2RKMA

Structure of oppa complexed with lys-lys
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title Peptide binding in OppA, the crystal structures of the periplasmic oligopeptide binding protein in the unliganded form and in complex with lysyllysine.
pubmed doi rcsb
total genus 186
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1997-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 2rkmA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2rkmA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 2rkmA02
2Q88A 3VLVA 3VDFA 3GBBA 3RTFB 2QS1A 3OELA 2OK2A 2AYSA 2AL5A 4U23A 3SKPA 5K2YA 2ALUA 2B65A 3HV1A 1B58A 4F22A 1Q1KA 3MJNA 4F3PA 4H5FA 1EZPA 2NXOA 2DWAA 1IQ7A 1PBPA 1DPEA 3ILUB 4HTGA 1HSLA 1N0TA 4O3CA 3CSBA 4DCYA 3PPOA 3SESA 5TPAB 4U4XA 1B3FA 3G3GA 3N6TA 4TLLB 4XTCQ 1Y4CA 2XXIA 3IR1A 4R9GA 2B4MA 1UTHA 3PMVA 1SW1A 4GXAA 4IO2A 4GWOA 3TMGA 1UIVA 1NNPA 3CI8A 1SYIA 3PUVE 5H8QA 3N6UA 1N04A 5CM6A 1J1NA 2B3FA 4HW8A 3IB1A 5I57B 3H4ZA 4IY6A 4JWOA 3MVZA 5AA4B 4RPNA 2VP1A 1T0KA 3BKIB 1FTLA 1B7HA 1D9VA 3B7DA 1OLCA 1LCTA 5ICQA 2ANJA 3IORA 5I84A 4R9FA 5AE4A 2XX7A 1MXYA 3ZKKA 1P1NA 4U1ZA 3Q27A 4QFKA 3ZS6A 4DXBA 3FIRA 4BDRA 4BLAA 4IY5A 3FV1A 2DP8A 1P1OA 1XVYA 4GXSB 2F5XA 5LOMA 3GBAA 5I2NB 4ISUA 2XXRA 4U1OA 3K01A 2ZMBA 3WAEA 1ZLQA 1OQHA 3T9HB 4DLDA 1EZ9A 4PQJA 3T9UA 2FA7A 4ESWA 4KCDA 4N6PA 1SBPA 5CBSA 1FQFA 3FJMA 2IA4A 2BJJX 3UA8A 1QKAA 5J1DA 2PT2A 3I3VA 4WKMA 5IAIA 3HO7A 3PUWE 3ECRA 1JQFA 3SEXA 1MM7A 3M3KA 2HQ0A 3ZKLA 2Y7KA 5AA1A 1R9QA 1A40A 3G3IA 4U22A 1SYHA 2I6EA 2PT1A 2Q8JA 1IEJA 2FNCA 4BDLA 1NH7A 1JNFA 2E0SA 5DEXA 3MQ9A 4OETA 3TYHA 1II5A 5ITOA 4PFTA 5FTIA 4G2ZA 3CVGA 3V8XB 2VGQA 2E1SA 4KR5A 4BDOA 4GL8A 1I6AA 1B1HA 3TCHA 2PX1A 1O7TA 3CG3A 4U2RA 5I58A 4RY1A 4EQ9A 3E4RA 2XXXA 2R71A 3ONMA 1QW0A 4WEPA 1Y20A 3A3UA 4QFPA 2PMSA 2XXPA 3FATA 4R72A 4R2BA 4RXLA 1SW4A 2KLFA 4XIGQ 3KBRA 3IAZA 2F8DA 3RNNA 3RGYA 1LAXA 4FE8A 5F1QA 1MPCA 1XHYA 4QFOA 4F3GA 3O66A 3KN7A 1IXHA 3LSFB 4MH5A 4YB6A 2DQVA 2Z8EA 3F11A 2VHAA 4H5GA 4NF4A 1MQHA 2DYXA 2DVCA 3L6HA 2M8CA 4KYEA 4PE5B 1AH5A 3HHGA 4F1YA 4EXKA 4RJZA 2D5WA 3U93A 1DTGA 4JWYA 3SEVA 2AL4A 1JEVA 4JBZA 3EQ1A 2ONSA 3LVUA 4YKKA 1QUKA 4OVJA 2XD3A 1JETA 3IJXB 3OO6A 2V84A 3TQLA 3PUZE 3USDA 2THIA 1LGBC 2A5TA 5FTHA 3MBPA 3U92A 1A8FA 4NWDA 2GRVA 1NNFA 4K3FA 4XKRA 3KJ7A 3H6WA 4GD5A 4F2QA 4Z0IA 4R75A 2XXYA 4G68A 3OD7A 2OBGA 5AA2B 3QAXA 3FJ7A 5TP9B 1MY1A 3TTMA 1M5CA 2HAUA 1M5FA 1MY4A 3RUMA 3ZSFA 1QULA 3LSLA 1O64A 1ZJLA 4H0WA 4EDPA 4XKPA 1N7XA 1FCKA 1GR2A 3CR9A 4TLMB 3K6VA 1CE2A 3DRFA 4DE8A 2QPQA 2OWSA 3K6WA 2F7BA 2O1LA 2F35A 3OO8A 3G3FA 5EHMA 4F1VA 4H1XA 3H6VA 2UVIA 3LSWA 3ILTB 1FW0A 2RC7A 1I69A 1MM6A 4BDMA 4PFYA 1GVCA 5CMCA 4OXVA 1B3LA 4PP0A 5H8NB 5M2VA 3PPNA 4NTLA 3MZBA 4H65A 4YB7A 4YKPA 2XXVA 5L9OA 1B9JA 1MH4A 3UP9A 3N94A 1UQWA 2CMOA 1BP5A 2NOOA 3K0VA 1A7LA 4LONB 5CRYA 2REJA 1B40A 3RY3A 2OJTA 3EPEA 4EXLA 5L8DA 1Y3PA 3HSTA 3TQWA 4FATA 1GV8A 2V25A 1OIBA 4OEVA 1MY2A 3K6XA 2DVZA 4FAJA 1S50A 1PDAA 3H3GA 1PEBA 4IGTA 1OVTA 2O68A 5TPAA 3KOSA 3OEMA 2NVUB 1ZIUA 1URDA 1DTZA 1MDQA 1WODA 4JWXA 4NE4A 4F29A 3TODA 1D9YA 3C32A 4YB5A 3TZAA 3V83A 4H6DA 4C0RA 4R73A 1S9TA 2OWTA 2UXAA 1IXCA 3MW0A 4ZEDA 3VVEA 5ISUA 2F97A 1A99A 2QMWA 1YCJA 4WXJA 1LB9A 1O63A 3VV5A 1R6ZA 4RA1A 4GQOA 3S9EA 1B52A 2H98A 4PFUA 2NWJA 3M8UA 3G7WA 3SERA 4QSEA 1IUDA 3B6WA 3FV2A 3KOTA 4O3BA 3CFXA 2P2AA 1B5HA 4KQPA 3C4MA 1UTBA 1M5DA 3PUYE 4Q8RA 4JSOA 3DP6A 5HM4B 4ECFA 4ND9A 2QRYA 3RT8A 3FXRA 2ZYNA 2ABHA 2DWIA 3CFZA 3CG1A 4YU0A 4ZZEA 2D21A 1L5TA 1ZTYA 1A8EA 4IO3A 1TXFA 1VE4A 2GH9A 3KJTA 3K1MA 3DRKA 4GF8A 3D4CA 3MAMA 2OCUA 2FYIA 2ZYKA 4YMBA 1N84A 3MP8A 5H8FA 2DSFA 5I2KB 4POXA 4KPTA 3QIMA 2O84X 1P1QA 3FXUA 4OMBA 3PPQA 4NF5A 2I58A 1JW5A 1PBQA 1ZBMA 4LZ8A 4H67A 1MXZA 4GVOA 4UA8A 1PB8A 1B4ZA 5IKBA 4OFLA 1GGGA 1N3WA 3U8QA 5HBCA 3TCFA 3KEIA 4Q30B 4BDNA 4KHZE 4ELQA 1WVJA 4G8NA 1JEUA 1YPNA 3CRBA 3QUFA 3FJGA 4LQ2A 1S7YA 3TTKA 3THIA 2YPNA 4FEBA 2XXTA 5KCJA 4G8MA 4M1VA 1IITA 1FTMA 3PPPA 4KI0E 1N76A 1Y9UA 3O6GA 1TFDA 4EUOA 1D3KA 3O28A 4F2OA 2O6AA 3QXMA 1SW5A 3LC8A 5KZTA 5ITPA 5KDTA 3TTRA 3DM0A 4PFWA 3O6HA 1IIWA 5AA3A 4F1UA 5HPQA 1TT1A 3K1NA 4MLVA 3KGCA 4NEDA 1NH8A 5DVJA 1SQYA 2YJPA 3H06B 1UTHB 3VXCA 4I62A 2WOLA 1MXVA 4C1UA 2Q9TA 4OERA 3RYAA 2AIXA 2HAVA 2RC9A 4ZDMA 3IB0A 3C33A 4HCYA 3Q28A 2I4CA 2F78A 2H25A 2DE3A 4DDDA 4YICA 2F6GA 1JW4A 4F19A 1EZOA 4QFNA 3MZ9A 1XC1A 3UGWA 1ZMGA 1B3EA 3A09A 3IJOB 4PETA 4OFJA 3OSRA 1MQJA 4X9TA 4ELPA 1IZ1A 5L9MA 5I56A 5L9SA 4ESXA 2REGA 1HSJA 2ZYMA 1SI1A 1A55A 1MPBA 4QSCA 1FTOA 1KWHA 1SI0A 4R74A 3IO4A 5JTYB 1FQCA 3U72A 1XS5A 2UVGA 3T22A 4RYAA 3BBRA 2RKMA 3CSGA 4IO6A 2P1SA 3AXFA 1RYXA 2ZNUA 5BUUA 1MPDA 1BIYA 4WEDA 3SEUA 1B5JA 4JSDA 3FZVA 4JXIA 2I49A 3MWBA 1SW2A 3C9HA 4GFRA 5ELVA 1R9LA 3H7MA 2HEUA 2HXWA 4KCCA 4LUBA 4MF3A 3V5AA 3M3LA 3PMWA 4ONYA 1Z7ME 1LLSA 3PD9A 5H8HB 5A5XB 4UACA 5FHOA 3TTLA 3N26A 3MPLA 3KN8A 1P1UA 3HCQA 2O7IA 3PV0E 4XXUA 4F3BA 1B51A 4RK9A 5H8NA 1B3GA 3R7XA 3EN3A 3WAFA 4G68C 4LZ7A 2VD2A 5F7VA 3P7IA 5CI5A 2ZNTA 4X1DA 4HCWA 1M5BA 1LBCA 3DP8A 1DPPA 3S4UA 1URSA 3U1OA 2V3QA 1SVXB 1LFIA 5I58B 3E9XA 5DYHA 1MXUA 4F3SA 4THIA 2QS2A 5I59A 1NL5A 4L17A 1PB9A 2O1MA 4I8CA 3G3KA 1P1WA 2F7AA 4P0GA 1B6HA 3OENA 3IOTA 4YAHX 2GHBA 4FECA 1ZKBA 2RCBA 1JVXA 5JEIA 1LFGA 4YMAA 2Y7IA 3TTNA 1POTA 3IOWA 4M4GA 4OENA 4F31B 2DE2A 3TUSA 1AIVA 2ONRA 1LAFE 4G77A 1Z7NE 4LZ5A 1USYE 4IB2A 4JDFA 1DSNA 2RINA 3FUZA 2Q2AA 3K4UA 1Q35A 3GLBA 4TOZA 2QSXA 3U94A 3K2DA 4OYVA 4I1DA 3MP1A 3IO6A 1D4NA 1MXXA 2X7PA 3TCGA 3OO7A 2XX8A 4QSDA 1I6BA 4N13A 5EYFA 3EHTA 1EH3A 1MH3A 3A3CA 4KD5A 4F39A 5CBRA 1AOVA 1HSEA 1H3DA 5DTBA 1OLAA 4G68B 3RTWB 3FTOA 3K6UA 4EF2A 2GHAA 2R6GE 1LFHA 3W15C 4KYSA 3TPAA 2HZKA 1Y4TA 3G3JA 3FASA 2QL3A 4XKNA 4G8HA 4ZEFA 1NKXA 4OFOA 1IXIA 2ZYOA 4NF8B 3VVDA 2OZZA 4NF6B 5I57A 3BFTA 1B7UA 1B0HA 4YZZA 1H45A 1TFAA 2CZLA 1RKMA 1URGA 5AA4A 2RF1A 3O2AA 3RYBA 3RT6B 3FVOA 3R26A 3FVGA 3O6IA 4EQBA 3S9MC 1WDNA 4Q0CA 1RYOA 3K1PA 1Y1MA 1MQDA 4XKQA 1IXGA 5EHSA 4R6HA 2V3TA 3SETA 1A54A 3MUQA 4IGRA 3VE1B 2Y84A 3VLWA 3GXAA 2QJEA 4POWA 4U4SA 3E3KA 3OMBA 4OEUA 4AB5A 2PBWA 2HCAA 3B6TA 3W9WA 2G29A 4OHNA 5I2NA 3CFLA 2X7QA 1XVXA 3N5LA 1Y3NA 1BLFA 1MDP1 4OESA 2Z8FA 3UIFA 4QF9A 3OEKA 4FIMA 1MS7A 3PMXA 3Q29A 4R2FA 4RK2A 3T96B 2O69A 3MC2A 4H8JA 3S2VA 3FXQA 4ZZAA 1B4HA 1GTKA 1NNTA 1B46A 1VFDA 2A5SA 3MVYA 1XT8A 3O6PA 3SDFA 4OTEA 3TEPA 3JV9A 4QFLA 4ELRA 4GLIA 2Q89A 3VFJA 5H8SA 1JW1A 2XX9A 1P99A 2I3WA 3SEWA 3RPWA 2QS3A 2H9BA 3C35A 2O51A 1LB8A 4HS7A 1FTJA 2Y7RA 4ZS9A 3DRJA 2DXYA 1H43A 3L6GA 4RNSA 4Q5TA 2UYFA 2H99A 1FQBA 4R6KA 1F9BA 3PAMA 1POY1 3RLFE 3CHGA 2Z22A 4ZEBA 3H6UA 4P0IA 2DE4A 2D3IA 4AQ4A 4MFIA 1Y1ZA 5JTYA 1UTBB 5JK4A 2WOKA 1MQIA 4ZEIA 2F34A 1YTVA 3ODBA 1AMFA 2WOPA 1B5IA 1MXWA 3HHFA 3KSXA 1CB6A 1US4A 1ATGA 2LAOA 3K02A 4KYDA 3C36A 4FEDA 3OOAA 5K2XA 1VSOA 3PU5A 3S9NC 2DOJA 4YKJA 1LAHE 2NUVA 5BWJA 4X48A 2WKYA 3E13X 3KG2A 1TWYA 3M3FA 4R6YA 5H8FB 3JZJA 3KZGA 4TQUQ 2QS4A 5CMBA 1Y3QA 4LQ5A 5H8QB 1QUIA 5H8HA 3DP4A 1B32A 5A5XA 5ICTA 2PVUA 4IO7A 4DXUA 4NF5B 3QUJA 3VLUA 3OSQA 3QK6A 2I48A 2ZNSA 4GOTA 3O29A 4ZE8A 1DMBA 2Y7WA 4E0WA 4RPOA 3T66A 2YLNA 3CIJA 3Q26A 2XHDA 3IOVA 1LBBA 4U21A 5CMMA 4OWDA 2I3VA 3TDJA 2OLBA 2I0CA 1H44A 2I0BA 3RN8A 2DS9A 5TU0A 3IK6B 5KCJB 2ZXTA 2ONKE 5AA2A 3BFUA 5TP9A 1B0LA 4GL0A 3PPRA 4LVQA 1QJMA 4P11A 3IB2A 3H6TA 3C31A 4YKIA 2UVHA 3FVKA 4N07A 1NFTA 3DRIA 3K00A 4H8IA 5KDTB 3W9VA 1OMPA 4QRZA 2DWJA 2V93A 2RCAA 2F6PA 2HZLA 1EU8A 4KFQA 2P0SA 1FTKA 3TELA 1JVYA 2XXQA 1BKAA 4AB6A 1VFEA 3T9XB 1FQEA 3PD8A 3FD3A 3LUYA 3MP6A 2XXWA 2DXRA 3MPKA 4O3AA 1N3XA 3SEYA 2Z8DA 3LSXA 4F18A 4DXCA 3PGFA 2Z23A 4OQOA 3HPIA 3DLNA 3C34A 1N7WA 5DEXB 3EHSA 1MG1A 2I4BA 1M5EA 3TFLA 3VVFA 1H76A 2XXUA 2VOZA 3S9LC 3B6QA 5I56B 4ZEKA 3UORA 1US5A 3EHUA 3LBSA 4Z7EA 2ESNA 2PYYA 4LATA 3GZGA 3Q25A 3PUXE 3QYTA 2F7CA 4DCXA 1NMUA 2R9JA 2B4LA 1OVBA 3MZ1A 3QSLA 2V3UA 1ANFA 2B3BA 1R1NA 4NWCA 2UYEA 1I6QA 1B2HA 1UIUA 2VD3A 1LAGE 3UN6A 4X1BA 3H03A 2W7YA 4LP2B 4DZ1A 2HFBA 1XOCA 4DIGA 5DVFA 3IOUA 1NNKA 4NF8A 5B70A 4NF4B 4NF6A 4ZECA 4OZ9A 1FQDA 4MBPA 3MVXA 4GRKA 1QVSA 4MLQA 2UVJA 1MY3A 1OQGA 3DRHA 1QUJA 3DRGA 3T93B 3IL1B 1B1XA 4IO4A 5CMKA 1ZU0A 1SD3A 4QHQA 3OXNA 3D4GA 1QKBA 2H4IA 3T9VA 1FQAA 1MY0A 4EQ7A 4G4PA 3RQTA 3TKDA 5FHMA 2IEEA 4C1TA 3I5OA 4JB7A 3UK4A 4GIZA 2A5TB 5AA2D 3KSJA 1LSTA 3EF7A 1AL3A 1SDXA 1B7ZA 1MQGA 3O9PA 2F36A 5DVIA 1B05A 2XXHA 1DOTA 1USYH 4NMYA 4ELOA 2X26A 1MRPA 3O97A 2Q2CA 4FORA 5I59B 4EF1A 2O7UA 2Y7PA 3KFMA 3TAJA 1BTJA 3KN3A 5B7DA 1PC3A 5I2KA 4BDQA 3DELB 3FVNA 5CC2A 1PB7A 5DT6A 4I9DA 2RC8A 3VXBA 1YAEA 5FHNA 1VR5A 3MVWA 2G93A 2H5YA 3V89B 3R6UA 3IX1A 3I6VA 2QMXA 2XD2A 4E0XA 1B3HA 4FJPA 4LA9A 3JYRA 1ELJA 2GFEA 1LCFA 3LR1A 4IO5A 2DWHA 4ZE9A 3G3HA 3OO9A 3FGSA 3HN0A
chains in the Genus database with same CATH superfamily
2Q88A 3VLVA 3VDFA 3GBBA 3RTFB 2QS1A 3OELA 2OK2A 2AYSA 2AL5A 4U23A 3SKPA 5K2YA 1YXIA 1FJ6A 2ALUA 2B65A 3HV1A 1B58A 4F22A 1Q1KA 3MJNA 4F3PA 4H5FA 1EZPA 2NXOA 2DWAA 1IQ7A 1PBPA 5EYGA 4DI4B 1DPEA 3ILUB 4HTGA 1HSLA 1N0TA 4O3CA 3CSBA 4DCYA 3PPOA 3SESA 1LBZA 5TPAB 4U4XA 1B3FA 3G3GA 3N6TA 4TLLB 4GX3A 4XTCQ 1Y4CA 2XXIA 3IR1A 4R9GA 2B4MA 2DDKA 1UTHA 4QXDA 3PMVA 1SW1A 4GXAA 4IO2A 4GWOA 3TMGA 1UIVA 1NNPA 3CI8A 1SYIA 3PUVE 5H8QA 5I3SA 3N6UA 1IMDA 1RDXA 1N04A 5CM6A 4I3EA 1J1NA 2B3FA 4HW8A 3IB1A 5I57B 4OVSA 3H4ZA 4IY6A 4JWOA 3MVZA 5AA4B 4RPNA 2VP1A 1NV3A 1T0KA 3BKIB 1FTLA 1B7HA 4JVDA 1D9VA 4JVIA 3B7DA 1OLCA 1LCTA 5ICQA 2ANJA 2ZZXA 3IORA 5I84A 4R9FA 5AE4A 2XX7A 1MXYA 3ZKKA 1P1NA 4U1ZA 1IMCA 3Q27A 4QFKA 3ZS6A 4DXBA 3FIRA 4BDRA 4BLAA 4IY5A 2PFZA 3FV1A 2DP8A 1P1OA 1XVYA 4GXSB 2F5XA 5LOMA 3GBAA 5I2NB 4P9KA 4ISUA 3RPLA 4N4UA 2QVVA 2XXRA 4U1OA 4OVRA 3K01A 2MKZA 2ZMBA 4MNIA 3WAEA 1ZLQA 1OQHA 4NX1A 3T9HB 4MX6A 4DLDA 4NQ8A 1EZ9A 4PQJA 5EQ8A 4XFEA 3T9UA 2FA7A 4ESWA 4KCDA 4N6PA 1SBPA 5CBSA 1FQFA 3FJMA 2IA4A 1AWBA 2BJJX 3UA8A 1QKAA 5J1DA 2PT2A 3I3VA 4WKMA 5IAIA 3HO7A 3PUWE 3ECRA 1JQFA 4OVPA 4XEQA 3SEXA 1MM7A 3M3KA 2HQ0A 1SPIA 5IM2A 3ZKLA 2Y7KA 1FPDA 5AA1A 1R9QA 5IZ3A 1A40A 2PCRA 3G3IA 4U22A 1SYHA 1NUXA 4PFBA 2I6EA 2PT1A 2Q8JA 1IEJA 1RDZA 2FNCA 4BDLA 1NH7A 4GWUA 1JNFA 2P3VA 2E0SA 5DEXA 3MQ9A 4OETA 3TYHA 1II5A 5ITOA 4PFTA 5FTIA 4G2ZA 2OX3A 3CVGA 3V8XB 2VGQA 2XWOA 2E1SA 4KR5A 4BDOA 4GL8A 1I6AA 1B1HA 3TCHA 2PX1A 1O7TA 3CG3A 4AS5A 4U2RA 5I58A 4RY1A 4EQ9A 3E4RA 2XXXA 1FPKA 2R71A 3ONMA 1QW0A 4WEPA 4PF8A 1Y20A 3A3UA 4QFPA 2PMSA 2XXPA 3FATA 4R72A 4R2BA 4RXLA 1SW4A 4NN3A 2KLFA 2JJKA 4XIGQ 3KBRA 3IAZA 4QBAA 2F8DA 3RNNA 3RGYA 1LAXA 4FE8A 1RDYA 5F1QA 1MPCA 1XHYA 4QFOA 4F3GA 2F3DA 3O66A 3KN7A 3U65A 1IXHA 3LSFB 4MH5A 4YB6A 2DQVA 2Z8EA 3F11A 2VHAA 4H5GA 4NF4A 1MQHA 2DYXA 2DVCA 2OWZA 1KA0A 3L6HA 2M8CA 1YYZA 4KYEA 4PE5B 1AH5A 3HHGA 4F1YA 1K9ZA 4EXKA 4RJZA 2D5WA 3U93A 1DTGA 4JWYA 3SEVA 2AL4A 1JEVA 4JBZA 3EQ1A 2ONSA 3LVUA 4YKKA 1QUKA 4OVJA 2XD3A 3LV0A 1IMFA 2QFLA 1JETA 3IJXB 3OO6A 2V84A 3TQLA 3PUZE 3USDA 2THIA 1NI9A 2FIXA 1LGBC 2A5TA 5FTHA 3MBPA 3U92A 1A8FA 4NWDA 2GRVA 1NNFA 4K3FA 3IFAA 2V4CA 4XKRA 3KJ7A 3H6WA 4GD5A 4F2QA 4P56A 4Z0IA 4R75A 4N17A 2XXYA 4G68A 3OD7A 4O94A 2OBGA 5AA2B 3QAXA 4PAIA 2FVZA 3FJ7A 5TP9B 1MY1A 1M5CA 3TTMA 2HAUA 1M5FA 1MY4A 3RUMA 3ZSFA 1QULA 3LSLA 4PE3A 1O64A 3LUZA 1ZJLA 4H0WA 4EDPA 4XKPA 1N7XA 1FCKA 1GR2A 3CR9A 4TLMB 3K6VA 1CE2A 2ZZVA 3DRFA 4DE8A 2QPQA 2FIEA 2OWSA 3K6WA 2F7BA 3KC0A 4PCDA 2O1LA 2F35A 3OO8A 3G3FA 5EHMA 4F1VA 1FJ9A 4H1XA 3H6VA 2UVIA 4MNCA 3LSWA 3ILTB 5IGAA 1FW0A 2RC7A 1I69A 1MM6A 4BDMA 4PFYA 4PAKA 1GVCA 5CMCA 4OXVA 1B3LA 4PP0A 5H8NB 5M2VA 2WX9A 3PPNA 4NTLA 3MZBA 4H65A 4YB7A 4YKPA 2XXVA 5L9OA 1B9JA 1MH4A 3UP9A 3N94A 1UQWA 5ESYA 2CMOA 1BP5A 2NOOA 3K0VA 1A7LA 4LONB 5CRYA 3ROJA 2REJA 1B40A 3B50A 4H45A 3RY3A 2OJTA 4I40A 3EPEA 4EXLA 5L8DA 1Y3PA 3HSTA 3TQWA 4FATA 1GV8A 2V25A 1OIBA 4OEVA 1MY2A 3K6XA 4P3LA 1LBWA 2DVZA 4HE1A 4FAJA 2WBBA 1S50A 1PDAA 3H3GA 1PEBA 4IGTA 1OVTA 2O68A 3E79A 5TPAA 3KOSA 3OEMA 2NVUB 1ZIUA 1URDA 1DTZA 1MDQA 4PGPA 1WODA 4JWXA 4NE4A 4F29A 3TODA 1D9YA 3C32A 4N6KA 4YB5A 3TZAA 3V83A 1EYJA 4H6DA 4C0RA 4R73A 5EQAA 1FTAA 1S9TA 2OWTA 2UXAA 1IXCA 3MW0A 4ZEDA 1G0HA 3VVEA 5ISUA 2F97A 4N8GA 1A99A 2QMWA 1YCJA 4WXJA 1LB9A 1O63A 3VV5A 1R6ZA 4RA1A 4GQOA 1FPIA 3EKIA 3S9EA 1B52A 2H98A 4LN5A 4OVQA 4PFUA 2NWJA 3M8UA 3G7WA 3SERA 4QSEA 1IUDA 3B6WA 3FV2A 2QVRA 3KOTA 4O3BA 3CFXA 2P2AA 1B5HA 4KQPA 3C4MA 1UTBA 4NF0A 1M5DA 3PUYE 4Q8RA 4JSOA 3DP6A 3D1RA 5HM4B 4ECFA 4ND9A 2QRYA 4O7MA 3RT8A 3FXRA 2ZYNA 2ABHA 1FPEA 2DWIA 3CFZA 3CG1A 4YU0A 3NOHA 4ZZEA 2D21A 1L5TA 1ZTYA 4PBHA 1A8EA 4IO3A 1TXFA 1VE4A 2GH9A 3KJTA 1XI6A 3K1MA 3DRKA 4GF8A 3D4CA 3MAMA 2OCUA 2FYIA 2ZYKA 4YMBA 1N84A 1FBFA 3MP8A 5H8FA 2DSFA 5I2KB 4POXA 4KPTA 3QIMA 2WBDA 2O84X 4NAPA 1P1QA 3FXUA 4OMBA 3PPQA 2WEFA 4NF5A 4MNPA 2I58A 1JW5A 1PBQA 1ZBMA 4P1EA 4LZ8A 4H67A 1MXZA 4GVOA 4UA8A 1PB8A 1B4ZA 5IKBA 4OFLA 1GGGA 1N3WA 3U8QA 5HBCA 3TCFA 3KEIA 4Q30B 2CZIA 4BDNA 4KHZE 4ELQA 1WVJA 4G8NA 1JEUA 1YPNA 3CRBA 3QUFA 1D9QA 3FJGA 4LQ2A 1FRPA 1S7YA 3TTKA 2WYPA 3THIA 2YPNA 4FEBA 2XXTA 5KCJA 4G8MA 4M1VA 1IITA 3QMFA 1FTMA 3PPPA 4KI0E 1N76A 1Y9UA 3O6GA 1TFDA 4EUOA 1D3KA 1JP4A 4MIJA 3O28A 4F2OA 3GYYA 2O6AA 3QXMA 1SW5A 3LC8A 5KZTA 4P8BA 4OA4A 5ITPA 5KDTA 4PDDA 3TTRA 3DM0A 4PFWA 3O6HA 1IIWA 5AA3A 4F1UA 5HPQA 1TT1A 3K1NA 4MLVA 3KGCA 4NEDA 1NH8A 5DVJA 3A29A 4N8YA 1SQYA 2YJPA 5I5PA 3H06B 1UTHB 3VXCA 4I62A 2WOLA 1MXVA 4C1UA 2Q9TA 4OERA 3RYAA 2XWIA 2VPOA 2AIXA 2HAVA 2RC9A 4ZDMA 3IB0A 3C33A 4HCYA 3Q28A 2I4CA 4O8MA 2F78A 1FBCA 2H25A 2DE3A 3BIHA 4DDDA 4YICA 2F6GA 1JW4A 1FSAA 4F19A 1EZOA 4N91A 4QFNA 3MZ9A 1XC1A 3UGWA 3KC1A 1ZMGA 3ISPA 1B3EA 3A09A 3IJOB 4PETA 4OFJA 3OSRA 4HXVA 1MQJA 4X9TA 4ELPA 1IZ1A 2HHMA 5L9MA 5I56A 5L9SA 4ESXA 2FBPA 2REGA 1HSJA 2ZYMA 1SI1A 1A55A 1MPBA 4QSCA 1FTOA 1KWHA 4NHBA 1SI0A 4R74A 5T3JA 3IO4A 4IR8A 5JTYB 1FQCA 3U72A 1XS5A 2UVGA 3T22A 4RYAA 3BBRA 4GWSA 2RKMA 3CSGA 4IO6A 2P1SA 3AXFA 1RYXA 4X8RA 3RPLB 2CZHA 2ZNUA 5BUUA 1MPDA 1BIYA 4WEDA 3SEUA 1B5JA 4JSDA 3FZVA 4JXIA 2I49A 3MWBA 4DI3D 4PBQA 1SW2A 3C9HA 4GFRA 5ELVA 1R9LA 3H7MA 2HEUA 2HXWA 4OANA 4GBVA 4KCCA 4LUBA 4MF3A 3V5AA 1QGXA 4P1LA 3M3LA 3PMWA 4ONYA 1Z7ME 1LLSA 3PD9A 4JVCA 2WYKA 5H8HB 2Y5KA 5A5XB 4UACA 5FHOA 4G61A 3TTLA 3N26A 3MPLA 3KN8A 3FBPA 1P1UA 3HCQA 2O7IA 5I7IA 3PV0E 4XXUA 4F3BA 5ET6A 1B51A 4RK9A 5H8NA 5IZ3B 1B3GA 3R7XA 3EN3A 3WAFA 4G68C 2HPGA 4LZ7A 2VD2A 5F7VA 3P7IA 5CI5A 2ZNTA 4X1DA 4HCWA 1M5BA 1LBCA 4PC9A 2XA5A 3DP8A 1DPPA 3S4UA 1URSA 3U1OA 2V3QA 1SVXB 1IMBA 2CEYA 1FBHA 1LFIA 5I58B 3E9XA 5DYHA 1MXUA 4F3SA 4THIA 2QS2A 5I59A 1NL5A 4XF5A 4PTKA 1EYKA 4L17A 1PB9A 2O1MA 4I8CA 3G3KA 1P1WA 2F7AA 1NUZA 1NV0A 4P0GA 2HXRA 1B6HA 4OVTA 3OENA 3IOTA 4YAHX 2GHBA 2R8TA 4FECA 1ZKBA 2RCBA 1JVXA 5JEIA 1LFGA 3T1BA 4YMAA 2Y7IA 3TTNA 1POTA 3IOWA 4M4GA 4OENA 4F31B 2DE2A 5ET8A 3TUSA 1AIVA 2ONRA 1LAFE 4G77A 1Z7NE 4N15A 4LZ5A 1USYE 4IB2A 4JDFA 1DSNA 5LTCA 2RINA 3FUZA 2Q2AA 3K4UA 1Q35A 3GLBA 4TOZA 1LEVA 2QSXA 3U94A 3K2DA 3RYDA 4PDHA 4OYVA 2BJIA 4I1DA 4N81A 3MP1A 3IO6A 1D4NA 4MCOA 1MXXA 1FPGA 2X7PA 3TCGA 3OO7A 2XX8A 4QSDA 1I6BA 4N13A 1IMEA 5EYFA 1Q9DA 3EHTA 1EH3A 1MH3A 3A3CA 4KD5A 4F39A 5CBRA 1AOVA 1HSEA 1H3DA 5DTBA 1CNQA 1OLAA 4G68B 3RTWB 2CZKA 3FTOA 3K6UA 4EF2A 2GHAA 2R6GE 2VPNA 1LFHA 3W15C 4KYSA 3TPAA 4GWZA 4O7IA 2HZKA 1Y4TA 1FPLA 3T0JA 3G3JA 3FASA 2QL3A 4MJOA 4NGUA 4XKNA 4G8HA 4ZEFA 1NUYA 1NKXA 2QVUA 1G0IA 4OFOA 1IXIA 5IZ1A 2ZYOA 4NF8B 3VVDA 2OZZA 4NF6B 5I57A 3BFTA 1B7UA 1B0HA 1H45A 1TFAA 2CZLA 4YZZA 1RKMA 1URGA 5AA4A 1DBZA 2RF1A 3O2AA 3RYBA 3RT6B 3FVOA 3R26A 3FVGA 3O6IA 4EQBA 3S9MC 1WDNA 4PF6A 4Q0CA 1RYOA 3K1PA 1Y1MA 1MQDA 5LDZA 4XKQA 1IXGA 5EHSA 4R6HA 2V3TA 3SETA 1A54A 3MUQA 4IGRA 3VE1B 2Y84A 3VLWA 3GXAA 2QJEA 4POWA 4U4SA 3E3KA 3OMBA 4OEUA 4AB5A 2PBWA 2HCAA 3B6TA 3W9WA 4OHNA 2G29A 5I2NA 3CFLA 2FHYA 2XWKA 2X7QA 1XVXA 3N5LA 1Y3NA 1BLFA 1MDP1 4OESA 2Z8FA 3UIFA 4QF9A 3OEKA 4FIMA 1MS7A 3PMXA 3Q29A 4R2FA 4RK2A 3T96B 2O69A 3MC2A 4H8JA 3S2VA 3FXQA 4ZZAA 1B4HA 1NV1A 1GTKA 1NNTA 1B46A 1VFDA 2A5SA 3MVYA 1XT8A 4N6DA 1INPA 4P47A 3O6PA 3SDFA 4OTEA 3TEPA 3B8BA 3JV9A 4X04A 4GWXA 1NV4A 4QFLA 4PGNA 4ELRA 4GLIA 4UABA 2Q89A 3VFJA 5H8SA 1JW1A 2XX9A 1P99A 2I3WA 3SEWA 3RPWA 2QS3A 2H9BA 3C35A 2O51A 1LB8A 4HS7A 1FTJA 2Y7RA 1FBPA 4ZS9A 3DRJA 2DXYA 2P3NA 1H43A 3L6GA 4RNSA 4GBWA 4Q5TA 2UYFA 2H99A 1NV6A 1FQBA 4R6KA 1F9BA 2L5VA 3PAMA 1POY1 3RLFE 3CHGA 1YZ0A 2Z22A 4ZEBA 3H6UA 4P0IA 2DE4A 1FPBA 4HE2A 4MEVA 2D3IA 4AQ4A 2GQ1A 5DW8A 4MFIA 1Y1ZA 5JTYA 4GWWA 4KXPA 2CEXA 1UTBB 5JK4A 2XWVA 2WOKA 1MQIA 4ZEIA 2F34A 1YTVA 3ODBA 1AMFA 2WOPA 3IFCA 1B5IA 1MXWA 4NG7A 3HHFA 2Q74A 3KSXA 5F24A 1CB6A 5EQ7A 4FBPA 1US4A 1ATGA 2ZZWA 2LAOA 3K02A 4KYDA 3MSTA 3C36A 4FEDA 3OOAA 5K2XA 1VSOA 3PU5A 3S9NC 2DOJA 4YKJA 1LAHE 2NUVA 5BWJA 2KQZA 4X48A 4MAGA 2WKYA 3E13X 3KG2A 1TWYA 3M3FA 4R6YA 5H8FB 3JZJA 3KZGA 4TQUQ 1NUWA 2QS4A 5CMBA 1DK4A 1Y3QA 4LQ5A 5H8QB 1QUIA 5H8HA 3DP4A 1B32A 4HE0A 5A5XA 5ICTA 2PVUA 4IO7A 4DXUA 1FPFA 4NF5B 5ET7A 3QUJA 3VLUA 3OSQA 3QK6A 2I48A 2ZNSA 4GOTA 3O29A 4ZE8A 1DMBA 2Y7WA 4E0WA 4RPOA 3T66A 2YLNA 3CIJA 3Q26A 2XHDA 3IOVA 1LBBA 1FPJA 4U21A 5CMMA 4OWDA 2I3VA 3TDJA 2OLBA 2I0CA 1H44A 2I0BA 3RN8A 1BK4A 2DS9A 5TU0A 3IK6B 5KCJB 2ZXTA 2ONKE 5AA2A 3BFUA 1NV5A 5TP9A 1B0LA 4GL0A 3PPRA 4LVQA 1QJMA 4P11A 3IB2A 3H6TA 3C31A 4YKIA 2UVHA 3FVKA 3HFUA 4GX6A 4N07A 4MMPA 1NFTA 3DRIA 3K00A 5EYHA 4H8IA 3FXBA 5KDTB 3W9VA 1OMPA 4QRZA 2DWJA 2V93A 3PTYA 2RCAA 1LBXA 2F6PA 2HZLA 1EU8A 4KFQA 2P0SA 1FTKA 3TELA 1JVYA 2XXQA 1BKAA 4AB6A 1VFEA 3T9XB 2KR0A 1FQEA 3PD8A 4GWYA 3FD3A 3LUYA 3MP6A 2XXWA 4PFIA 2DXRA 3MPKA 4O3AA 3KBZA 1N3XA 3SEYA 2Z8DA 5EQ9A 3LSXA 4F18A 4DXCA 4H46A 3PGFA 2Z23A 4OQOA 3HPIA 3DLNA 3C34A 1N7WA 5DEXB 3EHSA 1KZ8A 5FBPA 1MG1A 2I4BA 1M5EA 3TFLA 3VVFA 1H76A 2XXUA 2VOZA 3S9LC 3B6QA 5I56B 4ZEKA 3UORA 1US5A 3EHUA 1DCUA 3LBSA 4Z7EA 2ESNA 2PYYA 4LATA 3GZGA 3Q25A 3PUXE 3QYTA 2F7CA 4DCXA 1NMUA 2R9JA 2B4LA 1OVBA 3MZ1A 3QSLA 4PAFA 2V3UA 3MYUA 1ANFA 2B3BA 1R1NA 3E78A 4NWCA 2UYEA 1I6QA 1B2HA 1UIUA 2VD3A 1LAGE 3UN6A 3SZPA 4X1BA 1NV7A 3H03A 2W7YA 4LP2B 4DZ1A 2HFBA 1XOCA 4DIGA 5DVFA 3IOUA 1NNKA 4NF8A 5B70A 4MHFA 4NF4B 2XXKA 4NF6A 1VDWA 4ZECA 4OZ9A 1FBGA 1FQDA 4MBPA 3MVXA 4GRKA 1QVSA 4MLQA 2UVJA 1LBYA 2F3BA 1MY3A 1OQGA 3DRHA 1FBEA 1QUJA 3DRGA 3T93B 3IL1B 1B1XA 4IO4A 5CMKA 3BIGA 1ZU0A 1KA1A 1SD3A 4QHQA 3OXNA 3D4GA 4PFRA 1QKBA 2H4IA 4I3YA 3T9VA 1FQAA 2Q8MA 5A5LA 1MY0A 4EQ7A 4G4PA 3RQTA 3TKDA 5IZZA 5FHMA 2Y5LA 2IEEA 4C1TA 3I5OA 4JB7A 3UK4A 4GIZA 2A5TB 5AA2D 4AS4A 3KSJA 1LSTA 3EF7A 1AL3A 1SDXA 1B7ZA 1MQGA 3O9PA 2F36A 5DVIA 1B05A 2XXHA 1EYIA 1DOTA 1USYH 1IMAA 4NMYA 4ELOA 2X26A 1MRPA 3O97A 2Q2CA 4FORA 5I59B 1K9YA 4EF1A 2O7UA 2Y7PA 3KFMA 3TAJA 1BTJA 3KN3A 5B7DA 1PC3A 5I2KA 1NV2A 4BDQA 3DELB 3FVNA 5CC2A 1PB7A 5ET5A 5DT6A 4I9DA 2RC8A 3VXBA 1YAEA 5FHNA 1VR5A 2VT5A 4GX4A 3MVWA 2G93A 5J16A 2H5YA 1LBVA 3V89B 1FBDA 3R6UA 2PFYA 3IX1A 3I6VA 2QMXA 2XD2A 4E0XA 1B3HA 4FJPA 4LA9A 3JYRA 1ELJA 2GFEA 1LCFA 3LR1A 4IO5A 2DWHA 4ZE9A 3G3HA 3OO9A 3FGSA 3HN0A
chains in the Genus database with same CATH topology
2Q88A 3VLVA 3VDFA 3GBBA 3RTFB 2QS1A 3OELA 2OK2A 2AYSA 2AL5A 4U23A 3SKPA 5K2YA 2ALUA 2B65A 3HV1A 1B58A 4F22A 1Q1KA 3MJNA 4F3PA 4H5FA 1EZPA 2NXOA 2DWAA 1IQ7A 1PBPA 1DPEA 3ILUB 4HTGA 1HSLA 1N0TA 4O3CA 3CSBA 4DCYA 3PPOA 3SESA 5TPAB 4U4XA 1B3FA 3G3GA 3N6TA 4TLLB 4XTCQ 1Y4CA 2XXIA 3IR1A 4R9GA 2B4MA 1UTHA 3PMVA 1SW1A 4GXAA 4IO2A 4GWOA 3TMGA 1UIVA 1NNPA 3CI8A 1SYIA 3PUVE 5H8QA 3N6UA 1N04A 5CM6A 1J1NA 2B3FA 4HW8A 3IB1A 5I57B 3H4ZA 4IY6A 4JWOA 3MVZA 5AA4B 4RPNA 2VP1A 1T0KA 3BKIB 1FTLA 1B7HA 1D9VA 3B7DA 1OLCA 1LCTA 5ICQA 2ANJA 3IORA 5I84A 4R9FA 5AE4A 2XX7A 1MXYA 3ZKKA 1P1NA 4U1ZA 3Q27A 4QFKA 3ZS6A 4DXBA 3FIRA 4BDRA 4BLAA 4IY5A 3FV1A 2DP8A 1P1OA 1XVYA 4GXSB 2F5XA 5LOMA 3GBAA 5I2NB 4ISUA 2XXRA 4U1OA 3K01A 2ZMBA 3WAEA 1ZLQA 1OQHA 3T9HB 4DLDA 1EZ9A 4PQJA 3T9UA 2FA7A 4ESWA 4KCDA 4N6PA 1SBPA 5CBSA 1FQFA 3FJMA 2IA4A 2BJJX 3UA8A 1QKAA 5J1DA 2PT2A 3I3VA 4WKMA 5IAIA 3HO7A 3PUWE 3ECRA 1JQFA 3SEXA 1MM7A 3M3KA 2HQ0A 3ZKLA 2Y7KA 5AA1A 1R9QA 1A40A 3G3IA 4U22A 1SYHA 2I6EA 2PT1A 2Q8JA 1IEJA 2FNCA 4BDLA 1NH7A 1JNFA 2E0SA 5DEXA 3MQ9A 4OETA 3TYHA 1II5A 5ITOA 4PFTA 5FTIA 4G2ZA 3CVGA 3V8XB 2VGQA 2E1SA 4KR5A 4BDOA 4GL8A 1I6AA 1B1HA 3TCHA 2PX1A 1O7TA 3CG3A 4U2RA 5I58A 4RY1A 4EQ9A 3E4RA 2XXXA 2R71A 3ONMA 1QW0A 4WEPA 1Y20A 3A3UA 4QFPA 2PMSA 2XXPA 3FATA 4R72A 4R2BA 4RXLA 1SW4A 2KLFA 4XIGQ 3KBRA 3IAZA 2F8DA 3RNNA 3RGYA 1LAXA 4FE8A 5F1QA 1MPCA 1XHYA 4QFOA 4F3GA 3O66A 3KN7A 1IXHA 3LSFB 4MH5A 4YB6A 2DQVA 2Z8EA 3F11A 2VHAA 4H5GA 4NF4A 1MQHA 2DYXA 2DVCA 3L6HA 2M8CA 4KYEA 4PE5B 1AH5A 3HHGA 4F1YA 4EXKA 4RJZA 2D5WA 3U93A 1DTGA 4JWYA 3SEVA 2AL4A 1JEVA 4JBZA 3EQ1A 2ONSA 3LVUA 4YKKA 1QUKA 4OVJA 2XD3A 1JETA 3IJXB 3OO6A 2V84A 3TQLA 3PUZE 3USDA 2THIA 1LGBC 2A5TA 5FTHA 3MBPA 3U92A 1A8FA 4NWDA 2GRVA 1NNFA 4K3FA 4XKRA 3KJ7A 3H6WA 4GD5A 4F2QA 4Z0IA 4R75A 2XXYA 4G68A 3OD7A 2OBGA 5AA2B 3QAXA 3FJ7A 5TP9B 1MY1A 3TTMA 1M5CA 2HAUA 1M5FA 1MY4A 3RUMA 3ZSFA 1QULA 3LSLA 1O64A 1ZJLA 4H0WA 4EDPA 4XKPA 1N7XA 1FCKA 1GR2A 3CR9A 4TLMB 3K6VA 1CE2A 3DRFA 4DE8A 2QPQA 2OWSA 3K6WA 2F7BA 2O1LA 2F35A 3OO8A 3G3FA 5EHMA 4F1VA 4H1XA 3H6VA 2UVIA 3LSWA 3ILTB 1FW0A 2RC7A 1I69A 1MM6A 4BDMA 4PFYA 1GVCA 5CMCA 4OXVA 1B3LA 4PP0A 5H8NB 5M2VA 3PPNA 4NTLA 3MZBA 4H65A 4YB7A 4YKPA 2XXVA 5L9OA 1B9JA 1MH4A 3UP9A 3N94A 1UQWA 2CMOA 1BP5A 2NOOA 3K0VA 1A7LA 4LONB 5CRYA 2REJA 1B40A 3RY3A 2OJTA 3EPEA 4EXLA 5L8DA 1Y3PA 3HSTA 3TQWA 4FATA 1GV8A 2V25A 1OIBA 4OEVA 1MY2A 3K6XA 2DVZA 4FAJA 1S50A 1PDAA 3H3GA 1PEBA 4IGTA 1OVTA 2O68A 5TPAA 3KOSA 3OEMA 2NVUB 1ZIUA 1URDA 1DTZA 1MDQA 1WODA 4JWXA 4NE4A 4F29A 3TODA 1D9YA 3C32A 4YB5A 3TZAA 3V83A 4H6DA 4C0RA 4R73A 1S9TA 2OWTA 2UXAA 1IXCA 3MW0A 4ZEDA 3VVEA 5ISUA 2F97A 1A99A 2QMWA 1YCJA 4WXJA 1LB9A 1O63A 3VV5A 1R6ZA 4RA1A 4GQOA 3S9EA 1B52A 2H98A 4PFUA 2NWJA 3M8UA 3G7WA 3SERA 4QSEA 1IUDA 3B6WA 3FV2A 3KOTA 4O3BA 3CFXA 2P2AA 1B5HA 4KQPA 3C4MA 1UTBA 1M5DA 3PUYE 4Q8RA 4JSOA 3DP6A 5HM4B 4ECFA 4ND9A 2QRYA 3RT8A 3FXRA 2ZYNA 2ABHA 2DWIA 3CFZA 3CG1A 4YU0A 4ZZEA 2D21A 1L5TA 1ZTYA 1A8EA 4IO3A 1TXFA 1VE4A 2GH9A 3KJTA 3K1MA 3DRKA 4GF8A 3D4CA 3MAMA 2OCUA 2FYIA 2ZYKA 4YMBA 1N84A 3MP8A 5H8FA 2DSFA 5I2KB 4POXA 4KPTA 3QIMA 2O84X 1P1QA 3FXUA 4OMBA 3PPQA 4NF5A 2I58A 1JW5A 1PBQA 1ZBMA 4LZ8A 4H67A 1MXZA 4GVOA 4UA8A 1PB8A 1B4ZA 5IKBA 4OFLA 1GGGA 1N3WA 3U8QA 5HBCA 3TCFA 3KEIA 4Q30B 4BDNA 4KHZE 4ELQA 1WVJA 4G8NA 1JEUA 1YPNA 3CRBA 3QUFA 3FJGA 4LQ2A 1S7YA 3TTKA 3THIA 2YPNA 4FEBA 2XXTA 5KCJA 4G8MA 4M1VA 1IITA 1FTMA 3PPPA 4KI0E 1N76A 1Y9UA 3O6GA 1TFDA 4EUOA 1D3KA 3O28A 4F2OA 2O6AA 3QXMA 1SW5A 3LC8A 5KZTA 5ITPA 5KDTA 3TTRA 3DM0A 4PFWA 3O6HA 1IIWA 5AA3A 4F1UA 5HPQA 1TT1A 3K1NA 4MLVA 3KGCA 4NEDA 1NH8A 5DVJA 1SQYA 2YJPA 3H06B 1UTHB 3VXCA 4I62A 2WOLA 1MXVA 4C1UA 2Q9TA 4OERA 3RYAA 2AIXA 2HAVA 2RC9A 4ZDMA 3IB0A 3C33A 4HCYA 3Q28A 2I4CA 2F78A 2H25A 2DE3A 4DDDA 4YICA 2F6GA 1JW4A 4F19A 1EZOA 4QFNA 3MZ9A 1XC1A 3UGWA 1ZMGA 1B3EA 3A09A 3IJOB 4PETA 4OFJA 3OSRA 1MQJA 4X9TA 4ELPA 1IZ1A 5L9MA 5I56A 5L9SA 4ESXA 2REGA 1HSJA 2ZYMA 1SI1A 1A55A 1MPBA 4QSCA 1FTOA 1KWHA 1SI0A 4R74A 3IO4A 5JTYB 1FQCA 3U72A 1XS5A 2UVGA 3T22A 4RYAA 3BBRA 2RKMA 3CSGA 4IO6A 2P1SA 3AXFA 1RYXA 2ZNUA 5BUUA 1MPDA 1BIYA 4WEDA 3SEUA 1B5JA 4JSDA 3FZVA 4JXIA 2I49A 3MWBA 1SW2A 3C9HA 4GFRA 5ELVA 1R9LA 3H7MA 2HEUA 2HXWA 4KCCA 4LUBA 4MF3A 3V5AA 3M3LA 3PMWA 4ONYA 1Z7ME 1LLSA 3PD9A 5H8HB 5A5XB 4UACA 5FHOA 3TTLA 3N26A 3MPLA 3KN8A 1P1UA 3HCQA 2O7IA 3PV0E 4XXUA 4F3BA 1B51A 4RK9A 5H8NA 1B3GA 3R7XA 3EN3A 3WAFA 4G68C 4LZ7A 2VD2A 5F7VA 3P7IA 5CI5A 2ZNTA 4X1DA 4HCWA 1M5BA 1LBCA 3DP8A 1DPPA 3S4UA 1URSA 3U1OA 2V3QA 1SVXB 1LFIA 5I58B 3E9XA 5DYHA 1MXUA 4F3SA 4THIA 2QS2A 5I59A 1NL5A 4L17A 1PB9A 2O1MA 4I8CA 3G3KA 1P1WA 2F7AA 4P0GA 1B6HA 3OENA 3IOTA 4YAHX 2GHBA 4FECA 1ZKBA 2RCBA 1JVXA 5JEIA 1LFGA 4YMAA 2Y7IA 3TTNA 1POTA 3IOWA 4M4GA 4OENA 4F31B 2DE2A 3TUSA 1AIVA 2ONRA 1LAFE 4G77A 1Z7NE 4LZ5A 1USYE 4IB2A 4JDFA 1DSNA 2RINA 3FUZA 2Q2AA 3K4UA 1Q35A 3GLBA 4TOZA 2QSXA 3U94A 3K2DA 4OYVA 4I1DA 3MP1A 3IO6A 1D4NA 1MXXA 2X7PA 3TCGA 3OO7A 2XX8A 4QSDA 1I6BA 4N13A 5EYFA 3EHTA 1EH3A 1MH3A 3A3CA 4KD5A 4F39A 5CBRA 1AOVA 1HSEA 1H3DA 5DTBA 1OLAA 4G68B 3RTWB 3FTOA 3K6UA 4EF2A 2GHAA 2R6GE 1LFHA 3W15C 4KYSA 3TPAA 2HZKA 1Y4TA 3G3JA 3FASA 2QL3A 4XKNA 4G8HA 4ZEFA 1NKXA 4OFOA 1IXIA 2ZYOA 4NF8B 3VVDA 2OZZA 4NF6B 5I57A 3BFTA 1B7UA 1B0HA 4YZZA 1H45A 1TFAA 2CZLA 1RKMA 1URGA 5AA4A 2RF1A 3O2AA 3RYBA 3RT6B 3FVOA 3R26A 3FVGA 3O6IA 4EQBA 3S9MC 1WDNA 4Q0CA 1RYOA 3K1PA 1Y1MA 1MQDA 4XKQA 1IXGA 5EHSA 4R6HA 2V3TA 3SETA 1A54A 3MUQA 4IGRA 3VE1B 2Y84A 3VLWA 3GXAA 2QJEA 4POWA 4U4SA 3E3KA 3OMBA 4OEUA 4AB5A 2PBWA 2HCAA 3B6TA 3W9WA 2G29A 4OHNA 5I2NA 3CFLA 2X7QA 1XVXA 3N5LA 1Y3NA 1BLFA 1MDP1 4OESA 2Z8FA 3UIFA 4QF9A 3OEKA 4FIMA 1MS7A 3PMXA 3Q29A 4R2FA 4RK2A 3T96B 2O69A 3MC2A 4H8JA 3S2VA 3FXQA 4ZZAA 1B4HA 1GTKA 1NNTA 1B46A 1VFDA 2A5SA 3MVYA 1XT8A 3O6PA 3SDFA 4OTEA 3TEPA 3JV9A 4QFLA 4ELRA 4GLIA 2Q89A 3VFJA 5H8SA 1JW1A 2XX9A 1P99A 2I3WA 3SEWA 3RPWA 2QS3A 2H9BA 3C35A 2O51A 1LB8A 4HS7A 1FTJA 2Y7RA 4ZS9A 3DRJA 2DXYA 1H43A 3L6GA 4RNSA 4Q5TA 2UYFA 2H99A 1FQBA 4R6KA 1F9BA 3PAMA 1POY1 3RLFE 3CHGA 2Z22A 4ZEBA 3H6UA 4P0IA 2DE4A 2D3IA 4AQ4A 4MFIA 1Y1ZA 5JTYA 1UTBB 5JK4A 2WOKA 1MQIA 4ZEIA 2F34A 1YTVA 3ODBA 1AMFA 2WOPA 1B5IA 1MXWA 3HHFA 3KSXA 1CB6A 1US4A 1ATGA 2LAOA 3K02A 4KYDA 3C36A 4FEDA 3OOAA 5K2XA 1VSOA 3PU5A 3S9NC 2DOJA 4YKJA 1LAHE 2NUVA 5BWJA 4X48A 2WKYA 3E13X 3KG2A 1TWYA 3M3FA 4R6YA 5H8FB 3JZJA 3KZGA 4TQUQ 2QS4A 5CMBA 1Y3QA 4LQ5A 5H8QB 1QUIA 5H8HA 3DP4A 1B32A 5A5XA 5ICTA 2PVUA 4IO7A 4DXUA 4NF5B 3QUJA 3VLUA 3OSQA 3QK6A 2I48A 2ZNSA 4GOTA 3O29A 4ZE8A 1DMBA 2Y7WA 4E0WA 4RPOA 3T66A 2YLNA 3CIJA 3Q26A 2XHDA 3IOVA 1LBBA 4U21A 5CMMA 4OWDA 2I3VA 3TDJA 2OLBA 2I0CA 1H44A 2I0BA 3RN8A 2DS9A 5TU0A 3IK6B 5KCJB 2ZXTA 2ONKE 5AA2A 3BFUA 5TP9A 1B0LA 4GL0A 3PPRA 4LVQA 1QJMA 4P11A 3IB2A 3H6TA 3C31A 4YKIA 2UVHA 3FVKA 4N07A 1NFTA 3DRIA 3K00A 4H8IA 5KDTB 3W9VA 1OMPA 4QRZA 2DWJA 2V93A 2RCAA 2F6PA 2HZLA 1EU8A 4KFQA 2P0SA 1FTKA 3TELA 1JVYA 2XXQA 1BKAA 4AB6A 1VFEA 3T9XB 1FQEA 3PD8A 3FD3A 3LUYA 3MP6A 2XXWA 2DXRA 3MPKA 4O3AA 1N3XA 3SEYA 2Z8DA 3LSXA 4F18A 4DXCA 3PGFA 2Z23A 4OQOA 3HPIA 3DLNA 3C34A 1N7WA 5DEXB 3EHSA 1MG1A 2I4BA 1M5EA 3TFLA 3VVFA 1H76A 2XXUA 2VOZA 3S9LC 3B6QA 5I56B 4ZEKA 3UORA 1US5A 3EHUA 3LBSA 4Z7EA 2ESNA 2PYYA 4LATA 3GZGA 3Q25A 3PUXE 3QYTA 2F7CA 4DCXA 1NMUA 2R9JA 2B4LA 1OVBA 3MZ1A 3QSLA 2V3UA 1ANFA 2B3BA 1R1NA 4NWCA 2UYEA 1I6QA 1B2HA 1UIUA 2VD3A 1LAGE 3UN6A 4X1BA 3H03A 2W7YA 4LP2B 4DZ1A 2HFBA 1XOCA 4DIGA 5DVFA 3IOUA 1NNKA 4NF8A 5B70A 4NF4B 4NF6A 4ZECA 4OZ9A 1FQDA 4MBPA 3MVXA 4GRKA 1QVSA 4MLQA 2UVJA 1MY3A 1OQGA 3DRHA 1QUJA 3DRGA 3T93B 3IL1B 1B1XA 4IO4A 5CMKA 1ZU0A 1SD3A 4QHQA 3OXNA 3D4GA 1QKBA 2H4IA 3T9VA 1FQAA 1MY0A 4EQ7A 4G4PA 3RQTA 3TKDA 5FHMA 2IEEA 4C1TA 3I5OA 4JB7A 3UK4A 4GIZA 2A5TB 5AA2D 3KSJA 1LSTA 3EF7A 1AL3A 1SDXA 1B7ZA 1MQGA 3O9PA 2F36A 5DVIA 1B05A 2XXHA 1DOTA 1USYH 4NMYA 4ELOA 2X26A 1MRPA 3O97A 2Q2CA 4FORA 5I59B 4EF1A 2O7UA 2Y7PA 3KFMA 3TAJA 1BTJA 3KN3A 5B7DA 1PC3A 5I2KA 4BDQA 3DELB 3FVNA 5CC2A 1PB7A 5DT6A 4I9DA 2RC8A 3VXBA 1YAEA 5FHNA 1VR5A 3MVWA 2G93A 2H5YA 3V89B 3R6UA 3IX1A 3I6VA 2QMXA 2XD2A 4E0XA 1B3HA 4FJPA 4LA9A 3JYRA 1ELJA 2GFEA 1LCFA 3LR1A 4IO5A 2DWHA 4ZE9A 3G3HA 3OO9A 3FGSA 3HN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q88 A;  3VLV A;  3VDF A;  3GBB A;  3RTF B;  2QS1 A;  3OEL A;  2OK2 A;  2AYS A;  2AL5 A;  4U23 A;  3SKP A;  5K2Y A;  2ALU A;  2B65 A;  3HV1 A;  1B58 A;  4F22 A;  1Q1K A;  3MJN A;  4F3P A;  4H5F A;  1EZP A;  2NXO A;  2DWA A;  1IQ7 A;  1PBP A;  1DPE A;  3ILU B;  4HTG A;  1HSL A;  1N0T A;  4O3C A;  3CSB A;  4DCY A;  3PPO A;  3SES A;  5TPA B;  4U4X A;  1B3F A;  3G3G A;  3N6T A;  4TLL B;  4XTC Q;  1Y4C A;  2XXI A;  3IR1 A;  4R9G A;  2B4M A;  1UTH A;  3PMV A;  1SW1 A;  4GXA A;  4IO2 A;  4GWO A;  3TMG A;  1UIV A;  1NNP A;  3CI8 A;  1SYI A;  3PUV E;  5H8Q A;  3N6U A;  1N04 A;  5CM6 A;  1J1N A;  2B3F A;  4HW8 A;  3IB1 A;  5I57 B;  3H4Z A;  4IY6 A;  4JWO A;  3MVZ A;  5AA4 B;  4RPN A;  2VP1 A;  1T0K A;  3BKI B;  1FTL A;  1B7H A;  1D9V A;  3B7D A;  1OLC A;  1LCT A;  5ICQ A;  2ANJ A;  3IOR A;  5I84 A;  4R9F A;  5AE4 A;  2XX7 A;  1MXY A;  3ZKK A;  1P1N A;  4U1Z A;  3Q27 A;  4QFK A;  3ZS6 A;  4DXB A;  3FIR A;  4BDR A;  4BLA A;  4IY5 A;  3FV1 A;  2DP8 A;  1P1O A;  1XVY A;  4GXS B;  2F5X A;  5LOM A;  3GBA A;  5I2N B;  4ISU A;  2XXR A;  4U1O A;  3K01 A;  2ZMB A;  3WAE A;  1ZLQ A;  1OQH A;  3T9H B;  4DLD A;  1EZ9 A;  4PQJ A;  3T9U A;  2FA7 A;  4ESW A;  4KCD A;  4N6P A;  1SBP A;  5CBS A;  1FQF A;  3FJM A;  2IA4 A;  2BJJ X;  3UA8 A;  1QKA A;  5J1D A;  2PT2 A;  3I3V A;  4WKM A;  5IAI A;  3HO7 A;  3PUW E;  3ECR A;  1JQF A;  3SEX A;  1MM7 A;  3M3K A;  2HQ0 A;  3ZKL A;  2Y7K A;  5AA1 A;  1R9Q A;  1A40 A;  3G3I A;  4U22 A;  1SYH A;  2I6E A;  2PT1 A;  2Q8J A;  1IEJ A;  2FNC A;  4BDL A;  1NH7 A;  1JNF A;  2E0S A;  5DEX A;  3MQ9 A;  4OET A;  3TYH A;  1II5 A;  5ITO A;  4PFT A;  5FTI A;  4G2Z A;  3CVG A;  3V8X B;  2VGQ A;  2E1S A;  4KR5 A;  4BDO A;  4GL8 A;  1I6A A;  1B1H A;  3TCH A;  2PX1 A;  1O7T A;  3CG3 A;  4U2R A;  5I58 A;  4RY1 A;  4EQ9 A;  3E4R A;  2XXX A;  2R71 A;  3ONM A;  1QW0 A;  4WEP A;  1Y20 A;  3A3U A;  4QFP A;  2PMS A;  2XXP A;  3FAT A;  4R72 A;  4R2B A;  4RXL A;  1SW4 A;  2KLF A;  4XIG Q;  3KBR A;  3IAZ A;  2F8D A;  3RNN A;  3RGY A;  1LAX A;  4FE8 A;  5F1Q A;  1MPC A;  1XHY A;  4QFO A;  4F3G A;  3O66 A;  3KN7 A;  1IXH A;  3LSF B;  4MH5 A;  4YB6 A;  2DQV A;  2Z8E A;  3F11 A;  2VHA A;  4H5G A;  4NF4 A;  1MQH A;  2DYX A;  2DVC A;  3L6H A;  2M8C A;  4KYE A;  4PE5 B;  1AH5 A;  3HHG A;  4F1Y A;  4EXK A;  4RJZ A;  2D5W A;  3U93 A;  1DTG A;  4JWY A;  3SEV A;  2AL4 A;  1JEV A;  4JBZ A;  3EQ1 A;  2ONS A;  3LVU A;  4YKK A;  1QUK A;  4OVJ A;  2XD3 A;  1JET A;  3IJX B;  3OO6 A;  2V84 A;  3TQL A;  3PUZ E;  3USD A;  2THI A;  1LGB C;  2A5T A;  5FTH A;  3MBP A;  3U92 A;  1A8F A;  4NWD A;  2GRV A;  1NNF A;  4K3F A;  4XKR A;  3KJ7 A;  3H6W A;  4GD5 A;  4F2Q A;  4Z0I A;  4R75 A;  2XXY A;  4G68 A;  3OD7 A;  2OBG A;  5AA2 B;  3QAX A;  3FJ7 A;  5TP9 B;  1MY1 A;  3TTM A;  1M5C A;  2HAU A;  1M5F A;  1MY4 A;  3RUM A;  3ZSF A;  1QUL A;  3LSL A;  1O64 A;  1ZJL A;  4H0W A;  4EDP A;  4XKP A;  1N7X A;  1FCK A;  1GR2 A;  3CR9 A;  4TLM B;  3K6V A;  1CE2 A;  3DRF A;  4DE8 A;  2QPQ A;  2OWS A;  3K6W A;  2F7B A;  2O1L A;  2F35 A;  3OO8 A;  3G3F A;  5EHM A;  4F1V A;  4H1X A;  3H6V A;  2UVI A;  3LSW A;  3ILT B;  1FW0 A;  2RC7 A;  1I69 A;  1MM6 A;  4BDM A;  4PFY A;  1GVC A;  5CMC A;  4OXV A;  1B3L A;  4PP0 A;  5H8N B;  5M2V A;  3PPN A;  4NTL A;  3MZB A;  4H65 A;  4YB7 A;  4YKP A;  2XXV A;  5L9O A;  1B9J A;  1MH4 A;  3UP9 A;  3N94 A;  1UQW A;  2CMO A;  1BP5 A;  2NOO A;  3K0V A;  1A7L A;  4LON B;  5CRY A;  2REJ A;  1B40 A;  3RY3 A;  2OJT A;  3EPE A;  4EXL A;  5L8D A;  1Y3P A;  3HST A;  3TQW A;  4FAT A;  1GV8 A;  2V25 A;  1OIB A;  4OEV A;  1MY2 A;  3K6X A;  2DVZ A;  4FAJ A;  1S50 A;  1PDA A;  3H3G A;  1PEB A;  4IGT A;  1OVT A;  2O68 A;  5TPA A;  3KOS A;  3OEM A;  2NVU B;  1ZIU A;  1URD A;  1DTZ A;  1MDQ A;  1WOD A;  4JWX A;  4NE4 A;  4F29 A;  3TOD A;  1D9Y A;  3C32 A;  4YB5 A;  3TZA A;  3V83 A;  4H6D A;  4C0R A;  4R73 A;  1S9T A;  2OWT A;  2UXA A;  1IXC A;  3MW0 A;  4ZED A;  3VVE A;  5ISU A;  2F97 A;  1A99 A;  2QMW A;  1YCJ A;  4WXJ A;  1LB9 A;  1O63 A;  3VV5 A;  1R6Z A;  4RA1 A;  4GQO A;  3S9E A;  1B52 A;  2H98 A;  4PFU A;  2NWJ A;  3M8U A;  3G7W A;  3SER A;  4QSE A;  1IUD A;  3B6W A;  3FV2 A;  3KOT A;  4O3B A;  3CFX A;  2P2A A;  1B5H A;  4KQP A;  3C4M A;  1UTB A;  1M5D A;  3PUY E;  4Q8R A;  4JSO A;  3DP6 A;  5HM4 B;  4ECF A;  4ND9 A;  2QRY A;  3RT8 A;  3FXR A;  2ZYN A;  2ABH A;  2DWI A;  3CFZ A;  3CG1 A;  4YU0 A;  4ZZE A;  2D21 A;  1L5T A;  1ZTY A;  1A8E A;  4IO3 A;  1TXF A;  1VE4 A;  2GH9 A;  3KJT A;  3K1M A;  3DRK A;  4GF8 A;  3D4C A;  3MAM A;  2OCU A;  2FYI A;  2ZYK A;  4YMB A;  1N84 A;  3MP8 A;  5H8F A;  2DSF A;  5I2K B;  4POX A;  4KPT A;  3QIM A;  2O84 X;  1P1Q A;  3FXU A;  4OMB A;  3PPQ A;  4NF5 A;  2I58 A;  1JW5 A;  1PBQ A;  1ZBM A;  4LZ8 A;  4H67 A;  1MXZ A;  4GVO A;  4UA8 A;  1PB8 A;  1B4Z A;  5IKB A;  4OFL A;  1GGG A;  1N3W A;  3U8Q A;  5HBC A;  3TCF A;  3KEI A;  4Q30 B;  4BDN A;  4KHZ E;  4ELQ A;  1WVJ A;  4G8N A;  1JEU A;  1YPN A;  3CRB A;  3QUF A;  3FJG A;  4LQ2 A;  1S7Y A;  3TTK A;  3THI A;  2YPN A;  4FEB A;  2XXT A;  5KCJ A;  4G8M A;  4M1V A;  1IIT A;  1FTM A;  3PPP A;  4KI0 E;  1N76 A;  1Y9U A;  3O6G A;  1TFD A;  4EUO A;  1D3K A;  3O28 A;  4F2O A;  2O6A A;  3QXM A;  1SW5 A;  3LC8 A;  5KZT A;  5ITP A;  5KDT A;  3TTR A;  3DM0 A;  4PFW A;  3O6H A;  1IIW A;  5AA3 A;  4F1U A;  5HPQ A;  1TT1 A;  3K1N A;  4MLV A;  3KGC A;  4NED A;  1NH8 A;  5DVJ A;  1SQY A;  2YJP A;  3H06 B;  1UTH B;  3VXC A;  4I62 A;  2WOL A;  1MXV A;  4C1U A;  2Q9T A;  4OER A;  3RYA A;  2AIX A;  2HAV A;  2RC9 A;  4ZDM A;  3IB0 A;  3C33 A;  4HCY A;  3Q28 A;  2I4C A;  2F78 A;  2H25 A;  2DE3 A;  4DDD A;  4YIC A;  2F6G A;  1JW4 A;  4F19 A;  1EZO A;  4QFN A;  3MZ9 A;  1XC1 A;  3UGW A;  1ZMG A;  1B3E A;  3A09 A;  3IJO B;  4PET A;  4OFJ A;  3OSR A;  1MQJ A;  4X9T A;  4ELP A;  1IZ1 A;  5L9M A;  5I56 A;  5L9S A;  4ESX A;  2REG A;  1HSJ A;  2ZYM A;  1SI1 A;  1A55 A;  1MPB A;  4QSC A;  1FTO A;  1KWH A;  1SI0 A;  4R74 A;  3IO4 A;  5JTY B;  1FQC A;  3U72 A;  1XS5 A;  2UVG A;  3T22 A;  4RYA A;  3BBR A;  2RKM A;  3CSG A;  4IO6 A;  2P1S A;  3AXF A;  1RYX A;  2ZNU A;  5BUU A;  1MPD A;  1BIY A;  4WED A;  3SEU A;  1B5J A;  4JSD A;  3FZV A;  4JXI A;  2I49 A;  3MWB A;  1SW2 A;  3C9H A;  4GFR A;  5ELV A;  1R9L A;  3H7M A;  2HEU A;  2HXW A;  4KCC A;  4LUB A;  4MF3 A;  3V5A A;  3M3L A;  3PMW A;  4ONY A;  1Z7M E;  1LLS A;  3PD9 A;  5H8H B;  5A5X B;  4UAC A;  5FHO A;  3TTL A;  3N26 A;  3MPL A;  3KN8 A;  1P1U A;  3HCQ A;  2O7I A;  3PV0 E;  4XXU A;  4F3B A;  1B51 A;  4RK9 A;  5H8N A;  1B3G A;  3R7X A;  3EN3 A;  3WAF A;  4G68 C;  4LZ7 A;  2VD2 A;  5F7V A;  3P7I A;  5CI5 A;  2ZNT A;  4X1D A;  4HCW A;  1M5B A;  1LBC A;  3DP8 A;  1DPP A;  3S4U A;  1URS A;  3U1O A;  2V3Q A;  1SVX B;  1LFI A;  5I58 B;  3E9X A;  5DYH A;  1MXU A;  4F3S A;  4THI A;  2QS2 A;  5I59 A;  1NL5 A;  4L17 A;  1PB9 A;  2O1M A;  4I8C A;  3G3K A;  1P1W A;  2F7A A;  4P0G A;  1B6H A;  3OEN A;  3IOT A;  4YAH X;  2GHB A;  4FEC A;  1ZKB A;  2RCB A;  1JVX A;  5JEI A;  1LFG A;  4YMA A;  2Y7I A;  3TTN A;  1POT A;  3IOW A;  4M4G A;  4OEN A;  4F31 B;  2DE2 A;  3TUS A;  1AIV A;  2ONR A;  1LAF E;  4G77 A;  1Z7N E;  4LZ5 A;  1USY E;  4IB2 A;  4JDF A;  1DSN A;  2RIN A;  3FUZ A;  2Q2A A;  3K4U A;  1Q35 A;  3GLB A;  4TOZ A;  2QSX A;  3U94 A;  3K2D A;  4OYV A;  4I1D A;  3MP1 A;  3IO6 A;  1D4N A;  1MXX A;  2X7P A;  3TCG A;  3OO7 A;  2XX8 A;  4QSD A;  1I6B A;  4N13 A;  5EYF A;  3EHT A;  1EH3 A;  1MH3 A;  3A3C A;  4KD5 A;  4F39 A;  5CBR A;  1AOV A;  1HSE A;  1H3D A;  5DTB A;  1OLA A;  4G68 B;  3RTW B;  3FTO A;  3K6U A;  4EF2 A;  2GHA A;  2R6G E;  1LFH A;  3W15 C;  4KYS A;  3TPA A;  2HZK A;  1Y4T A;  3G3J A;  3FAS A;  2QL3 A;  4XKN A;  4G8H A;  4ZEF A;  1NKX A;  4OFO A;  1IXI A;  2ZYO A;  4NF8 B;  3VVD A;  2OZZ A;  4NF6 B;  5I57 A;  3BFT A;  1B7U A;  1B0H A;  4YZZ A;  1H45 A;  1TFA A;  2CZL A;  1RKM A;  1URG A;  5AA4 A;  2RF1 A;  3O2A A;  3RYB A;  3RT6 B;  3FVO A;  3R26 A;  3FVG A;  3O6I A;  4EQB A;  3S9M C;  1WDN A;  4Q0C A;  1RYO A;  3K1P A;  1Y1M A;  1MQD A;  4XKQ A;  1IXG A;  5EHS A;  4R6H A;  2V3T A;  3SET A;  1A54 A;  3MUQ A;  4IGR A;  3VE1 B;  2Y84 A;  3VLW A;  3GXA A;  2QJE A;  4POW A;  4U4S A;  3E3K A;  3OMB A;  4OEU A;  4AB5 A;  2PBW A;  2HCA A;  3B6T A;  3W9W A;  2G29 A;  4OHN A;  5I2N A;  3CFL A;  2X7Q A;  1XVX A;  3N5L A;  1Y3N A;  1BLF A;  1MDP 1;  4OES A;  2Z8F A;  3UIF A;  4QF9 A;  3OEK A;  4FIM A;  1MS7 A;  3PMX A;  3Q29 A;  4R2F A;  4RK2 A;  3T96 B;  2O69 A;  3MC2 A;  4H8J A;  3S2V A;  3FXQ A;  4ZZA A;  1B4H A;  1GTK A;  1NNT A;  1B46 A;  1VFD A;  2A5S A;  3MVY A;  1XT8 A;  3O6P A;  3SDF A;  4OTE A;  3TEP A;  3JV9 A;  4QFL A;  4ELR A;  4GLI A;  2Q89 A;  3VFJ A;  5H8S A;  1JW1 A;  2XX9 A;  1P99 A;  2I3W A;  3SEW A;  3RPW A;  2QS3 A;  2H9B A;  3C35 A;  2O51 A;  1LB8 A;  4HS7 A;  1FTJ A;  2Y7R A;  4ZS9 A;  3DRJ A;  2DXY A;  1H43 A;  3L6G A;  4RNS A;  4Q5T A;  2UYF A;  2H99 A;  1FQB A;  4R6K A;  1F9B A;  3PAM A;  1POY 1;  3RLF E;  3CHG A;  2Z22 A;  4ZEB A;  3H6U A;  4P0I A;  2DE4 A;  2D3I A;  4AQ4 A;  4MFI A;  1Y1Z A;  5JTY A;  1UTB B;  5JK4 A;  2WOK A;  1MQI A;  4ZEI A;  2F34 A;  1YTV A;  3ODB A;  1AMF A;  2WOP A;  1B5I A;  1MXW A;  3HHF A;  3KSX A;  1CB6 A;  1US4 A;  1ATG A;  2LAO A;  3K02 A;  4KYD A;  3C36 A;  4FED A;  3OOA A;  5K2X A;  1VSO A;  3PU5 A;  3S9N C;  2DOJ A;  4YKJ A;  1LAH E;  2NUV A;  5BWJ A;  4X48 A;  2WKY A;  3E13 X;  3KG2 A;  1TWY A;  3M3F A;  4R6Y A;  5H8F B;  3JZJ A;  3KZG A;  4TQU Q;  2QS4 A;  5CMB A;  1Y3Q A;  4LQ5 A;  5H8Q B;  1QUI A;  5H8H A;  3DP4 A;  1B32 A;  5A5X A;  5ICT A;  2PVU A;  4IO7 A;  4DXU A;  4NF5 B;  3QUJ A;  3VLU A;  3OSQ A;  3QK6 A;  2I48 A;  2ZNS A;  4GOT A;  3O29 A;  4ZE8 A;  1DMB A;  2Y7W A;  4E0W A;  4RPO A;  3T66 A;  2YLN A;  3CIJ A;  3Q26 A;  2XHD A;  3IOV A;  1LBB A;  4U21 A;  5CMM A;  4OWD A;  2I3V A;  3TDJ A;  2OLB A;  2I0C A;  1H44 A;  2I0B A;  3RN8 A;  2DS9 A;  5TU0 A;  3IK6 B;  5KCJ B;  2ZXT A;  2ONK E;  5AA2 A;  3BFU A;  5TP9 A;  1B0L A;  4GL0 A;  3PPR A;  4LVQ A;  1QJM A;  4P11 A;  3IB2 A;  3H6T A;  3C31 A;  4YKI A;  2UVH A;  3FVK A;  4N07 A;  1NFT A;  3DRI A;  3K00 A;  4H8I A;  5KDT B;  3W9V A;  1OMP A;  4QRZ A;  2DWJ A;  2V93 A;  2RCA A;  2F6P A;  2HZL A;  1EU8 A;  4KFQ A;  2P0S A;  1FTK A;  3TEL A;  1JVY A;  2XXQ A;  1BKA A;  4AB6 A;  1VFE A;  3T9X B;  1FQE A;  3PD8 A;  3FD3 A;  3LUY A;  3MP6 A;  2XXW A;  2DXR A;  3MPK A;  4O3A A;  1N3X A;  3SEY A;  2Z8D A;  3LSX A;  4F18 A;  4DXC A;  3PGF A;  2Z23 A;  4OQO A;  3HPI A;  3DLN A;  3C34 A;  1N7W A;  5DEX B;  3EHS A;  1MG1 A;  2I4B A;  1M5E A;  3TFL A;  3VVF A;  1H76 A;  2XXU A;  2VOZ A;  3S9L C;  3B6Q A;  5I56 B;  4ZEK A;  3UOR A;  1US5 A;  3EHU A;  3LBS A;  4Z7E A;  2ESN A;  2PYY A;  4LAT A;  3GZG A;  3Q25 A;  3PUX E;  3QYT A;  2F7C A;  4DCX A;  1NMU A;  2R9J A;  2B4L A;  1OVB A;  3MZ1 A;  3QSL A;  2V3U A;  1ANF A;  2B3B A;  1R1N A;  4NWC A;  2UYE A;  1I6Q A;  1B2H A;  1UIU A;  2VD3 A;  1LAG E;  3UN6 A;  4X1B A;  3H03 A;  2W7Y A;  4LP2 B;  4DZ1 A;  2HFB A;  1XOC A;  4DIG A;  5DVF A;  3IOU A;  1NNK A;  4NF8 A;  5B70 A;  4NF4 B;  4NF6 A;  4ZEC A;  4OZ9 A;  1FQD A;  4MBP A;  3MVX A;  4GRK A;  1QVS A;  4MLQ A;  2UVJ A;  1MY3 A;  1OQG A;  3DRH A;  1QUJ A;  3DRG A;  3T93 B;  3IL1 B;  1B1X A;  4IO4 A;  5CMK A;  1ZU0 A;  1SD3 A;  4QHQ A;  3OXN A;  3D4G A;  1QKB A;  2H4I A;  3T9V A;  1FQA A;  1MY0 A;  4EQ7 A;  4G4P A;  3RQT A;  3TKD A;  5FHM A;  2IEE A;  4C1T A;  3I5O A;  4JB7 A;  3UK4 A;  4GIZ A;  2A5T B;  5AA2 D;  3KSJ A;  1LST A;  3EF7 A;  1AL3 A;  1SDX A;  1B7Z A;  1MQG A;  3O9P A;  2F36 A;  5DVI A;  1B05 A;  2XXH A;  1DOT A;  1USY H;  4NMY A;  4ELO A;  2X26 A;  1MRP A;  3O97 A;  2Q2C A;  4FOR A;  5I59 B;  4EF1 A;  2O7U A;  2Y7P A;  3KFM A;  3TAJ A;  1BTJ A;  3KN3 A;  5B7D A;  1PC3 A;  5I2K A;  4BDQ A;  3DEL B;  3FVN A;  5CC2 A;  1PB7 A;  5DT6 A;  4I9D A;  2RC8 A;  3VXB A;  1YAE A;  5FHN A;  1VR5 A;  3MVW A;  2G93 A;  2H5Y A;  3V89 B;  3R6U A;  3IX1 A;  3I6V A;  2QMX A;  2XD2 A;  4E0X A;  1B3H A;  4FJP A;  4LA9 A;  3JYR A;  1ELJ A;  2GFE A;  1LCF A;  3LR1 A;  4IO5 A;  2DWH A;  4ZE9 A;  3G3H A;  3OO9 A;  3FGS A;  3HN0 A; 
#chains in the Genus database with same CATH topology
 2Q88 A;  3VLV A;  3VDF A;  3GBB A;  3RTF B;  2QS1 A;  3OEL A;  2OK2 A;  2AYS A;  2AL5 A;  4U23 A;  3SKP A;  5K2Y A;  1YXI A;  1FJ6 A;  2ALU A;  2B65 A;  3HV1 A;  1B58 A;  4F22 A;  1Q1K A;  3MJN A;  4F3P A;  4H5F A;  1EZP A;  2NXO A;  2DWA A;  1IQ7 A;  1PBP A;  5EYG A;  4DI4 B;  1DPE A;  3ILU B;  4HTG A;  1HSL A;  1N0T A;  4O3C A;  3CSB A;  4DCY A;  3PPO A;  3SES A;  1LBZ A;  5TPA B;  4U4X A;  1B3F A;  3G3G A;  3N6T A;  4TLL B;  4GX3 A;  4XTC Q;  1Y4C A;  2XXI A;  3IR1 A;  4R9G A;  2B4M A;  2DDK A;  1UTH A;  4QXD A;  3PMV A;  1SW1 A;  4GXA A;  4IO2 A;  4GWO A;  3TMG A;  1UIV A;  1NNP A;  3CI8 A;  1SYI A;  3PUV E;  5H8Q A;  5I3S A;  3N6U A;  1IMD A;  1RDX A;  1N04 A;  5CM6 A;  4I3E A;  1J1N A;  2B3F A;  4HW8 A;  3IB1 A;  5I57 B;  4OVS A;  3H4Z A;  4IY6 A;  4JWO A;  3MVZ A;  5AA4 B;  4RPN A;  2VP1 A;  1NV3 A;  1T0K A;  3BKI B;  1FTL A;  1B7H A;  4JVD A;  1D9V A;  4JVI A;  3B7D A;  1OLC A;  1LCT A;  5ICQ A;  2ANJ A;  2ZZX A;  3IOR A;  5I84 A;  4R9F A;  5AE4 A;  2XX7 A;  1MXY A;  3ZKK A;  1P1N A;  4U1Z A;  1IMC A;  3Q27 A;  4QFK A;  3ZS6 A;  4DXB A;  3FIR A;  4BDR A;  4BLA A;  4IY5 A;  2PFZ A;  3FV1 A;  2DP8 A;  1P1O A;  1XVY A;  4GXS B;  2F5X A;  5LOM A;  3GBA A;  5I2N B;  4P9K A;  4ISU A;  3RPL A;  4N4U A;  2QVV A;  2XXR A;  4U1O A;  4OVR A;  3K01 A;  2MKZ A;  2ZMB A;  4MNI A;  3WAE A;  1ZLQ A;  1OQH A;  4NX1 A;  3T9H B;  4MX6 A;  4DLD A;  4NQ8 A;  1EZ9 A;  4PQJ A;  5EQ8 A;  4XFE A;  3T9U A;  2FA7 A;  4ESW A;  4KCD A;  4N6P A;  1SBP A;  5CBS A;  1FQF A;  3FJM A;  2IA4 A;  1AWB A;  2BJJ X;  3UA8 A;  1QKA A;  5J1D A;  2PT2 A;  3I3V A;  4WKM A;  5IAI A;  3HO7 A;  3PUW E;  3ECR A;  1JQF A;  4OVP A;  4XEQ A;  3SEX A;  1MM7 A;  3M3K A;  2HQ0 A;  1SPI A;  5IM2 A;  3ZKL A;  2Y7K A;  1FPD A;  5AA1 A;  1R9Q A;  5IZ3 A;  1A40 A;  2PCR A;  3G3I A;  4U22 A;  1SYH A;  1NUX A;  4PFB A;  2I6E A;  2PT1 A;  2Q8J A;  1IEJ A;  1RDZ A;  2FNC A;  4BDL A;  1NH7 A;  4GWU A;  1JNF A;  2P3V A;  2E0S A;  5DEX A;  3MQ9 A;  4OET A;  3TYH A;  1II5 A;  5ITO A;  4PFT A;  5FTI A;  4G2Z A;  2OX3 A;  3CVG A;  3V8X B;  2VGQ A;  2XWO A;  2E1S A;  4KR5 A;  4BDO A;  4GL8 A;  1I6A A;  1B1H A;  3TCH A;  2PX1 A;  1O7T A;  3CG3 A;  4AS5 A;  4U2R A;  5I58 A;  4RY1 A;  4EQ9 A;  3E4R A;  2XXX A;  1FPK A;  2R71 A;  3ONM A;  1QW0 A;  4WEP A;  4PF8 A;  1Y20 A;  3A3U A;  4QFP A;  2PMS A;  2XXP A;  3FAT A;  4R72 A;  4R2B A;  4RXL A;  1SW4 A;  4NN3 A;  2KLF A;  2JJK A;  4XIG Q;  3KBR A;  3IAZ A;  4QBA A;  2F8D A;  3RNN A;  3RGY A;  1LAX A;  4FE8 A;  1RDY A;  5F1Q A;  1MPC A;  1XHY A;  4QFO A;  4F3G A;  2F3D A;  3O66 A;  3KN7 A;  3U65 A;  1IXH A;  3LSF B;  4MH5 A;  4YB6 A;  2DQV A;  2Z8E A;  3F11 A;  2VHA A;  4H5G A;  4NF4 A;  1MQH A;  2DYX A;  2DVC A;  2OWZ A;  1KA0 A;  3L6H A;  2M8C A;  1YYZ A;  4KYE A;  4PE5 B;  1AH5 A;  3HHG A;  4F1Y A;  1K9Z A;  4EXK A;  4RJZ A;  2D5W A;  3U93 A;  1DTG A;  4JWY A;  3SEV A;  2AL4 A;  1JEV A;  4JBZ A;  3EQ1 A;  2ONS A;  3LVU A;  4YKK A;  1QUK A;  4OVJ A;  2XD3 A;  3LV0 A;  1IMF A;  2QFL A;  1JET A;  3IJX B;  3OO6 A;  2V84 A;  3TQL A;  3PUZ E;  3USD A;  2THI A;  1NI9 A;  2FIX A;  1LGB C;  2A5T A;  5FTH A;  3MBP A;  3U92 A;  1A8F A;  4NWD A;  2GRV A;  1NNF A;  4K3F A;  3IFA A;  2V4C A;  4XKR A;  3KJ7 A;  3H6W A;  4GD5 A;  4F2Q A;  4P56 A;  4Z0I A;  4R75 A;  4N17 A;  2XXY A;  4G68 A;  3OD7 A;  4O94 A;  2OBG A;  5AA2 B;  3QAX A;  4PAI A;  2FVZ A;  3FJ7 A;  5TP9 B;  1MY1 A;  1M5C A;  3TTM A;  2HAU A;  1M5F A;  1MY4 A;  3RUM A;  3ZSF A;  1QUL A;  3LSL A;  4PE3 A;  1O64 A;  3LUZ A;  1ZJL A;  4H0W A;  4EDP A;  4XKP A;  1N7X A;  1FCK A;  1GR2 A;  3CR9 A;  4TLM B;  3K6V A;  1CE2 A;  2ZZV A;  3DRF A;  4DE8 A;  2QPQ A;  2FIE A;  2OWS A;  3K6W A;  2F7B A;  3KC0 A;  4PCD A;  2O1L A;  2F35 A;  3OO8 A;  3G3F A;  5EHM A;  4F1V A;  1FJ9 A;  4H1X A;  3H6V A;  2UVI A;  4MNC A;  3LSW A;  3ILT B;  5IGA A;  1FW0 A;  2RC7 A;  1I69 A;  1MM6 A;  4BDM A;  4PFY A;  4PAK A;  1GVC A;  5CMC A;  4OXV A;  1B3L A;  4PP0 A;  5H8N B;  5M2V A;  2WX9 A;  3PPN A;  4NTL A;  3MZB A;  4H65 A;  4YB7 A;  4YKP A;  2XXV A;  5L9O A;  1B9J A;  1MH4 A;  3UP9 A;  3N94 A;  1UQW A;  5ESY A;  2CMO A;  1BP5 A;  2NOO A;  3K0V A;  1A7L A;  4LON B;  5CRY A;  3ROJ A;  2REJ A;  1B40 A;  3B50 A;  4H45 A;  3RY3 A;  2OJT A;  4I40 A;  3EPE A;  4EXL A;  5L8D A;  1Y3P A;  3HST A;  3TQW A;  4FAT A;  1GV8 A;  2V25 A;  1OIB A;  4OEV A;  1MY2 A;  3K6X A;  4P3L A;  1LBW A;  2DVZ A;  4HE1 A;  4FAJ A;  2WBB A;  1S50 A;  1PDA A;  3H3G A;  1PEB A;  4IGT A;  1OVT A;  2O68 A;  3E79 A;  5TPA A;  3KOS A;  3OEM A;  2NVU B;  1ZIU A;  1URD A;  1DTZ A;  1MDQ A;  4PGP A;  1WOD A;  4JWX A;  4NE4 A;  4F29 A;  3TOD A;  1D9Y A;  3C32 A;  4N6K A;  4YB5 A;  3TZA A;  3V83 A;  1EYJ A;  4H6D A;  4C0R A;  4R73 A;  5EQA A;  1FTA A;  1S9T A;  2OWT A;  2UXA A;  1IXC A;  3MW0 A;  4ZED A;  1G0H A;  3VVE A;  5ISU A;  2F97 A;  4N8G A;  1A99 A;  2QMW A;  1YCJ A;  4WXJ A;  1LB9 A;  1O63 A;  3VV5 A;  1R6Z A;  4RA1 A;  4GQO A;  1FPI A;  3EKI A;  3S9E A;  1B52 A;  2H98 A;  4LN5 A;  4OVQ A;  4PFU A;  2NWJ A;  3M8U A;  3G7W A;  3SER A;  4QSE A;  1IUD A;  3B6W A;  3FV2 A;  2QVR A;  3KOT A;  4O3B A;  3CFX A;  2P2A A;  1B5H A;  4KQP A;  3C4M A;  1UTB A;  4NF0 A;  1M5D A;  3PUY E;  4Q8R A;  4JSO A;  3DP6 A;  3D1R A;  5HM4 B;  4ECF A;  4ND9 A;  2QRY A;  4O7M A;  3RT8 A;  3FXR A;  2ZYN A;  2ABH A;  1FPE A;  2DWI A;  3CFZ A;  3CG1 A;  4YU0 A;  3NOH A;  4ZZE A;  2D21 A;  1L5T A;  1ZTY A;  4PBH A;  1A8E A;  4IO3 A;  1TXF A;  1VE4 A;  2GH9 A;  3KJT A;  1XI6 A;  3K1M A;  3DRK A;  4GF8 A;  3D4C A;  3MAM A;  2OCU A;  2FYI A;  2ZYK A;  4YMB A;  1N84 A;  1FBF A;  3MP8 A;  5H8F A;  2DSF A;  5I2K B;  4POX A;  4KPT A;  3QIM A;  2WBD A;  2O84 X;  4NAP A;  1P1Q A;  3FXU A;  4OMB A;  3PPQ A;  2WEF A;  4NF5 A;  4MNP A;  2I58 A;  1JW5 A;  1PBQ A;  1ZBM A;  4P1E A;  4LZ8 A;  4H67 A;  1MXZ A;  4GVO A;  4UA8 A;  1PB8 A;  1B4Z A;  5IKB A;  4OFL A;  1GGG A;  1N3W A;  3U8Q A;  5HBC A;  3TCF A;  3KEI A;  4Q30 B;  2CZI A;  4BDN A;  4KHZ E;  4ELQ A;  1WVJ A;  4G8N A;  1JEU A;  1YPN A;  3CRB A;  3QUF A;  1D9Q A;  3FJG A;  4LQ2 A;  1FRP A;  1S7Y A;  3TTK A;  2WYP A;  3THI A;  2YPN A;  4FEB A;  2XXT A;  5KCJ A;  4G8M A;  4M1V A;  1IIT A;  3QMF A;  1FTM A;  3PPP A;  4KI0 E;  1N76 A;  1Y9U A;  3O6G A;  1TFD A;  4EUO A;  1D3K A;  1JP4 A;  4MIJ A;  3O28 A;  4F2O A;  3GYY A;  2O6A A;  3QXM A;  1SW5 A;  3LC8 A;  5KZT A;  4P8B A;  4OA4 A;  5ITP A;  5KDT A;  4PDD A;  3TTR A;  3DM0 A;  4PFW A;  3O6H A;  1IIW A;  5AA3 A;  4F1U A;  5HPQ A;  1TT1 A;  3K1N A;  4MLV A;  3KGC A;  4NED A;  1NH8 A;  5DVJ A;  3A29 A;  4N8Y A;  1SQY A;  2YJP A;  5I5P A;  3H06 B;  1UTH B;  3VXC A;  4I62 A;  2WOL A;  1MXV A;  4C1U A;  2Q9T A;  4OER A;  3RYA A;  2XWI A;  2VPO A;  2AIX A;  2HAV A;  2RC9 A;  4ZDM A;  3IB0 A;  3C33 A;  4HCY A;  3Q28 A;  2I4C A;  4O8M A;  2F78 A;  1FBC A;  2H25 A;  2DE3 A;  3BIH A;  4DDD A;  4YIC A;  2F6G A;  1JW4 A;  1FSA A;  4F19 A;  1EZO A;  4N91 A;  4QFN A;  3MZ9 A;  1XC1 A;  3UGW A;  3KC1 A;  1ZMG A;  3ISP A;  1B3E A;  3A09 A;  3IJO B;  4PET A;  4OFJ A;  3OSR A;  4HXV A;  1MQJ A;  4X9T A;  4ELP A;  1IZ1 A;  2HHM A;  5L9M A;  5I56 A;  5L9S A;  4ESX A;  2FBP A;  2REG A;  1HSJ A;  2ZYM A;  1SI1 A;  1A55 A;  1MPB A;  4QSC A;  1FTO A;  1KWH A;  4NHB A;  1SI0 A;  4R74 A;  5T3J A;  3IO4 A;  4IR8 A;  5JTY B;  1FQC A;  3U72 A;  1XS5 A;  2UVG A;  3T22 A;  4RYA A;  3BBR A;  4GWS A;  2RKM A;  3CSG A;  4IO6 A;  2P1S A;  3AXF A;  1RYX A;  4X8R A;  3RPL B;  2CZH A;  2ZNU A;  5BUU A;  1MPD A;  1BIY A;  4WED A;  3SEU A;  1B5J A;  4JSD A;  3FZV A;  4JXI A;  2I49 A;  3MWB A;  4DI3 D;  4PBQ A;  1SW2 A;  3C9H A;  4GFR A;  5ELV A;  1R9L A;  3H7M A;  2HEU A;  2HXW A;  4OAN A;  4GBV A;  4KCC A;  4LUB A;  4MF3 A;  3V5A A;  1QGX A;  4P1L A;  3M3L A;  3PMW A;  4ONY A;  1Z7M E;  1LLS A;  3PD9 A;  4JVC A;  2WYK A;  5H8H B;  2Y5K A;  5A5X B;  4UAC A;  5FHO A;  4G61 A;  3TTL A;  3N26 A;  3MPL A;  3KN8 A;  3FBP A;  1P1U A;  3HCQ A;  2O7I A;  5I7I A;  3PV0 E;  4XXU A;  4F3B A;  5ET6 A;  1B51 A;  4RK9 A;  5H8N A;  5IZ3 B;  1B3G A;  3R7X A;  3EN3 A;  3WAF A;  4G68 C;  2HPG A;  4LZ7 A;  2VD2 A;  5F7V A;  3P7I A;  5CI5 A;  2ZNT A;  4X1D A;  4HCW A;  1M5B A;  1LBC A;  4PC9 A;  2XA5 A;  3DP8 A;  1DPP A;  3S4U A;  1URS A;  3U1O A;  2V3Q A;  1SVX B;  1IMB A;  2CEY A;  1FBH A;  1LFI A;  5I58 B;  3E9X A;  5DYH A;  1MXU A;  4F3S A;  4THI A;  2QS2 A;  5I59 A;  1NL5 A;  4XF5 A;  4PTK A;  1EYK A;  4L17 A;  1PB9 A;  2O1M A;  4I8C A;  3G3K A;  1P1W A;  2F7A A;  1NUZ A;  1NV0 A;  4P0G A;  2HXR A;  1B6H A;  4OVT A;  3OEN A;  3IOT A;  4YAH X;  2GHB A;  2R8T A;  4FEC A;  1ZKB A;  2RCB A;  1JVX A;  5JEI A;  1LFG A;  3T1B A;  4YMA A;  2Y7I A;  3TTN A;  1POT A;  3IOW A;  4M4G A;  4OEN A;  4F31 B;  2DE2 A;  5ET8 A;  3TUS A;  1AIV A;  2ONR A;  1LAF E;  4G77 A;  1Z7N E;  4N15 A;  4LZ5 A;  1USY E;  4IB2 A;  4JDF A;  1DSN A;  5LTC A;  2RIN A;  3FUZ A;  2Q2A A;  3K4U A;  1Q35 A;  3GLB A;  4TOZ A;  1LEV A;  2QSX A;  3U94 A;  3K2D A;  3RYD A;  4PDH A;  4OYV A;  2BJI A;  4I1D A;  4N81 A;  3MP1 A;  3IO6 A;  1D4N A;  4MCO A;  1MXX A;  1FPG A;  2X7P A;  3TCG A;  3OO7 A;  2XX8 A;  4QSD A;  1I6B A;  4N13 A;  1IME A;  5EYF A;  1Q9D A;  3EHT A;  1EH3 A;  1MH3 A;  3A3C A;  4KD5 A;  4F39 A;  5CBR A;  1AOV A;  1HSE A;  1H3D A;  5DTB A;  1CNQ A;  1OLA A;  4G68 B;  3RTW B;  2CZK A;  3FTO A;  3K6U A;  4EF2 A;  2GHA A;  2R6G E;  2VPN A;  1LFH A;  3W15 C;  4KYS A;  3TPA A;  4GWZ A;  4O7I A;  2HZK A;  1Y4T A;  1FPL A;  3T0J A;  3G3J A;  3FAS A;  2QL3 A;  4MJO A;  4NGU A;  4XKN A;  4G8H A;  4ZEF A;  1NUY A;  1NKX A;  2QVU A;  1G0I A;  4OFO A;  1IXI A;  5IZ1 A;  2ZYO A;  4NF8 B;  3VVD A;  2OZZ A;  4NF6 B;  5I57 A;  3BFT A;  1B7U A;  1B0H A;  1H45 A;  1TFA A;  2CZL A;  4YZZ A;  1RKM A;  1URG A;  5AA4 A;  1DBZ A;  2RF1 A;  3O2A A;  3RYB A;  3RT6 B;  3FVO A;  3R26 A;  3FVG A;  3O6I A;  4EQB A;  3S9M C;  1WDN A;  4PF6 A;  4Q0C A;  1RYO A;  3K1P A;  1Y1M A;  1MQD A;  5LDZ A;  4XKQ A;  1IXG A;  5EHS A;  4R6H A;  2V3T A;  3SET A;  1A54 A;  3MUQ A;  4IGR A;  3VE1 B;  2Y84 A;  3VLW A;  3GXA A;  2QJE A;  4POW A;  4U4S A;  3E3K A;  3OMB A;  4OEU A;  4AB5 A;  2PBW A;  2HCA A;  3B6T A;  3W9W A;  4OHN A;  2G29 A;  5I2N A;  3CFL A;  2FHY A;  2XWK A;  2X7Q A;  1XVX A;  3N5L A;  1Y3N A;  1BLF A;  1MDP 1;  4OES A;  2Z8F A;  3UIF A;  4QF9 A;  3OEK A;  4FIM A;  1MS7 A;  3PMX A;  3Q29 A;  4R2F A;  4RK2 A;  3T96 B;  2O69 A;  3MC2 A;  4H8J A;  3S2V A;  3FXQ A;  4ZZA A;  1B4H A;  1NV1 A;  1GTK A;  1NNT A;  1B46 A;  1VFD A;  2A5S A;  3MVY A;  1XT8 A;  4N6D A;  1INP A;  4P47 A;  3O6P A;  3SDF A;  4OTE A;  3TEP A;  3B8B A;  3JV9 A;  4X04 A;  4GWX A;  1NV4 A;  4QFL A;  4PGN A;  4ELR A;  4GLI A;  4UAB A;  2Q89 A;  3VFJ A;  5H8S A;  1JW1 A;  2XX9 A;  1P99 A;  2I3W A;  3SEW A;  3RPW A;  2QS3 A;  2H9B A;  3C35 A;  2O51 A;  1LB8 A;  4HS7 A;  1FTJ A;  2Y7R A;  1FBP A;  4ZS9 A;  3DRJ A;  2DXY A;  2P3N A;  1H43 A;  3L6G A;  4RNS A;  4GBW A;  4Q5T A;  2UYF A;  2H99 A;  1NV6 A;  1FQB A;  4R6K A;  1F9B A;  2L5V A;  3PAM A;  1POY 1;  3RLF E;  3CHG A;  1YZ0 A;  2Z22 A;  4ZEB A;  3H6U A;  4P0I A;  2DE4 A;  1FPB A;  4HE2 A;  4MEV A;  2D3I A;  4AQ4 A;  2GQ1 A;  5DW8 A;  4MFI A;  1Y1Z A;  5JTY A;  4GWW A;  4KXP A;  2CEX A;  1UTB B;  5JK4 A;  2XWV A;  2WOK A;  1MQI A;  4ZEI A;  2F34 A;  1YTV A;  3ODB A;  1AMF A;  2WOP A;  3IFC A;  1B5I A;  1MXW A;  4NG7 A;  3HHF A;  2Q74 A;  3KSX A;  5F24 A;  1CB6 A;  5EQ7 A;  4FBP A;  1US4 A;  1ATG A;  2ZZW A;  2LAO A;  3K02 A;  4KYD A;  3MST A;  3C36 A;  4FED A;  3OOA A;  5K2X A;  1VSO A;  3PU5 A;  3S9N C;  2DOJ A;  4YKJ A;  1LAH E;  2NUV A;  5BWJ A;  2KQZ A;  4X48 A;  4MAG A;  2WKY A;  3E13 X;  3KG2 A;  1TWY A;  3M3F A;  4R6Y A;  5H8F B;  3JZJ A;  3KZG A;  4TQU Q;  1NUW A;  2QS4 A;  5CMB A;  1DK4 A;  1Y3Q A;  4LQ5 A;  5H8Q B;  1QUI A;  5H8H A;  3DP4 A;  1B32 A;  4HE0 A;  5A5X A;  5ICT A;  2PVU A;  4IO7 A;  4DXU A;  1FPF A;  4NF5 B;  5ET7 A;  3QUJ A;  3VLU A;  3OSQ A;  3QK6 A;  2I48 A;  2ZNS A;  4GOT A;  3O29 A;  4ZE8 A;  1DMB A;  2Y7W A;  4E0W A;  4RPO A;  3T66 A;  2YLN A;  3CIJ A;  3Q26 A;  2XHD A;  3IOV A;  1LBB A;  1FPJ A;  4U21 A;  5CMM A;  4OWD A;  2I3V A;  3TDJ A;  2OLB A;  2I0C A;  1H44 A;  2I0B A;  3RN8 A;  1BK4 A;  2DS9 A;  5TU0 A;  3IK6 B;  5KCJ B;  2ZXT A;  2ONK E;  5AA2 A;  3BFU A;  1NV5 A;  5TP9 A;  1B0L A;  4GL0 A;  3PPR A;  4LVQ A;  1QJM A;  4P11 A;  3IB2 A;  3H6T A;  3C31 A;  4YKI A;  2UVH A;  3FVK A;  3HFU A;  4GX6 A;  4N07 A;  4MMP A;  1NFT A;  3DRI A;  3K00 A;  5EYH A;  4H8I A;  3FXB A;  5KDT B;  3W9V A;  1OMP A;  4QRZ A;  2DWJ A;  2V93 A;  3PTY A;  2RCA A;  1LBX A;  2F6P A;  2HZL A;  1EU8 A;  4KFQ A;  2P0S A;  1FTK A;  3TEL A;  1JVY A;  2XXQ A;  1BKA A;  4AB6 A;  1VFE A;  3T9X B;  2KR0 A;  1FQE A;  3PD8 A;  4GWY A;  3FD3 A;  3LUY A;  3MP6 A;  2XXW A;  4PFI A;  2DXR A;  3MPK A;  4O3A A;  3KBZ A;  1N3X A;  3SEY A;  2Z8D A;  5EQ9 A;  3LSX A;  4F18 A;  4DXC A;  4H46 A;  3PGF A;  2Z23 A;  4OQO A;  3HPI A;  3DLN A;  3C34 A;  1N7W A;  5DEX B;  3EHS A;  1KZ8 A;  5FBP A;  1MG1 A;  2I4B A;  1M5E A;  3TFL A;  3VVF A;  1H76 A;  2XXU A;  2VOZ A;  3S9L C;  3B6Q A;  5I56 B;  4ZEK A;  3UOR A;  1US5 A;  3EHU A;  1DCU A;  3LBS A;  4Z7E A;  2ESN A;  2PYY A;  4LAT A;  3GZG A;  3Q25 A;  3PUX E;  3QYT A;  2F7C A;  4DCX A;  1NMU A;  2R9J A;  2B4L A;  1OVB A;  3MZ1 A;  3QSL A;  4PAF A;  2V3U A;  3MYU A;  1ANF A;  2B3B A;  1R1N A;  3E78 A;  4NWC A;  2UYE A;  1I6Q A;  1B2H A;  1UIU A;  2VD3 A;  1LAG E;  3UN6 A;  3SZP A;  4X1B A;  1NV7 A;  3H03 A;  2W7Y A;  4LP2 B;  4DZ1 A;  2HFB A;  1XOC A;  4DIG A;  5DVF A;  3IOU A;  1NNK A;  4NF8 A;  5B70 A;  4MHF A;  4NF4 B;  2XXK A;  4NF6 A;  1VDW A;  4ZEC A;  4OZ9 A;  1FBG A;  1FQD A;  4MBP A;  3MVX A;  4GRK A;  1QVS A;  4MLQ A;  2UVJ A;  1LBY A;  2F3B A;  1MY3 A;  1OQG A;  3DRH A;  1FBE A;  1QUJ A;  3DRG A;  3T93 B;  3IL1 B;  1B1X A;  4IO4 A;  5CMK A;  3BIG A;  1ZU0 A;  1KA1 A;  1SD3 A;  4QHQ A;  3OXN A;  3D4G A;  4PFR A;  1QKB A;  2H4I A;  4I3Y A;  3T9V A;  1FQA A;  2Q8M A;  5A5L A;  1MY0 A;  4EQ7 A;  4G4P A;  3RQT A;  3TKD A;  5IZZ A;  5FHM A;  2Y5L A;  2IEE A;  4C1T A;  3I5O A;  4JB7 A;  3UK4 A;  4GIZ A;  2A5T B;  5AA2 D;  4AS4 A;  3KSJ A;  1LST A;  3EF7 A;  1AL3 A;  1SDX A;  1B7Z A;  1MQG A;  3O9P A;  2F36 A;  5DVI A;  1B05 A;  2XXH A;  1EYI A;  1DOT A;  1USY H;  1IMA A;  4NMY A;  4ELO A;  2X26 A;  1MRP A;  3O97 A;  2Q2C A;  4FOR A;  5I59 B;  1K9Y A;  4EF1 A;  2O7U A;  2Y7P A;  3KFM A;  3TAJ A;  1BTJ A;  3KN3 A;  5B7D A;  1PC3 A;  5I2K A;  1NV2 A;  4BDQ A;  3DEL B;  3FVN A;  5CC2 A;  1PB7 A;  5ET5 A;  5DT6 A;  4I9D A;  2RC8 A;  3VXB A;  1YAE A;  5FHN A;  1VR5 A;  2VT5 A;  4GX4 A;  3MVW A;  2G93 A;  5J16 A;  2H5Y A;  1LBV A;  3V89 B;  1FBD A;  3R6U A;  2PFY A;  3IX1 A;  3I6V A;  2QMX A;  2XD2 A;  4E0X A;  1B3H A;  4FJP A;  4LA9 A;  3JYR A;  1ELJ A;  2GFE A;  1LCF A;  3LR1 A;  4IO5 A;  2DWH A;  4ZE9 A;  3G3H A;  3OO9 A;  3FGS A;  3HN0 A; 
#chains in the Genus database with same CATH homology
 2Q88 A;  3VLV A;  3VDF A;  3GBB A;  3RTF B;  2QS1 A;  3OEL A;  2OK2 A;  2AYS A;  2AL5 A;  4U23 A;  3SKP A;  5K2Y A;  2ALU A;  2B65 A;  3HV1 A;  1B58 A;  4F22 A;  1Q1K A;  3MJN A;  4F3P A;  4H5F A;  1EZP A;  2NXO A;  2DWA A;  1IQ7 A;  1PBP A;  1DPE A;  3ILU B;  4HTG A;  1HSL A;  1N0T A;  4O3C A;  3CSB A;  4DCY A;  3PPO A;  3SES A;  5TPA B;  4U4X A;  1B3F A;  3G3G A;  3N6T A;  4TLL B;  4XTC Q;  1Y4C A;  2XXI A;  3IR1 A;  4R9G A;  2B4M A;  1UTH A;  3PMV A;  1SW1 A;  4GXA A;  4IO2 A;  4GWO A;  3TMG A;  1UIV A;  1NNP A;  3CI8 A;  1SYI A;  3PUV E;  5H8Q A;  3N6U A;  1N04 A;  5CM6 A;  1J1N A;  2B3F A;  4HW8 A;  3IB1 A;  5I57 B;  3H4Z A;  4IY6 A;  4JWO A;  3MVZ A;  5AA4 B;  4RPN A;  2VP1 A;  1T0K A;  3BKI B;  1FTL A;  1B7H A;  1D9V A;  3B7D A;  1OLC A;  1LCT A;  5ICQ A;  2ANJ A;  3IOR A;  5I84 A;  4R9F A;  5AE4 A;  2XX7 A;  1MXY A;  3ZKK A;  1P1N A;  4U1Z A;  3Q27 A;  4QFK A;  3ZS6 A;  4DXB A;  3FIR A;  4BDR A;  4BLA A;  4IY5 A;  3FV1 A;  2DP8 A;  1P1O A;  1XVY A;  4GXS B;  2F5X A;  5LOM A;  3GBA A;  5I2N B;  4ISU A;  2XXR A;  4U1O A;  3K01 A;  2ZMB A;  3WAE A;  1ZLQ A;  1OQH A;  3T9H B;  4DLD A;  1EZ9 A;  4PQJ A;  3T9U A;  2FA7 A;  4ESW A;  4KCD A;  4N6P A;  1SBP A;  5CBS A;  1FQF A;  3FJM A;  2IA4 A;  2BJJ X;  3UA8 A;  1QKA A;  5J1D A;  2PT2 A;  3I3V A;  4WKM A;  5IAI A;  3HO7 A;  3PUW E;  3ECR A;  1JQF A;  3SEX A;  1MM7 A;  3M3K A;  2HQ0 A;  3ZKL A;  2Y7K A;  5AA1 A;  1R9Q A;  1A40 A;  3G3I A;  4U22 A;  1SYH A;  2I6E A;  2PT1 A;  2Q8J A;  1IEJ A;  2FNC A;  4BDL A;  1NH7 A;  1JNF A;  2E0S A;  5DEX A;  3MQ9 A;  4OET A;  3TYH A;  1II5 A;  5ITO A;  4PFT A;  5FTI A;  4G2Z A;  3CVG A;  3V8X B;  2VGQ A;  2E1S A;  4KR5 A;  4BDO A;  4GL8 A;  1I6A A;  1B1H A;  3TCH A;  2PX1 A;  1O7T A;  3CG3 A;  4U2R A;  5I58 A;  4RY1 A;  4EQ9 A;  3E4R A;  2XXX A;  2R71 A;  3ONM A;  1QW0 A;  4WEP A;  1Y20 A;  3A3U A;  4QFP A;  2PMS A;  2XXP A;  3FAT A;  4R72 A;  4R2B A;  4RXL A;  1SW4 A;  2KLF A;  4XIG Q;  3KBR A;  3IAZ A;  2F8D A;  3RNN A;  3RGY A;  1LAX A;  4FE8 A;  5F1Q A;  1MPC A;  1XHY A;  4QFO A;  4F3G A;  3O66 A;  3KN7 A;  1IXH A;  3LSF B;  4MH5 A;  4YB6 A;  2DQV A;  2Z8E A;  3F11 A;  2VHA A;  4H5G A;  4NF4 A;  1MQH A;  2DYX A;  2DVC A;  3L6H A;  2M8C A;  4KYE A;  4PE5 B;  1AH5 A;  3HHG A;  4F1Y A;  4EXK A;  4RJZ A;  2D5W A;  3U93 A;  1DTG A;  4JWY A;  3SEV A;  2AL4 A;  1JEV A;  4JBZ A;  3EQ1 A;  2ONS A;  3LVU A;  4YKK A;  1QUK A;  4OVJ A;  2XD3 A;  1JET A;  3IJX B;  3OO6 A;  2V84 A;  3TQL A;  3PUZ E;  3USD A;  2THI A;  1LGB C;  2A5T A;  5FTH A;  3MBP A;  3U92 A;  1A8F A;  4NWD A;  2GRV A;  1NNF A;  4K3F A;  4XKR A;  3KJ7 A;  3H6W A;  4GD5 A;  4F2Q A;  4Z0I A;  4R75 A;  2XXY A;  4G68 A;  3OD7 A;  2OBG A;  5AA2 B;  3QAX A;  3FJ7 A;  5TP9 B;  1MY1 A;  3TTM A;  1M5C A;  2HAU A;  1M5F A;  1MY4 A;  3RUM A;  3ZSF A;  1QUL A;  3LSL A;  1O64 A;  1ZJL A;  4H0W A;  4EDP A;  4XKP A;  1N7X A;  1FCK A;  1GR2 A;  3CR9 A;  4TLM B;  3K6V A;  1CE2 A;  3DRF A;  4DE8 A;  2QPQ A;  2OWS A;  3K6W A;  2F7B A;  2O1L A;  2F35 A;  3OO8 A;  3G3F A;  5EHM A;  4F1V A;  4H1X A;  3H6V A;  2UVI A;  3LSW A;  3ILT B;  1FW0 A;  2RC7 A;  1I69 A;  1MM6 A;  4BDM A;  4PFY A;  1GVC A;  5CMC A;  4OXV A;  1B3L A;  4PP0 A;  5H8N B;  5M2V A;  3PPN A;  4NTL A;  3MZB A;  4H65 A;  4YB7 A;  4YKP A;  2XXV A;  5L9O A;  1B9J A;  1MH4 A;  3UP9 A;  3N94 A;  1UQW A;  2CMO A;  1BP5 A;  2NOO A;  3K0V A;  1A7L A;  4LON B;  5CRY A;  2REJ A;  1B40 A;  3RY3 A;  2OJT A;  3EPE A;  4EXL A;  5L8D A;  1Y3P A;  3HST A;  3TQW A;  4FAT A;  1GV8 A;  2V25 A;  1OIB A;  4OEV A;  1MY2 A;  3K6X A;  2DVZ A;  4FAJ A;  1S50 A;  1PDA A;  3H3G A;  1PEB A;  4IGT A;  1OVT A;  2O68 A;  5TPA A;  3KOS A;  3OEM A;  2NVU B;  1ZIU A;  1URD A;  1DTZ A;  1MDQ A;  1WOD A;  4JWX A;  4NE4 A;  4F29 A;  3TOD A;  1D9Y A;  3C32 A;  4YB5 A;  3TZA A;  3V83 A;  4H6D A;  4C0R A;  4R73 A;  1S9T A;  2OWT A;  2UXA A;  1IXC A;  3MW0 A;  4ZED A;  3VVE A;  5ISU A;  2F97 A;  1A99 A;  2QMW A;  1YCJ A;  4WXJ A;  1LB9 A;  1O63 A;  3VV5 A;  1R6Z A;  4RA1 A;  4GQO A;  3S9E A;  1B52 A;  2H98 A;  4PFU A;  2NWJ A;  3M8U A;  3G7W A;  3SER A;  4QSE A;  1IUD A;  3B6W A;  3FV2 A;  3KOT A;  4O3B A;  3CFX A;  2P2A A;  1B5H A;  4KQP A;  3C4M A;  1UTB A;  1M5D A;  3PUY E;  4Q8R A;  4JSO A;  3DP6 A;  5HM4 B;  4ECF A;  4ND9 A;  2QRY A;  3RT8 A;  3FXR A;  2ZYN A;  2ABH A;  2DWI A;  3CFZ A;  3CG1 A;  4YU0 A;  4ZZE A;  2D21 A;  1L5T A;  1ZTY A;  1A8E A;  4IO3 A;  1TXF A;  1VE4 A;  2GH9 A;  3KJT A;  3K1M A;  3DRK A;  4GF8 A;  3D4C A;  3MAM A;  2OCU A;  2FYI A;  2ZYK A;  4YMB A;  1N84 A;  3MP8 A;  5H8F A;  2DSF A;  5I2K B;  4POX A;  4KPT A;  3QIM A;  2O84 X;  1P1Q A;  3FXU A;  4OMB A;  3PPQ A;  4NF5 A;  2I58 A;  1JW5 A;  1PBQ A;  1ZBM A;  4LZ8 A;  4H67 A;  1MXZ A;  4GVO A;  4UA8 A;  1PB8 A;  1B4Z A;  5IKB A;  4OFL A;  1GGG A;  1N3W A;  3U8Q A;  5HBC A;  3TCF A;  3KEI A;  4Q30 B;  4BDN A;  4KHZ E;  4ELQ A;  1WVJ A;  4G8N A;  1JEU A;  1YPN A;  3CRB A;  3QUF A;  3FJG A;  4LQ2 A;  1S7Y A;  3TTK A;  3THI A;  2YPN A;  4FEB A;  2XXT A;  5KCJ A;  4G8M A;  4M1V A;  1IIT A;  1FTM A;  3PPP A;  4KI0 E;  1N76 A;  1Y9U A;  3O6G A;  1TFD A;  4EUO A;  1D3K A;  3O28 A;  4F2O A;  2O6A A;  3QXM A;  1SW5 A;  3LC8 A;  5KZT A;  5ITP A;  5KDT A;  3TTR A;  3DM0 A;  4PFW A;  3O6H A;  1IIW A;  5AA3 A;  4F1U A;  5HPQ A;  1TT1 A;  3K1N A;  4MLV A;  3KGC A;  4NED A;  1NH8 A;  5DVJ A;  1SQY A;  2YJP A;  3H06 B;  1UTH B;  3VXC A;  4I62 A;  2WOL A;  1MXV A;  4C1U A;  2Q9T A;  4OER A;  3RYA A;  2AIX A;  2HAV A;  2RC9 A;  4ZDM A;  3IB0 A;  3C33 A;  4HCY A;  3Q28 A;  2I4C A;  2F78 A;  2H25 A;  2DE3 A;  4DDD A;  4YIC A;  2F6G A;  1JW4 A;  4F19 A;  1EZO A;  4QFN A;  3MZ9 A;  1XC1 A;  3UGW A;  1ZMG A;  1B3E A;  3A09 A;  3IJO B;  4PET A;  4OFJ A;  3OSR A;  1MQJ A;  4X9T A;  4ELP A;  1IZ1 A;  5L9M A;  5I56 A;  5L9S A;  4ESX A;  2REG A;  1HSJ A;  2ZYM A;  1SI1 A;  1A55 A;  1MPB A;  4QSC A;  1FTO A;  1KWH A;  1SI0 A;  4R74 A;  3IO4 A;  5JTY B;  1FQC A;  3U72 A;  1XS5 A;  2UVG A;  3T22 A;  4RYA A;  3BBR A;  2RKM A;  3CSG A;  4IO6 A;  2P1S A;  3AXF A;  1RYX A;  2ZNU A;  5BUU A;  1MPD A;  1BIY A;  4WED A;  3SEU A;  1B5J A;  4JSD A;  3FZV A;  4JXI A;  2I49 A;  3MWB A;  1SW2 A;  3C9H A;  4GFR A;  5ELV A;  1R9L A;  3H7M A;  2HEU A;  2HXW A;  4KCC A;  4LUB A;  4MF3 A;  3V5A A;  3M3L A;  3PMW A;  4ONY A;  1Z7M E;  1LLS A;  3PD9 A;  5H8H B;  5A5X B;  4UAC A;  5FHO A;  3TTL A;  3N26 A;  3MPL A;  3KN8 A;  1P1U A;  3HCQ A;  2O7I A;  3PV0 E;  4XXU A;  4F3B A;  1B51 A;  4RK9 A;  5H8N A;  1B3G A;  3R7X A;  3EN3 A;  3WAF A;  4G68 C;  4LZ7 A;  2VD2 A;  5F7V A;  3P7I A;  5CI5 A;  2ZNT A;  4X1D A;  4HCW A;  1M5B A;  1LBC A;  3DP8 A;  1DPP A;  3S4U A;  1URS A;  3U1O A;  2V3Q A;  1SVX B;  1LFI A;  5I58 B;  3E9X A;  5DYH A;  1MXU A;  4F3S A;  4THI A;  2QS2 A;  5I59 A;  1NL5 A;  4L17 A;  1PB9 A;  2O1M A;  4I8C A;  3G3K A;  1P1W A;  2F7A A;  4P0G A;  1B6H A;  3OEN A;  3IOT A;  4YAH X;  2GHB A;  4FEC A;  1ZKB A;  2RCB A;  1JVX A;  5JEI A;  1LFG A;  4YMA A;  2Y7I A;  3TTN A;  1POT A;  3IOW A;  4M4G A;  4OEN A;  4F31 B;  2DE2 A;  3TUS A;  1AIV A;  2ONR A;  1LAF E;  4G77 A;  1Z7N E;  4LZ5 A;  1USY E;  4IB2 A;  4JDF A;  1DSN A;  2RIN A;  3FUZ A;  2Q2A A;  3K4U A;  1Q35 A;  3GLB A;  4TOZ A;  2QSX A;  3U94 A;  3K2D A;  4OYV A;  4I1D A;  3MP1 A;  3IO6 A;  1D4N A;  1MXX A;  2X7P A;  3TCG A;  3OO7 A;  2XX8 A;  4QSD A;  1I6B A;  4N13 A;  5EYF A;  3EHT A;  1EH3 A;  1MH3 A;  3A3C A;  4KD5 A;  4F39 A;  5CBR A;  1AOV A;  1HSE A;  1H3D A;  5DTB A;  1OLA A;  4G68 B;  3RTW B;  3FTO A;  3K6U A;  4EF2 A;  2GHA A;  2R6G E;  1LFH A;  3W15 C;  4KYS A;  3TPA A;  2HZK A;  1Y4T A;  3G3J A;  3FAS A;  2QL3 A;  4XKN A;  4G8H A;  4ZEF A;  1NKX A;  4OFO A;  1IXI A;  2ZYO A;  4NF8 B;  3VVD A;  2OZZ A;  4NF6 B;  5I57 A;  3BFT A;  1B7U A;  1B0H A;  4YZZ A;  1H45 A;  1TFA A;  2CZL A;  1RKM A;  1URG A;  5AA4 A;  2RF1 A;  3O2A A;  3RYB A;  3RT6 B;  3FVO A;  3R26 A;  3FVG A;  3O6I A;  4EQB A;  3S9M C;  1WDN A;  4Q0C A;  1RYO A;  3K1P A;  1Y1M A;  1MQD A;  4XKQ A;  1IXG A;  5EHS A;  4R6H A;  2V3T A;  3SET A;  1A54 A;  3MUQ A;  4IGR A;  3VE1 B;  2Y84 A;  3VLW A;  3GXA A;  2QJE A;  4POW A;  4U4S A;  3E3K A;  3OMB A;  4OEU A;  4AB5 A;  2PBW A;  2HCA A;  3B6T A;  3W9W A;  2G29 A;  4OHN A;  5I2N A;  3CFL A;  2X7Q A;  1XVX A;  3N5L A;  1Y3N A;  1BLF A;  1MDP 1;  4OES A;  2Z8F A;  3UIF A;  4QF9 A;  3OEK A;  4FIM A;  1MS7 A;  3PMX A;  3Q29 A;  4R2F A;  4RK2 A;  3T96 B;  2O69 A;  3MC2 A;  4H8J A;  3S2V A;  3FXQ A;  4ZZA A;  1B4H A;  1GTK A;  1NNT A;  1B46 A;  1VFD A;  2A5S A;  3MVY A;  1XT8 A;  3O6P A;  3SDF A;  4OTE A;  3TEP A;  3JV9 A;  4QFL A;  4ELR A;  4GLI A;  2Q89 A;  3VFJ A;  5H8S A;  1JW1 A;  2XX9 A;  1P99 A;  2I3W A;  3SEW A;  3RPW A;  2QS3 A;  2H9B A;  3C35 A;  2O51 A;  1LB8 A;  4HS7 A;  1FTJ A;  2Y7R A;  4ZS9 A;  3DRJ A;  2DXY A;  1H43 A;  3L6G A;  4RNS A;  4Q5T A;  2UYF A;  2H99 A;  1FQB A;  4R6K A;  1F9B A;  3PAM A;  1POY 1;  3RLF E;  3CHG A;  2Z22 A;  4ZEB A;  3H6U A;  4P0I A;  2DE4 A;  2D3I A;  4AQ4 A;  4MFI A;  1Y1Z A;  5JTY A;  1UTB B;  5JK4 A;  2WOK A;  1MQI A;  4ZEI A;  2F34 A;  1YTV A;  3ODB A;  1AMF A;  2WOP A;  1B5I A;  1MXW A;  3HHF A;  3KSX A;  1CB6 A;  1US4 A;  1ATG A;  2LAO A;  3K02 A;  4KYD A;  3C36 A;  4FED A;  3OOA A;  5K2X A;  1VSO A;  3PU5 A;  3S9N C;  2DOJ A;  4YKJ A;  1LAH E;  2NUV A;  5BWJ A;  4X48 A;  2WKY A;  3E13 X;  3KG2 A;  1TWY A;  3M3F A;  4R6Y A;  5H8F B;  3JZJ A;  3KZG A;  4TQU Q;  2QS4 A;  5CMB A;  1Y3Q A;  4LQ5 A;  5H8Q B;  1QUI A;  5H8H A;  3DP4 A;  1B32 A;  5A5X A;  5ICT A;  2PVU A;  4IO7 A;  4DXU A;  4NF5 B;  3QUJ A;  3VLU A;  3OSQ A;  3QK6 A;  2I48 A;  2ZNS A;  4GOT A;  3O29 A;  4ZE8 A;  1DMB A;  2Y7W A;  4E0W A;  4RPO A;  3T66 A;  2YLN A;  3CIJ A;  3Q26 A;  2XHD A;  3IOV A;  1LBB A;  4U21 A;  5CMM A;  4OWD A;  2I3V A;  3TDJ A;  2OLB A;  2I0C A;  1H44 A;  2I0B A;  3RN8 A;  2DS9 A;  5TU0 A;  3IK6 B;  5KCJ B;  2ZXT A;  2ONK E;  5AA2 A;  3BFU A;  5TP9 A;  1B0L A;  4GL0 A;  3PPR A;  4LVQ A;  1QJM A;  4P11 A;  3IB2 A;  3H6T A;  3C31 A;  4YKI A;  2UVH A;  3FVK A;  4N07 A;  1NFT A;  3DRI A;  3K00 A;  4H8I A;  5KDT B;  3W9V A;  1OMP A;  4QRZ A;  2DWJ A;  2V93 A;  2RCA A;  2F6P A;  2HZL A;  1EU8 A;  4KFQ A;  2P0S A;  1FTK A;  3TEL A;  1JVY A;  2XXQ A;  1BKA A;  4AB6 A;  1VFE A;  3T9X B;  1FQE A;  3PD8 A;  3FD3 A;  3LUY A;  3MP6 A;  2XXW A;  2DXR A;  3MPK A;  4O3A A;  1N3X A;  3SEY A;  2Z8D A;  3LSX A;  4F18 A;  4DXC A;  3PGF A;  2Z23 A;  4OQO A;  3HPI A;  3DLN A;  3C34 A;  1N7W A;  5DEX B;  3EHS A;  1MG1 A;  2I4B A;  1M5E A;  3TFL A;  3VVF A;  1H76 A;  2XXU A;  2VOZ A;  3S9L C;  3B6Q A;  5I56 B;  4ZEK A;  3UOR A;  1US5 A;  3EHU A;  3LBS A;  4Z7E A;  2ESN A;  2PYY A;  4LAT A;  3GZG A;  3Q25 A;  3PUX E;  3QYT A;  2F7C A;  4DCX A;  1NMU A;  2R9J A;  2B4L A;  1OVB A;  3MZ1 A;  3QSL A;  2V3U A;  1ANF A;  2B3B A;  1R1N A;  4NWC A;  2UYE A;  1I6Q A;  1B2H A;  1UIU A;  2VD3 A;  1LAG E;  3UN6 A;  4X1B A;  3H03 A;  2W7Y A;  4LP2 B;  4DZ1 A;  2HFB A;  1XOC A;  4DIG A;  5DVF A;  3IOU A;  1NNK A;  4NF8 A;  5B70 A;  4NF4 B;  4NF6 A;  4ZEC A;  4OZ9 A;  1FQD A;  4MBP A;  3MVX A;  4GRK A;  1QVS A;  4MLQ A;  2UVJ A;  1MY3 A;  1OQG A;  3DRH A;  1QUJ A;  3DRG A;  3T93 B;  3IL1 B;  1B1X A;  4IO4 A;  5CMK A;  1ZU0 A;  1SD3 A;  4QHQ A;  3OXN A;  3D4G A;  1QKB A;  2H4I A;  3T9V A;  1FQA A;  1MY0 A;  4EQ7 A;  4G4P A;  3RQT A;  3TKD A;  5FHM A;  2IEE A;  4C1T A;  3I5O A;  4JB7 A;  3UK4 A;  4GIZ A;  2A5T B;  5AA2 D;  3KSJ A;  1LST A;  3EF7 A;  1AL3 A;  1SDX A;  1B7Z A;  1MQG A;  3O9P A;  2F36 A;  5DVI A;  1B05 A;  2XXH A;  1DOT A;  1USY H;  4NMY A;  4ELO A;  2X26 A;  1MRP A;  3O97 A;  2Q2C A;  4FOR A;  5I59 B;  4EF1 A;  2O7U A;  2Y7P A;  3KFM A;  3TAJ A;  1BTJ A;  3KN3 A;  5B7D A;  1PC3 A;  5I2K A;  4BDQ A;  3DEL B;  3FVN A;  5CC2 A;  1PB7 A;  5DT6 A;  4I9D A;  2RC8 A;  3VXB A;  1YAE A;  5FHN A;  1VR5 A;  3MVW A;  2G93 A;  2H5Y A;  3V89 B;  3R6U A;  3IX1 A;  3I6V A;  2QMX A;  2XD2 A;  4E0X A;  1B3H A;  4FJP A;  4LA9 A;  3JYR A;  1ELJ A;  2GFE A;  1LCF A;  3LR1 A;  4IO5 A;  2DWH A;  4ZE9 A;  3G3H A;  3OO9 A;  3FGS A;  3HN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...