPO A;  2OX3 A;  1NNP A;  4OYV A;  4OVR A;  3TTL A;  1MQH A;  4R74 A;  1IIT A;  2G29 A;  4PC9 A;  2QVU A;  3IO6 A;  4FJP A;  5IKB A;  3GZG A;  4AS5 A;  3K6U A;  3VV5 A;  1MS7 A;  5AA2 B;  2THI A;  1VSO A;  1HSJ A;  2B4L A;  4H8I A;  3SES A;  2O1L A;  4TLL B;  1MXV A;  2ONK E;  5I56 A;  4XXU A;  4PAI A;  4N6D A;  3C31 A;  1MM6 A;  1QKB A;  4O3C A;  1P1N A;  1XT8 A;  3O6P A;  5IAI A;  3UN6 A;  1PDA A;  2RCA A;  2Y7P A;  4G68 A;  1QUJ A;  3LSL A;  3TFL A;  3T9V A;  3RTW B;  2B65 A;  3U72 A;  4P1E A;  5K2X A;  2W7Y A;  3T1B A;  1G0H A;  2DE2 A;  3SEV A;  2BJJ X;  3OEL A;  5KCJ A;  4DI3 D;  1VE4 A;  4P56 A;  3HFU A;  3QUJ A;  4MFI A;  4I1D A;  1IME A;  3VXB A;  2XXW A;  2D3I A;  5ET6 A;  1IMC A;  3UGW A;  2X7Q A;  3CG3 A;  4AQ4 A;  3FXQ A;  4P47 A;  3RPL A;  3KSJ A;  1B5I A;  5EYF A;  2QSX A;  1IQ7 A;  4NGU A;  2ZNT A;  1ELJ A;  3MP1 A;  3KGC A;  1FQA A;  4FOR A;  1LFG A;  4YB5 A;  3KFM A;  4QFP A;  1SW2 A;  4PET A;  3I6V A;  4HTG A;  4O3B A;  3SDF A;  3MQ9 A;  1GVC A;  3ZSF A;  2UVI A;  4LN5 A;  4GWY A;  4M4G A;  3IFC A;  4OHN A;  1IXG A;  4N6K A;  1MPD A;  1QW0 A;  2H99 A;  2V84 A;  3BIG A;  3MC2 A;  3OEM A;  2P3V A;  4IY6 A;  3I5O A;  4K3F A;  3LVU A;  3W9W A;  3K2D A;  1B51 A;  1FBF A;  3FUZ A;  4NF6 A;  2QS4 A;  4H0W A;  3I3V A;  2VHA A;  2F7C A;  3IAZ A;  3ISP A;  1MG1 A;  3KEI A;  1NI9 A;  4GXS B;  2QMW A;  3FJG A;  1MXX A;  1IXH A;  3G3H A;  4FBP A;  2RC7 A;  1DCU A;  1Z7M E;  2HFB A;  3MYU A;  4U1O A;  1TXF A;  3FVK A;  4BLA A;  1XI6 A;  4POW A;  2HEU A;  4H5F A;  2A5S A;  3TMG A;  3LSF B;  1S9T A;  2DP8 A;  2ZNU A;  1URS A;  1MXZ A;  2WEF A;  3TZA A;  1B7Z A;  3FBP A;  3QYT A;  4ND9 A;  1GR2 A;  1I6B A;  3RQT A;  4F3G A;  1MQD A;  4BDN A;  3B6T A;  1NL5 A;  2B3B A;  4MMP A;  3T96 B;  4I62 A;  1EZO A;  3MW0 A;  1JW4 A;  3U1O A;  3IB0 A;  1B52 A;  2ZZV A;  3SZP A;  2OWS A;  4XKP A;  4P0I A;  4FAT A;  2V3T A;  1RYX A;  5FBP A;  3HCQ A;  3RT8 A;  3IOV A;  3LBS A;  3TYH A;  2Z22 A;  4FED A;  4H45 A;  1JP4 A;  3LUZ A;  4KFQ A;  3IR1 A;  5EQ7 A;  3BFT A;  4PFR A;  3BBR A;  4GL0 A;  1USY H;  2ZXT A;  5AA2 A;  1S7Y A;  1SDX A;  3CRB A;  2CZK A;  2X7P A;  4PGN A;  3FXB A;  5H8N B;  2QS2 A;  3H06 B;  3MZB A;  3OO8 A;  1NH8 A;  4DXU A;  4LVQ A;  4E0W A;  5EHM A;  1UTB A;  4OEV A;  2ZMB A;  4KCD A;  3SEX A;  1JQF A;  1CE2 A;  3EN3 A;  3G3G A;  4NF5 B;  3IOT A;  4ZE9 A;  2QPQ A;  2P3N A;  4OVQ A;  4PAK A;  4FEB A;  4IGT A;  3MPL A;  4PBH A;  4OVP A;  2FVZ A;  2HZK A;  1N3X A;  3VVE A;  3ROJ A;  4DCY A;  3HN0 A;  1FPD A;  1DPE A;  1ZJL A;  3O6I A;  1LCT A;  2PFZ A;  2CZL A;  3FV1 A;  3IJO B;  1MY1 A;  4TQU Q;  1EZP A;  2F5X A;  3QXM A;  4QF9 A;  2I58 A;  1O64 A;  1RDX A;  4QBA A;  2KQZ A;  4KHZ E;  1LBB A;  3K1M A;  4DXB A;  1LAH E;  2F3B A;  1EH3 A;  4NG7 A;  4R2F A;  3RN8 A;  4F29 A;  3Q26 A;  2ONR A;  3UIF A;  4PFY A;  3R6U A;  4ZEF A;  3PUW E;  3PUY E;  4LZ7 A;  3UP9 A;  1OLA A;  1A7L A;  2O68 A;  3MVW A;  2Y7K A;  3JV9 A;  3PMV A;  1FPB A;  3TUS A;  1Z7N E;  3T66 A;  1OVB A;  3ILU B;  4G2Z A;  3SEU A;  4GWW A;  3FAS A;  2F35 A;  4N15 A;  1R1N A;  3N6U A;  5CC2 A;  3M3L A;  2QJE A;  4ZEK A;  5BWJ A;  3K1P A;  2Y7R A;  5L9S A;  4R75 A;  4WKM A;  5AA4 A;  2XWK A;  4ZS9 A;  4R73 A;  2FIX A;  5I2N A;  2B3F A;  5ET8 A;  1B9J A;  2XXR A;  3PU5 A;  1XC1 A;  4IO6 A;  1MXW A;  2O84 X;  2R6G E;  4KPT A;  1B3L A;  2IEE A;  1NV3 A;  4XKN A;  4OFL A;  4H65 A;  4KR5 A;  4KD5 A;  1NH7 A;  5HBC A;  2OJT A;  3M8U A;  3S9L C;  1N84 A;  3DRG A;  4BDQ A;  4NHB A;  1Y4C A;  1N76 A;  1NUY A;  1WDN A;  2XX9 A;  4N6P A;  5FHN A;  1MDP 1;  1XHY A;  4I40 A;  4DDD A;  1B7H A;  2NUV A;  4ONY A;  1NFT A;  1B46 A;  2FHY A;  1POT A;  4FEC A;  4LQ5 A;  4R6K A;  2GFE A;  5T3J A;  1JVX A;  1NNF A;  1T0K A;  3FJ7 A;  4YKJ A;  5TU0 A;  3UOR A;  2F97 A;  3KZG A;  2XWI A;  1JET A;  2Y5L A;  1B3E A;  2PYY A;  4G4P A;  4NED A;  1EZ9 A;  3H4Z A;  3U8Q A;  1IMA A;  2XXP A;  1B05 A;  3RYD A;  4EQB A;  4PFW A;  5BUU A;  2PBW A;  1SPI A;  3IB1 A;  4HE2 A;  1USY E;  4JBZ A;  4GIZ A;  4IO4 A;  2NWJ A;  2FBP A;  1US4 A;  3G3F A;  4MH5 A;  2Y84 A;  1SQY A;  1FBH A;  4TLM B;  4YMB A;  5EQ8 A;  1QKA A;  2HHM A;  1UTB B;  4U2R A;  3DEL B;  1LB9 A;  1AMF A;  2WOP A;  5CBS A;  2XD3 A;  4HCW A;  2HZL A;  1FPF A;  3QUF A;  5KDT B;  2OLB A;  4PFB A;  1M5D A;  4AB5 A;  4LZ8 A;  5ET5 A;  5JTY B;  1UIU A;  3K01 A;  3KN3 A;  3CG1 A;  2RF1 A;  2DVZ A;  3KOS A;  2I49 A;  4TOZ A;  5DTB A;  1MQG A;  1NV7 A;  5LDZ A;  2HXW A;  1H43 A;  2XXU A;  2XX8 A;  3OEN A;  4THI A;  4ZZA A;  3S9E A;  4O3A A;  4NN3 A;  5DEX A;  2O7I A;  1DBZ A;  4N13 A;  4PP0 A;  1BTJ A;  1FBD A;  3MP8 A;  1KA1 A;  4Q5T A;  5A5L A;  1XVY A;  3O9P A;  1ANF A;  5AE4 A;  1P1O A;  1DTG A;  1TT1 A;  2HQ0 A;  2A5T A;  4QHQ A;  3KC0 A;  1UTH B;  2XXQ A;  4P0G A;  4WED A;  5K2Y A;  1B40 A;  3EHS A;  4NMY A;  3BIH A;  3FJM A;  3E9X A;  1MQI A;  2Q89 A;  4IB2 A;  4R9G A;  4O7I A;  4NE4 A;  2OBG A;  1LFI A;  3RTF B;  3MUQ A;  4GX4 A;  4UAB A;  3O97 A;  1BK4 A;  2QS1 A;  4DCX A;  3FIR A;  3MPK A;  3DLN A;  3IOU A;  2NXO A;  1FSA A;  2ABH A;  1ZLQ A;  3H6W A;  4KQP A;  4AB6 A;  4PQJ A;  1JW5 A;  4N8Y A;  4N8G A;  1DSN A;  3TTR A;  5KZT A;  3TKD A;  1H44 A;  1PB8 A;  3NOH A;  3S2V A;  4G68 C;  1M5E A;  1L5T A;  2F7A A;  2FA7 A;  1N7X A;  3V5A A;  1B7U A;  4GWS A;  4E0X A;  1EYI A;  1NV2 A;  1LBW A;  5JK4 A;  1GV8 A;  1BLF A;  5DVF A;  5IM2 A;  2Q9T A;  2P0S A;  3C32 A;  3PPQ A;  1MRP A;  2P2A A;  4OVJ A;  1NV1 A;  2I4B A;  3FGS A;  3H03 A;  4GWX A;  4DIG A;  2XXY A;  1B58 A;  3H6U A;  3RUM A;  5CBR A;  5FTH A;  4Q0C A;  1YTV A;  4R2B A;  2RC8 A;  4XEQ A;  4C1T A;  4BDM A;  4XFE A;  4F39 A;  1UQW A;  1NUZ A;  1P1Q A;  2PCR A;  2PX1 A;  5H8H B;  2R71 A;  4R6H A;  2Z23 A;  1M5C A;  1NV6 A;  1ATG A;  2DE4 A;  2QMX A;  2ZYN A;  5I3S A;  2AL4 A;  5IGA A;  2KR0 A;  4XIG Q;  4LP2 B;  2Z8D A;  2VOZ A;  2WKY A;  4MCO A;  4GLI A;  4QSC A;  3K00 A;  3R7X A;  3EKI A;  1ZTY A;  1Y3N A;  3PPO A;  2AL5 A;  5H8F A;  2AYS A;  4NX1 A;  3TEL A;  1PB9 A;  3K6X A;  4KYD A;  4NTL A;  1WVJ A;  5H8Q B;  1UIV A;  4QFK A;  2HAV A;  3DRI A;  2LAO A;  4ESX A;  1K9Z A;  2I3W A;  1D3K A;  2GQ1 A;  2UXA A;  4KYS A;  2UYF A;  1EYJ A;  1AOV A;  5EYG A;  3MST A;  1JEU A;  1DK4 A;  1MY2 A;  1GGG A;  3EHT A;  3TTN A;  4NF5 A;  5DEX B;  3SEW A;  5HPQ A;  5H8S A;  2R9J A;  4GF8 A;  3IOW A;  2UVH A;  1H76 A;  2RCB A;  4IGR A;  4U23 A;  1LAX A;  3KN8 A;  4EF2 A;  5ITP A;  3S9M C;  1FPJ A;  2XD2 A;  4GWU A;  4LA9 A;  3U92 A;  1LST A;  3OO6 A;  4PDD A;  5F1Q A;  1TWY A;  5DYH A;  5I5P A;  5A5X B;  1MQJ A;  4RA1 A;  4FAJ A;  3KG2 A;  3H6V A;  3FV2 A;  3PPN A;  1IMD A;  1LBV A;  4JVC A;  4GRK A;  4EF1 A;  4POX A;  4LZ5 A;  1FBP A;  4OVS A;  5I2K B;  3IFA A;  2DDK A;  5ELV A;  1A8E A;  3AXF A;  4F2Q A;  1ZIU A;  4YIC A;  5CMC A;  2QFL A;  1OQH A;  5J1D A;  2YJP A;  1MY4 A;  4NF4 A;  1D9Y A;  3LR1 A;  1B4Z A;  2NOO A;  2XWO A;  1SBP A;  2F7B A;  1NV0 A;  4P8B A;  5I2N B;  2CMO A;  4EUO A;  4YKI A;  2VP1 A;  1A8F A;  1AL3 A;  2A5T B;  1AH5 A;  2O6A A;  4MNC A;  2Q74 A;  1B1H A;  3V83 A;  3QK6 A;  3DP8 A;  2DOJ A;  1HSE A;  3ILT B;  1FQE A;  4LAT A;  3Q29 A;  4OEU A;  2Z8E A;  1SW1 A;  3V8X B;  4MJO A;  3MAM A;  1Y20 A;  3HV1 A;  2GHA A;  4U4S A;  4OFO A;  4WEP A;  4HS7 A;  5LTC A;  4RYA A;  1B3H A;  2CZI A;  3CR9 A;  2WYK A;  1QUI A;  3FXU A;  3HHF A;  2CEY A;  3MWB A;  3PV0 E;  1MM7 A;  4MF3 A;  3H6T A;  4U22 A;  3T22 A;  4NF8 A;  4QFN A;  4PE3 A;  3A29 A;  2Y7W A;  1JVY A;  2OWT A;  1B5J A;  5I58 B;  3FTO A;  4F31 B;  5L8D A;  3C36 A;  1MH3 A;  5TP9 B;  4G8H A;  4MNP A;  4X1D A;  2V25 A;  3E4R A;  4P3L A;  2Q2C A;  1CNQ A;  3BKI B;  2L5V A;  1LB8 A;  5H8Q A;  3ECR A;  4GBW A;  2O69 A;  5CMM A;  4JWY A;  3Q28 A;  4JXI A;  3ONM A;  2ZNS A;  1PB7 A;  2F6P A;  2CEX A;  1YZ0 A;  2M8C A;  2ZYO A;  4MBP A;  4XTC Q;  4F1V A;  2NVU B;  1ZBM A;  4O94 A;  4NQ8 A;  1B1X A;  4PFI A;  5KDT A;  2QVV A;  2DE3 A;  2DWI A;  3CHG A;  3PUZ E;  3B7D A;  3FAT A;  1KZ8 A;  3WAF A;  3H3G A;  1AWB A;  2QVR A;  3VFJ A;  1FRP A;  3PUX E;  3PD8 A;  4UAC A;  4R72 A;  1JEV A;  1S50 A;  3CVG A;  3O28 A;  4RK9 A;  4X1B A;  2DXR A;  5FTI A;  1R6Z A;  4LQ2 A;  4EXK A;  1Y1Z A;  2V3Q A;  4PTK A;  3VDF A;  1LBC A;  5EQA A;  3K6V A;  3F11 A;  4HE0 A;  3EPE A;  2JJK A;  4JB7 A;  4OES A;  2QS3 A;  3ZS6 A;  4KXP A;  3L6G A;  1IZ1 A;  2Q8J A;  1II5 A;  2QL3 A;  3PUV E;  2DSF A;  2GHB A;  2DWA A;  2VPO A;  2O7U A;  1IXC A;  4PFU A;  2E0S A;  5I56 B;  4ELO A;  2WOL A;  5CMB A;  3PD9 A;  3CSB A;  1ZMG A;  4IY5 A;  3FVO A;  3N5L A;  1F9B A;  4GX6 A;  5TP9 A;  3CI8 A;  3KJ7 A;  3E13 X;  5DW8 A;  3VXC A;  2VPN A;  2IA4 A;  2DWJ A;  1FQF A;  3KJT A;  3C9H A;  4N91 A;  3QSL A;  1SYI A;  4IO2 A;  5EHS A;  3K4U A;  4YKK A;  4OQO A;  1JNF A;  1YXI A;  3FD3 A;  3KOT A;  2DXY A;  4PE5 B;  1FPG A;  1SYH A;  3KC1 A;  1B3G A;  4KI0 E;  1G0I A;  3VLV A;  1H45 A;  1LAG E;  3CFL A;  3QMF A;  3N6T A;  4FE8 A;  2WOK A;  4GWO A;  1QGX A;  4ESW A;  4F18 A;  3MP6 A;  2H5Y A;  4FIM A;  3RNN A;  3KBZ A;  4GL8 A;  5LOM A;  2XX7 A;  2ANJ A;  3E79 A;  4Q30 B;  2DWH A;  3OOA A;  2Q88 A;  2F3D A;  5DT6 A;  3M3F A;  4YKP A;  3Q25 A;  3FZV A;  3M3K A;  3T93 B;  3VVD A;  3HST A;  1FPI A;  3K6W A;  1PEB A;  3C4M A;  3SET A;  1NMU A;  4N17 A;  1DTZ A;  4HW8 A;  1B2H A;  5L9M A;  3DP6 A;  5I59 A;  2UVG A;  3LC8 A;  3A3U A;  4JDF A;  1JW1 A;  1N04 A;  1B4H A;  1OLC A;  3QIM A;  4I8C A;  3TDJ A;  4G8M A;  1VR5 A;  3B6Q A;  5B70 A;  1M5B A;  4GD5 A;  3K0V A;  1LLS A;  5AA3 A;  4YAH X;  4X8R A;  4YB6 A;  1IXI A;  3CFX A;  4G61 A;  3HHG A;  2FNC A;  3RPW A;  5H8F B;  4GOT A;  1LEV A;  2O51 A;  4EXL A;  4RNS A;  2F78 A;  3H7M A;  1DPP A;  5IZ3 A;  2AIX A;  2XXX A;  1FBG A;  2P1S A;  4PCD A;  5I58 A;  1MXY A;  3PPP A;  4X04 A;  4OTE A;  3W9V A;  4F19 A;  3OO7 A;  3O2A A;  5EQ9 A;  1OQG A;  5ITO A;  3MVZ A;  2REG A;  4KCC A;  1N3W A;  3HPI A;  3N26 A;  4OEN A;  2D5W A;  2RC9 A;  3IL1 B;  3D4G A;  3T0J A;  3KN7 A;  3OEK A;  4ZED A;  2Q2A A;  3MZ9 A;  2F8D A;  1OVT A;  3TPA A;  1DOT A;  1VDW A;  4N81 A;  1D4N A;  3VE1 B;  4F1U A;  3FVN A;  3TCG A;  1VFE A;  3RGY A;  2HCA A;  3L6H A;  3R26 A;  2GH9 A;  3KBR A;  1A54 A;  3TQL A;  4N4U A;  1FW0 A;  5I7I A;  5ESY A;  1M5F A;  4HE1 A;  1ZKB A;  2H98 A;  1FQB A;  4RXL A;  3TQW A;  1Y3P A;  3IO4 A;  5ICT A;  3C35 A;  3OMB A;  4MEV A;  2OK2 A;  1I69 A;  4QXD A;  5FHM A;  2XHD A;  1R9Q A;  1YAE A;  2HPG A;  4I3Y A;  4O8M A;  3IJX B;  1J1N A;  4HXV A;  2PMS A;  4U4X A;  1IUD A;  1MDQ A;  4X48 A;  4I3E A;  3D4C A;  4NF4 B;  3Q27 A;  5HM4 B;  4NF0 A;  3FXR A;  1URD A;  3LUY A;  4DLD A;  1NKX A;  1FTO A;  2OZZ A;  3RLF E;  3HO7 A;  2XXK A;  4QSE A;  3B8B A;  1B0L A;  2RKM A;  3TTK A;  4OAN A;  5IZ3 B;  1SVX B;  4YB7 A;  1SW5 A;  4OER A;  1IEJ A;  2OWZ A;  3LV0 A;  3OD7 A;  2PVU A;  5JTY A;  1FPL A;  4ZZE A;  3TAJ A;  4QSD A;  1MY0 A;  3EF7 A;  1OMP A;  2DYX A;  2CZH A;  4EDP A;  3U94 A;  3DRF A;  4XKR A;  5I59 B;  2WBD A;  3VLW A;  4H67 A;  4PDH A;  2F36 A;  4G8N A;  1XS5 A;  4Z0I A;  2UVJ A;  3S4U A;  3E78 A;  3PAM A;  1QUL A;  2HXR A;  4JSD A;  4I9D A;  3U93 A;  3GXA A;  1NUW A;  1MXU A;  2PT1 A;  4OVT A;  2H9B A;  3T9X B;  4L17 A;  1RKM A;  4NAP A;  2ZZX A;  1FBE A;  5J16 A;  2F34 A;  3QAX A;  5B7D A;  1SD3 A;  4U1Z A;  5I84 A;  4RPN A;  2Y7I A;  4ZDM A;  1TFD A;  3ZKK A;  3LSW A;  1SW4 A;  1UTH A;  3GLB A;  2B4M A;  1EU8 A;  3V89 B;  1NNK A;  2I4C A;  2XXT A;  4X9T A;  3VLU A;  3A3C A;  1P1U A;  3DRJ A;  3B6W A;  1PC3 A;  2XA5 A;  2O1M A;  5FHO A;  1D9V A;  3G7W A;  2HAU A;  1B3F A;  3KSX A;  4MX6 A;  1Y3Q A;  2VT5 A;  3P7I A;  4RK2 A;  5DVI A;  4OA4 A;  3IX1 A;  1IIW A;  5L9O A;  3CFZ A;  5M2V A;  1Q1K A;  3D1R A;  4H1X A;  2V3U A;  2E1S A;  3GBA A;  3TCH A;  5H8N A;  1US5 A;  3PMX A;  3TTM A;  4MLQ A;  2ESN A;  4GVO A;  4G77 A;  1NNT A;  3RYA A;  5DVJ A;  1FPK A;  1FTA A;  1O7T A;  4C0R A;  4UA8 A;  2I48 A;  2GRV A;  2I6E A;  3EQ1 A;  1YPN A;  4QFO A;  1LCF A;  3GYY A;  1D9Q A;  3ODB A;  2KLF A;  3BFU A;  1NUX A;  3MJN A;  4F1Y A;  3OSR A;  3WAE A;  4BDR A;  4AS4 A;  1ZU0 A;  1KWH A;  4IO3 A;  4DE8 A;  3E3K A;  1R9L A;  4KYE A;  3DRK A;  2I3V A;  4OXV A;  4HCY A;  2WX9 A;  2PFY A;  5ICQ A;  1I6Q A;  3S9N C;  3TOD A;  3T9H B;  4QFL A;  4P1L A;  4U21 A;  1QJM A;  1B32 A;  5F7V A;  2YPN A;  1FTM A;  1QUK A;  1HSL A;  3O29 A;  2Q8M A;  3PTY A;  1H3D A;  3W15 C;  1LBX A;  4MIJ A;  3MZ1 A;  3IB2 A;  3PMW A;  1LGB C;  3IOR A;  1LBZ A;  1RYO A;  4IO5 A;  3K1N A;  2FYI A;  2DVC A;  3PPR A;  2DQV A;  2Z8F A;  4ZEC A;  1LAF E;  4GBV A;  1AIV A;  4ZEI A;  2G93 A;  1MH4 A;  4H46 A;  4JVI A;  1B6H A;  3RYB A;  2XXV A;  1A55 A;  2QRY A;  3DRH A;  1N7W A;  3K02 A;  4DI4 B;  1BKA A;  1Q9D A;  1PBQ A;  1TFA A;  3MVX A;  3T9U A;  2PT2 A;  2ZYM A;  1I6A A;  1SI0 A;  3ZKL A;  3CIJ A;  3G3I A;  5CI5 A;  3A09 A;  5AA2 D;  4ISU A;  4JVD A;  1LFH A;  5I57 B;  1Q35 A;  5CM6 A;  4F3P A;  1NV5 A;  3SKP A;  1CB6 A;  5JEI A;  3JZJ A;  1XVX A;  4EQ9 A;  4BDO A;  1N0T A;  4YU0 A;  5TPA B;  2DS9 A;  2VD2 A;  2YLN A;  5EYH A;  1PBP A;  4RY1 A;  3UA8 A;  4GFR A;  4OZ9 A;  3VVF A;  2X26 A;  3CSG A;  4R6Y A;  5IZZ A;  3THI A;  4C1U A;  2XXI A;  5CRY A;  1P1W A;  3LSX A;  1Y4T A;  1MPC A;  4BDL A;  1P99 A;  4MAG A;  1FCK A;  3RY3 A;  2MKZ A;  5I57 A;  1FPE A;  3SEY A;  2WYP A;  2VD3 A;  2I0B A;  1POY 1;  3MBP A;  3O6H A;  4OMB A;  4EQ7 A;  1YCJ A;  4GX3 A;  4F2O A;  1FTK A;  3N94 A;  5TPA A;  3OXN A;  2ALU A;  4PAF A;  1A99 A;  1GTK A;  2F6G A;  1Y9U A;  5ISU A;  4F3S A;  3B50 A;  4OFJ A;  2D21 A;  3FVG A;  1K9Y A;  2XXH A;  3UK4 A;  5IZ1 A;  1BIY A;  4NF6 B;  4QRZ A;  1EYK A;  4G68 B;  1FQC A;  4MLV A;  2ZYK A;  4IO7 A;  1INP A;  2FIE A;  4GWZ A;  1YYZ A;  5KCJ B;  4MNI A;  1FJ9 A;  4PFT A;  1DMB A;  5H8H A;  4NWD A;  4LUB A;  1KA0 A;  3O6G A;  2H4I A;  1MY3 A;  2VGQ A;  3G3K A;  1SI1 A;  4ELQ A;  2ONS A;  2XWV A;  2UYE A;  4F3B A;  2OCU A;  2ZZW A;  1BP5 A;  1FQD A;  1B5H A;  3PGF A;  1IMF A;  3GBB A;  4LON B;  5AA4 B;  4Z7E A;  2R8T A;  5CMK A;  4N07 A;  4ZE8 A;  2Y5K A;  3RT6 B;  1RDZ A;  1MPB A;  4NF8 B;  4MHF A;  4NWC A;  3OO9 A;  4RJZ A;  4JWO A;  4XKQ A;  4PF6 A;  4PF8 A;  2H25 A;  4O7M A;  4XF5 A;  4YMA A;  2V4C A;  2WBB A;  2BJI A;  5F24 A;  3DP4 A;  5AA1 A;  4M1V A;  1IMB A; 
#chains in the Genus database with same CATH homology
 3Q27 A;  4H65 A;  5HM4 B;  3SER A;  4YKI A;  1VFD A;  3FXR A;  4KR5 A;  2VP1 A;  1A8F A;  1URD A;  3LUY A;  3C33 A;  4DLD A;  1AL3 A;  2A5T B;  4KD5 A;  1AH5 A;  1NKX A;  1URG A;  2O6A A;  1NH7 A;  4GQO A;  4WXJ A;  1FTO A;  2OZZ A;  5HBC A;  3RLF E;  3HO7 A;  1B1H A;  4QSE A;  4ELR A;  3V83 A;  1B0L A;  3DP8 A;  2DOJ A;  2RKM A;  3C34 A;  1HSE A;  2OJT A;  3ILT B;  3QK6 A;  1FQE A;  3M8U A;  3MVY A;  4LAT A;  3TTK A;  4DZ1 A;  4Q8R A;  3S9L C;  3Q29 A;  1N84 A;  3DRG A;  4OEU A;  4BDQ A;  1Y4C A;  3OSQ A;  1FTL A;  1N76 A;  1SVX B;  4JWX A;  2Z8E A;  1SW1 A;  2CMO A;  4YB7 A;  3V8X B;  1WDN A;  3SEV A;  1SW5 A;  4OER A;  3MAM A;  4JSO A;  2XX9 A;  1IEJ A;  1Y20 A;  4N6P A;  3HV1 A;  5FHN A;  2GHA A;  4YZZ A;  1MDP 1;  1XHY A;  4R9F A;  4U4S A;  4OFO A;  4WEP A;  4HS7 A;  4DDD A;  1B7H A;  2NUV A;  4RYA A;  4ONY A;  1NFT A;  1B46 A;  1QVS A;  4ELP A;  1B3H A;  4ECF A;  1OIB A;  1POT A;  3JYR A;  3CR9 A;  4OET A;  3OD7 A;  3TEP A;  1QUI A;  4FEC A;  3FXU A;  3HHF A;  2PVU A;  4H8J A;  5JTY A;  4LQ5 A;  4R6K A;  2GFE A;  4ZZE A;  3TAJ A;  3MWB A;  3PV0 E;  4QSD A;  1JVX A;  1NNF A;  1T0K A;  1MM7 A;  1MY0 A;  2RIN A;  3DM0 A;  3TCF A;  1A40 A;  3FJ7 A;  3EF7 A;  1OMP A;  4MF3 A;  4YKJ A;  2F97 A;  3KZG A;  3H6T A;  4U22 A;  5TU0 A;  3UOR A;  1O63 A;  4DXC A;  4P11 A;  1FTJ A;  1JET A;  5A5X A;  2DYX A;  3IK6 B;  3T22 A;  4NF8 A;  4QFN A;  1B3E A;  1Y1M A;  2PYY A;  4G4P A;  4NED A;  3DRF A;  3U94 A;  4EDP A;  1EZ9 A;  2Y7W A;  4H6D A;  3H4Z A;  4F22 A;  2I0C A;  4XKR A;  1JVY A;  3EHU A;  3U8Q A;  2OWT A;  1B5J A;  5I59 B;  3O66 A;  1XOC A;  2XXP A;  5I58 B;  4H5G A;  2V93 A;  1B05 A;  4H67 A;  3VLW A;  4PFW A;  4EQB A;  2F36 A;  4G8N A;  5BUU A;  3FTO A;  2PBW A;  3IB1 A;  4F31 B;  1XS5 A;  4Z0I A;  2UVJ A;  5L8D A;  3C36 A;  1USY E;  3S4U A;  1B0H A;  3PAM A;  1QUL A;  4OWD A;  1MH3 A;  4ZEB A;  4JBZ A;  4JSD A;  3G3J A;  4G8H A;  5TP9 B;  4I9D A;  2V25 A;  4X1D A;  4GIZ A;  4IO4 A;  2IEE A;  2REJ A;  2NWJ A;  4GXA A;  3U93 A;  3USD A;  1US4 A;  1WOD A;  3GXA A;  1MXU A;  2PT1 A;  3E4R A;  3G3F A;  4MH5 A;  2Y84 A;  4RPO A;  2H9B A;  2Q2C A;  1SQY A;  1NNP A;  3T9X B;  4L17 A;  1RKM A;  4OYV A;  3TTL A;  1MQH A;  4R74 A;  2F34 A;  3BKI B;  3QAX A;  4TLM B;  1LB8 A;  1IIT A;  5B7D A;  5H8Q A;  2G29 A;  3ECR A;  1SD3 A;  4YMB A;  2O69 A;  5CMM A;  4JWY A;  3IO6 A;  3Q28 A;  4U1Z A;  4JXI A;  1QKA A;  5I84 A;  4RPN A;  4FJP A;  5IKB A;  1UTB B;  4U2R A;  2Y7I A;  3DEL B;  3GZG A;  3ONM A;  4ZDM A;  1LB9 A;  1AMF A;  2ZNS A;  3K6U A;  1PB7 A;  2WOP A;  5CBS A;  1TFD A;  2F6P A;  3ZKK A;  2XD3 A;  3VV5 A;  3LSW A;  1SW4 A;  1MS7 A;  1UTH A;  3GLB A;  2B4M A;  4HCW A;  2HZL A;  1EU8 A;  3V89 B;  1NNK A;  2I4C A;  2XXT A;  5AA2 B;  3QUF A;  2THI A;  5KDT B;  2OLB A;  1VSO A;  2M8C A;  2ZYO A;  4X9T A;  4MBP A;  1HSJ A;  4XTC Q;  2B4L A;  4H8I A;  1M5D A;  4F1V A;  2NVU B;  3SES A;  3VLU A;  1ZBM A;  3A3C A;  2O1L A;  4TLL B;  1MXV A;  3TZA A;  2ONK E;  1P1U A;  4AB5 A;  3DRJ A;  3B6W A;  4LZ8 A;  5JTY B;  1PC3 A;  2O1M A;  1UIU A;  5I56 A;  4XXU A;  1D9V A;  5FHO A;  3G7W A;  3K01 A;  3KN3 A;  2HAU A;  1B1X A;  1B3F A;  3C31 A;  2RF1 A;  3CG1 A;  5KDT A;  2DVZ A;  3KSX A;  1MM6 A;  2DE3 A;  2DWI A;  1Y3Q A;  3KOS A;  1QKB A;  3CHG A;  4TOZ A;  1P1N A;  1MQG A;  2I49 A;  3P7I A;  3PUZ E;  4O3C A;  4RK2 A;  1XT8 A;  3B7D A;  5DVI A;  3IX1 A;  3O6P A;  2HXW A;  1IIW A;  3FAT A;  5I2N B;  3WAF A;  5IAI A;  1H43 A;  3UN6 A;  1PDA A;  2RCA A;  2XXU A;  5L9O A;  3H3G A;  3CFZ A;  5M2V A;  2Y7P A;  1Q1K A;  1QUJ A;  4G68 A;  3LSL A;  4H1X A;  2V3U A;  3VFJ A;  3TFL A;  3T9V A;  2E1S A;  3RTW B;  2XX8 A;  3PUX E;  2B65 A;  3GBA A;  3TCH A;  3OEN A;  4THI A;  5H8N A;  3U72 A;  4ZZA A;  1US5 A;  5K2X A;  2W7Y A;  3PD8 A;  3PMX A;  4UAC A;  3TTM A;  4R72 A;  3S9E A;  4O3A A;  1JEV A;  1S50 A;  4MLQ A;  2ESN A;  4GVO A;  2DE2 A;  3CVG A;  3O28 A;  1NNT A;  4G77 A;  2BJJ X;  2DXR A;  1R6Z A;  3OEL A;  4RK9 A;  2O7I A;  4X1B A;  5DEX A;  5FTI A;  1VE4 A;  5KCJ A;  3RYA A;  5DVJ A;  4LQ2 A;  4EXK A;  1Y1Z A;  2V3Q A;  4N13 A;  1O7T A;  1BTJ A;  3QUJ A;  4PP0 A;  3MP8 A;  4MFI A;  1LBC A;  4I1D A;  4UA8 A;  3VDF A;  4C0R A;  2I48 A;  4Q5T A;  2GRV A;  2I6E A;  3K6V A;  1XVY A;  3F11 A;  3VXB A;  2XXW A;  2D3I A;  3O9P A;  3EQ1 A;  3EPE A;  1ANF A;  5AE4 A;  1YPN A;  1P1O A;  4JB7 A;  1DTG A;  4OES A;  4QFO A;  1TT1 A;  2QS3 A;  3ZS6 A;  1LCF A;  2HQ0 A;  3ODB A;  3UGW A;  3L6G A;  2KLF A;  1IZ1 A;  2X7Q A;  2A5T A;  4QHQ A;  3CG3 A;  2Q8J A;  3FXQ A;  4AQ4 A;  1II5 A;  3KSJ A;  2QL3 A;  1B5I A;  1UTH B;  2XXQ A;  3PUV E;  4WED A;  4P0G A;  5EYF A;  5K2Y A;  3BFU A;  2QSX A;  1B40 A;  1IQ7 A;  2ZNT A;  1ELJ A;  3EHS A;  2DSF A;  2GHB A;  3MJN A;  4NMY A;  4F1Y A;  3MP1 A;  3OSR A;  3WAE A;  3KGC A;  2DWA A;  1FQA A;  4BDR A;  2O7U A;  3FJM A;  1IXC A;  4FOR A;  3E9X A;  1LFG A;  1ZU0 A;  4PFU A;  1MQI A;  1KWH A;  4YB5 A;  2E0S A;  3KFM A;  4IO3 A;  5I56 B;  4QFP A;  1SW2 A;  4PET A;  2Q89 A;  4IB2 A;  3E3K A;  1R9L A;  3I6V A;  4HTG A;  4KYE A;  4R9G A;  4DE8 A;  4NE4 A;  3DRK A;  2OBG A;  2WOL A;  1LFI A;  4O3B A;  3RTF B;  3SDF A;  3MQ9 A;  1GVC A;  3MUQ A;  2I3V A;  5CMB A;  3PD9 A;  4OXV A;  2UVI A;  3ZSF A;  3CSB A;  3O97 A;  1ZMG A;  4HCY A;  4IY5 A;  4M4G A;  3FVO A;  3N5L A;  1F9B A;  5ICQ A;  2QS1 A;  5TP9 A;  4DCX A;  4OHN A;  3FIR A;  1I6Q A;  1IXG A;  3S9N C;  3TOD A;  3T9H B;  4QFL A;  3CI8 A;  3MPK A;  3DLN A;  3KJ7 A;  3IOU A;  2NXO A;  4U21 A;  1QJM A;  1B32 A;  3E13 X;  1MPD A;  1QW0 A;  2ABH A;  1ZLQ A;  2H99 A;  2V84 A;  3H6W A;  3MC2 A;  3OEM A;  4KQP A;  5F7V A;  4IY6 A;  3I5O A;  3VXC A;  2YPN A;  1FTM A;  1QUK A;  1HSL A;  4AB6 A;  2IA4 A;  4K3F A;  3O29 A;  4PQJ A;  3LVU A;  1JW5 A;  3W9W A;  1DSN A;  3TTR A;  3K2D A;  1B51 A;  5KZT A;  1FQF A;  2DWJ A;  3FUZ A;  3TKD A;  1H3D A;  1H44 A;  3C9H A;  3KJT A;  3QSL A;  2QS4 A;  1PB8 A;  4NF6 A;  1SYI A;  4H0W A;  3W15 C;  4IO2 A;  5EHS A;  3I3V A;  3K4U A;  2VHA A;  4OQO A;  1JNF A;  2F7C A;  3FD3 A;  3IAZ A;  4YKK A;  3S2V A;  3KOT A;  3MZ1 A;  1MG1 A;  2DXY A;  3KEI A;  4G68 C;  4PE5 B;  4ESX A;  1M5E A;  3IB2 A;  1L5T A;  3PMW A;  2F7A A;  1LGB C;  3IOR A;  1SYH A;  4GXS B;  1RYO A;  4IO5 A;  2QMW A;  3K1N A;  3FJG A;  1B3G A;  2FYI A;  2DVC A;  3PPR A;  4KI0 E;  1MXX A;  3VLV A;  1IXH A;  3G3H A;  1H45 A;  1LAG E;  2RC7 A;  2FA7 A;  2DQV A;  3CFL A;  1N7X A;  1Z7M E;  2HFB A;  2Z8F A;  4ZEC A;  1LAF E;  3N6T A;  3V5A A;  4FE8 A;  4U1O A;  1B7U A;  2WOK A;  1TXF A;  4GWO A;  1AIV A;  3FVK A;  4E0X A;  4ESW A;  4ZEI A;  2G93 A;  4F18 A;  1MH4 A;  3MP6 A;  4BLA A;  2H5Y A;  4FIM A;  1B6H A;  3RNN A;  4POW A;  5JK4 A;  1GV8 A;  2HEU A;  4GL8 A;  4H5F A;  1BLF A;  2A5S A;  3RYB A;  2XXV A;  5DVF A;  5LOM A;  3TMG A;  1A55 A;  3LSF B;  1S9T A;  2XX7 A;  2DP8 A;  2QRY A;  2ANJ A;  2ZNU A;  3DRH A;  1N7W A;  1URS A;  1MXZ A;  3K02 A;  4Q30 B;  2Q9T A;  2P0S A;  1BKA A;  2DWH A;  1PBQ A;  3C32 A;  1TFA A;  1B7Z A;  2Q88 A;  3OOA A;  3MVX A;  1MRP A;  2P2A A;  3PPQ A;  3QYT A;  3T9U A;  4OVJ A;  3H03 A;  2I4B A;  3FGS A;  4ND9 A;  5DT6 A;  3M3F A;  4DIG A;  1GR2 A;  1I6B A;  3RQT A;  2XXY A;  1B58 A;  2PT2 A;  4YKP A;  4F3G A;  3H6U A;  1MQD A;  3RUM A;  5CBR A;  2ZYM A;  5FTH A;  1I6A A;  1SI0 A;  4Q0C A;  3Q25 A;  4BDN A;  1YTV A;  3B6T A;  1NL5 A;  4ELO A;  4R2B A;  3FZV A;  2RC8 A;  3M3K A;  3ZKL A;  3T93 B;  3CIJ A;  3G3I A;  2B3B A;  4BDM A;  3VVD A;  3T96 B;  4C1T A;  4I62 A;  5CI5 A;  3HST A;  1EZO A;  3A09 A;  3MW0 A;  1JW4 A;  4ISU A;  3IB0 A;  3U1O A;  5AA2 D;  1B52 A;  3K6W A;  4F39 A;  1UQW A;  1PEB A;  3C4M A;  2OWS A;  3SET A;  1LFH A;  4XKP A;  4P0I A;  1NMU A;  4FAT A;  2V3T A;  1RYX A;  5I57 B;  1P1Q A;  1DTZ A;  1Q35 A;  5CM6 A;  3HCQ A;  3RT8 A;  4HW8 A;  4F3P A;  2PX1 A;  3IOV A;  1B2H A;  3LBS A;  5H8H B;  5L9M A;  3SKP A;  1CB6 A;  2Z22 A;  3TYH A;  3JZJ A;  4FED A;  5JEI A;  3DP6 A;  5I59 A;  1XVX A;  2R71 A;  2UVG A;  4EQ9 A;  2Z23 A;  1M5C A;  4R6H A;  2DE4 A;  1ATG A;  2QMX A;  2ZYN A;  3A3U A;  3LC8 A;  4JDF A;  4KFQ A;  2AL4 A;  4BDO A;  1JW1 A;  1N0T A;  4YU0 A;  5TPA B;  1B4H A;  1N04 A;  1OLC A;  3QIM A;  4I8C A;  2DS9 A;  2VD2 A;  3IR1 A;  3BFT A;  2YLN A;  4XIG Q;  4EUO A;  4G8M A;  1VR5 A;  3B6Q A;  3BBR A;  4GL0 A;  4LP2 B;  1PBP A;  1USY H;  5B70 A;  2Z8D A;  2ZXT A;  4RY1 A;  3UA8 A;  5AA2 A;  2VOZ A;  1M5B A;  2WKY A;  4GFR A;  4OZ9 A;  3VVF A;  1S7Y A;  2X26 A;  1SDX A;  3CRB A;  1LLS A;  2X7P A;  3CSG A;  3K0V A;  4GD5 A;  4GLI A;  4QSC A;  4R6Y A;  3THI A;  4C1U A;  2XXI A;  5CRY A;  1P1W A;  3K00 A;  3R7X A;  5AA3 A;  1ZTY A;  3LSX A;  1Y3N A;  5H8N B;  1Y4T A;  1MPC A;  2AL5 A;  3PPO A;  4BDL A;  2AYS A;  4YAH X;  5H8F A;  2QS2 A;  3TEL A;  3H06 B;  1P99 A;  1PB9 A;  3MZB A;  3K6X A;  4KYD A;  4NTL A;  3OO8 A;  1NH8 A;  1WVJ A;  5H8Q B;  1FCK A;  5I2K A;  3RY3 A;  4YB6 A;  4LVQ A;  1UIV A;  1IXI A;  4QFK A;  4DXU A;  4E0W A;  3CFX A;  5I57 A;  2HAV A;  5EHM A;  1UTB A;  3HHG A;  4OEV A;  2FNC A;  2ZMB A;  3DRI A;  2VD3 A;  3RPW A;  4KCD A;  3SEY A;  3SEX A;  1JQF A;  2I0B A;  1CE2 A;  2LAO A;  3EN3 A;  3G3G A;  4GOT A;  1POY 1;  3MBP A;  3O6H A;  4NF5 B;  4OMB A;  5H8F B;  2O51 A;  3IOT A;  4EQ7 A;  4ZE9 A;  2QPQ A;  2I3W A;  1YCJ A;  1D3K A;  2UXA A;  4KYS A;  4FEB A;  4EXL A;  2UYF A;  1AOV A;  4RNS A;  4F2O A;  4IGT A;  1FTK A;  3MPL A;  3N94 A;  2F78 A;  3H7M A;  5TPA A;  3OXN A;  1DPP A;  2ALU A;  2HZK A;  1JEU A;  1MY2 A;  1N3X A;  4LZ7 A;  3VVE A;  2AIX A;  3UP9 A;  2XXX A;  1GGG A;  3EHT A;  4DCY A;  3TTN A;  3HN0 A;  4NF5 A;  2P1S A;  1A99 A;  1DPE A;  5DEX B;  1GTK A;  1ZJL A;  3O6I A;  5I58 A;  2F6G A;  1LCT A;  3SEW A;  1MXY A;  1Y9U A;  3PPP A;  5ISU A;  5HPQ A;  4OTE A;  4F3S A;  2CZL A;  3W9V A;  3FV1 A;  4F19 A;  5H8S A;  2R9J A;  4GF8 A;  4OFJ A;  2D21 A;  3FVG A;  3IJO B;  1MY1 A;  3IOW A;  4TQU Q;  1EZP A;  2F5X A;  2XXH A;  3OO7 A;  3O2A A;  3QXM A;  1OQG A;  2UVH A;  3UK4 A;  4QF9 A;  1H76 A;  5ITO A;  1BIY A;  3MVZ A;  2RCB A;  2REG A;  4NF6 B;  4IGR A;  4QRZ A;  4KCC A;  2I58 A;  1O64 A;  4G68 B;  4U23 A;  1FQC A;  1LAX A;  4MLV A;  2ZYK A;  4IO7 A;  1N3W A;  3HPI A;  3KN8 A;  5DTB A;  3N26 A;  4KHZ E;  1LBB A;  4OEN A;  2D5W A;  3K1M A;  4EF2 A;  2RC9 A;  5ITP A;  3IL1 B;  3D4G A;  4DXB A;  1LAH E;  5KCJ B;  3S9M C;  3KN7 A;  3OEK A;  1EH3 A;  2XD2 A;  4R2F A;  4LA9 A;  3RN8 A;  4F29 A;  3Q26 A;  4ZED A;  2Q2A A;  3MZ9 A;  2F8D A;  2ONR A;  3U92 A;  4PFT A;  1OVT A;  3UIF A;  1DMB A;  5H8H A;  4PFY A;  1LST A;  3TPA A;  3OO6 A;  4NWD A;  3R6U A;  4ZEF A;  1DOT A;  1D4N A;  3VE1 B;  3PUW E;  5F1Q A;  1TWY A;  3PUY E;  4F1U A;  3FVN A;  4LUB A;  1OLA A;  1A7L A;  3O6G A;  3TCG A;  1VFE A;  2H4I A;  1MY3 A;  2O68 A;  3RGY A;  2VGQ A;  2HCA A;  3G3K A;  3L6H A;  3MVW A;  2GH9 A;  3R26 A;  5DYH A;  3KBR A;  1A54 A;  2Y7K A;  3JV9 A;  3PMV A;  3TUS A;  5A5X B;  1SI1 A;  1MQJ A;  4RA1 A;  1Z7N E;  3TQL A;  3T66 A;  4ELQ A;  2ONS A;  1OVB A;  4FAJ A;  2UYE A;  3ILU B;  4G2Z A;  1FW0 A;  4F3B A;  2OCU A;  3KG2 A;  1M5F A;  3H6V A;  3SEU A;  1BP5 A;  1FQD A;  3FAS A;  3FV2 A;  3PPN A;  1B5H A;  3PGF A;  3GBB A;  2F35 A;  4GRK A;  4LON B;  1ZKB A;  3TDJ A;  2H98 A;  1FQB A;  4Z7E A;  5AA4 B;  4EF1 A;  4POX A;  5CMK A;  4RXL A;  4N07 A;  1R1N A;  3N6U A;  5CC2 A;  4ZE8 A;  4LZ5 A;  3RT6 B;  5I2K B;  3TQW A;  1Y3P A;  3M3L A;  3IO4 A;  1MPB A;  2QJE A;  4ZEK A;  5ELV A;  1A8E A;  3K1P A;  2Y7R A;  5BWJ A;  5L9S A;  3AXF A;  4NF8 B;  4NWC A;  4R75 A;  3OO9 A;  4RJZ A;  4JWO A;  4XKQ A;  4WKM A;  4F2Q A;  5AA4 A;  1ZIU A;  4YIC A;  5CMC A;  5ICT A;  4ZS9 A;  1OQH A;  2H25 A;  3C35 A;  3OMB A;  2OK2 A;  1I69 A;  4R73 A;  5J1D A;  5I2N A;  2YJP A;  1MY4 A;  5FHM A;  4NF4 A;  2B3F A;  1D9Y A;  4YMA A;  2XHD A;  1B9J A;  1R9Q A;  1YAE A;  2XXR A;  3LR1 A;  1B4Z A;  2NOO A;  3PU5 A;  1XC1 A;  3DP4 A;  4IO6 A;  4M1V A;  3IJX B;  1J1N A;  5AA1 A;  2PMS A;  1MXW A;  2O84 X;  4U4X A;  1IUD A;  2R6G E;  1MDQ A;  1SBP A;  2F7B A;  4KPT A;  4X48 A;  3D4C A;  1B3L A;  4XKN A;  4OFL A;  4NF4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...