1ZTYA

Crystal structure of the chitin oligasaccharide binding protein
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
528
structure length
528
Chain Sequence
RSELTIVPDFYPTMVRNFNPYLATNLRTTTDFIYEPLVVFNEMKGNTPVFRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRFRLSEANSNVPYEISLIPIVAEHVWKDVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQLLGKIVNSELDWTSSFVPDIDRTYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKKEALDNVDFRRAFSMALDRQTIIDIAFYGSGTVNDFASGLGYAFEAWSDEATHKKYKGFNTYDVEGSKKLLAKAGFKDVNGDGFVETPSGKSFELLIQSPNGWTDFNNTVQLAVEQLQEVGIKAKARTPEFAVYNQAMLEGTYDVAYTNYFHGADPFTYWNSGYNSALQSGDGMPRFAMHYFTDKKLDGLLDSFYKTADKNEQLAIAHGIQKIIAENQVTIPVMSGAWMYQYNTTRFTGWWSEENPKGRPSVWAGIPERLLHVLDLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein, signaling protein
molecule keywords Chitin Oligosaccharide Binding Protein
publication title Crystal structure of the liganded and unliganded periplasmic Chitin oligosaccharide binding protein.
rcsb
source organism Vibrio cholerae
total genus 157
structure length 528
sequence length 528
ec nomenclature
pdb deposition date 2005-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1ztyA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ztyA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1ztyA02
5FHNA 3U93A 4DZ1A 1LAXA 1US4A 3OEMA 1ZJLA 3RGYA 5ICTA 1FQAA 3M3FA 5LOMA 3FJMA 3KOSA 1MH3A 3H7MA 2R71A 3KFMA 2R9JA 4LZ7A 3N5LA 3KJTA 1I6QA 3KJ7A 3FVNA 4YB7A 3KN3A 2QS3A 3FVOA 4PFYA 2AL4A 3SEUA 1MXYA 3D4CA 3G3FA 4PQJA 3TKDA 4BLAA 3EHUA 5K2XA 3TZAA 3T9HB 1TWYA 3C4MA 2XXQA 4RYAA 4FAJA 1LLSA 2I58A 3ZKKA 4GRKA 1ZBMA 1YAEA 5IKBA 4I62A 1M5DA 3L6HA 3UA8A 4NF4A 1P1NA 1R9QA 1B3FA 2CZLA 4O3AA 3QAXA 3O29A 3W15C 2XXIA 3RLFE 4R75A 3OENA 4RJZA 3RT8A 5KDTA 4Q0CA 2HZLA 2DYXA 3DP4A 1B6HA 2V3TA 4FE8A 4F1VA 3MJNA 2X7QA 2DE4A 2QRYA 2H5YA 5DEXB 1USYE 2F6GA 2QS2A 3H06B 1Y4CA 1LFIA 2UVGA 3PUXE 5CI5A 2Z23A 1T0KA 1H45A 4NWCA 3T9VA 2QPQA 4HS7A 4OERA 1PDAA 5H8NB 4JWXA 1ELJA 1B3HA 1OVTA 3PMVA 2F8DA 3VXCA 5KDTB 1J1NA 4HCYA 4N13A 2O7UA 2ZYNA 2RF1A 2XXUA 1O64A 5I84A 5AA4B 1US5A 4OEVA 2HFBA 4ELOA 3G3KA 5TP9A 2I48A 1Y3NA 2A5SA 1URSA 4NTLA 1XVXA 3U92A 1JW1A 4MFIA 1MRPA 2ONKE 1SD3A 5I59B 3EF7A 1PBPA 4X1DA 4PFWA 1D9YA 3CFLA 4KR5A 3OOAA 4NEDA 5JEIA 3U72A 1MS7A 3C34A 2F34A 2B3FA 3W9WA 3MPKA 5FHMA 4EDPA 4EXKA 3IO6A 1FW0A 4YU0A 1MQHA 5CMMA 5I57A 1FTOA 3T22A 3G3HA 4WEPA 2DWJA 4JXIA 1I69A 3CRBA 3T93B 4H65A 1VE4A 1A8FA 5TP9B 3KN8A 2Y7IA 1ZTYA 4H8IA 2NUVA 2HEUA 4EQBA 2B4MA 4YICA 4ESXA 2GH9A 1B3GA 2NVUB 3IOTA 3MVXA 2QSXA 5CMBA 4YMBA 3O6IA 5ISUA 3VVEA 1BKAA 3GBAA 1QKAA 3E3KA 4P0IA 3V5AA 3UIFA 2YPNA 1UIVA 4H8JA 3W9VA 4HW8A 3RYBA 1GGGA 5L9SA 3VFJA 1D3KA 3OO7A 2AL5A 1NH7A 4FATA 4OVJA 1M5CA 4PETA 1WODA 1B58A 1UTHB 4LUBA 4Z0IA 3MVZA 4WKMA 4IO2A 3FVKA 5A5XA 2E0SA 5H8QA 4OZ9A 2DQVA 2DOJA 4RNSA 5H8FA 2XXWA 3GLBA 3G7WA 1Y1ZA 4FIMA 4YMAA 3PUYE 4X48A 2Y7KA 4QFKA 2I0BA 4N07A 2RC9A 2REGA 3ODBA 3KZGA 1LCFA 3PMXA 3TYHA 4U2RA 4EUOA 4R6YA 3KBRA 3BFTA 4LVQA 2G29A 3SEVA 2O84X 2DS9A 2P0SA 1XHYA 2O69A 4H5GA 5AA2D 4IGRA 1OLCA 3UORA 1B4ZA 5H8SA 4AQ4A 1B1HA 4G8NA 3SEXA 4E0XA 3HN0A 2DVZA 4OQOA 1B0HA 2ZNTA 3C35A 4F2QA 2VP1A 3O2AA 2HAVA 4G2ZA 3MC2A 1LFGA 1LCTA 3QK6A 3U8QA 3PV0E 2X7PA 4G68C 4LATA 2DWHA 3QYTA 1IXHA 1ATGA 1MG1A 4NF5A 4O3CA 3M3KA 4R6KA 2Y7WA 4DXCA 1RYOA 3FATA 2O1MA 3A3UA 3DM0A 3CG3A 1L5TA 4KYSA 3LBSA 3BKIB 1N84A 1HSJA 5CMKA 3RUMA 4OWDA 3H4ZA 4ECFA 1MH4A 4QFPA 2F5XA 4F3GA 3LSLA 1NH8A 3ZS6A 1F9BA 3GZGA 3MWBA 1SW4A 3B6QA 3N26A 1GR2A 5IAIA 2DP8A 3EPEA 3WAFA 4R73A 1IEJA 3HPIA 5CRYA 1UTBA 2Z8FA 3PUWE 1EZOA 3GXAA 3MAMA 3PPNA 4ZE8A 3RN8A 1HSLA 2B4LA 3A3CA 3FIRA 4MF3A 2E1SA 1KWHA 1SQYA 1R6ZA 3THIA 3H3GA 1ZMGA 4LQ5A 3RPWA 5F1QA 1POY1 5L8DA 3H6UA 3TQWA 4X9TA 1JW5A 3CSGA 2I49A 2XX9A 2I6EA 2G93A 1O7TA 3Q29A 2GHAA 1OLAA 5JTYA 3VVDA 4ESWA 5I56B 1UTBB 5AA2B 1YCJA 2O6AA 4R72A 1B7HA 4XKPA 4HTGA 3O6GA 3VLUA 1S50A 2UVIA 4M4GA 4F22A 4THIA 4YB6A 3VE1B 3PPPA 3E4RA 1XOCA 2KLFA 4LZ8A 4POWA 2A5TB 2AYSA 1I6BA 1RKMA 3TCGA 4OXVA 1S7YA 4IO4A 2F35A 2ABHA 1II5A 3MW0A 5F7VA 3B7DA 5KCJB 2HXWA 3GBBA 2ZMBA 4EQ7A 1P99A 4MH5A 1MQJA 4XKQA 1VSOA 1DSNA 2ZXTA 2Z8DA 5JTYB 1DPEA 3SETA 1SW1A 5DEXA 4RK9A 3KSJA 4ZEBA 1NFTA 3HSTA 2O51A 3K6VA 1FTKA 4OFJA 2CMOA 1LAGE 4ISUA 4OHNA 4F29A 3SEWA 1B3LA 3KN7A 4Q30B 4GOTA 4ELPA 2WOLA 1B51A 2D21A 3VDFA 2QL3A 5H8NA 1D9VA 3H6WA 3OELA 3DRIA 3MVWA 1LBBA 5ITPA 2QS4A 4GL8A 2LAOA 5AA4A 5ICQA 4MBPA 3ZKLA 3H6TA 4I9DA 1D4NA 2OJTA 2VD3A 1QJMA 3QSLA 2V93A 3FJGA 3T96B 3TMGA 1GV8A 5I59A 4YB5A 4ELRA 1QW0A 2D5WA 4LA9A 2FA7A 1ANFA 1EU8A 4P0GA 3PUZE 1H76A 3EHTA 3DRJA 2F78A 4U23A 1H43A 4G4PA 1SI1A 1MPDA 4QFLA 3HHGA 1MY3A 1MPBA 3O6PA 2QMXA 4ZECA 1PEBA 1QVSA 3S4UA 2HCAA 1Y3QA 2XD2A 1UQWA 3IAZA 4F1UA 1PC3A 4U22A 5TPAB 2BJJX 4G8HA 3MP1A 3CVGA 2RCBA 4QFNA 3FV1A 2VHAA 1XVYA 4YKKA 2XXVA 4OYVA 1QULA 3K02A 3OO6A 3RNNA 1URGA 2RCAA 2XX8A 3O66A 1MY1A 4OMBA 2B3BA 2Y7PA 3S9LC 2XD3A 1UTHA 1PB9A 1EZ9A 2FNCA 3B6WA 5DVJA 1JEVA 1R1NA 1N0TA 3KSXA 2F7BA 3LC8A 3SEYA 5L9OA 3IOUA 3TCFA 3S2VA 3OMBA 3TFLA 1SI0A 3V89B 1DTZA 1WDNA 3FXRA 3CHGA 1SBPA 4NF6B 1LB8A 2DE3A 1NNTA 3SDFA 3R6UA 4G68A 4R2BA 4AB6A 3E9XA 2PMSA 3M3LA 3PPQA 2QJEA 4OFOA 3Q27A 1OVBA 1FTLA 4F3SA 1P1QA 1A99A 3MVYA 2V3UA 1H44A 3K4UA 2PX1A 4BDNA 4MLVA 5DVFA 3KGCA 2P1SA 3SERA 3TPAA 2I3WA 2PVUA 4F19A 3FXQA 2Y84A 1XC1A 2VGQA 5HBCA 4U4SA 3WAEA 1TFDA 1QUKA 4O3BA 1JEUA 4G68B 1IXGA 3CFXA 1B40A 4YKIA 1MXZA 1Y3PA 5EHSA 1JVYA 3UGWA 1MXUA 4BDMA 3K00A 1N76A 2WKYA 3OXNA 4ZEIA 3OO8A 1N3WA 1B5IA 4BDOA 2M8CA 4Z7EA 1BLFA 2OK2A 1LAHE 3I5OA 2DWIA 2GFEA 5JK4A 1IITA 2PT1A 4C1TA 4DXUA 1MQGA 2RKMA 4GXAA 3MZBA 2IEEA 4H6DA 4LONB 4F2OA 2O68A 4GQOA 2Q89A 5CC2A 4PP0A 1B7ZA 4XIGQ 1JW4A 3K6XA 4MLQA 3VXBA 2QMWA 2XXRA 3I3VA 3H03A 3TELA 5CBSA 2QS1A 4QSDA 4RPOA 2RINA 5CMCA 1JNFA 4DIGA 1TT1A 3G3JA 3MZ1A 1SDXA 3G3IA 4KYEA 1PB7A 3K0VA 1DTGA 3FVGA 3FGSA 3LSWA 3FTOA 3ZSFA 1IZ1A 4R9GA 1A8EA 3F11A 1ZLQA 3TODA 3PPOA 4JBZA 2F97A 3PAMA 3K1MA 1JQFA 4GIZA 1M5EA 1WVJA 2Z22A 1JETA 4FEDA 3DELB 2UVHA 3C32A 5L9MA 2HQ0A 1NL5A 4IO7A 3HCQA 2I4BA 2B65A 3BBRA 3IORA 1AL3A 4G77A 4TOZA 2HZKA 3FV2A 3UK4A 2OWSA 4ZS9A 3LSXA 2ZYOA 4YAHX 2XXHA 2O1LA 2ZYKA 4LQ2A 1CB6A 2GHBA 5DT6A 1RYXA 1B5JA 1LB9A 5I2NB 1O63A 2ONRA 1B2HA 2ESNA 2D3IA 2YLNA 5I56A 1SYHA 5J1DA 2DVCA 5AA2A 1URDA 5I58A 1QUJA 2ONSA 3IR1A 4EF1A 1QKBA 1BP5A 1OQGA 4QF9A 2VD2A 3SESA 4ZE9A 1IUDA 2DWAA 2A5TA 4TQUQ 5DTBA 3ILTB 3TTNA 1FCKA 4QSCA 4PFTA 5KCJA 3ONMA 1NNPA 1P1WA 3C9HA 2H25A 1Z7NE 4LP2B 4GXSB 4F3BA 3FZVA 2OBGA 3H6VA 2YJPA 4KYDA 2NWJA 4M1VA 3CFZA 2X26A 5BUUA 1YTVA 4NMYA 4KI0E 3KG2A 2XXPA 3FD3A 2R6GE 3B6TA 4QRZA 1YPNA 3TTKA 3EHSA 5DVIA 3IB0A 4KD5A 1B05A 4I1DA 5I58B 1B9JA 1ZU0A 4F31B 2Q8JA 3O9PA 1MQDA 3IB1A 3M8UA 1FQEA 1LAFE 5B7DA 3K1NA 4KCCA 1Y4TA 4Q5TA 3R7XA 4WXJA 2XX7A 2Q2AA 4JSDA 2PT2A 4FJPA 3SKPA 4X1BA 4EF2A 3BFUA 3T66A 3C36A 3VV5A 1MM6A 4GD5A 4KCDA 3MBPA 1R9LA 3FXUA 5AA3A 1AH5A 1UIUA 4IY5A 2H98A 1N7WA 1EZPA 3K2DA 4DE8A 3DRKA 3PPRA 5AA1A 1IXIA 4NWDA 1N3XA 1IXCA 3O28A 2GRVA 2PBWA 4OETA 2AIXA 1FQBA 1B32A 4U1ZA 3L6GA 3JYRA 3RYAA 5K2YA 4H0WA 4F3PA 4AB5A 2O7IA 4EQ9A 4IO5A 4G8MA 2IA4A 4IY6A 2UYFA 3PUVE 1SVXB 1LBCA 3IOVA 4RA1A 3DP8A 3K01A 3TUSA 1FQFA 1DMBA 4JSOA 2NXOA 3VVFA 1Y1MA 3U1OA 3TCHA 5TPAA 1LSTA 1TXFA 2Q88A 3CIJA 2F7AA 1Y9UA 1B1XA 1MY4A 3DLNA 3IJXB 3PU5A 1LFHA 2DXYA 1LGBC 4OFLA 4TLLB 4DCYA 5EHMA 4GFRA 4P11A 5BWJA 4EXLA 4H67A 4KHZE 3HO7A 2DE2A 1Y20A 4XTCQ 1JVXA 1QUIA 4NF4B 3Q28A 1FQDA 2XHDA 3E13X 4C1UA 3RTWB 1ZKBA 4OENA 4F18A 4GL0A 5TU0A 4FECA 3N6UA 3T9UA 2DSFA 3USDA 4FORA 2OWTA 4HCWA 2I0CA 4ZEFA 2RC8A 4YKPA 3ECRA 4NF6A 1Z7ME 3Q26A 3Q25A 2THIA 3PGFA 2PYYA 2Z8EA 3CG1A 3VLVA 3DRFA 2OZZA 2ZNUA 5EYFA 1Q1KA 3OSRA 1M5BA 3O6HA 4I8CA 5FHOA 1SW5A 2Q9TA 4QSEA 4NE4A 1P1OA 1XT8A 3S9MC 4JWYA 4DXBA 3RT6B 4K3FA 4R74A 3UP9A 2WOKA 3LR1A 1H3DA 1MPCA 1S9TA 3I6VA 3IK6B 1VFEA 1DPPA 5KZTA 3PD8A 2ZNSA 4JWOA 3RY3A 3K1PA 4Q8RA 3QXMA 4F39A 4OEUA 2F7CA 2XXXA 3EN3A 3HV1A 4WEDA 3K6UA 2W7YA 3IB2A 1N7XA 2F36A 2UYEA 1B7UA 2Q2CA 4U4XA 5ITOA 3MP8A 1OQHA 4UA8A 4UACA 1M5FA 1N04A 4XKNA 4IO3A 4U1OA 1BTJA 3D4GA 2OLBA 1CE2A 3LUYA 4IO6A 5I57B 3JV9A 1VFDA 4JB7A 4ELQA 3T9XB 1HSEA 4XXUA 2UXAA 1GVCA 4OESA 4E0WA 3LSFB 2XXTA 1B46A 3S9EA 3QUFA 3TDJA 2WOPA 3CR9A 3IX1A 3PMWA 3AXFA 4F1YA 2I4CA 1POTA 4GLIA 2NOOA 3C31A 2OCUA 4JDFA 1A54A 4ZZAA 1MXXA 5CBRA 1B3EA 5FTIA 1NNFA 1XS5A 2ZYMA 2HAUA 1AOVA 1NKXA 4BDQA 4ZEKA 3VLWA 4ZEDA 2ALUA 3P7IA 1OIBA 5FTHA 3DRGA 1MDP1 4KPTA 3IOWA 4IB2A 1TFAA 2VOZA 3TEPA 3CSBA 2P2AA 4DLDA 1MY2A 3KEIA 4GVOA 5AE4A 3QUJA 5DYHA 1GTKA 3MQ9A 4OTEA 1MQIA 3U94A 5A5XB 2REJA 3K6WA 1PBQA 5H8QB 1SYIA 5ELVA 4LZ5A 3FASA 5H8FB 3TQLA 1B4HA 2RC7A 3TTRA 3G3GA 3DP6A 1FTJA 4NF8A 5I2NA 4TLMB 3C33A 4FEBA 3UN6A 4ONYA 3QIMA 3IJOB 3N94A 1MDQA 1B5HA 3KOTA 2UVJA 4GF8A 1B0LA 5HM4B 3OO9A 4ND9A 4RXLA 4GWOA 1USYH 3HHFA 3MPLA 4ZDMA 2XXYA 3TAJA 3CI8A 5M2VA 5I2KA 2V3QA 3MZ9A 4U21A 1ZIUA 4DCXA 4POXA 4R6HA 4RPNA 3IO4A 4C0RA 4BDRA 1A55A 4IGTA 3R26A 4RK2A 3DRHA 2H4IA 3OEKA 1A7LA 3OD7A 1MXVA 4RY1A 3OSQA 4NF8B 2V25A 3RQTA 5HPQA 4N6PA 3JZJA 1MY0A 1IQ7A 3TTLA 4XKRA 3V83A 1FQCA 4R9FA 1AMFA 3EQ1A 1IIWA 1MM7A 1VR5A 3MUQA 2ANJA 3LVUA 4L17A 2F6PA 5I2KB 4DDDA 1Q35A 4NF5B 5B70A 1I6AA 1OMPA 5H8HA 3FUZA 1MXWA 3FJ7A 3N6TA 1AIVA 3A09A 4YZZA 2V84A 5CM6A 1FTMA 4BDLA 3O97A 4ZZEA 3MP6A 1EH3A 1P1UA 4KFQA 2DXRA 1SW2A 1DOTA 4H1XA 1NMUA 1BIYA 4QFOA 2H9BA 4YKJA 3ILUB 1PB8A 1A40A 3PD9A 4PE5B 1NNKA 3RTFB 2FYIA 4KQPA 1B52A 3S9NC 3V8XB 4PFUA 2Y7RA 4H5FA 2H99A 4R2FA 5H8HB 3IL1B 3TTMA 2I3VA 4QHQA
chains in the Genus database with same CATH superfamily
5FHNA 5ESYA 3U93A 1G0HA 4DZ1A 4HE1A 1LAXA 1US4A 4PFIA 2FBPA 3OEMA 1ZJLA 4MHFA 3RGYA 5ICTA 1FQAA 3M3FA 5LOMA 3FJMA 3KOSA 1MH3A 3H7MA 2MKZA 2R71A 3KFMA 2R9JA 4LZ7A 3N5LA 3KJTA 1I6QA 3KJ7A 4N15A 3RYDA 2XA5A 3FVNA 4YB7A 3KN3A 2QS3A 3FVOA 4PFYA 2AL4A 3SEUA 1MXYA 3D4CA 3G3FA 4PQJA 4OANA 3TKDA 2XXKA 4BLAA 3EHUA 2CZIA 5K2XA 3TZAA 1FJ9A 3T9HB 1TWYA 3C4MA 5IM2A 2XXQA 2KR0A 1RDZA 4RYAA 4FAJA 1LLSA 2I58A 3ZKKA 4GRKA 1NV2A 1ZBMA 1YAEA 5IKBA 4I62A 1M5DA 3L6HA 3UA8A 4NF4A 5ET8A 1P1NA 1R9QA 1B3FA 5LTCA 2CZLA 4O3AA 4N91A 3QAXA 3O29A 3W15C 2XXIA 4X04A 3RLFE 1FPBA 4R75A 3OENA 4RJZA 3RT8A 5KDTA 2FHYA 4Q0CA 2HZLA 2DYXA 4MCOA 3DP4A 3RPLB 1B6HA 2V3TA 1FPKA 2WYKA 4FE8A 4F1VA 3B8BA 3MJNA 2X7QA 2DE4A 4FBPA 2QRYA 2H5YA 5DEXB 1USYE 2F6GA 2QS2A 3H06B 5T3JA 1Y4CA 1LFIA 1FBEA 2XWOA 2UVGA 3PUXE 5CI5A 1IMEA 2Z23A 1T0KA 1H45A 4NWCA 3T9VA 2QPQA 4HS7A 4OERA 1PDAA 5H8NB 4JWXA 4PAFA 4N6KA 1ELJA 1B3HA 1OVTA 4MIJA 3PMVA 2F8DA 3VXCA 5KDTB 1J1NA 4HCYA 4N13A 2O7UA 2CEXA 2ZYNA 2RF1A 2XXUA 1O64A 5I84A 5AA4B 1US5A 4OEVA 2HFBA 4ELOA 3G3KA 5TP9A 2I48A 1Y3NA 2A5SA 1URSA 4NTLA 1XVXA 3U92A 1VDWA 1JW1A 2ZZVA 4MFIA 1DBZA 1MRPA 2ONKE 1SD3A 4N4UA 5I59B 3EF7A 1PBPA 4X1DA 4PFWA 1D9YA 3CFLA 4KR5A 3OOAA 2XWVA 4NEDA 5JEIA 3U72A 1MS7A 2WBBA 3C34A 5EYHA 2F34A 2B3FA 5I3SA 3W9WA 3MPKA 5FHMA 4NG7A 1NV4A 4EDPA 4EXKA 3IO6A 1FW0A 4YU0A 1MQHA 5CMMA 5I57A 1FTOA 3T22A 3G3HA 2ZZXA 1IMFA 4WEPA 2DWJA 4JXIA 1I69A 3CRBA 3T93B 1LBXA 4H65A 1VE4A 1A8FA 5TP9B 3KN8A 1Q9DA 2Y7IA 1ZTYA 4H8IA 2NUVA 2FIEA 4PBQA 2HEUA 4EQBA 2B4MA 4YICA 4ESXA 2GH9A 2CZKA 1B3GA 2NVUB 5ET5A 3IOTA 3MVXA 2QSXA 5CMBA 4YMBA 1KA0A 3O6IA 5ISUA 2PFYA 2JJKA 3VVEA 1BKAA 3GBAA 1QKAA 3E3KA 4P0IA 3V5AA 3UIFA 2R8TA 4GWSA 2YPNA 1UIVA 4H8JA 1QGXA 3W9VA 4HW8A 3RYBA 1GGGA 5L9SA 3VFJA 1D3KA 3OO7A 2AL5A 4UABA 1NH7A 4FATA 4OVJA 1M5CA 4PETA 1WODA 1B58A 1UTHB 3GYYA 4LUBA 4NAPA 4Z0IA 3MVZA 4WKMA 4IO2A 3FVKA 5A5XA 2E0SA 5H8QA 4OZ9A 2DQVA 2DOJA 4RNSA 5H8FA 2XXWA 4GX3A 3GLBA 3G7WA 1Y1ZA 4N6DA 4FIMA 4YMAA 3PUYE 4X48A 2Y7KA 4QFKA 2I0BA 4N07A 4HE0A 2RC9A 1FTAA 2REGA 3ODBA 4PAIA 2OX3A 3KZGA 1LBYA 1LCFA 3PMXA 3TYHA 4JVDA 4U2RA 4EUOA 3A29A 2F3BA 4R6YA 3KBRA 4PF8A 3BFTA 3ROJA 4LVQA 2G29A 3SEVA 2O84X 2DS9A 2P0SA 1XHYA 2O69A 4H5GA 5AA2D 4IGRA 1EYIA 1OLCA 3UORA 4MNPA 1B4ZA 5H8SA 4AQ4A 1B1HA 4G8NA 4I40A 3SEXA 4E0XA 3HN0A 2DVZA 4OQOA 1B0HA 2ZNTA 3C35A 4F2QA 2VP1A 3O2AA 3ISPA 2HAVA 4G2ZA 3MC2A 4P9KA 1LFGA 1LCTA 4GX4A 3QK6A 1NUXA 5EQAA 3U8QA 3PV0E 4MJOA 2X7PA 4G68C 1FPDA 4LATA 2DWHA 4MAGA 1KZ8A 3QYTA 1IXHA 2HPGA 1ATGA 1MG1A 4NF5A 4O3CA 3M3KA 3KC1A 4R6KA 2Y7WA 4DXCA 1RYOA 3FATA 4PDHA 2O1MA 4XFEA 2WYPA 3A3UA 3DM0A 3CG3A 1L5TA 4KYSA 3LBSA 3BKIB 1N84A 1HSJA 4IR8A 5CMKA 2ZZWA 3RUMA 4OWDA 3H4ZA 3D1RA 5EQ9A 2Y5LA 4ECFA 1MH4A 4QFPA 2F5XA 3KC0A 4F3GA 3LSLA 1NH8A 2CEYA 3ZS6A 1F9BA 3GZGA 3MWBA 1SW4A 3B6QA 3N26A 1GR2A 5IAIA 2DP8A 3EPEA 4GBVA 3WAFA 4R73A 1IEJA 3HPIA 5CRYA 1UTBA 1SPIA 2Z8FA 3PUWE 1EZOA 3GXAA 3MAMA 3PPNA 4ZE8A 4PBHA 3RN8A 4PAKA 1HSLA 2B4LA 3A3CA 4N17A 3FIRA 4MF3A 2E1SA 1KWHA 1SQYA 1R6ZA 3THIA 3H3GA 1ZMGA 4LQ5A 3RPWA 5F1QA 1POY1 5L8DA 3H6UA 3TQWA 4PFBA 4X9TA 1JW5A 3CSGA 2I49A 2XX9A 2I6EA 4X8RA 4NQ8A 2G93A 1O7TA 3Q29A 2GHAA 1OLAA 5JTYA 3VVDA 4ESWA 5I56B 1UTBB 5AA2B 1YCJA 2O6AA 3B50A 4R72A 1B7HA 4XKPA 4HTGA 1FBFA 3O6GA 3VLUA 5F24A 1S50A 2UVIA 4M4GA 4F22A 4THIA 4YB6A 3VE1B 3PPPA 3E4RA 4GWZA 1XOCA 2KLFA 4LZ8A 4POWA 2A5TB 4P8BA 2AYSA 1I6BA 2FIXA 3T1BA 1RKMA 3TCGA 4OXVA 1S7YA 4IO4A 2F35A 2ABHA 1II5A 3MW0A 5F7VA 3B7DA 5KCJB 5IZZA 2HXWA 3GBBA 2ZMBA 4EQ7A 1P99A 4MH5A 1MQJA 1YXIA 4XKQA 4JVIA 3RPLA 1VSOA 1DSNA 2ZXTA 2Z8DA 5JTYB 1DPEA 3SETA 1SW1A 5DEXA 1DCUA 3LUZA 4RK9A 1FSAA 2WEFA 3KSJA 4MMPA 4ZEBA 1NFTA 4GWWA 3HSTA 2O51A 3K6VA 1FTKA 4OFJA 2CMOA 1LAGE 4ISUA 4OHNA 4F29A 3SEWA 1B3LA 3KN7A 4Q30B 4G61A 4GOTA 4ELPA 2WOLA 1B51A 2D21A 3VDFA 2QL3A 5H8NA 1D9VA 4OA4A 3H6WA 3OELA 3DRIA 3MVWA 4HXVA 1EYJA 1LBBA 5ITPA 4KXPA 2QS4A 4GL8A 2LAOA 1K9ZA 5AA4A 5ICQA 4MBPA 3ZKLA 3H6TA 2L5VA 1NI9A 4I9DA 1D4NA 2OJTA 4GWYA 2VD3A 1QJMA 1LBVA 3QSLA 2V93A 3FJGA 3T96B 3TMGA 1GV8A 5I59A 4YB5A 4ELRA 1QW0A 2D5WA 4LA9A 2FA7A 1ANFA 1EU8A 4P0GA 3PUZE 1H76A 3EHTA 3DRJA 2F78A 4U23A 2Y5KA 1H43A 4G4PA 1SI1A 1MPDA 4QFLA 3HHGA 3HFUA 1MY3A 1MPBA 3O6PA 2QMXA 4ZECA 1PEBA 1QVSA 3S4UA 2HCAA 1Y3QA 2XD2A 1UQWA 3IAZA 4F1UA 1PC3A 4U22A 5TPAB 2BJJX 4G8HA 3MP1A 3IFCA 3CVGA 2RCBA 4QFNA 3FV1A 2QVVA 4AS5A 2VHAA 1XVYA 4YKKA 2XXVA 4OYVA 4XEQA 1QULA 3K02A 3OO6A 3RNNA 1URGA 2RCAA 1LBWA 2XX8A 3O66A 1MY1A 1LBZA 4OMBA 2B3BA 1INPA 2Y7PA 5FBPA 3S9LC 2XD3A 1UTHA 1PB9A 1EZ9A 2V4CA 2FNCA 3B6WA 5DVJA 1JEVA 4GWUA 1R1NA 1N0TA 3KSXA 2F7BA 3LC8A 3SEYA 4O7MA 5L9OA 3IOUA 3TCFA 3S2VA 3OMBA 3TFLA 1SI0A 3V89B 1DTZA 1WDNA 3FXRA 3CHGA 5IGAA 1SBPA 4NF6B 1LB8A 2DE3A 1NNTA 3SDFA 3R6UA 4G68A 4R2BA 4AB6A 3E9XA 2PMSA 3M3LA 3PPQA 4PGPA 2QJEA 4OFOA 4HE2A 3Q27A 4O8MA 1OVBA 1FTLA 4F3SA 3BIGA 1P1QA 1A99A 3MVYA 2V3UA 1H44A 3K4UA 2PX1A 4BDNA 4MLVA 5DVFA 3E78A 1NV6A 2P3VA 3KGCA 3U65A 2P1SA 3SERA 3TPAA 2I3WA 2PVUA 4F19A 3FXQA 2Y84A 4PGNA 4I3YA 1XC1A 3SZPA 2VGQA 5HBCA 4U4SA 3WAEA 1AWBA 5LDZA 1TFDA 1QUKA 2PCRA 4O3BA 1JEUA 4G68B 1IXGA 3CFXA 4GWXA 1B40A 4YKIA 1MXZA 1Y3PA 5EHSA 1JVYA 3UGWA 1MXUA 4BDMA 3K00A 1N76A 2WKYA 3OXNA 4ZEIA 3OO8A 1N3WA 1B5IA 4BDOA 4DI3D 2M8CA 4Z7EA 1BLFA 1FRPA 4QXDA 2OK2A 1LAHE 3I5OA 2DWIA 2GFEA 5JK4A 1IITA 2PT1A 4C1TA 4DXUA 1MQGA 2RKMA 4GXAA 3MZBA 2IEEA 4H6DA 4LONB 4F2OA 2O68A 4GQOA 2Q89A 5CC2A 4PP0A 1B7ZA 4XIGQ 1JW4A 3K6XA 4MLQA 3VXBA 2QMWA 2XXRA 3I3VA 1XI6A 3H03A 3TELA 5CBSA 2FVZA 2QS1A 4QSDA 4RPOA 2RINA 5CMCA 1JNFA 4DIGA 1TT1A 3G3JA 4MX6A 3MZ1A 1SDXA 3E79A 2WBDA 2VPOA 3G3IA 4MNIA 4KYEA 1PB7A 3K0VA 3PTYA 1DTGA 3FVGA 3FGSA 3LSWA 3FTOA 3ZSFA 1FBDA 1IZ1A 4R9GA 1A8EA 3F11A 1ZLQA 3TODA 2QVRA 3PPOA 1NUZA 4JBZA 2F97A 3PAMA 3K1MA 1JQFA 4GIZA 1M5EA 1WVJA 2Z22A 1JETA 4FEDA 3DELB 2UVHA 3C32A 5L9MA 2HQ0A 1NL5A 4IO7A 4MNCA 4NX1A 3HCQA 2I4BA 2B65A 3BBRA 3IORA 1AL3A 4OVTA 1NV7A 3MYUA 4G77A 4TOZA 2HZKA 3FV2A 4MEVA 2OWSA 3UK4A 4ZS9A 4PTKA 3LSXA 2ZYOA 4YAHX 1D9QA 2XXHA 2O1LA 2ZYKA 3NOHA 4LQ2A 1CB6A 2GHBA 5DT6A 1RYXA 1B5JA 1LB9A 4O94A 5I2NB 1O63A 2ONRA 5J16A 1B2HA 2ESNA 2D3IA 2YLNA 4OVQA 5I56A 1SYHA 5J1DA 2DVCA 5AA2A 1URDA 5I58A 1QUJA 2ONSA 3IR1A 1JP4A 4EF1A 1QKBA 1BP5A 1OQGA 2OWZA 4QF9A 4P47A 1FBGA 2VD2A 2DDKA 3SESA 2WX9A 4ZE9A 1IUDA 2DWAA 2A5TA 4TQUQ 5DTBA 3ILTB 3TTNA 1FCKA 4P1EA 5EQ7A 4QSCA 4PFTA 5KCJA 3ONMA 1NNPA 1P1WA 3C9HA 2H25A 1Z7NE 4LP2B 4GXSB 4F3BA 3FZVA 4PFRA 2OBGA 3H6VA 2YJPA 4GX6A 4KYDA 2NWJA 4M1VA 3CFZA 2X26A 5BUUA 1DK4A 1YTVA 4NMYA 4KI0E 3KG2A 2XXPA 1FPGA 2R6GE 3B6TA 3FD3A 4QRZA 1YPNA 3TTKA 3FBPA 3EHSA 5DVIA 3IB0A 4KD5A 1B05A 4I1DA 5I58B 4OVRA 1B9JA 1ZU0A 4F31B 2Q8JA 3O9PA 1MQDA 1IMBA 1RDXA 2QVUA 3IB1A 3M8UA 1FQEA 1LAFE 5B7DA 3K1NA 4KCCA 1Y4TA 4Q5TA 3R7XA 2HXRA 4WXJA 1IMAA 2XX7A 2BJIA 2Q2AA 4JSDA 2PT2A 5I5PA 4JVCA 4FJPA 2XWKA 3SKPA 4X1BA 4EF2A 3BFUA 3T66A 3C36A 3VV5A 1FPFA 4OVPA 1MM6A 4GD5A 4NHBA 4KCDA 3MBPA 1R9LA 3FXUA 5AA3A 1AH5A 1FBHA 1UIUA 4IY5A 2H98A 1IMDA 1N7WA 1EZPA 3K2DA 4DE8A 3DRKA 2F3DA 5ET7A 3PPRA 5AA1A 1IXIA 4NWDA 1N3XA 1IXCA 3O28A 2GRVA 2PBWA 4O7IA 4OETA 2AIXA 1FQBA 1B32A 4U1ZA 3L6GA 3JYRA 4PC9A 3RYAA 5K2YA 4H0WA 4F3PA 5DW8A 4AB5A 2O7IA 4EQ9A 4IO5A 4G8MA 4PE3A 2IA4A 4IY6A 2UYFA 3PUVE 1SVXB 1LBCA 1G0IA 3IOVA 3KBZA 2GQ1A 4RA1A 3DP8A 3K01A 3TUSA 1FQFA 1KA1A 1DMBA 4JSOA 2NXOA 3EKIA 3VVFA 1Y1MA 3FXBA 3U1OA 3TCHA 5TPAA 5I7IA 1LSTA 1TXFA 4I3EA 1K9YA 4N8YA 4N8GA 2Q88A 3CIJA 2F7AA 1Y9UA 1B1XA 1MY4A 3DLNA 3IJXB 3PU5A 1LFHA 2DXYA 1LGBC 1FPIA 4OFLA 4TLLB 4DCYA 5EHMA 4GFRA 4P11A 1RDYA 5BWJA 4EXLA 4H67A 4KHZE 3HO7A 2DE2A 1Y20A 4XTCQ 1JVXA 1QUIA 4NF4B 3Q28A 1FQDA 2XHDA 3E13X 5IZ3A 4C1UA 3RTWB 1ZKBA 4OENA 4F18A 4GL0A 5TU0A 4FECA 3N6UA 1NUYA 3T9UA 2DSFA 3USDA 4FORA 2OWTA 4HCWA 1EYKA 3IFAA 2I0CA 4ZEFA 2RC8A 4YKPA 3ECRA 4NF6A 1Z7ME 3Q26A 1FPJA 3Q25A 2THIA 3PGFA 2PYYA 2Z8EA 3CG1A 3VLVA 1FBPA 3DRFA 2OZZA 4QBAA 2KQZA 2ZNUA 5EYFA 1Q1KA 3OSRA 1NUWA 1M5BA 3O6HA 4P56A 4I8CA 5FHOA 1SW5A 2Q9TA 4QSEA 4NE4A 1P1OA 1XT8A 5IZ3B 3T0JA 3S9MC 4JWYA 1YYZA 4DXBA 3RT6B 4K3FA 4R74A 3UP9A 3QMFA 2WOKA 3LR1A 1H3DA 1MPCA 1S9TA 3I6VA 1BK4A 3IK6B 1VFEA 1DPPA 5KZTA 3PD8A 2ZNSA 4JWOA 3RY3A 3K1PA 4Q8RA 3QXMA 4F39A 4OEUA 2F7CA 2XXXA 3EN3A 3HV1A 4WEDA 3K6UA 2W7YA 3IB2A 1N7XA 4P1LA 1CNQA 2F36A 2UYEA 1B7UA 2Q2CA 4U4XA 5ITOA 3MP8A 1OQHA 4NGUA 4UA8A 4UACA 1M5FA 1N04A 4XKNA 4IO3A 4P3LA 4U1OA 1BTJA 3D4GA 2OLBA 1CE2A 3LUYA 4IO6A 5I57B 3JV9A 1VFDA 4JB7A 5EYGA 4ELQA 3T9XB 2PFZA 1HSEA 4XXUA 3BIHA 2UXAA 1GVCA 4OESA 4E0WA 3LSFB 2XXTA 4NN3A 1B46A 3S9EA 3QUFA 3TDJA 2WOPA 3CR9A 3IX1A 3PMWA 4PF6A 3AXFA 4F1YA 2I4CA 5ET6A 1IMCA 1POTA 4GLIA 2NOOA 3C31A 2OCUA 4JDFA 1A54A 4ZZAA 1MXXA 2VPNA 4PCDA 5CBRA 1B3EA 5FTIA 1NNFA 1XS5A 2ZYMA 2HAUA 1AOVA 1NKXA 4BDQA 3LV0A 4ZEKA 3VLWA 4ZEDA 2ALUA 3P7IA 1OIBA 1NV0A 5FTHA 3DRGA 1MDP1 4KPTA 3IOWA 4IB2A 1TFAA 2VOZA 3TEPA 3CSBA 2P2AA 4DLDA 1MY2A 3KEIA 4GVOA 5AE4A 2Q8MA 3QUJA 5DYHA 1GTKA 3MQ9A 4OTEA 1MQIA 3U94A 1FBCA 5A5XB 2REJA 3K6WA 1PBQA 5H8QB 1SYIA 5ELVA 4LZ5A 3FASA 5A5LA 5H8FB 3TQLA 1LEVA 1B4HA 2RC7A 3TTRA 3G3GA 1NV5A 3DP6A 1FTJA 4NF8A 5IZ1A 5I2NA 4TLMB 3C33A 4FEBA 3UN6A 2Q74A 4ONYA 3QIMA 3IJOB 3N94A 1MDQA 4GBWA 1B5HA 3KOTA 2P3NA 2UVJA 4GF8A 1B0LA 5HM4B 3OO9A 4ND9A 4RXLA 4XF5A 4GWOA 1USYH 3HHFA 2QFLA 3MPLA 4ZDMA 2CZHA 2XXYA 3TAJA 3CI8A 5M2VA 5I2KA 2V3QA 3MZ9A 4U21A 1ZIUA 4DCXA 4POXA 4R6HA 4RPNA 3IO4A 4C0RA 4BDRA 1A55A 4IGTA 3R26A 4RK2A 3DRHA 2H4IA 3OEKA 1A7LA 3OD7A 1MXVA 4RY1A 3OSQA 4NF8B 1YZ0A 2V25A 3RQTA 5HPQA 4N6PA 2XWIA 3JZJA 1MY0A 1IQ7A 3TTLA 4XKRA 3V83A 4LN5A 1FQCA 4R9FA 1AMFA 3EQ1A 1IIWA 1NV1A 1MM7A 1VR5A 3MUQA 2ANJA 3LVUA 4L17A 2F6PA 3MSTA 5I2KB 4DDDA 1Q35A 2VT5A 4NF5B 4N81A 5B70A 4DI4B 1I6AA 1OMPA 5H8HA 3FUZA 4NF0A 1MXWA 3FJ7A 3N6TA 1AIVA 3A09A 1FPLA 4OVSA 4YZZA 2V84A 1FPEA 5CM6A 1FTMA 4BDLA 3O97A 4ZZEA 5EQ8A 3MP6A 1EH3A 1P1UA 4KFQA 2DXRA 1SW2A 1DOTA 2HHMA 4H1XA 1NMUA 1BIYA 4QFOA 2H9BA 4YKJA 4H46A 1FJ6A 3ILUB 1PB8A 1A40A 4PDDA 3PD9A 4PE5B 4H45A 1NNKA 3RTFB 1NV3A 2FYIA 4KQPA 1B52A 3S9NC 3V8XB 4PFUA 2Y7RA 4H5FA 2H99A 4R2FA 5H8HB 3IL1B 4AS4A 3TTMA 2I3VA 4QHQA
chains in the Genus database with same CATH topology
5FHNA 3U93A 4DZ1A 1LAXA 1US4A 3OEMA 1ZJLA 3RGYA 5ICTA 1FQAA 3M3FA 5LOMA 3FJMA 3KOSA 1MH3A 3H7MA 2R71A 3KFMA 2R9JA 4LZ7A 3N5LA 3KJTA 1I6QA 3KJ7A 3FVNA 4YB7A 3KN3A 2QS3A 3FVOA 4PFYA 2AL4A 3SEUA 1MXYA 3D4CA 3G3FA 4PQJA 3TKDA 4BLAA 3EHUA 5K2XA 3TZAA 3T9HB 1TWYA 3C4MA 2XXQA 4RYAA 4FAJA 1LLSA 2I58A 3ZKKA 4GRKA 1ZBMA 1YAEA 5IKBA 4I62A 1M5DA 3L6HA 3UA8A 4NF4A 1P1NA 1R9QA 1B3FA 2CZLA 4O3AA 3QAXA 3O29A 3W15C 2XXIA 3RLFE 4R75A 3OENA 4RJZA 3RT8A 5KDTA 4Q0CA 2HZLA 2DYXA 3DP4A 1B6HA 2V3TA 4FE8A 4F1VA 3MJNA 2X7QA 2DE4A 2QRYA 2H5YA 5DEXB 1USYE 2F6GA 2QS2A 3H06B 1Y4CA 1LFIA 2UVGA 3PUXE 5CI5A 2Z23A 1T0KA 1H45A 4NWCA 3T9VA 2QPQA 4HS7A 4OERA 1PDAA 5H8NB 4JWXA 1ELJA 1B3HA 1OVTA 3PMVA 2F8DA 3VXCA 5KDTB 1J1NA 4HCYA 4N13A 2O7UA 2ZYNA 2RF1A 2XXUA 1O64A 5I84A 5AA4B 1US5A 4OEVA 2HFBA 4ELOA 3G3KA 5TP9A 2I48A 1Y3NA 2A5SA 1URSA 4NTLA 1XVXA 3U92A 1JW1A 4MFIA 1MRPA 2ONKE 1SD3A 5I59B 3EF7A 1PBPA 4X1DA 4PFWA 1D9YA 3CFLA 4KR5A 3OOAA 4NEDA 5JEIA 3U72A 1MS7A 3C34A 2F34A 2B3FA 3W9WA 3MPKA 5FHMA 4EDPA 4EXKA 3IO6A 1FW0A 4YU0A 1MQHA 5CMMA 5I57A 1FTOA 3T22A 3G3HA 4WEPA 2DWJA 4JXIA 1I69A 3CRBA 3T93B 4H65A 1VE4A 1A8FA 5TP9B 3KN8A 2Y7IA 1ZTYA 4H8IA 2NUVA 2HEUA 4EQBA 2B4MA 4YICA 4ESXA 2GH9A 1B3GA 2NVUB 3IOTA 3MVXA 2QSXA 5CMBA 4YMBA 3O6IA 5ISUA 3VVEA 1BKAA 3GBAA 1QKAA 3E3KA 4P0IA 3V5AA 3UIFA 2YPNA 1UIVA 4H8JA 3W9VA 4HW8A 3RYBA 1GGGA 5L9SA 3VFJA 1D3KA 3OO7A 2AL5A 1NH7A 4FATA 4OVJA 1M5CA 4PETA 1WODA 1B58A 1UTHB 4LUBA 4Z0IA 3MVZA 4WKMA 4IO2A 3FVKA 5A5XA 2E0SA 5H8QA 4OZ9A 2DQVA 2DOJA 4RNSA 5H8FA 2XXWA 3GLBA 3G7WA 1Y1ZA 4FIMA 4YMAA 3PUYE 4X48A 2Y7KA 4QFKA 2I0BA 4N07A 2RC9A 2REGA 3ODBA 3KZGA 1LCFA 3PMXA 3TYHA 4U2RA 4EUOA 4R6YA 3KBRA 3BFTA 4LVQA 2G29A 3SEVA 2O84X 2DS9A 2P0SA 1XHYA 2O69A 4H5GA 5AA2D 4IGRA 1OLCA 3UORA 1B4ZA 5H8SA 4AQ4A 1B1HA 4G8NA 3SEXA 4E0XA 3HN0A 2DVZA 4OQOA 1B0HA 2ZNTA 3C35A 4F2QA 2VP1A 3O2AA 2HAVA 4G2ZA 3MC2A 1LFGA 1LCTA 3QK6A 3U8QA 3PV0E 2X7PA 4G68C 4LATA 2DWHA 3QYTA 1IXHA 1ATGA 1MG1A 4NF5A 4O3CA 3M3KA 4R6KA 2Y7WA 4DXCA 1RYOA 3FATA 2O1MA 3A3UA 3DM0A 3CG3A 1L5TA 4KYSA 3LBSA 3BKIB 1N84A 1HSJA 5CMKA 3RUMA 4OWDA 3H4ZA 4ECFA 1MH4A 4QFPA 2F5XA 4F3GA 3LSLA 1NH8A 3ZS6A 1F9BA 3GZGA 3MWBA 1SW4A 3B6QA 3N26A 1GR2A 5IAIA 2DP8A 3EPEA 3WAFA 4R73A 1IEJA 3HPIA 5CRYA 1UTBA 2Z8FA 3PUWE 1EZOA 3GXAA 3MAMA 3PPNA 4ZE8A 3RN8A 1HSLA 2B4LA 3A3CA 3FIRA 4MF3A 2E1SA 1KWHA 1SQYA 1R6ZA 3THIA 3H3GA 1ZMGA 4LQ5A 3RPWA 5F1QA 1POY1 5L8DA 3H6UA 3TQWA 4X9TA 1JW5A 3CSGA 2I49A 2XX9A 2I6EA 2G93A 1O7TA 3Q29A 2GHAA 1OLAA 5JTYA 3VVDA 4ESWA 5I56B 1UTBB 5AA2B 1YCJA 2O6AA 4R72A 1B7HA 4XKPA 4HTGA 3O6GA 3VLUA 1S50A 2UVIA 4M4GA 4F22A 4THIA 4YB6A 3VE1B 3PPPA 3E4RA 1XOCA 2KLFA 4LZ8A 4POWA 2A5TB 2AYSA 1I6BA 1RKMA 3TCGA 4OXVA 1S7YA 4IO4A 2F35A 2ABHA 1II5A 3MW0A 5F7VA 3B7DA 5KCJB 2HXWA 3GBBA 2ZMBA 4EQ7A 1P99A 4MH5A 1MQJA 4XKQA 1VSOA 1DSNA 2ZXTA 2Z8DA 5JTYB 1DPEA 3SETA 1SW1A 5DEXA 4RK9A 3KSJA 4ZEBA 1NFTA 3HSTA 2O51A 3K6VA 1FTKA 4OFJA 2CMOA 1LAGE 4ISUA 4OHNA 4F29A 3SEWA 1B3LA 3KN7A 4Q30B 4GOTA 4ELPA 2WOLA 1B51A 2D21A 3VDFA 2QL3A 5H8NA 1D9VA 3H6WA 3OELA 3DRIA 3MVWA 1LBBA 5ITPA 2QS4A 4GL8A 2LAOA 5AA4A 5ICQA 4MBPA 3ZKLA 3H6TA 4I9DA 1D4NA 2OJTA 2VD3A 1QJMA 3QSLA 2V93A 3FJGA 3T96B 3TMGA 1GV8A 5I59A 4YB5A 4ELRA 1QW0A 2D5WA 4LA9A 2FA7A 1ANFA 1EU8A 4P0GA 3PUZE 1H76A 3EHTA 3DRJA 2F78A 4U23A 1H43A 4G4PA 1SI1A 1MPDA 4QFLA 3HHGA 1MY3A 1MPBA 3O6PA 2QMXA 4ZECA 1PEBA 1QVSA 3S4UA 2HCAA 1Y3QA 2XD2A 1UQWA 3IAZA 4F1UA 1PC3A 4U22A 5TPAB 2BJJX 4G8HA 3MP1A 3CVGA 2RCBA 4QFNA 3FV1A 2VHAA 1XVYA 4YKKA 2XXVA 4OYVA 1QULA 3K02A 3OO6A 3RNNA 1URGA 2RCAA 2XX8A 3O66A 1MY1A 4OMBA 2B3BA 2Y7PA 3S9LC 2XD3A 1UTHA 1PB9A 1EZ9A 2FNCA 3B6WA 5DVJA 1JEVA 1R1NA 1N0TA 3KSXA 2F7BA 3LC8A 3SEYA 5L9OA 3IOUA 3TCFA 3S2VA 3OMBA 3TFLA 1SI0A 3V89B 1DTZA 1WDNA 3FXRA 3CHGA 1SBPA 4NF6B 1LB8A 2DE3A 1NNTA 3SDFA 3R6UA 4G68A 4R2BA 4AB6A 3E9XA 2PMSA 3M3LA 3PPQA 2QJEA 4OFOA 3Q27A 1OVBA 1FTLA 4F3SA 1P1QA 1A99A 3MVYA 2V3UA 1H44A 3K4UA 2PX1A 4BDNA 4MLVA 5DVFA 3KGCA 2P1SA 3SERA 3TPAA 2I3WA 2PVUA 4F19A 3FXQA 2Y84A 1XC1A 2VGQA 5HBCA 4U4SA 3WAEA 1TFDA 1QUKA 4O3BA 1JEUA 4G68B 1IXGA 3CFXA 1B40A 4YKIA 1MXZA 1Y3PA 5EHSA 1JVYA 3UGWA 1MXUA 4BDMA 3K00A 1N76A 2WKYA 3OXNA 4ZEIA 3OO8A 1N3WA 1B5IA 4BDOA 2M8CA 4Z7EA 1BLFA 2OK2A 1LAHE 3I5OA 2DWIA 2GFEA 5JK4A 1IITA 2PT1A 4C1TA 4DXUA 1MQGA 2RKMA 4GXAA 3MZBA 2IEEA 4H6DA 4LONB 4F2OA 2O68A 4GQOA 2Q89A 5CC2A 4PP0A 1B7ZA 4XIGQ 1JW4A 3K6XA 4MLQA 3VXBA 2QMWA 2XXRA 3I3VA 3H03A 3TELA 5CBSA 2QS1A 4QSDA 4RPOA 2RINA 5CMCA 1JNFA 4DIGA 1TT1A 3G3JA 3MZ1A 1SDXA 3G3IA 4KYEA 1PB7A 3K0VA 1DTGA 3FVGA 3FGSA 3LSWA 3FTOA 3ZSFA 1IZ1A 4R9GA 1A8EA 3F11A 1ZLQA 3TODA 3PPOA 4JBZA 2F97A 3PAMA 3K1MA 1JQFA 4GIZA 1M5EA 1WVJA 2Z22A 1JETA 4FEDA 3DELB 2UVHA 3C32A 5L9MA 2HQ0A 1NL5A 4IO7A 3HCQA 2I4BA 2B65A 3BBRA 3IORA 1AL3A 4G77A 4TOZA 2HZKA 3FV2A 3UK4A 2OWSA 4ZS9A 3LSXA 2ZYOA 4YAHX 2XXHA 2O1LA 2ZYKA 4LQ2A 1CB6A 2GHBA 5DT6A 1RYXA 1B5JA 1LB9A 5I2NB 1O63A 2ONRA 1B2HA 2ESNA 2D3IA 2YLNA 5I56A 1SYHA 5J1DA 2DVCA 5AA2A 1URDA 5I58A 1QUJA 2ONSA 3IR1A 4EF1A 1QKBA 1BP5A 1OQGA 4QF9A 2VD2A 3SESA 4ZE9A 1IUDA 2DWAA 2A5TA 4TQUQ 5DTBA 3ILTB 3TTNA 1FCKA 4QSCA 4PFTA 5KCJA 3ONMA 1NNPA 1P1WA 3C9HA 2H25A 1Z7NE 4LP2B 4GXSB 4F3BA 3FZVA 2OBGA 3H6VA 2YJPA 4KYDA 2NWJA 4M1VA 3CFZA 2X26A 5BUUA 1YTVA 4NMYA 4KI0E 3KG2A 2XXPA 3FD3A 2R6GE 3B6TA 4QRZA 1YPNA 3TTKA 3EHSA 5DVIA 3IB0A 4KD5A 1B05A 4I1DA 5I58B 1B9JA 1ZU0A 4F31B 2Q8JA 3O9PA 1MQDA 3IB1A 3M8UA 1FQEA 1LAFE 5B7DA 3K1NA 4KCCA 1Y4TA 4Q5TA 3R7XA 4WXJA 2XX7A 2Q2AA 4JSDA 2PT2A 4FJPA 3SKPA 4X1BA 4EF2A 3BFUA 3T66A 3C36A 3VV5A 1MM6A 4GD5A 4KCDA 3MBPA 1R9LA 3FXUA 5AA3A 1AH5A 1UIUA 4IY5A 2H98A 1N7WA 1EZPA 3K2DA 4DE8A 3DRKA 3PPRA 5AA1A 1IXIA 4NWDA 1N3XA 1IXCA 3O28A 2GRVA 2PBWA 4OETA 2AIXA 1FQBA 1B32A 4U1ZA 3L6GA 3JYRA 3RYAA 5K2YA 4H0WA 4F3PA 4AB5A 2O7IA 4EQ9A 4IO5A 4G8MA 2IA4A 4IY6A 2UYFA 3PUVE 1SVXB 1LBCA 3IOVA 4RA1A 3DP8A 3K01A 3TUSA 1FQFA 1DMBA 4JSOA 2NXOA 3VVFA 1Y1MA 3U1OA 3TCHA 5TPAA 1LSTA 1TXFA 2Q88A 3CIJA 2F7AA 1Y9UA 1B1XA 1MY4A 3DLNA 3IJXB 3PU5A 1LFHA 2DXYA 1LGBC 4OFLA 4TLLB 4DCYA 5EHMA 4GFRA 4P11A 5BWJA 4EXLA 4H67A 4KHZE 3HO7A 2DE2A 1Y20A 4XTCQ 1JVXA 1QUIA 4NF4B 3Q28A 1FQDA 2XHDA 3E13X 4C1UA 3RTWB 1ZKBA 4OENA 4F18A 4GL0A 5TU0A 4FECA 3N6UA 3T9UA 2DSFA 3USDA 4FORA 2OWTA 4HCWA 2I0CA 4ZEFA 2RC8A 4YKPA 3ECRA 4NF6A 1Z7ME 3Q26A 3Q25A 2THIA 3PGFA 2PYYA 2Z8EA 3CG1A 3VLVA 3DRFA 2OZZA 2ZNUA 5EYFA 1Q1KA 3OSRA 1M5BA 3O6HA 4I8CA 5FHOA 1SW5A 2Q9TA 4QSEA 4NE4A 1P1OA 1XT8A 3S9MC 4JWYA 4DXBA 3RT6B 4K3FA 4R74A 3UP9A 2WOKA 3LR1A 1H3DA 1MPCA 1S9TA 3I6VA 3IK6B 1VFEA 1DPPA 5KZTA 3PD8A 2ZNSA 4JWOA 3RY3A 3K1PA 4Q8RA 3QXMA 4F39A 4OEUA 2F7CA 2XXXA 3EN3A 3HV1A 4WEDA 3K6UA 2W7YA 3IB2A 1N7XA 2F36A 2UYEA 1B7UA 2Q2CA 4U4XA 5ITOA 3MP8A 1OQHA 4UA8A 4UACA 1M5FA 1N04A 4XKNA 4IO3A 4U1OA 1BTJA 3D4GA 2OLBA 1CE2A 3LUYA 4IO6A 5I57B 3JV9A 1VFDA 4JB7A 4ELQA 3T9XB 1HSEA 4XXUA 2UXAA 1GVCA 4OESA 4E0WA 3LSFB 2XXTA 1B46A 3S9EA 3QUFA 3TDJA 2WOPA 3CR9A 3IX1A 3PMWA 3AXFA 4F1YA 2I4CA 1POTA 4GLIA 2NOOA 3C31A 2OCUA 4JDFA 1A54A 4ZZAA 1MXXA 5CBRA 1B3EA 5FTIA 1NNFA 1XS5A 2ZYMA 2HAUA 1AOVA 1NKXA 4BDQA 4ZEKA 3VLWA 4ZEDA 2ALUA 3P7IA 1OIBA 5FTHA 3DRGA 1MDP1 4KPTA 3IOWA 4IB2A 1TFAA 2VOZA 3TEPA 3CSBA 2P2AA 4DLDA 1MY2A 3KEIA 4GVOA 5AE4A 3QUJA 5DYHA 1GTKA 3MQ9A 4OTEA 1MQIA 3U94A 5A5XB 2REJA 3K6WA 1PBQA 5H8QB 1SYIA 5ELVA 4LZ5A 3FASA 5H8FB 3TQLA 1B4HA 2RC7A 3TTRA 3G3GA 3DP6A 1FTJA 4NF8A 5I2NA 4TLMB 3C33A 4FEBA 3UN6A 4ONYA 3QIMA 3IJOB 3N94A 1MDQA 1B5HA 3KOTA 2UVJA 4GF8A 1B0LA 5HM4B 3OO9A 4ND9A 4RXLA 4GWOA 1USYH 3HHFA 3MPLA 4ZDMA 2XXYA 3TAJA 3CI8A 5M2VA 5I2KA 2V3QA 3MZ9A 4U21A 1ZIUA 4DCXA 4POXA 4R6HA 4RPNA 3IO4A 4C0RA 4BDRA 1A55A 4IGTA 3R26A 4RK2A 3DRHA 2H4IA 3OEKA 1A7LA 3OD7A 1MXVA 4RY1A 3OSQA 4NF8B 2V25A 3RQTA 5HPQA 4N6PA 3JZJA 1MY0A 1IQ7A 3TTLA 4XKRA 3V83A 1FQCA 4R9FA 1AMFA 3EQ1A 1IIWA 1MM7A 1VR5A 3MUQA 2ANJA 3LVUA 4L17A 2F6PA 5I2KB 4DDDA 1Q35A 4NF5B 5B70A 1I6AA 1OMPA 5H8HA 3FUZA 1MXWA 3FJ7A 3N6TA 1AIVA 3A09A 4YZZA 2V84A 5CM6A 1FTMA 4BDLA 3O97A 4ZZEA 3MP6A 1EH3A 1P1UA 4KFQA 2DXRA 1SW2A 1DOTA 4H1XA 1NMUA 1BIYA 4QFOA 2H9BA 4YKJA 3ILUB 1PB8A 1A40A 3PD9A 4PE5B 1NNKA 3RTFB 2FYIA 4KQPA 1B52A 3S9NC 3V8XB 4PFUA 2Y7RA 4H5FA 2H99A 4R2FA 5H8HB 3IL1B 3TTMA 2I3VA 4QHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FHN A;  3U93 A;  4DZ1 A;  1LAX A;  1US4 A;  3OEM A;  1ZJL A;  3RGY A;  5ICT A;  1FQA A;  3M3F A;  5LOM A;  3FJM A;  3KOS A;  1MH3 A;  3H7M A;  2R71 A;  3KFM A;  2R9J A;  4LZ7 A;  3N5L A;  3KJT A;  1I6Q A;  3KJ7 A;  3FVN A;  4YB7 A;  3KN3 A;  2QS3 A;  3FVO A;  4PFY A;  2AL4 A;  3SEU A;  1MXY A;  3D4C A;  3G3F A;  4PQJ A;  3TKD A;  4BLA A;  3EHU A;  5K2X A;  3TZA A;  3T9H B;  1TWY A;  3C4M A;  2XXQ A;  4RYA A;  4FAJ A;  1LLS A;  2I58 A;  3ZKK A;  4GRK A;  1ZBM A;  1YAE A;  5IKB A;  4I62 A;  1M5D A;  3L6H A;  3UA8 A;  4NF4 A;  1P1N A;  1R9Q A;  1B3F A;  2CZL A;  4O3A A;  3QAX A;  3O29 A;  3W15 C;  2XXI A;  3RLF E;  4R75 A;  3OEN A;  4RJZ A;  3RT8 A;  5KDT A;  4Q0C A;  2HZL A;  2DYX A;  3DP4 A;  1B6H A;  2V3T A;  4FE8 A;  4F1V A;  3MJN A;  2X7Q A;  2DE4 A;  2QRY A;  2H5Y A;  5DEX B;  1USY E;  2F6G A;  2QS2 A;  3H06 B;  1Y4C A;  1LFI A;  2UVG A;  3PUX E;  5CI5 A;  2Z23 A;  1T0K A;  1H45 A;  4NWC A;  3T9V A;  2QPQ A;  4HS7 A;  4OER A;  1PDA A;  5H8N B;  4JWX A;  1ELJ A;  1B3H A;  1OVT A;  3PMV A;  2F8D A;  3VXC A;  5KDT B;  1J1N A;  4HCY A;  4N13 A;  2O7U A;  2ZYN A;  2RF1 A;  2XXU A;  1O64 A;  5I84 A;  5AA4 B;  1US5 A;  4OEV A;  2HFB A;  4ELO A;  3G3K A;  5TP9 A;  2I48 A;  1Y3N A;  2A5S A;  1URS A;  4NTL A;  1XVX A;  3U92 A;  1JW1 A;  4MFI A;  1MRP A;  2ONK E;  1SD3 A;  5I59 B;  3EF7 A;  1PBP A;  4X1D A;  4PFW A;  1D9Y A;  3CFL A;  4KR5 A;  3OOA A;  4NED A;  5JEI A;  3U72 A;  1MS7 A;  3C34 A;  2F34 A;  2B3F A;  3W9W A;  3MPK A;  5FHM A;  4EDP A;  4EXK A;  3IO6 A;  1FW0 A;  4YU0 A;  1MQH A;  5CMM A;  5I57 A;  1FTO A;  3T22 A;  3G3H A;  4WEP A;  2DWJ A;  4JXI A;  1I69 A;  3CRB A;  3T93 B;  4H65 A;  1VE4 A;  1A8F A;  5TP9 B;  3KN8 A;  2Y7I A;  1ZTY A;  4H8I A;  2NUV A;  2HEU A;  4EQB A;  2B4M A;  4YIC A;  4ESX A;  2GH9 A;  1B3G A;  2NVU B;  3IOT A;  3MVX A;  2QSX A;  5CMB A;  4YMB A;  3O6I A;  5ISU A;  3VVE A;  1BKA A;  3GBA A;  1QKA A;  3E3K A;  4P0I A;  3V5A A;  3UIF A;  2YPN A;  1UIV A;  4H8J A;  3W9V A;  4HW8 A;  3RYB A;  1GGG A;  5L9S A;  3VFJ A;  1D3K A;  3OO7 A;  2AL5 A;  1NH7 A;  4FAT A;  4OVJ A;  1M5C A;  4PET A;  1WOD A;  1B58 A;  1UTH B;  4LUB A;  4Z0I A;  3MVZ A;  4WKM A;  4IO2 A;  3FVK A;  5A5X A;  2E0S A;  5H8Q A;  4OZ9 A;  2DQV A;  2DOJ A;  4RNS A;  5H8F A;  2XXW A;  3GLB A;  3G7W A;  1Y1Z A;  4FIM A;  4YMA A;  3PUY E;  4X48 A;  2Y7K A;  4QFK A;  2I0B A;  4N07 A;  2RC9 A;  2REG A;  3ODB A;  3KZG A;  1LCF A;  3PMX A;  3TYH A;  4U2R A;  4EUO A;  4R6Y A;  3KBR A;  3BFT A;  4LVQ A;  2G29 A;  3SEV A;  2O84 X;  2DS9 A;  2P0S A;  1XHY A;  2O69 A;  4H5G A;  5AA2 D;  4IGR A;  1OLC A;  3UOR A;  1B4Z A;  5H8S A;  4AQ4 A;  1B1H A;  4G8N A;  3SEX A;  4E0X A;  3HN0 A;  2DVZ A;  4OQO A;  1B0H A;  2ZNT A;  3C35 A;  4F2Q A;  2VP1 A;  3O2A A;  2HAV A;  4G2Z A;  3MC2 A;  1LFG A;  1LCT A;  3QK6 A;  3U8Q A;  3PV0 E;  2X7P A;  4G68 C;  4LAT A;  2DWH A;  3QYT A;  1IXH A;  1ATG A;  1MG1 A;  4NF5 A;  4O3C A;  3M3K A;  4R6K A;  2Y7W A;  4DXC A;  1RYO A;  3FAT A;  2O1M A;  3A3U A;  3DM0 A;  3CG3 A;  1L5T A;  4KYS A;  3LBS A;  3BKI B;  1N84 A;  1HSJ A;  5CMK A;  3RUM A;  4OWD A;  3H4Z A;  4ECF A;  1MH4 A;  4QFP A;  2F5X A;  4F3G A;  3LSL A;  1NH8 A;  3ZS6 A;  1F9B A;  3GZG A;  3MWB A;  1SW4 A;  3B6Q A;  3N26 A;  1GR2 A;  5IAI A;  2DP8 A;  3EPE A;  3WAF A;  4R73 A;  1IEJ A;  3HPI A;  5CRY A;  1UTB A;  2Z8F A;  3PUW E;  1EZO A;  3GXA A;  3MAM A;  3PPN A;  4ZE8 A;  3RN8 A;  1HSL A;  2B4L A;  3A3C A;  3FIR A;  4MF3 A;  2E1S A;  1KWH A;  1SQY A;  1R6Z A;  3THI A;  3H3G A;  1ZMG A;  4LQ5 A;  3RPW A;  5F1Q A;  1POY 1;  5L8D A;  3H6U A;  3TQW A;  4X9T A;  1JW5 A;  3CSG A;  2I49 A;  2XX9 A;  2I6E A;  2G93 A;  1O7T A;  3Q29 A;  2GHA A;  1OLA A;  5JTY A;  3VVD A;  4ESW A;  5I56 B;  1UTB B;  5AA2 B;  1YCJ A;  2O6A A;  4R72 A;  1B7H A;  4XKP A;  4HTG A;  3O6G A;  3VLU A;  1S50 A;  2UVI A;  4M4G A;  4F22 A;  4THI A;  4YB6 A;  3VE1 B;  3PPP A;  3E4R A;  1XOC A;  2KLF A;  4LZ8 A;  4POW A;  2A5T B;  2AYS A;  1I6B A;  1RKM A;  3TCG A;  4OXV A;  1S7Y A;  4IO4 A;  2F35 A;  2ABH A;  1II5 A;  3MW0 A;  5F7V A;  3B7D A;  5KCJ B;  2HXW A;  3GBB A;  2ZMB A;  4EQ7 A;  1P99 A;  4MH5 A;  1MQJ A;  4XKQ A;  1VSO A;  1DSN A;  2ZXT A;  2Z8D A;  5JTY B;  1DPE A;  3SET A;  1SW1 A;  5DEX A;  4RK9 A;  3KSJ A;  4ZEB A;  1NFT A;  3HST A;  2O51 A;  3K6V A;  1FTK A;  4OFJ A;  2CMO A;  1LAG E;  4ISU A;  4OHN A;  4F29 A;  3SEW A;  1B3L A;  3KN7 A;  4Q30 B;  4GOT A;  4ELP A;  2WOL A;  1B51 A;  2D21 A;  3VDF A;  2QL3 A;  5H8N A;  1D9V A;  3H6W A;  3OEL A;  3DRI A;  3MVW A;  1LBB A;  5ITP A;  2QS4 A;  4GL8 A;  2LAO A;  5AA4 A;  5ICQ A;  4MBP A;  3ZKL A;  3H6T A;  4I9D A;  1D4N A;  2OJT A;  2VD3 A;  1QJM A;  3QSL A;  2V93 A;  3FJG A;  3T96 B;  3TMG A;  1GV8 A;  5I59 A;  4YB5 A;  4ELR A;  1QW0 A;  2D5W A;  4LA9 A;  2FA7 A;  1ANF A;  1EU8 A;  4P0G A;  3PUZ E;  1H76 A;  3EHT A;  3DRJ A;  2F78 A;  4U23 A;  1H43 A;  4G4P A;  1SI1 A;  1MPD A;  4QFL A;  3HHG A;  1MY3 A;  1MPB A;  3O6P A;  2QMX A;  4ZEC A;  1PEB A;  1QVS A;  3S4U A;  2HCA A;  1Y3Q A;  2XD2 A;  1UQW A;  3IAZ A;  4F1U A;  1PC3 A;  4U22 A;  5TPA B;  2BJJ X;  4G8H A;  3MP1 A;  3CVG A;  2RCB A;  4QFN A;  3FV1 A;  2VHA A;  1XVY A;  4YKK A;  2XXV A;  4OYV A;  1QUL A;  3K02 A;  3OO6 A;  3RNN A;  1URG A;  2RCA A;  2XX8 A;  3O66 A;  1MY1 A;  4OMB A;  2B3B A;  2Y7P A;  3S9L C;  2XD3 A;  1UTH A;  1PB9 A;  1EZ9 A;  2FNC A;  3B6W A;  5DVJ A;  1JEV A;  1R1N A;  1N0T A;  3KSX A;  2F7B A;  3LC8 A;  3SEY A;  5L9O A;  3IOU A;  3TCF A;  3S2V A;  3OMB A;  3TFL A;  1SI0 A;  3V89 B;  1DTZ A;  1WDN A;  3FXR A;  3CHG A;  1SBP A;  4NF6 B;  1LB8 A;  2DE3 A;  1NNT A;  3SDF A;  3R6U A;  4G68 A;  4R2B A;  4AB6 A;  3E9X A;  2PMS A;  3M3L A;  3PPQ A;  2QJE A;  4OFO A;  3Q27 A;  1OVB A;  1FTL A;  4F3S A;  1P1Q A;  1A99 A;  3MVY A;  2V3U A;  1H44 A;  3K4U A;  2PX1 A;  4BDN A;  4MLV A;  5DVF A;  3KGC A;  2P1S A;  3SER A;  3TPA A;  2I3W A;  2PVU A;  4F19 A;  3FXQ A;  2Y84 A;  1XC1 A;  2VGQ A;  5HBC A;  4U4S A;  3WAE A;  1TFD A;  1QUK A;  4O3B A;  1JEU A;  4G68 B;  1IXG A;  3CFX A;  1B40 A;  4YKI A;  1MXZ A;  1Y3P A;  5EHS A;  1JVY A;  3UGW A;  1MXU A;  4BDM A;  3K00 A;  1N76 A;  2WKY A;  3OXN A;  4ZEI A;  3OO8 A;  1N3W A;  1B5I A;  4BDO A;  2M8C A;  4Z7E A;  1BLF A;  2OK2 A;  1LAH E;  3I5O A;  2DWI A;  2GFE A;  5JK4 A;  1IIT A;  2PT1 A;  4C1T A;  4DXU A;  1MQG A;  2RKM A;  4GXA A;  3MZB A;  2IEE A;  4H6D A;  4LON B;  4F2O A;  2O68 A;  4GQO A;  2Q89 A;  5CC2 A;  4PP0 A;  1B7Z A;  4XIG Q;  1JW4 A;  3K6X A;  4MLQ A;  3VXB A;  2QMW A;  2XXR A;  3I3V A;  3H03 A;  3TEL A;  5CBS A;  2QS1 A;  4QSD A;  4RPO A;  2RIN A;  5CMC A;  1JNF A;  4DIG A;  1TT1 A;  3G3J A;  3MZ1 A;  1SDX A;  3G3I A;  4KYE A;  1PB7 A;  3K0V A;  1DTG A;  3FVG A;  3FGS A;  3LSW A;  3FTO A;  3ZSF A;  1IZ1 A;  4R9G A;  1A8E A;  3F11 A;  1ZLQ A;  3TOD A;  3PPO A;  4JBZ A;  2F97 A;  3PAM A;  3K1M A;  1JQF A;  4GIZ A;  1M5E A;  1WVJ A;  2Z22 A;  1JET A;  4FED A;  3DEL B;  2UVH A;  3C32 A;  5L9M A;  2HQ0 A;  1NL5 A;  4IO7 A;  3HCQ A;  2I4B A;  2B65 A;  3BBR A;  3IOR A;  1AL3 A;  4G77 A;  4TOZ A;  2HZK A;  3FV2 A;  3UK4 A;  2OWS A;  4ZS9 A;  3LSX A;  2ZYO A;  4YAH X;  2XXH A;  2O1L A;  2ZYK A;  4LQ2 A;  1CB6 A;  2GHB A;  5DT6 A;  1RYX A;  1B5J A;  1LB9 A;  5I2N B;  1O63 A;  2ONR A;  1B2H A;  2ESN A;  2D3I A;  2YLN A;  5I56 A;  1SYH A;  5J1D A;  2DVC A;  5AA2 A;  1URD A;  5I58 A;  1QUJ A;  2ONS A;  3IR1 A;  4EF1 A;  1QKB A;  1BP5 A;  1OQG A;  4QF9 A;  2VD2 A;  3SES A;  4ZE9 A;  1IUD A;  2DWA A;  2A5T A;  4TQU Q;  5DTB A;  3ILT B;  3TTN A;  1FCK A;  4QSC A;  4PFT A;  5KCJ A;  3ONM A;  1NNP A;  1P1W A;  3C9H A;  2H25 A;  1Z7N E;  4LP2 B;  4GXS B;  4F3B A;  3FZV A;  2OBG A;  3H6V A;  2YJP A;  4KYD A;  2NWJ A;  4M1V A;  3CFZ A;  2X26 A;  5BUU A;  1YTV A;  4NMY A;  4KI0 E;  3KG2 A;  2XXP A;  3FD3 A;  2R6G E;  3B6T A;  4QRZ A;  1YPN A;  3TTK A;  3EHS A;  5DVI A;  3IB0 A;  4KD5 A;  1B05 A;  4I1D A;  5I58 B;  1B9J A;  1ZU0 A;  4F31 B;  2Q8J A;  3O9P A;  1MQD A;  3IB1 A;  3M8U A;  1FQE A;  1LAF E;  5B7D A;  3K1N A;  4KCC A;  1Y4T A;  4Q5T A;  3R7X A;  4WXJ A;  2XX7 A;  2Q2A A;  4JSD A;  2PT2 A;  4FJP A;  3SKP A;  4X1B A;  4EF2 A;  3BFU A;  3T66 A;  3C36 A;  3VV5 A;  1MM6 A;  4GD5 A;  4KCD A;  3MBP A;  1R9L A;  3FXU A;  5AA3 A;  1AH5 A;  1UIU A;  4IY5 A;  2H98 A;  1N7W A;  1EZP A;  3K2D A;  4DE8 A;  3DRK A;  3PPR A;  5AA1 A;  1IXI A;  4NWD A;  1N3X A;  1IXC A;  3O28 A;  2GRV A;  2PBW A;  4OET A;  2AIX A;  1FQB A;  1B32 A;  4U1Z A;  3L6G A;  3JYR A;  3RYA A;  5K2Y A;  4H0W A;  4F3P A;  4AB5 A;  2O7I A;  4EQ9 A;  4IO5 A;  4G8M A;  2IA4 A;  4IY6 A;  2UYF A;  3PUV E;  1SVX B;  1LBC A;  3IOV A;  4RA1 A;  3DP8 A;  3K01 A;  3TUS A;  1FQF A;  1DMB A;  4JSO A;  2NXO A;  3VVF A;  1Y1M A;  3U1O A;  3TCH A;  5TPA A;  1LST A;  1TXF A;  2Q88 A;  3CIJ A;  2F7A A;  1Y9U A;  1B1X A;  1MY4 A;  3DLN A;  3IJX B;  3PU5 A;  1LFH A;  2DXY A;  1LGB C;  4OFL A;  4TLL B;  4DCY A;  5EHM A;  4GFR A;  4P11 A;  5BWJ A;  4EXL A;  4H67 A;  4KHZ E;  3HO7 A;  2DE2 A;  1Y20 A;  4XTC Q;  1JVX A;  1QUI A;  4NF4 B;  3Q28 A;  1FQD A;  2XHD A;  3E13 X;  4C1U A;  3RTW B;  1ZKB A;  4OEN A;  4F18 A;  4GL0 A;  5TU0 A;  4FEC A;  3N6U A;  3T9U A;  2DSF A;  3USD A;  4FOR A;  2OWT A;  4HCW A;  2I0C A;  4ZEF A;  2RC8 A;  4YKP A;  3ECR A;  4NF6 A;  1Z7M E;  3Q26 A;  3Q25 A;  2THI A;  3PGF A;  2PYY A;  2Z8E A;  3CG1 A;  3VLV A;  3DRF A;  2OZZ A;  2ZNU A;  5EYF A;  1Q1K A;  3OSR A;  1M5B A;  3O6H A;  4I8C A;  5FHO A;  1SW5 A;  2Q9T A;  4QSE A;  4NE4 A;  1P1O A;  1XT8 A;  3S9M C;  4JWY A;  4DXB A;  3RT6 B;  4K3F A;  4R74 A;  3UP9 A;  2WOK A;  3LR1 A;  1H3D A;  1MPC A;  1S9T A;  3I6V A;  3IK6 B;  1VFE A;  1DPP A;  5KZT A;  3PD8 A;  2ZNS A;  4JWO A;  3RY3 A;  3K1P A;  4Q8R A;  3QXM A;  4F39 A;  4OEU A;  2F7C A;  2XXX A;  3EN3 A;  3HV1 A;  4WED A;  3K6U A;  2W7Y A;  3IB2 A;  1N7X A;  2F36 A;  2UYE A;  1B7U A;  2Q2C A;  4U4X A;  5ITO A;  3MP8 A;  1OQH A;  4UA8 A;  4UAC A;  1M5F A;  1N04 A;  4XKN A;  4IO3 A;  4U1O A;  1BTJ A;  3D4G A;  2OLB A;  1CE2 A;  3LUY A;  4IO6 A;  5I57 B;  3JV9 A;  1VFD A;  4JB7 A;  4ELQ A;  3T9X B;  1HSE A;  4XXU A;  2UXA A;  1GVC A;  4OES A;  4E0W A;  3LSF B;  2XXT A;  1B46 A;  3S9E A;  3QUF A;  3TDJ A;  2WOP A;  3CR9 A;  3IX1 A;  3PMW A;  3AXF A;  4F1Y A;  2I4C A;  1POT A;  4GLI A;  2NOO A;  3C31 A;  2OCU A;  4JDF A;  1A54 A;  4ZZA A;  1MXX A;  5CBR A;  1B3E A;  5FTI A;  1NNF A;  1XS5 A;  2ZYM A;  2HAU A;  1AOV A;  1NKX A;  4BDQ A;  4ZEK A;  3VLW A;  4ZED A;  2ALU A;  3P7I A;  1OIB A;  5FTH A;  3DRG A;  1MDP 1;  4KPT A;  3IOW A;  4IB2 A;  1TFA A;  2VOZ A;  3TEP A;  3CSB A;  2P2A A;  4DLD A;  1MY2 A;  3KEI A;  4GVO A;  5AE4 A;  3QUJ A;  5DYH A;  1GTK A;  3MQ9 A;  4OTE A;  1MQI A;  3U94 A;  5A5X B;  2REJ A;  3K6W A;  1PBQ A;  5H8Q B;  1SYI A;  5ELV A;  4LZ5 A;  3FAS A;  5H8F B;  3TQL A;  1B4H A;  2RC7 A;  3TTR A;  3G3G A;  3DP6 A;  1FTJ A;  4NF8 A;  5I2N A;  4TLM B;  3C33 A;  4FEB A;  3UN6 A;  4ONY A;  3QIM A;  3IJO B;  3N94 A;  1MDQ A;  1B5H A;  3KOT A;  2UVJ A;  4GF8 A;  1B0L A;  5HM4 B;  3OO9 A;  4ND9 A;  4RXL A;  4GWO A;  1USY H;  3HHF A;  3MPL A;  4ZDM A;  2XXY A;  3TAJ A;  3CI8 A;  5M2V A;  5I2K A;  2V3Q A;  3MZ9 A;  4U21 A;  1ZIU A;  4DCX A;  4POX A;  4R6H A;  4RPN A;  3IO4 A;  4C0R A;  4BDR A;  1A55 A;  4IGT A;  3R26 A;  4RK2 A;  3DRH A;  2H4I A;  3OEK A;  1A7L A;  3OD7 A;  1MXV A;  4RY1 A;  3OSQ A;  4NF8 B;  2V25 A;  3RQT A;  5HPQ A;  4N6P A;  3JZJ A;  1MY0 A;  1IQ7 A;  3TTL A;  4XKR A;  3V83 A;  1FQC A;  4R9F A;  1AMF A;  3EQ1 A;  1IIW A;  1MM7 A;  1VR5 A;  3MUQ A;  2ANJ A;  3LVU A;  4L17 A;  2F6P A;  5I2K B;  4DDD A;  1Q35 A;  4NF5 B;  5B70 A;  1I6A A;  1OMP A;  5H8H A;  3FUZ A;  1MXW A;  3FJ7 A;  3N6T A;  1AIV A;  3A09 A;  4YZZ A;  2V84 A;  5CM6 A;  1FTM A;  4BDL A;  3O97 A;  4ZZE A;  3MP6 A;  1EH3 A;  1P1U A;  4KFQ A;  2DXR A;  1SW2 A;  1DOT A;  4H1X A;  1NMU A;  1BIY A;  4QFO A;  2H9B A;  4YKJ A;  3ILU B;  1PB8 A;  1A40 A;  3PD9 A;  4PE5 B;  1NNK A;  3RTF B;  2FYI A;  4KQP A;  1B52 A;  3S9N C;  3V8X B;  4PFU A;  2Y7R A;  4H5F A;  2H99 A;  4R2F A;  5H8H B;  3IL1 B;  3TTM A;  2I3V A;  4QHQ A; 
#chains in the Genus database with same CATH topology
 5FHN A;  5ESY A;  3U93 A;  1G0H A;  4DZ1 A;  4HE1 A;  1LAX A;  1US4 A;  4PFI A;  2FBP A;  3OEM A;  1ZJL A;  4MHF A;  3RGY A;  5ICT A;  1FQA A;  3M3F A;  5LOM A;  3FJM A;  3KOS A;  1MH3 A;  3H7M A;  2MKZ A;  2R71 A;  3KFM A;  2R9J A;  4LZ7 A;  3N5L A;  3KJT A;  1I6Q A;  3KJ7 A;  4N15 A;  3RYD A;  2XA5 A;  3FVN A;  4YB7 A;  3KN3 A;  2QS3 A;  3FVO A;  4PFY A;  2AL4 A;  3SEU A;  1MXY A;  3D4C A;  3G3F A;  4PQJ A;  4OAN A;  3TKD A;  2XXK A;  4BLA A;  3EHU A;  2CZI A;  5K2X A;  3TZA A;  1FJ9 A;  3T9H B;  1TWY A;  3C4M A;  5IM2 A;  2XXQ A;  2KR0 A;  1RDZ A;  4RYA A;  4FAJ A;  1LLS A;  2I58 A;  3ZKK A;  4GRK A;  1NV2 A;  1ZBM A;  1YAE A;  5IKB A;  4I62 A;  1M5D A;  3L6H A;  3UA8 A;  4NF4 A;  5ET8 A;  1P1N A;  1R9Q A;  1B3F A;  5LTC A;  2CZL A;  4O3A A;  4N91 A;  3QAX A;  3O29 A;  3W15 C;  2XXI A;  4X04 A;  3RLF E;  1FPB A;  4R75 A;  3OEN A;  4RJZ A;  3RT8 A;  5KDT A;  2FHY A;  4Q0C A;  2HZL A;  2DYX A;  4MCO A;  3DP4 A;  3RPL B;  1B6H A;  2V3T A;  1FPK A;  2WYK A;  4FE8 A;  4F1V A;  3B8B A;  3MJN A;  2X7Q A;  2DE4 A;  4FBP A;  2QRY A;  2H5Y A;  5DEX B;  1USY E;  2F6G A;  2QS2 A;  3H06 B;  5T3J A;  1Y4C A;  1LFI A;  1FBE A;  2XWO A;  2UVG A;  3PUX E;  5CI5 A;  1IME A;  2Z23 A;  1T0K A;  1H45 A;  4NWC A;  3T9V A;  2QPQ A;  4HS7 A;  4OER A;  1PDA A;  5H8N B;  4JWX A;  4PAF A;  4N6K A;  1ELJ A;  1B3H A;  1OVT A;  4MIJ A;  3PMV A;  2F8D A;  3VXC A;  5KDT B;  1J1N A;  4HCY A;  4N13 A;  2O7U A;  2CEX A;  2ZYN A;  2RF1 A;  2XXU A;  1O64 A;  5I84 A;  5AA4 B;  1US5 A;  4OEV A;  2HFB A;  4ELO A;  3G3K A;  5TP9 A;  2I48 A;  1Y3N A;  2A5S A;  1URS A;  4NTL A;  1XVX A;  3U92 A;  1VDW A;  1JW1 A;  2ZZV A;  4MFI A;  1DBZ A;  1MRP A;  2ONK E;  1SD3 A;  4N4U A;  5I59 B;  3EF7 A;  1PBP A;  4X1D A;  4PFW A;  1D9Y A;  3CFL A;  4KR5 A;  3OOA A;  2XWV A;  4NED A;  5JEI A;  3U72 A;  1MS7 A;  2WBB A;  3C34 A;  5EYH A;  2F34 A;  2B3F A;  5I3S A;  3W9W A;  3MPK A;  5FHM A;  4NG7 A;  1NV4 A;  4EDP A;  4EXK A;  3IO6 A;  1FW0 A;  4YU0 A;  1MQH A;  5CMM A;  5I57 A;  1FTO A;  3T22 A;  3G3H A;  2ZZX A;  1IMF A;  4WEP A;  2DWJ A;  4JXI A;  1I69 A;  3CRB A;  3T93 B;  1LBX A;  4H65 A;  1VE4 A;  1A8F A;  5TP9 B;  3KN8 A;  1Q9D A;  2Y7I A;  1ZTY A;  4H8I A;  2NUV A;  2FIE A;  4PBQ A;  2HEU A;  4EQB A;  2B4M A;  4YIC A;  4ESX A;  2GH9 A;  2CZK A;  1B3G A;  2NVU B;  5ET5 A;  3IOT A;  3MVX A;  2QSX A;  5CMB A;  4YMB A;  1KA0 A;  3O6I A;  5ISU A;  2PFY A;  2JJK A;  3VVE A;  1BKA A;  3GBA A;  1QKA A;  3E3K A;  4P0I A;  3V5A A;  3UIF A;  2R8T A;  4GWS A;  2YPN A;  1UIV A;  4H8J A;  1QGX A;  3W9V A;  4HW8 A;  3RYB A;  1GGG A;  5L9S A;  3VFJ A;  1D3K A;  3OO7 A;  2AL5 A;  4UAB A;  1NH7 A;  4FAT A;  4OVJ A;  1M5C A;  4PET A;  1WOD A;  1B58 A;  1UTH B;  3GYY A;  4LUB A;  4NAP A;  4Z0I A;  3MVZ A;  4WKM A;  4IO2 A;  3FVK A;  5A5X A;  2E0S A;  5H8Q A;  4OZ9 A;  2DQV A;  2DOJ A;  4RNS A;  5H8F A;  2XXW A;  4GX3 A;  3GLB A;  3G7W A;  1Y1Z A;  4N6D A;  4FIM A;  4YMA A;  3PUY E;  4X48 A;  2Y7K A;  4QFK A;  2I0B A;  4N07 A;  4HE0 A;  2RC9 A;  1FTA A;  2REG A;  3ODB A;  4PAI A;  2OX3 A;  3KZG A;  1LBY A;  1LCF A;  3PMX A;  3TYH A;  4JVD A;  4U2R A;  4EUO A;  3A29 A;  2F3B A;  4R6Y A;  3KBR A;  4PF8 A;  3BFT A;  3ROJ A;  4LVQ A;  2G29 A;  3SEV A;  2O84 X;  2DS9 A;  2P0S A;  1XHY A;  2O69 A;  4H5G A;  5AA2 D;  4IGR A;  1EYI A;  1OLC A;  3UOR A;  4MNP A;  1B4Z A;  5H8S A;  4AQ4 A;  1B1H A;  4G8N A;  4I40 A;  3SEX A;  4E0X A;  3HN0 A;  2DVZ A;  4OQO A;  1B0H A;  2ZNT A;  3C35 A;  4F2Q A;  2VP1 A;  3O2A A;  3ISP A;  2HAV A;  4G2Z A;  3MC2 A;  4P9K A;  1LFG A;  1LCT A;  4GX4 A;  3QK6 A;  1NUX A;  5EQA A;  3U8Q A;  3PV0 E;  4MJO A;  2X7P A;  4G68 C;  1FPD A;  4LAT A;  2DWH A;  4MAG A;  1KZ8 A;  3QYT A;  1IXH A;  2HPG A;  1ATG A;  1MG1 A;  4NF5 A;  4O3C A;  3M3K A;  3KC1 A;  4R6K A;  2Y7W A;  4DXC A;  1RYO A;  3FAT A;  4PDH A;  2O1M A;  4XFE A;  2WYP A;  3A3U A;  3DM0 A;  3CG3 A;  1L5T A;  4KYS A;  3LBS A;  3BKI B;  1N84 A;  1HSJ A;  4IR8 A;  5CMK A;  2ZZW A;  3RUM A;  4OWD A;  3H4Z A;  3D1R A;  5EQ9 A;  2Y5L A;  4ECF A;  1MH4 A;  4QFP A;  2F5X A;  3KC0 A;  4F3G A;  3LSL A;  1NH8 A;  2CEY A;  3ZS6 A;  1F9B A;  3GZG A;  3MWB A;  1SW4 A;  3B6Q A;  3N26 A;  1GR2 A;  5IAI A;  2DP8 A;  3EPE A;  4GBV A;  3WAF A;  4R73 A;  1IEJ A;  3HPI A;  5CRY A;  1UTB A;  1SPI A;  2Z8F A;  3PUW E;  1EZO A;  3GXA A;  3MAM A;  3PPN A;  4ZE8 A;  4PBH A;  3RN8 A;  4PAK A;  1HSL A;  2B4L A;  3A3C A;  4N17 A;  3FIR A;  4MF3 A;  2E1S A;  1KWH A;  1SQY A;  1R6Z A;  3THI A;  3H3G A;  1ZMG A;  4LQ5 A;  3RPW A;  5F1Q A;  1POY 1;  5L8D A;  3H6U A;  3TQW A;  4PFB A;  4X9T A;  1JW5 A;  3CSG A;  2I49 A;  2XX9 A;  2I6E A;  4X8R A;  4NQ8 A;  2G93 A;  1O7T A;  3Q29 A;  2GHA A;  1OLA A;  5JTY A;  3VVD A;  4ESW A;  5I56 B;  1UTB B;  5AA2 B;  1YCJ A;  2O6A A;  3B50 A;  4R72 A;  1B7H A;  4XKP A;  4HTG A;  1FBF A;  3O6G A;  3VLU A;  5F24 A;  1S50 A;  2UVI A;  4M4G A;  4F22 A;  4THI A;  4YB6 A;  3VE1 B;  3PPP A;  3E4R A;  4GWZ A;  1XOC A;  2KLF A;  4LZ8 A;  4POW A;  2A5T B;  4P8B A;  2AYS A;  1I6B A;  2FIX A;  3T1B A;  1RKM A;  3TCG A;  4OXV A;  1S7Y A;  4IO4 A;  2F35 A;  2ABH A;  1II5 A;  3MW0 A;  5F7V A;  3B7D A;  5KCJ B;  5IZZ A;  2HXW A;  3GBB A;  2ZMB A;  4EQ7 A;  1P99 A;  4MH5 A;  1MQJ A;  1YXI A;  4XKQ A;  4JVI A;  3RPL A;  1VSO A;  1DSN A;  2ZXT A;  2Z8D A;  5JTY B;  1DPE A;  3SET A;  1SW1 A;  5DEX A;  1DCU A;  3LUZ A;  4RK9 A;  1FSA A;  2WEF A;  3KSJ A;  4MMP A;  4ZEB A;  1NFT A;  4GWW A;  3HST A;  2O51 A;  3K6V A;  1FTK A;  4OFJ A;  2CMO A;  1LAG E;  4ISU A;  4OHN A;  4F29 A;  3SEW A;  1B3L A;  3KN7 A;  4Q30 B;  4G61 A;  4GOT A;  4ELP A;  2WOL A;  1B51 A;  2D21 A;  3VDF A;  2QL3 A;  5H8N A;  1D9V A;  4OA4 A;  3H6W A;  3OEL A;  3DRI A;  3MVW A;  4HXV A;  1EYJ A;  1LBB A;  5ITP A;  4KXP A;  2QS4 A;  4GL8 A;  2LAO A;  1K9Z A;  5AA4 A;  5ICQ A;  4MBP A;  3ZKL A;  3H6T A;  2L5V A;  1NI9 A;  4I9D A;  1D4N A;  2OJT A;  4GWY A;  2VD3 A;  1QJM A;  1LBV A;  3QSL A;  2V93 A;  3FJG A;  3T96 B;  3TMG A;  1GV8 A;  5I59 A;  4YB5 A;  4ELR A;  1QW0 A;  2D5W A;  4LA9 A;  2FA7 A;  1ANF A;  1EU8 A;  4P0G A;  3PUZ E;  1H76 A;  3EHT A;  3DRJ A;  2F78 A;  4U23 A;  2Y5K A;  1H43 A;  4G4P A;  1SI1 A;  1MPD A;  4QFL A;  3HHG A;  3HFU A;  1MY3 A;  1MPB A;  3O6P A;  2QMX A;  4ZEC A;  1PEB A;  1QVS A;  3S4U A;  2HCA A;  1Y3Q A;  2XD2 A;  1UQW A;  3IAZ A;  4F1U A;  1PC3 A;  4U22 A;  5TPA B;  2BJJ X;  4G8H A;  3MP1 A;  3IFC A;  3CVG A;  2RCB A;  4QFN A;  3FV1 A;  2QVV A;  4AS5 A;  2VHA A;  1XVY A;  4YKK A;  2XXV A;  4OYV A;  4XEQ A;  1QUL A;  3K02 A;  3OO6 A;  3RNN A;  1URG A;  2RCA A;  1LBW A;  2XX8 A;  3O66 A;  1MY1 A;  1LBZ A;  4OMB A;  2B3B A;  1INP A;  2Y7P A;  5FBP A;  3S9L C;  2XD3 A;  1UTH A;  1PB9 A;  1EZ9 A;  2V4C A;  2FNC A;  3B6W A;  5DVJ A;  1JEV A;  4GWU A;  1R1N A;  1N0T A;  3KSX A;  2F7B A;  3LC8 A;  3SEY A;  4O7M A;  5L9O A;  3IOU A;  3TCF A;  3S2V A;  3OMB A;  3TFL A;  1SI0 A;  3V89 B;  1DTZ A;  1WDN A;  3FXR A;  3CHG A;  5IGA A;  1SBP A;  4NF6 B;  1LB8 A;  2DE3 A;  1NNT A;  3SDF A;  3R6U A;  4G68 A;  4R2B A;  4AB6 A;  3E9X A;  2PMS A;  3M3L A;  3PPQ A;  4PGP A;  2QJE A;  4OFO A;  4HE2 A;  3Q27 A;  4O8M A;  1OVB A;  1FTL A;  4F3S A;  3BIG A;  1P1Q A;  1A99 A;  3MVY A;  2V3U A;  1H44 A;  3K4U A;  2PX1 A;  4BDN A;  4MLV A;  5DVF A;  3E78 A;  1NV6 A;  2P3V A;  3KGC A;  3U65 A;  2P1S A;  3SER A;  3TPA A;  2I3W A;  2PVU A;  4F19 A;  3FXQ A;  2Y84 A;  4PGN A;  4I3Y A;  1XC1 A;  3SZP A;  2VGQ A;  5HBC A;  4U4S A;  3WAE A;  1AWB A;  5LDZ A;  1TFD A;  1QUK A;  2PCR A;  4O3B A;  1JEU A;  4G68 B;  1IXG A;  3CFX A;  4GWX A;  1B40 A;  4YKI A;  1MXZ A;  1Y3P A;  5EHS A;  1JVY A;  3UGW A;  1MXU A;  4BDM A;  3K00 A;  1N76 A;  2WKY A;  3OXN A;  4ZEI A;  3OO8 A;  1N3W A;  1B5I A;  4BDO A;  4DI3 D;  2M8C A;  4Z7E A;  1BLF A;  1FRP A;  4QXD A;  2OK2 A;  1LAH E;  3I5O A;  2DWI A;  2GFE A;  5JK4 A;  1IIT A;  2PT1 A;  4C1T A;  4DXU A;  1MQG A;  2RKM A;  4GXA A;  3MZB A;  2IEE A;  4H6D A;  4LON B;  4F2O A;  2O68 A;  4GQO A;  2Q89 A;  5CC2 A;  4PP0 A;  1B7Z A;  4XIG Q;  1JW4 A;  3K6X A;  4MLQ A;  3VXB A;  2QMW A;  2XXR A;  3I3V A;  1XI6 A;  3H03 A;  3TEL A;  5CBS A;  2FVZ A;  2QS1 A;  4QSD A;  4RPO A;  2RIN A;  5CMC A;  1JNF A;  4DIG A;  1TT1 A;  3G3J A;  4MX6 A;  3MZ1 A;  1SDX A;  3E79 A;  2WBD A;  2VPO A;  3G3I A;  4MNI A;  4KYE A;  1PB7 A;  3K0V A;  3PTY A;  1DTG A;  3FVG A;  3FGS A;  3LSW A;  3FTO A;  3ZSF A;  1FBD A;  1IZ1 A;  4R9G A;  1A8E A;  3F11 A;  1ZLQ A;  3TOD A;  2QVR A;  3PPO A;  1NUZ A;  4JBZ A;  2F97 A;  3PAM A;  3K1M A;  1JQF A;  4GIZ A;  1M5E A;  1WVJ A;  2Z22 A;  1JET A;  4FED A;  3DEL B;  2UVH A;  3C32 A;  5L9M A;  2HQ0 A;  1NL5 A;  4IO7 A;  4MNC A;  4NX1 A;  3HCQ A;  2I4B A;  2B65 A;  3BBR A;  3IOR A;  1AL3 A;  4OVT A;  1NV7 A;  3MYU A;  4G77 A;  4TOZ A;  2HZK A;  3FV2 A;  4MEV A;  2OWS A;  3UK4 A;  4ZS9 A;  4PTK A;  3LSX A;  2ZYO A;  4YAH X;  1D9Q A;  2XXH A;  2O1L A;  2ZYK A;  3NOH A;  4LQ2 A;  1CB6 A;  2GHB A;  5DT6 A;  1RYX A;  1B5J A;  1LB9 A;  4O94 A;  5I2N B;  1O63 A;  2ONR A;  5J16 A;  1B2H A;  2ESN A;  2D3I A;  2YLN A;  4OVQ A;  5I56 A;  1SYH A;  5J1D A;  2DVC A;  5AA2 A;  1URD A;  5I58 A;  1QUJ A;  2ONS A;  3IR1 A;  1JP4 A;  4EF1 A;  1QKB A;  1BP5 A;  1OQG A;  2OWZ A;  4QF9 A;  4P47 A;  1FBG A;  2VD2 A;  2DDK A;  3SES A;  2WX9 A;  4ZE9 A;  1IUD A;  2DWA A;  2A5T A;  4TQU Q;  5DTB A;  3ILT B;  3TTN A;  1FCK A;  4P1E A;  5EQ7 A;  4QSC A;  4PFT A;  5KCJ A;  3ONM A;  1NNP A;  1P1W A;  3C9H A;  2H25 A;  1Z7N E;  4LP2 B;  4GXS B;  4F3B A;  3FZV A;  4PFR A;  2OBG A;  3H6V A;  2YJP A;  4GX6 A;  4KYD A;  2NWJ A;  4M1V A;  3CFZ A;  2X26 A;  5BUU A;  1DK4 A;  1YTV A;  4NMY A;  4KI0 E;  3KG2 A;  2XXP A;  1FPG A;  2R6G E;  3B6T A;  3FD3 A;  4QRZ A;  1YPN A;  3TTK A;  3FBP A;  3EHS A;  5DVI A;  3IB0 A;  4KD5 A;  1B05 A;  4I1D A;  5I58 B;  4OVR A;  1B9J A;  1ZU0 A;  4F31 B;  2Q8J A;  3O9P A;  1MQD A;  1IMB A;  1RDX A;  2QVU A;  3IB1 A;  3M8U A;  1FQE A;  1LAF E;  5B7D A;  3K1N A;  4KCC A;  1Y4T A;  4Q5T A;  3R7X A;  2HXR A;  4WXJ A;  1IMA A;  2XX7 A;  2BJI A;  2Q2A A;  4JSD A;  2PT2 A;  5I5P A;  4JVC A;  4FJP A;  2XWK A;  3SKP A;  4X1B A;  4EF2 A;  3BFU A;  3T66 A;  3C36 A;  3VV5 A;  1FPF A;  4OVP A;  1MM6 A;  4GD5 A;  4NHB A;  4KCD A;  3MBP A;  1R9L A;  3FXU A;  5AA3 A;  1AH5 A;  1FBH A;  1UIU A;  4IY5 A;  2H98 A;  1IMD A;  1N7W A;  1EZP A;  3K2D A;  4DE8 A;  3DRK A;  2F3D A;  5ET7 A;  3PPR A;  5AA1 A;  1IXI A;  4NWD A;  1N3X A;  1IXC A;  3O28 A;  2GRV A;  2PBW A;  4O7I A;  4OET A;  2AIX A;  1FQB A;  1B32 A;  4U1Z A;  3L6G A;  3JYR A;  4PC9 A;  3RYA A;  5K2Y A;  4H0W A;  4F3P A;  5DW8 A;  4AB5 A;  2O7I A;  4EQ9 A;  4IO5 A;  4G8M A;  4PE3 A;  2IA4 A;  4IY6 A;  2UYF A;  3PUV E;  1SVX B;  1LBC A;  1G0I A;  3IOV A;  3KBZ A;  2GQ1 A;  4RA1 A;  3DP8 A;  3K01 A;  3TUS A;  1FQF A;  1KA1 A;  1DMB A;  4JSO A;  2NXO A;  3EKI A;  3VVF A;  1Y1M A;  3FXB A;  3U1O A;  3TCH A;  5TPA A;  5I7I A;  1LST A;  1TXF A;  4I3E A;  1K9Y A;  4N8Y A;  4N8G A;  2Q88 A;  3CIJ A;  2F7A A;  1Y9U A;  1B1X A;  1MY4 A;  3DLN A;  3IJX B;  3PU5 A;  1LFH A;  2DXY A;  1LGB C;  1FPI A;  4OFL A;  4TLL B;  4DCY A;  5EHM A;  4GFR A;  4P11 A;  1RDY A;  5BWJ A;  4EXL A;  4H67 A;  4KHZ E;  3HO7 A;  2DE2 A;  1Y20 A;  4XTC Q;  1JVX A;  1QUI A;  4NF4 B;  3Q28 A;  1FQD A;  2XHD A;  3E13 X;  5IZ3 A;  4C1U A;  3RTW B;  1ZKB A;  4OEN A;  4F18 A;  4GL0 A;  5TU0 A;  4FEC A;  3N6U A;  1NUY A;  3T9U A;  2DSF A;  3USD A;  4FOR A;  2OWT A;  4HCW A;  1EYK A;  3IFA A;  2I0C A;  4ZEF A;  2RC8 A;  4YKP A;  3ECR A;  4NF6 A;  1Z7M E;  3Q26 A;  1FPJ A;  3Q25 A;  2THI A;  3PGF A;  2PYY A;  2Z8E A;  3CG1 A;  3VLV A;  1FBP A;  3DRF A;  2OZZ A;  4QBA A;  2KQZ A;  2ZNU A;  5EYF A;  1Q1K A;  3OSR A;  1NUW A;  1M5B A;  3O6H A;  4P56 A;  4I8C A;  5FHO A;  1SW5 A;  2Q9T A;  4QSE A;  4NE4 A;  1P1O A;  1XT8 A;  5IZ3 B;  3T0J A;  3S9M C;  4JWY A;  1YYZ A;  4DXB A;  3RT6 B;  4K3F A;  4R74 A;  3UP9 A;  3QMF A;  2WOK A;  3LR1 A;  1H3D A;  1MPC A;  1S9T A;  3I6V A;  1BK4 A;  3IK6 B;  1VFE A;  1DPP A;  5KZT A;  3PD8 A;  2ZNS A;  4JWO A;  3RY3 A;  3K1P A;  4Q8R A;  3QXM A;  4F39 A;  4OEU A;  2F7C A;  2XXX A;  3EN3 A;  3HV1 A;  4WED A;  3K6U A;  2W7Y A;  3IB2 A;  1N7X A;  4P1L A;  1CNQ A;  2F36 A;  2UYE A;  1B7U A;  2Q2C A;  4U4X A;  5ITO A;  3MP8 A;  1OQH A;  4NGU A;  4UA8 A;  4UAC A;  1M5F A;  1N04 A;  4XKN A;  4IO3 A;  4P3L A;  4U1O A;  1BTJ A;  3D4G A;  2OLB A;  1CE2 A;  3LUY A;  4IO6 A;  5I57 B;  3JV9 A;  1VFD A;  4JB7 A;  5EYG A;  4ELQ A;  3T9X B;  2PFZ A;  1HSE A;  4XXU A;  3BIH A;  2UXA A;  1GVC A;  4OES A;  4E0W A;  3LSF B;  2XXT A;  4NN3 A;  1B46 A;  3S9E A;  3QUF A;  3TDJ A;  2WOP A;  3CR9 A;  3IX1 A;  3PMW A;  4PF6 A;  3AXF A;  4F1Y A;  2I4C A;  5ET6 A;  1IMC A;  1POT A;  4GLI A;  2NOO A;  3C31 A;  2OCU A;  4JDF A;  1A54 A;  4ZZA A;  1MXX A;  2VPN A;  4PCD A;  5CBR A;  1B3E A;  5FTI A;  1NNF A;  1XS5 A;  2ZYM A;  2HAU A;  1AOV A;  1NKX A;  4BDQ A;  3LV0 A;  4ZEK A;  3VLW A;  4ZED A;  2ALU A;  3P7I A;  1OIB A;  1NV0 A;  5FTH A;  3DRG A;  1MDP 1;  4KPT A;  3IOW A;  4IB2 A;  1TFA A;  2VOZ A;  3TEP A;  3CSB A;  2P2A A;  4DLD A;  1MY2 A;  3KEI A;  4GVO A;  5AE4 A;  2Q8M A;  3QUJ A;  5DYH A;  1GTK A;  3MQ9 A;  4OTE A;  1MQI A;  3U94 A;  1FBC A;  5A5X B;  2REJ A;  3K6W A;  1PBQ A;  5H8Q B;  1SYI A;  5ELV A;  4LZ5 A;  3FAS A;  5A5L A;  5H8F B;  3TQL A;  1LEV A;  1B4H A;  2RC7 A;  3TTR A;  3G3G A;  1NV5 A;  3DP6 A;  1FTJ A;  4NF8 A;  5IZ1 A;  5I2N A;  4TLM B;  3C33 A;  4FEB A;  3UN6 A;  2Q74 A;  4ONY A;  3QIM A;  3IJO B;  3N94 A;  1MDQ A;  4GBW A;  1B5H A;  3KOT A;  2P3N A;  2UVJ A;  4GF8 A;  1B0L A;  5HM4 B;  3OO9 A;  4ND9 A;  4RXL A;  4XF5 A;  4GWO A;  1USY H;  3HHF A;  2QFL A;  3MPL A;  4ZDM A;  2CZH A;  2XXY A;  3TAJ A;  3CI8 A;  5M2V A;  5I2K A;  2V3Q A;  3MZ9 A;  4U21 A;  1ZIU A;  4DCX A;  4POX A;  4R6H A;  4RPN A;  3IO4 A;  4C0R A;  4BDR A;  1A55 A;  4IGT A;  3R26 A;  4RK2 A;  3DRH A;  2H4I A;  3OEK A;  1A7L A;  3OD7 A;  1MXV A;  4RY1 A;  3OSQ A;  4NF8 B;  1YZ0 A;  2V25 A;  3RQT A;  5HPQ A;  4N6P A;  2XWI A;  3JZJ A;  1MY0 A;  1IQ7 A;  3TTL A;  4XKR A;  3V83 A;  4LN5 A;  1FQC A;  4R9F A;  1AMF A;  3EQ1 A;  1IIW A;  1NV1 A;  1MM7 A;  1VR5 A;  3MUQ A;  2ANJ A;  3LVU A;  4L17 A;  2F6P A;  3MST A;  5I2K B;  4DDD A;  1Q35 A;  2VT5 A;  4NF5 B;  4N81 A;  5B70 A;  4DI4 B;  1I6A A;  1OMP A;  5H8H A;  3FUZ A;  4NF0 A;  1MXW A;  3FJ7 A;  3N6T A;  1AIV A;  3A09 A;  1FPL A;  4OVS A;  4YZZ A;  2V84 A;  1FPE A;  5CM6 A;  1FTM A;  4BDL A;  3O97 A;  4ZZE A;  5EQ8 A;  3MP6 A;  1EH3 A;  1P1U A;  4KFQ A;  2DXR A;  1SW2 A;  1DOT A;  2HHM A;  4H1X A;  1NMU A;  1BIY A;  4QFO A;  2H9B A;  4YKJ A;  4H46 A;  1FJ6 A;  3ILU B;  1PB8 A;  1A40 A;  4PDD A;  3PD9 A;  4PE5 B;  4H45 A;  1NNK A;  3RTF B;  1NV3 A;  2FYI A;  4KQP A;  1B52 A;  3S9N C;  3V8X B;  4PFU A;  2Y7R A;  4H5F A;  2H99 A;  4R2F A;  5H8H B;  3IL1 B;  4AS4 A;  3TTM A;  2I3V A;  4QHQ A; 
#chains in the Genus database with same CATH homology
 5FHN A;  3U93 A;  4DZ1 A;  1LAX A;  1US4 A;  3OEM A;  1ZJL A;  3RGY A;  5ICT A;  1FQA A;  3M3F A;  5LOM A;  3FJM A;  3KOS A;  1MH3 A;  3H7M A;  2R71 A;  3KFM A;  2R9J A;  4LZ7 A;  3N5L A;  3KJT A;  1I6Q A;  3KJ7 A;  3FVN A;  4YB7 A;  3KN3 A;  2QS3 A;  3FVO A;  4PFY A;  2AL4 A;  3SEU A;  1MXY A;  3D4C A;  3G3F A;  4PQJ A;  3TKD A;  4BLA A;  3EHU A;  5K2X A;  3TZA A;  3T9H B;  1TWY A;  3C4M A;  2XXQ A;  4RYA A;  4FAJ A;  1LLS A;  2I58 A;  3ZKK A;  4GRK A;  1ZBM A;  1YAE A;  5IKB A;  4I62 A;  1M5D A;  3L6H A;  3UA8 A;  4NF4 A;  1P1N A;  1R9Q A;  1B3F A;  2CZL A;  4O3A A;  3QAX A;  3O29 A;  3W15 C;  2XXI A;  3RLF E;  4R75 A;  3OEN A;  4RJZ A;  3RT8 A;  5KDT A;  4Q0C A;  2HZL A;  2DYX A;  3DP4 A;  1B6H A;  2V3T A;  4FE8 A;  4F1V A;  3MJN A;  2X7Q A;  2DE4 A;  2QRY A;  2H5Y A;  5DEX B;  1USY E;  2F6G A;  2QS2 A;  3H06 B;  1Y4C A;  1LFI A;  2UVG A;  3PUX E;  5CI5 A;  2Z23 A;  1T0K A;  1H45 A;  4NWC A;  3T9V A;  2QPQ A;  4HS7 A;  4OER A;  1PDA A;  5H8N B;  4JWX A;  1ELJ A;  1B3H A;  1OVT A;  3PMV A;  2F8D A;  3VXC A;  5KDT B;  1J1N A;  4HCY A;  4N13 A;  2O7U A;  2ZYN A;  2RF1 A;  2XXU A;  1O64 A;  5I84 A;  5AA4 B;  1US5 A;  4OEV A;  2HFB A;  4ELO A;  3G3K A;  5TP9 A;  2I48 A;  1Y3N A;  2A5S A;  1URS A;  4NTL A;  1XVX A;  3U92 A;  1JW1 A;  4MFI A;  1MRP A;  2ONK E;  1SD3 A;  5I59 B;  3EF7 A;  1PBP A;  4X1D A;  4PFW A;  1D9Y A;  3CFL A;  4KR5 A;  3OOA A;  4NED A;  5JEI A;  3U72 A;  1MS7 A;  3C34 A;  2F34 A;  2B3F A;  3W9W A;  3MPK A;  5FHM A;  4EDP A;  4EXK A;  3IO6 A;  1FW0 A;  4YU0 A;  1MQH A;  5CMM A;  5I57 A;  1FTO A;  3T22 A;  3G3H A;  4WEP A;  2DWJ A;  4JXI A;  1I69 A;  3CRB A;  3T93 B;  4H65 A;  1VE4 A;  1A8F A;  5TP9 B;  3KN8 A;  2Y7I A;  1ZTY A;  4H8I A;  2NUV A;  2HEU A;  4EQB A;  2B4M A;  4YIC A;  4ESX A;  2GH9 A;  1B3G A;  2NVU B;  3IOT A;  3MVX A;  2QSX A;  5CMB A;  4YMB A;  3O6I A;  5ISU A;  3VVE A;  1BKA A;  3GBA A;  1QKA A;  3E3K A;  4P0I A;  3V5A A;  3UIF A;  2YPN A;  1UIV A;  4H8J A;  3W9V A;  4HW8 A;  3RYB A;  1GGG A;  5L9S A;  3VFJ A;  1D3K A;  3OO7 A;  2AL5 A;  1NH7 A;  4FAT A;  4OVJ A;  1M5C A;  4PET A;  1WOD A;  1B58 A;  1UTH B;  4LUB A;  4Z0I A;  3MVZ A;  4WKM A;  4IO2 A;  3FVK A;  5A5X A;  2E0S A;  5H8Q A;  4OZ9 A;  2DQV A;  2DOJ A;  4RNS A;  5H8F A;  2XXW A;  3GLB A;  3G7W A;  1Y1Z A;  4FIM A;  4YMA A;  3PUY E;  4X48 A;  2Y7K A;  4QFK A;  2I0B A;  4N07 A;  2RC9 A;  2REG A;  3ODB A;  3KZG A;  1LCF A;  3PMX A;  3TYH A;  4U2R A;  4EUO A;  4R6Y A;  3KBR A;  3BFT A;  4LVQ A;  2G29 A;  3SEV A;  2O84 X;  2DS9 A;  2P0S A;  1XHY A;  2O69 A;  4H5G A;  5AA2 D;  4IGR A;  1OLC A;  3UOR A;  1B4Z A;  5H8S A;  4AQ4 A;  1B1H A;  4G8N A;  3SEX A;  4E0X A;  3HN0 A;  2DVZ A;  4OQO A;  1B0H A;  2ZNT A;  3C35 A;  4F2Q A;  2VP1 A;  3O2A A;  2HAV A;  4G2Z A;  3MC2 A;  1LFG A;  1LCT A;  3QK6 A;  3U8Q A;  3PV0 E;  2X7P A;  4G68 C;  4LAT A;  2DWH A;  3QYT A;  1IXH A;  1ATG A;  1MG1 A;  4NF5 A;  4O3C A;  3M3K A;  4R6K A;  2Y7W A;  4DXC A;  1RYO A;  3FAT A;  2O1M A;  3A3U A;  3DM0 A;  3CG3 A;  1L5T A;  4KYS A;  3LBS A;  3BKI B;  1N84 A;  1HSJ A;  5CMK A;  3RUM A;  4OWD A;  3H4Z A;  4ECF A;  1MH4 A;  4QFP A;  2F5X A;  4F3G A;  3LSL A;  1NH8 A;  3ZS6 A;  1F9B A;  3GZG A;  3MWB A;  1SW4 A;  3B6Q A;  3N26 A;  1GR2 A;  5IAI A;  2DP8 A;  3EPE A;  3WAF A;  4R73 A;  1IEJ A;  3HPI A;  5CRY A;  1UTB A;  2Z8F A;  3PUW E;  1EZO A;  3GXA A;  3MAM A;  3PPN A;  4ZE8 A;  3RN8 A;  1HSL A;  2B4L A;  3A3C A;  3FIR A;  4MF3 A;  2E1S A;  1KWH A;  1SQY A;  1R6Z A;  3THI A;  3H3G A;  1ZMG A;  4LQ5 A;  3RPW A;  5F1Q A;  1POY 1;  5L8D A;  3H6U A;  3TQW A;  4X9T A;  1JW5 A;  3CSG A;  2I49 A;  2XX9 A;  2I6E A;  2G93 A;  1O7T A;  3Q29 A;  2GHA A;  1OLA A;  5JTY A;  3VVD A;  4ESW A;  5I56 B;  1UTB B;  5AA2 B;  1YCJ A;  2O6A A;  4R72 A;  1B7H A;  4XKP A;  4HTG A;  3O6G A;  3VLU A;  1S50 A;  2UVI A;  4M4G A;  4F22 A;  4THI A;  4YB6 A;  3VE1 B;  3PPP A;  3E4R A;  1XOC A;  2KLF A;  4LZ8 A;  4POW A;  2A5T B;  2AYS A;  1I6B A;  1RKM A;  3TCG A;  4OXV A;  1S7Y A;  4IO4 A;  2F35 A;  2ABH A;  1II5 A;  3MW0 A;  5F7V A;  3B7D A;  5KCJ B;  2HXW A;  3GBB A;  2ZMB A;  4EQ7 A;  1P99 A;  4MH5 A;  1MQJ A;  4XKQ A;  1VSO A;  1DSN A;  2ZXT A;  2Z8D A;  5JTY B;  1DPE A;  3SET A;  1SW1 A;  5DEX A;  4RK9 A;  3KSJ A;  4ZEB A;  1NFT A;  3HST A;  2O51 A;  3K6V A;  1FTK A;  4OFJ A;  2CMO A;  1LAG E;  4ISU A;  4OHN A;  4F29 A;  3SEW A;  1B3L A;  3KN7 A;  4Q30 B;  4GOT A;  4ELP A;  2WOL A;  1B51 A;  2D21 A;  3VDF A;  2QL3 A;  5H8N A;  1D9V A;  3H6W A;  3OEL A;  3DRI A;  3MVW A;  1LBB A;  5ITP A;  2QS4 A;  4GL8 A;  2LAO A;  5AA4 A;  5ICQ A;  4MBP A;  3ZKL A;  3H6T A;  4I9D A;  1D4N A;  2OJT A;  2VD3 A;  1QJM A;  3QSL A;  2V93 A;  3FJG A;  3T96 B;  3TMG A;  1GV8 A;  5I59 A;  4YB5 A;  4ELR A;  1QW0 A;  2D5W A;  4LA9 A;  2FA7 A;  1ANF A;  1EU8 A;  4P0G A;  3PUZ E;  1H76 A;  3EHT A;  3DRJ A;  2F78 A;  4U23 A;  1H43 A;  4G4P A;  1SI1 A;  1MPD A;  4QFL A;  3HHG A;  1MY3 A;  1MPB A;  3O6P A;  2QMX A;  4ZEC A;  1PEB A;  1QVS A;  3S4U A;  2HCA A;  1Y3Q A;  2XD2 A;  1UQW A;  3IAZ A;  4F1U A;  1PC3 A;  4U22 A;  5TPA B;  2BJJ X;  4G8H A;  3MP1 A;  3CVG A;  2RCB A;  4QFN A;  3FV1 A;  2VHA A;  1XVY A;  4YKK A;  2XXV A;  4OYV A;  1QUL A;  3K02 A;  3OO6 A;  3RNN A;  1URG A;  2RCA A;  2XX8 A;  3O66 A;  1MY1 A;  4OMB A;  2B3B A;  2Y7P A;  3S9L C;  2XD3 A;  1UTH A;  1PB9 A;  1EZ9 A;  2FNC A;  3B6W A;  5DVJ A;  1JEV A;  1R1N A;  1N0T A;  3KSX A;  2F7B A;  3LC8 A;  3SEY A;  5L9O A;  3IOU A;  3TCF A;  3S2V A;  3OMB A;  3TFL A;  1SI0 A;  3V89 B;  1DTZ A;  1WDN A;  3FXR A;  3CHG A;  1SBP A;  4NF6 B;  1LB8 A;  2DE3 A;  1NNT A;  3SDF A;  3R6U A;  4G68 A;  4R2B A;  4AB6 A;  3E9X A;  2PMS A;  3M3L A;  3PPQ A;  2QJE A;  4OFO A;  3Q27 A;  1OVB A;  1FTL A;  4F3S A;  1P1Q A;  1A99 A;  3MVY A;  2V3U A;  1H44 A;  3K4U A;  2PX1 A;  4BDN A;  4MLV A;  5DVF A;  3KGC A;  2P1S A;  3SER A;  3TPA A;  2I3W A;  2PVU A;  4F19 A;  3FXQ A;  2Y84 A;  1XC1 A;  2VGQ A;  5HBC A;  4U4S A;  3WAE A;  1TFD A;  1QUK A;  4O3B A;  1JEU A;  4G68 B;  1IXG A;  3CFX A;  1B40 A;  4YKI A;  1MXZ A;  1Y3P A;  5EHS A;  1JVY A;  3UGW A;  1MXU A;  4BDM A;  3K00 A;  1N76 A;  2WKY A;  3OXN A;  4ZEI A;  3OO8 A;  1N3W A;  1B5I A;  4BDO A;  2M8C A;  4Z7E A;  1BLF A;  2OK2 A;  1LAH E;  3I5O A;  2DWI A;  2GFE A;  5JK4 A;  1IIT A;  2PT1 A;  4C1T A;  4DXU A;  1MQG A;  2RKM A;  4GXA A;  3MZB A;  2IEE A;  4H6D A;  4LON B;  4F2O A;  2O68 A;  4GQO A;  2Q89 A;  5CC2 A;  4PP0 A;  1B7Z A;  4XIG Q;  1JW4 A;  3K6X A;  4MLQ A;  3VXB A;  2QMW A;  2XXR A;  3I3V A;  3H03 A;  3TEL A;  5CBS A;  2QS1 A;  4QSD A;  4RPO A;  2RIN A;  5CMC A;  1JNF A;  4DIG A;  1TT1 A;  3G3J A;  3MZ1 A;  1SDX A;  3G3I A;  4KYE A;  1PB7 A;  3K0V A;  1DTG A;  3FVG A;  3FGS A;  3LSW A;  3FTO A;  3ZSF A;  1IZ1 A;  4R9G A;  1A8E A;  3F11 A;  1ZLQ A;  3TOD A;  3PPO A;  4JBZ A;  2F97 A;  3PAM A;  3K1M A;  1JQF A;  4GIZ A;  1M5E A;  1WVJ A;  2Z22 A;  1JET A;  4FED A;  3DEL B;  2UVH A;  3C32 A;  5L9M A;  2HQ0 A;  1NL5 A;  4IO7 A;  3HCQ A;  2I4B A;  2B65 A;  3BBR A;  3IOR A;  1AL3 A;  4G77 A;  4TOZ A;  2HZK A;  3FV2 A;  3UK4 A;  2OWS A;  4ZS9 A;  3LSX A;  2ZYO A;  4YAH X;  2XXH A;  2O1L A;  2ZYK A;  4LQ2 A;  1CB6 A;  2GHB A;  5DT6 A;  1RYX A;  1B5J A;  1LB9 A;  5I2N B;  1O63 A;  2ONR A;  1B2H A;  2ESN A;  2D3I A;  2YLN A;  5I56 A;  1SYH A;  5J1D A;  2DVC A;  5AA2 A;  1URD A;  5I58 A;  1QUJ A;  2ONS A;  3IR1 A;  4EF1 A;  1QKB A;  1BP5 A;  1OQG A;  4QF9 A;  2VD2 A;  3SES A;  4ZE9 A;  1IUD A;  2DWA A;  2A5T A;  4TQU Q;  5DTB A;  3ILT B;  3TTN A;  1FCK A;  4QSC A;  4PFT A;  5KCJ A;  3ONM A;  1NNP A;  1P1W A;  3C9H A;  2H25 A;  1Z7N E;  4LP2 B;  4GXS B;  4F3B A;  3FZV A;  2OBG A;  3H6V A;  2YJP A;  4KYD A;  2NWJ A;  4M1V A;  3CFZ A;  2X26 A;  5BUU A;  1YTV A;  4NMY A;  4KI0 E;  3KG2 A;  2XXP A;  3FD3 A;  2R6G E;  3B6T A;  4QRZ A;  1YPN A;  3TTK A;  3EHS A;  5DVI A;  3IB0 A;  4KD5 A;  1B05 A;  4I1D A;  5I58 B;  1B9J A;  1ZU0 A;  4F31 B;  2Q8J A;  3O9P A;  1MQD A;  3IB1 A;  3M8U A;  1FQE A;  1LAF E;  5B7D A;  3K1N A;  4KCC A;  1Y4T A;  4Q5T A;  3R7X A;  4WXJ A;  2XX7 A;  2Q2A A;  4JSD A;  2PT2 A;  4FJP A;  3SKP A;  4X1B A;  4EF2 A;  3BFU A;  3T66 A;  3C36 A;  3VV5 A;  1MM6 A;  4GD5 A;  4KCD A;  3MBP A;  1R9L A;  3FXU A;  5AA3 A;  1AH5 A;  1UIU A;  4IY5 A;  2H98 A;  1N7W A;  1EZP A;  3K2D A;  4DE8 A;  3DRK A;  3PPR A;  5AA1 A;  1IXI A;  4NWD A;  1N3X A;  1IXC A;  3O28 A;  2GRV A;  2PBW A;  4OET A;  2AIX A;  1FQB A;  1B32 A;  4U1Z A;  3L6G A;  3JYR A;  3RYA A;  5K2Y A;  4H0W A;  4F3P A;  4AB5 A;  2O7I A;  4EQ9 A;  4IO5 A;  4G8M A;  2IA4 A;  4IY6 A;  2UYF A;  3PUV E;  1SVX B;  1LBC A;  3IOV A;  4RA1 A;  3DP8 A;  3K01 A;  3TUS A;  1FQF A;  1DMB A;  4JSO A;  2NXO A;  3VVF A;  1Y1M A;  3U1O A;  3TCH A;  5TPA A;  1LST A;  1TXF A;  2Q88 A;  3CIJ A;  2F7A A;  1Y9U A;  1B1X A;  1MY4 A;  3DLN A;  3IJX B;  3PU5 A;  1LFH A;  2DXY A;  1LGB C;  4OFL A;  4TLL B;  4DCY A;  5EHM A;  4GFR A;  4P11 A;  5BWJ A;  4EXL A;  4H67 A;  4KHZ E;  3HO7 A;  2DE2 A;  1Y20 A;  4XTC Q;  1JVX A;  1QUI A;  4NF4 B;  3Q28 A;  1FQD A;  2XHD A;  3E13 X;  4C1U A;  3RTW B;  1ZKB A;  4OEN A;  4F18 A;  4GL0 A;  5TU0 A;  4FEC A;  3N6U A;  3T9U A;  2DSF A;  3USD A;  4FOR A;  2OWT A;  4HCW A;  2I0C A;  4ZEF A;  2RC8 A;  4YKP A;  3ECR A;  4NF6 A;  1Z7M E;  3Q26 A;  3Q25 A;  2THI A;  3PGF A;  2PYY A;  2Z8E A;  3CG1 A;  3VLV A;  3DRF A;  2OZZ A;  2ZNU A;  5EYF A;  1Q1K A;  3OSR A;  1M5B A;  3O6H A;  4I8C A;  5FHO A;  1SW5 A;  2Q9T A;  4QSE A;  4NE4 A;  1P1O A;  1XT8 A;  3S9M C;  4JWY A;  4DXB A;  3RT6 B;  4K3F A;  4R74 A;  3UP9 A;  2WOK A;  3LR1 A;  1H3D A;  1MPC A;  1S9T A;  3I6V A;  3IK6 B;  1VFE A;  1DPP A;  5KZT A;  3PD8 A;  2ZNS A;  4JWO A;  3RY3 A;  3K1P A;  4Q8R A;  3QXM A;  4F39 A;  4OEU A;  2F7C A;  2XXX A;  3EN3 A;  3HV1 A;  4WED A;  3K6U A;  2W7Y A;  3IB2 A;  1N7X A;  2F36 A;  2UYE A;  1B7U A;  2Q2C A;  4U4X A;  5ITO A;  3MP8 A;  1OQH A;  4UA8 A;  4UAC A;  1M5F A;  1N04 A;  4XKN A;  4IO3 A;  4U1O A;  1BTJ A;  3D4G A;  2OLB A;  1CE2 A;  3LUY A;  4IO6 A;  5I57 B;  3JV9 A;  1VFD A;  4JB7 A;  4ELQ A;  3T9X B;  1HSE A;  4XXU A;  2UXA A;  1GVC A;  4OES A;  4E0W A;  3LSF B;  2XXT A;  1B46 A;  3S9E A;  3QUF A;  3TDJ A;  2WOP A;  3CR9 A;  3IX1 A;  3PMW A;  3AXF A;  4F1Y A;  2I4C A;  1POT A;  4GLI A;  2NOO A;  3C31 A;  2OCU A;  4JDF A;  1A54 A;  4ZZA A;  1MXX A;  5CBR A;  1B3E A;  5FTI A;  1NNF A;  1XS5 A;  2ZYM A;  2HAU A;  1AOV A;  1NKX A;  4BDQ A;  4ZEK A;  3VLW A;  4ZED A;  2ALU A;  3P7I A;  1OIB A;  5FTH A;  3DRG A;  1MDP 1;  4KPT A;  3IOW A;  4IB2 A;  1TFA A;  2VOZ A;  3TEP A;  3CSB A;  2P2A A;  4DLD A;  1MY2 A;  3KEI A;  4GVO A;  5AE4 A;  3QUJ A;  5DYH A;  1GTK A;  3MQ9 A;  4OTE A;  1MQI A;  3U94 A;  5A5X B;  2REJ A;  3K6W A;  1PBQ A;  5H8Q B;  1SYI A;  5ELV A;  4LZ5 A;  3FAS A;  5H8F B;  3TQL A;  1B4H A;  2RC7 A;  3TTR A;  3G3G A;  3DP6 A;  1FTJ A;  4NF8 A;  5I2N A;  4TLM B;  3C33 A;  4FEB A;  3UN6 A;  4ONY A;  3QIM A;  3IJO B;  3N94 A;  1MDQ A;  1B5H A;  3KOT A;  2UVJ A;  4GF8 A;  1B0L A;  5HM4 B;  3OO9 A;  4ND9 A;  4RXL A;  4GWO A;  1USY H;  3HHF A;  3MPL A;  4ZDM A;  2XXY A;  3TAJ A;  3CI8 A;  5M2V A;  5I2K A;  2V3Q A;  3MZ9 A;  4U21 A;  1ZIU A;  4DCX A;  4POX A;  4R6H A;  4RPN A;  3IO4 A;  4C0R A;  4BDR A;  1A55 A;  4IGT A;  3R26 A;  4RK2 A;  3DRH A;  2H4I A;  3OEK A;  1A7L A;  3OD7 A;  1MXV A;  4RY1 A;  3OSQ A;  4NF8 B;  2V25 A;  3RQT A;  5HPQ A;  4N6P A;  3JZJ A;  1MY0 A;  1IQ7 A;  3TTL A;  4XKR A;  3V83 A;  1FQC A;  4R9F A;  1AMF A;  3EQ1 A;  1IIW A;  1MM7 A;  1VR5 A;  3MUQ A;  2ANJ A;  3LVU A;  4L17 A;  2F6P A;  5I2K B;  4DDD A;  1Q35 A;  4NF5 B;  5B70 A;  1I6A A;  1OMP A;  5H8H A;  3FUZ A;  1MXW A;  3FJ7 A;  3N6T A;  1AIV A;  3A09 A;  4YZZ A;  2V84 A;  5CM6 A;  1FTM A;  4BDL A;  3O97 A;  4ZZE A;  3MP6 A;  1EH3 A;  1P1U A;  4KFQ A;  2DXR A;  1SW2 A;  1DOT A;  4H1X A;  1NMU A;  1BIY A;  4QFO A;  2H9B A;  4YKJ A;  3ILU B;  1PB8 A;  1A40 A;  3PD9 A;  4PE5 B;  1NNK A;  3RTF B;  2FYI A;  4KQP A;  1B52 A;  3S9N C;  3V8X B;  4PFU A;  2Y7R A;  4H5F A;  2H99 A;  4R2F A;  5H8H B;  3IL1 B;  3TTM A;  2I3V A;  4QHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...