1JETA

Oligo-peptide binding protein (oppa) complexed with kak
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (peptide transport/peptide)
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title The role of water in sequence-independent ligand binding by an oligopeptide transporter protein.
pubmed doi rcsb
total genus 187
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1996-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1jetA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jetA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1jetA02
1PB8A 1IXGA 5ICTA 3H6VA 1LBCA 1B4HA 1AH5A 3OSQA 2RC7A 4KYDA 1HSJA 1OIBA 3CFZA 4EXLA 3K02A 3ZKLA 2HFBA 3PMVA 3IORA 3EQ1A 3VVEA 5TU0A 3SEWA 3H6UA 3SKPA 2H5YA 2OK2A 1N0TA 1PC3A 3VXBA 1LB8A 3O29A 4FJPA 4H65A 4MF3A 4BDMA 3N6TA 3O97A 2RCAA 1EZOA 1XS5A 1DPEA 1A55A 1GR2A 1N7WA 3K4UA 2HAVA 1ZJLA 3FZVA 5CBSA 2KLFA 3T9UA 3TUSA 5FHOA 2I48A 4X48A 4I62A 1OMPA 5AA2D 2ONKE 4JWYA 3OMBA 3TCHA 2R9JA 2AIXA 2VHAA 1LCFA 3OEKA 4MLQA 4YB6A 2IEEA 4GIZA 3ZSFA 4KPTA 3EHTA 4ZEIA 3IO4A 1ZU0A 5ICQA 1T0KA 1MXYA 4H6DA 4FIMA 1IXCA 3DP8A 3TFLA 1LAFE 2XXVA 2F6GA 3FATA 4DCYA 4RA1A 3SEVA 4OYVA 3CVGA 3LUYA 1NNKA 4ZEFA 1JVXA 1QUJA 1P1NA 5L9MA 1OVTA 3KEIA 4QRZA 5DEXA 3MVWA 1RKMA 2E0SA 4QFKA 5M2VA 2XXIA 5B7DA 1UTHA 1URSA 5F7VA 3RYBA 2PMSA 5TP9A 3PD8A 2O7UA 4YZZA 1S9TA 5H8HB 3MZ1A 4OXVA 2XXXA 2H25A 4PETA 1PBQA 1M5CA 4JXIA 3RT8A 1AOVA 5AA2A 3Q26A 1D9VA 2PX1A 3KSJA 3DELB 2LAOA 1B3EA 4OENA 1FTLA 1O7TA 4ZE8A 1B3FA 2DOJA 2GH9A 1NMUA 5H8NA 1R9QA 4H67A 1BIYA 1N76A 5FHMA 5I84A 3S4UA 5KDTA 2DWAA 3OO7A 4TLLB 5EHMA 1B4ZA 1M5EA 4HW8A 3DRHA 4LA9A 4IB2A 3G7WA 4UACA 1IXIA 3MJNA 5CC2A 3SEYA 5K2XA 4ZECA 2UVGA 2ANJA 3B6TA 5CRYA 3IB1A 2Y84A 1P1WA 4OETA 3UA8A 3FV2A 2REJA 4F39A 3FJMA 5DEXB 1N7XA 1ZBMA 3E3KA 1SW2A 1UTHB 5TP9B 4NE4A 3H6WA 4E0XA 4F22A 5I2KA 2HZKA 1BKAA 3K1PA 3FVGA 4ELQA 3FJGA 4R72A 4RK2A 1QUKA 4O3CA 3DRIA 2ZYKA 4XKPA 2FNCA 2XXYA 4KI0E 4LZ8A 3UP9A 5JTYA 3P7IA 5AA2B 4MBPA 4AB6A 3HV1A 4ZZAA 2D3IA 4H0WA 5L9SA 4H5GA 3KFMA 2IA4A 1FQBA 4YICA 5DVIA 1D3KA 3IOTA 4GD5A 4LONB 5DTBA 1LB9A 1IXHA 2G93A 2DWIA 3TTRA 4R6HA 3C36A 3ILTB 3VDFA 3IJXB 2UXAA 4IY5A 4ZE9A 3H6TA 4QFNA 1Y20A 4C1TA 3O6HA 1USYH 2Y7IA 4IGRA 4RY1A 1MQGA 4RK9A 1JVYA 3R6UA 3ZS6A 4GF8A 3MWBA 1LAGE 3W9WA 5DVFA 3KN8A 1TWYA 2ZYMA 3MZ9A 3PD9A 1JW1A 3N5LA 1B32A 4DXBA 2QMXA 3E4RA 3CI8A 4KR5A 1MY0A 4YB7A 1A54A 3MVZA 3K1NA 4H1XA 4F3BA 5I2KB 3PUXE 3QK6A 3BBRA 3IOWA 5EHSA 3ONMA 1MXZA 4DXCA 4BDNA 1P1QA 5TPAA 3OEMA 4ZDMA 4I1DA 1UIVA 2I6EA 2VD3A 4FEBA 2QL3A 4AB5A 5JTYB 4U21A 4IY6A 1SW5A 1MY2A 1OVBA 3PV0E 1M5FA 3UK4A 3VLWA 3VVDA 4POWA 1TFAA 2DQVA 1H3DA 3EF7A 2UVJA 2OLBA 1P1OA 3FVOA 4OEVA 3TTKA 4KQPA 3TZAA 3L6HA 1B3LA 3MVYA 2F35A 2UYEA 3B6QA 3Q28A 2O84X 4N6PA 2XXUA 2XX7A 3BFTA 1S50A 3RTWB 2I3WA 2V3TA 3LC8A 3MP6A 3QAXA 3O9PA 4YKJA 3RTFB 4JSDA 4LZ7A 3M3KA 4LZ5A 1NFTA 3CIJA 2O51A 1B3GA 5I59A 4IO5A 3RLFE 4OFOA 1US4A 3PUZE 5CM6A 4JWXA 1VE4A 2YPNA 4OQOA 3EN3A 4GOTA 2B4LA 3G3KA 1D4NA 1FCKA 4PFTA 3G3HA 2QRYA 2XXPA 2F97A 5TPAB 4KFQA 1JW4A 2RF1A 1H45A 2PT2A 1ELJA 4F1UA 3MAMA 2XX8A 4JWOA 1DMBA 4QFLA 3KJTA 2QJEA 3K0VA 2O68A 1YCJA 1MPBA 4Q5TA 4I8CA 2I58A 1NNTA 3TYHA 2QS1A 3WAEA 4G68C 3RY3A 4GLIA 4F2QA 1SQYA 3O6GA 1IQ7A 1MQJA 3M3FA 2V84A 3K1MA 3VE1B 4NF8A 2QS2A 3TAJA 3QUFA 1QJMA 4YB5A 2XXHA 1LFHA 2DVCA 1AIVA 3WAFA 4JDFA 4FE8A 2O7IA 2DYXA 2WOLA 1A99A 3TCFA 1QKBA 1Y3QA 4OZ9A 4R9FA 1IITA 3CG3A 4IO2A 3PGFA 1MRPA 2Z8DA 1PB9A 3CFLA 3W15C 4G8NA 2A5SA 5CMKA 1F9BA 3JZJA 1Y4TA 2AYSA 1GGGA 1WVJA 2BJJX 4EQ9A 1S7YA 4I9DA 1DTGA 4LP2B 3K6UA 1VR5A 4EQBA 2DXYA 3JV9A 2ZNSA 2DP8A 2WKYA 4EXKA 4N07A 1RYOA 3EHUA 3W9VA 3V8XB 1MXVA 2OWSA 4NF4A 5FTHA 1URGA 2YLNA 3TMGA 1QULA 4OVJA 3S2VA 4G8HA 3CRBA 3I3VA 1POY1 2QSXA 1JNFA 4NF8B 1MY3A 2R71A 5CI5A 3E9XA 2H4IA 3ECRA 1LSTA 4X1DA 4YMAA 3JYRA 1UQWA 4Z7EA 1R6ZA 4QF9A 3U93A 5KZTA 4U22A 4DXUA 3TEPA 1B5HA 3H4ZA 1N84A 2DSFA 1Y3PA 4WKMA 5ITPA 1RYXA 1MXXA 3ODBA 2PBWA 1O64A 2UYFA 1LFIA 3O2AA 4KCDA 2DWJA 1XT8A 2HZLA 3RGYA 3QUJA 3QIMA 3DRGA 3CG1A 1B7ZA 3FVNA 4R74A 1LCTA 3DP4A 1Y1MA 3MPKA 3GZGA 2I4CA 2HQ0A 1QKAA 1FQFA 3SERA 3KN3A 4R73A 1Y1ZA 2DXRA 4JBZA 5H8SA 4M4GA 4QFOA 1VSOA 4DLDA 3MP1A 4ESWA 1MDQA 1MPCA 4NF4B 3KG2A 4AQ4A 1B58A 3PMXA 3S9LC 1FQDA 3D4CA 3FXUA 1Q35A 4ONYA 4ISUA 3TQWA 3OD7A 1EH3A 3S9EA 3HSTA 2VOZA 3H7MA 1FTMA 4XKRA 2Q2CA 3C32A 3VLUA 4R9GA 3AXFA 1I69A 1B52A 1FTKA 2VGQA 4U4XA 1M5BA 3Q29A 4BDQA 3TKDA 4F19A 4ZZEA 3H3GA 3TTMA 1WDNA 3O6IA 2PT1A 2VP1A 2UVIA 4YAHX 3C4MA 4IO3A 5IKBA 4FECA 1MH4A 2ZMBA 1LBBA 3VLVA 5CBRA 4KHZE 3FIRA 3RQTA 4BDLA 4NTLA 3QSLA 3VFJA 3CR9A 3KOTA 1YPNA 4KCCA 1B2HA 4OEUA 2QPQA 3TPAA 1BTJA 4P0IA 1Y3NA 3GBAA 1N3XA 2GFEA 3ZKKA 4EF1A 5DT6A 4GXSB 3IX1A 3T22A 3HN0A 1MY1A 5H8NB 4R6YA 2RC9A 2DE4A 1VFDA 2Z8EA 3FJ7A 3V89B 4FORA 3T96B 3OENA 4P11A 5KDTB 3OO9A 5BUUA 4OTEA 4PE5B 1B46A 2UVHA 1JQFA 3MC2A 4K3FA 3A3CA 3DLNA 1P99A 2Q9TA 3KN7A 4P0GA 1FQCA 2F7BA 2P1SA 3IOVA 4F1VA 1TFDA 1B3HA 2G29A 4R75A 4QSEA 3SEUA 1ZMGA 1Z7NE 4IO6A 3MVXA 1B0HA 4WXJA 4RPNA 1Z7ME 1HSLA 1ANFA 1CB6A 3USDA 3O66A 2Z23A 4X9TA 4TLMB 4ZEDA 1MQIA 1II5A 3UGWA 2NXOA 4UA8A 2XXWA 3LR1A 3CSGA 2H98A 4QFPA 4E0WA 4R6KA 3RUMA 3G3IA 2V3UA 2ONRA 4F1YA 1OQHA 3T9VA 5AA4A 3IK6B 2F6PA 3GLBA 3G3JA 1H44A 3E13X 1NH8A 2V3QA 1TXFA 1SYIA 3K6XA 2ALUA 1NH7A 2O1MA 1KWHA 1A8FA 4ZS9A 3IJOB 3V83A 1A40A 3K00A 3V5AA 3HHFA 3O28A 1B5JA 4LATA 4M1VA 3TTNA 2H9BA 1I6AA 1MQHA 3G3FA 5ITOA 2OCUA 4KYEA 2Y7RA 3FASA 2NUVA 3HO7A 1MXUA 2Y7KA 5ELVA 1YTVA 4F29A 2O1LA 1B7HA 4C0RA 3OELA 5DVJA 2F5XA 2W7YA 1SW1A 3K6VA 3TCGA 5I58A 2D21A 1IIWA 4WEDA 1DSNA 3UORA 5FTIA 2QMWA 1GTKA 3KGCA 1QUIA 1LAHE 3PMWA 3M8UA 3GBBA 4N13A 3TDJA 1Y9UA 2FYIA 1MDP1 2OJTA 4ELPA 4ELOA 3FVKA 4FAJA 4EDPA 2XD3A 1EZPA 3PPPA 4BLAA 5AE4A 4MH5A 4TOZA 2B3BA 4YMBA 4ECFA 3IB0A 1QW0A 3K6WA 3PAMA 1M5DA 4F31B 2RC8A 4OESA 2O69A 3FD3A 2F36A 1H43A 1N3WA 4U1ZA 4YKKA 3PPQA 1B5IA 3IR1A 3VXCA 4PP0A 5JEIA 1UIUA 4NMYA 4EF2A 4XKQA 5F1QA 3PU5A 3SETA 1EU8A 3DM0A 3KJ7A 1LAXA 4JSOA 3Q25A 4H5FA 2REGA 4XXUA 3GXAA 1ATGA 2Z22A 4X1BA 1TT1A 3LVUA 2Y7WA 4WEPA 3UN6A 3B6WA 4GQOA 1R1NA 4IGTA 5I59B 5L8DA 2Q2AA 4XKNA 3K01A 2X26A 4MLVA 3C9HA 5I2NA 4POXA 2YJPA 1FQEA 4O3AA 4RJZA 5I58B 3L6GA 4DIGA 3SESA 3H06B 1PEBA 1O63A 5CMBA 3LSWA 3C33A 1SD3A 2FA7A 1NL5A 2P0SA 3U94A 2RKMA 2M8CA 3TQLA 1YAEA 1MH3A 3N94A 1B7UA 4U2RA 2XHDA 2XX9A 5JK4A 5H8HA 2HXWA 3RNNA 3Q27A 4C1UA 1IZ1A 5A5XA 3M3LA 3T66A 4LUBA 1NKXA 4EQ7A 2I4BA 1P1UA 4ZEBA 5H8QA 2ESNA 4XTCQ 2OWTA 3S9NC 2GHAA 2ONSA 1A7LA 4NF6A 3IB2A 1SDXA 2Q88A 3U72A 1XOCA 1LLSA 1B05A 2D5WA 4R2FA 1DTZA 2O6AA 3VV5A 2RINA 2ZYOA 4Z0IA 1MPDA 4FEDA 4H8IA 2DS9A 2V25A 4Q0CA 1MM6A 4PFWA 2I49A 4QHQA 1HSEA 1CE2A 3DRKA 1SI0A 1Q1KA 5I2NB 3OSRA 2Y7PA 4XIGQ 1SVXB 3EPEA 3RPWA 4RNSA 2I3VA 3SDFA 5AA1A 2P2AA 4G2ZA 3VVFA 1R9LA 5L9OA 3RN8A 1SYHA 3RYAA 2GHBA 4HCYA 2CMOA 3IL1B 1B0LA 1OQGA 2XXTA 4HCWA 4RYAA 4O3BA 1J1NA 3HHGA 2HAUA 4F18A 5CMMA 1USYE 1POTA 3PUYE 1B40A 3S9MC 5A5XB 3MUQA 2I0CA 4Q30B 2F78A 4ND9A 5ISUA 1IUDA 4LVQA 4YU0A 3PPRA 1UTBA 5H8QB 4F3PA 1B9JA 1XHYA 3TODA 5KCJA 3H03A 4NF6B 2V93A 4Q8RA 2PVUA 3K2DA 1MXWA 1ZKBA 3MP8A 2NVUB 2NOOA 3ILUB 3KSXA 3KOSA 2Q89A 4HTGA 5LOMA 3MPLA 5H8FA 4FATA 3HCQA 4R2BA 3C35A 4EUOA 4YKPA 4LQ5A 4IO7A 3U8QA 1B51A 5I57A 3PUWE 2DVZA 4F3GA 2Z8FA 2GRVA 3TELA 3IAZA 4NWDA 4KYSA 2ZXTA 4GVOA 4U1OA 1FQAA 3TTLA 3KBRA 4F2OA 1H76A 3OOAA 3OXNA 4G4PA 1OLAA 2QS4A 1VFEA 3C34A 4THIA 2DE3A 3I5OA 3C31A 4DE8A 2DWHA 1PBPA 3DP6A 1XC1A 1SI1A 4DDDA 1AMFA 3LSXA 5FHNA 1MS7A 4NWCA 3FGSA 4GXAA 3PUVE 3FUZA 3DRJA 4BDRA 5IAIA 3A3UA 2F7CA 1GVCA 1UTBB 4ELRA 1I6QA 3LSFB 3KZGA 3LBSA 4ZEKA 5KCJB 5I56A 3U1OA 3RT6B 4QSDA 1NNPA 3MBPA 1XVXA 3F11A 1B6HA 4GRKA 1JW5A 3FXRA 1FW0A 1B1HA 3FXQA 1MM7A 5H8FB 1URDA 1LGBC 3SEXA 3D4GA 2F8DA 2OZZA 2F34A 2VD2A 1ZTYA 4NEDA 4RPOA 4GWOA 5I57B 5HM4B 4H8JA 4NF5A 4DZ1A 2XXRA 4G68A 1PDAA 3CFXA 1BLFA 3BFUA 1FTJA 4OWDA 4HS7A 2XXQA 3R7XA 3BKIB 1SW4A 2AL5A 1JETA 1MQDA 3CHGA 5K2YA 2WOKA 3DRFA 1B1XA 2B4MA 2F7AA 4YKIA 2X7PA 3IO6A 3IOUA 1ZLQA 3CSBA 4GFRA 1Y4CA 3A09A 3MQ9A 3T93B 4GL8A 1JEUA 2CZLA 4RXLA 5BWJA 4U4SA 5AA3A 1DPPA 2B65A 1EZ9A 1MG1A 1I6BA 3PPOA 5I56B 2WOPA 1ZIUA 1SBPA 2NWJA 3OO8A 2ABHA 2A5TA 2QS3A 4MFIA 3T9XB 2ZNTA 3PPNA 4OFJA 2Q8JA 1LFGA 2ZNUA 2HEUA 4LQ2A 1AL3A 3QYTA 4NF5B 1D9YA 5J1DA 1US5A 4BDOA 4G68B 1PB7A 1OLCA 3QXMA 3EHSA 4OFLA 1NNFA 3MZBA 1IEJA 5CMCA 3OO6A 2I0BA 3FV1A 3N6UA 3G3GA 5HPQA 4PFUA 3MW0A 5EYFA 4KD5A 2X7QA 4OMBA 4U23A 3I6VA 4IO4A 2HCAA 3UIFA 2XD2A 4JB7A 3U92A 3T9HB 4OERA 1GV8A 2E1SA 4L17A 3FTOA 2AL4A 4G77A 4DCXA 1MY4A 4PFYA 1BP5A 5AA4B 2RCBA 1A8EA 2THIA 3HPIA 3O6PA 2OBGA 1FTOA 3LSLA 3R26A 3N26A 2ZYNA 1XVYA 1L5TA 2PYYA 1DOTA 4PQJA 5B70A 4F3SA 4ESXA 4GL0A 1JEVA 2H99A 5DYHA 2DE2A 5HBCA 2A5TB 2B3FA 1QVSA 2R6GE 1WODA 4QSCA 4G8MA 3THIA 3B7DA 1N04A 4OHNA 4TQUQ
chains in the Genus database with same CATH superfamily
1PB8A 1IXGA 4PAFA 5ICTA 3H6VA 1LBCA 1B4HA 1AH5A 3OSQA 2RC7A 5FBPA 4KYDA 1HSJA 1LBWA 1FJ9A 1OIBA 1FBGA 3CFZA 4EXLA 3K02A 3ZKLA 2HFBA 2XWOA 3BIGA 3PMVA 3IORA 3EQ1A 3VVEA 5TU0A 3SEWA 3H6UA 3SKPA 4H46A 2H5YA 2OK2A 1N0TA 1PC3A 3VXBA 4N6KA 1NV4A 1LB8A 2XXKA 3RYDA 3O29A 4FJPA 4H65A 1IMDA 4MF3A 4OVSA 4BDMA 4OVQA 4PBHA 3N6TA 3O97A 2RCAA 4P47A 1EZOA 1XS5A 1DPEA 1A55A 1GR2A 1N7WA 1FBDA 3K4UA 2HAVA 3T1BA 1ZJLA 2WYKA 3FZVA 5CBSA 3IFAA 2KLFA 3T9UA 3TUSA 5FHOA 2I48A 4I62A 1OMPA 4GX6A 4X48A 2ONKE 5AA2D 4JWYA 3OMBA 3TCHA 2R9JA 4GX3A 4MX6A 2AIXA 2VHAA 1LCFA 3OEKA 4MLQA 4YB6A 2IEEA 1IMBA 4GIZA 3ZSFA 4KPTA 3EHTA 4ZEIA 3IO4A 1ZU0A 5ICQA 1T0KA 1MXYA 4H6DA 4PAIA 4FIMA 1IXCA 4OANA 3DP8A 3TFLA 1LAFE 2XXVA 2F6GA 3FATA 4DCYA 4MNCA 4RA1A 3SEVA 4OYVA 3CVGA 1FPBA 3LUYA 1NNKA 4ZEFA 1JVXA 1QUJA 1P1NA 5L9MA 1OVTA 3KEIA 4QRZA 5DEXA 3MVWA 1RKMA 2E0SA 4QFKA 5M2VA 3ISPA 2XXIA 5B7DA 1UTHA 1URSA 5F7VA 3RYBA 2PMSA 5TP9A 3PD8A 2O7UA 4YZZA 1S9TA 5H8HB 3MZ1A 1YXIA 4OXVA 2XXXA 4PGPA 1Q9DA 2H25A 4PETA 1PBQA 1M5CA 4JXIA 3RT8A 2P3VA 1AOVA 5AA2A 3Q26A 3EKIA 1D9VA 2PX1A 1NI9A 3KSJA 3DELB 2LAOA 1B3EA 4OENA 1FTLA 2WBDA 1O7TA 4ZE8A 1B3FA 2DOJA 2GH9A 1NMUA 3SZPA 5H8NA 1R9QA 4H67A 1BIYA 1N76A 4QXDA 5FHMA 5I84A 3S4UA 2XWKA 5KDTA 4PC9A 2DWAA 2OX3A 3OO7A 4TLLB 5EHMA 1CNQA 1B4ZA 1M5EA 4N91A 4HW8A 3DRHA 4LA9A 4IB2A 3G7WA 4UACA 1IXIA 3MJNA 4KXPA 1KA1A 5CC2A 3SEYA 5K2XA 4ZECA 2UVGA 2ANJA 3B6TA 5CRYA 3IB1A 2Y84A 4HE2A 1P1WA 4OETA 3UA8A 3FV2A 2REJA 4P9KA 4F39A 2CZHA 3FJMA 5DEXB 1N7XA 1BK4A 1ZBMA 3E3KA 1SW2A 1UTHB 5TP9B 4NE4A 3H6WA 2KR0A 4E0XA 4F22A 2HZKA 5I2KA 1BKAA 3K1PA 3FVGA 4N15A 4ELQA 4OA4A 3FJGA 3T0JA 4R72A 4RK2A 1QUKA 4O3CA 3DRIA 1YYZA 3KBZA 2ZYKA 4XKPA 5T3JA 2FNCA 4KI0E 2XXYA 4LZ8A 3UP9A 5JTYA 3P7IA 5IZ3B 5AA2B 4MBPA 4AB6A 3HV1A 4ZZAA 2D3IA 4H0WA 5L9SA 4H5GA 3KFMA 2IA4A 1FQBA 4YICA 5DVIA 1D3KA 3IOTA 4GD5A 4LONB 5DTBA 2ZZXA 1LB9A 3ROJA 5EQ7A 1IXHA 1FBPA 2G93A 1FBHA 2DWIA 3TTRA 4R6HA 3C36A 3ILTB 3IJXB 2UXAA 3VDFA 4P1EA 4IY5A 4ZE9A 3H6TA 4QFNA 1Y20A 4C1TA 3O6HA 1USYH 2Y7IA 4IGRA 2CZKA 4RY1A 1MQGA 3GYYA 4RK9A 1JVYA 3R6UA 3ZS6A 4GF8A 3MWBA 1LAGE 3W9WA 5DVFA 3KN8A 1TWYA 2ZYMA 3MZ9A 3PD9A 1RDZA 1JW1A 3N5LA 1B32A 4DXBA 2QMXA 1LBXA 3E4RA 4NF0A 3CI8A 1QGXA 4KR5A 1MY0A 4YB7A 1A54A 3MVZA 3K1NA 4H1XA 4F3BA 5I2KB 3PUXE 3QK6A 3BBRA 3IOWA 1NUYA 5EHSA 3ONMA 1MXZA 4DXCA 4BDNA 1P1QA 5TPAA 4N6DA 3OEMA 4ZDMA 4I1DA 1UIVA 2I6EA 2VD3A 4FEBA 2QL3A 4AB5A 5JTYB 4U21A 4IY6A 1SW5A 1MY2A 1OVBA 3PV0E 1M5FA 3UK4A 4X04A 3VLWA 3VVDA 4POWA 1TFAA 2DQVA 1H3DA 3EF7A 2UVJA 4NQ8A 2OLBA 1P1OA 3FVOA 4OEVA 3TTKA 4KQPA 3BIHA 4G61A 3TZAA 3L6HA 4NGUA 1B3LA 3MVYA 2F35A 2UYEA 3B6QA 3Q28A 2O84X 4N6PA 2XXUA 2XX7A 3BFTA 4IR8A 1S50A 3RTWB 2I3WA 2V3TA 3LC8A 3MP6A 3QAXA 3MYUA 3O9PA 4YKJA 3RTFB 4JSDA 4LZ7A 3M3KA 4LZ5A 1NFTA 3CIJA 2O51A 1B3GA 5I59A 4IO5A 3RLFE 2VPNA 4OFOA 1US4A 3PUZE 5CM6A 4JWXA 1VE4A 2FVZA 2YPNA 4OQOA 3EN3A 4GOTA 2B4LA 3G3KA 1D4NA 1FCKA 4PFTA 3G3HA 2QRYA 1LBYA 2XXPA 3RPLA 2F97A 5TPAB 4KFQA 4AS4A 1JW4A 1NV6A 2RF1A 1H45A 2PT2A 1ELJA 4F1UA 3MAMA 2XX8A 4JWOA 1DMBA 4QFLA 3KJTA 4MCOA 2QJEA 3K0VA 2O68A 1YCJA 1MPBA 3KC1A 4I8CA 4Q5TA 2I58A 1NNTA 3TYHA 2QS1A 3WAEA 4G68C 3RY3A 4GLIA 4F2QA 1SQYA 3O6GA 5I5PA 1IQ7A 1MQJA 3M3FA 2V84A 4XF5A 3K1MA 2CZIA 3VE1B 4NF8A 2QS2A 3TAJA 3QUFA 1QJMA 4MNIA 4YB5A 3A29A 2XXHA 5DW8A 1LFHA 2DVCA 1AIVA 5IZ1A 3WAFA 4JDFA 4FE8A 1FJ6A 2O7IA 2DYXA 2WOLA 1A99A 3TCFA 3B8BA 2HHMA 1QKBA 4UABA 2BJIA 1Y3QA 4OZ9A 4XFEA 4R9FA 1IITA 3CG3A 4IO2A 2XA5A 3PGFA 4PDDA 1MRPA 2Z8DA 1PB9A 3CFLA 3W15C 4G8NA 2A5SA 5CMKA 1F9BA 3JZJA 3RPLB 1Y4TA 2AYSA 1GGGA 1WVJA 2BJJX 4EQ9A 1S7YA 4I9DA 1DTGA 4GX4A 4LP2B 3K6UA 4N81A 1VR5A 4EQBA 2DXYA 3JV9A 2ZNSA 2DP8A 2WKYA 4EXKA 4N07A 1RYOA 3EHUA 3W9VA 4I3YA 1DCUA 3V8XB 1MXVA 2OWSA 4NF4A 5FTHA 1URGA 2YLNA 3TMGA 1QULA 4OVJA 4DI4B 3S2VA 4G8HA 4OVTA 3CRBA 3I3VA 1POY1 4GWWA 2QSXA 1JNFA 1FBEA 4NF8B 4QBAA 1MY3A 2R71A 5CI5A 3E78A 3E9XA 2H4IA 4I3EA 4PCDA 3ECRA 1LSTA 4X1DA 4YMAA 3JYRA 1UQWA 2PFZA 4Z7EA 1R6ZA 4QF9A 3U93A 5KZTA 4U22A 4DXUA 3TEPA 1FPDA 1B5HA 3H4ZA 1N84A 2DSFA 1Y3PA 4WKMA 5ITPA 1NV5A 1RYXA 1MXXA 3ODBA 2PBWA 1O64A 5ET7A 2UYFA 1LFIA 3O2AA 4KCDA 1IMAA 2DWJA 1XT8A 2HZLA 3RGYA 3QUJA 3QIMA 1G0IA 3DRGA 1FBFA 1VDWA 3CG1A 1B7ZA 3FVNA 4R74A 1LCTA 3DP4A 1Y1MA 3MPKA 3GZGA 2I4CA 2HQ0A 1QKAA 1FQFA 3SERA 3KN3A 4R73A 2F3BA 1Y1ZA 2GQ1A 2DXRA 4JBZA 5H8SA 4M4GA 4QFOA 1FPLA 1VSOA 3IFCA 4DLDA 3MP1A 2FIXA 4ESWA 1MDQA 1MPCA 4NF4B 3KG2A 2P3NA 4AQ4A 1B58A 3PMXA 3S9LC 1FQDA 3D4CA 3FXUA 1Q35A 1EYJA 1D9QA 4ONYA 4ISUA 3U65A 3TQWA 3OD7A 1EH3A 3S9EA 3HSTA 2VOZA 3H7MA 1FTMA 4XKRA 2Q2CA 3C32A 3VLUA 4R9GA 3AXFA 1I69A 1B52A 4PE3A 1FTKA 2VGQA 4MAGA 4U4XA 1M5BA 3Q29A 1JP4A 4BDQA 3TKDA 4F19A 4ZZEA 3H3GA 2WYPA 3TTMA 1WDNA 3O6IA 2PT1A 2VP1A 2UVIA 4YAHX 3C4MA 4IO3A 5IKBA 4FECA 1MH4A 2ZMBA 1LBBA 3VLVA 1FRPA 4PF8A 2R8TA 5CBRA 4KHZE 1YZ0A 3FIRA 3RQTA 1NV7A 2FBPA 3MSTA 4BDLA 5EQ8A 4NTLA 3QSLA 3VFJA 3CR9A 5LTCA 3KOTA 1YPNA 4KCCA 1B2HA 2HXRA 4OEUA 2QPQA 3TPAA 1IMFA 4HE1A 1BTJA 4P0IA 5EQ9A 1Y3NA 3GBAA 3FXBA 1N3XA 2GFEA 3ZKKA 4EF1A 5DT6A 4GXSB 3IX1A 4NHBA 3T22A 3HN0A 1MY1A 2FHYA 5H8NB 4R6YA 1NV3A 2RC9A 2DE4A 1VFDA 2Z8EA 4GWUA 4N8YA 3FJ7A 3V89B 4FORA 3OENA 3T96B 2CEXA 4P11A 5KDTB 3OO9A 5BUUA 4OTEA 1EYIA 4PE5B 1B46A 2UVHA 1JQFA 2ZZWA 3MC2A 3E79A 4HE0A 4K3FA 4GWYA 3A3CA 3DLNA 1P99A 4O7MA 2Q9TA 3KN7A 4P0GA 1FQCA 2F7BA 2P1SA 3IOVA 4F1VA 1TFDA 1B3HA 4GWZA 2G29A 4R75A 4QSEA 3SEUA 1ZMGA 1Z7NE 4IO6A 3MVXA 1B0HA 4WXJA 4RPNA 1Z7ME 1HSLA 1ANFA 1CB6A 3USDA 3O66A 2Z23A 4X9TA 1LEVA 4TLMB 4ZEDA 1MQIA 1II5A 3UGWA 2NXOA 4UA8A 2XXWA 3LR1A 4P3LA 3CSGA 2H98A 4QFPA 4E0WA 5IGAA 4R6KA 3RUMA 1DBZA 3G3IA 2V3UA 2ONRA 4F1YA 1OQHA 3T9VA 5AA4A 3IK6B 3GLBA 2F6PA 3G3JA 1H44A 3E13X 1NH8A 2V3QA 1TXFA 1SYIA 3K6XA 2ALUA 1NH7A 2O1MA 1KWHA 1A8FA 1FPFA 4ZS9A 3IJOB 3V83A 1A40A 1RDYA 1FPJA 3K00A 3V5AA 2HPGA 4HXVA 3HHFA 3O28A 1B5JA 4LATA 4M1VA 3TTNA 2H9BA 1I6AA 1MQHA 3G3FA 2OWZA 5ITOA 2OCUA 4KYEA 2Y7RA 4JVIA 4N8GA 3FASA 2NUVA 3HO7A 1MXUA 2Y7KA 5ELVA 1YTVA 4F29A 4PBQA 2O1LA 1B7HA 4C0RA 3OELA 5DVJA 2F5XA 2W7YA 1SW1A 3K6VA 4GBVA 3TCGA 5I58A 2D21A 4DI3D 1IIWA 4WEDA 1DSNA 4MEVA 3UORA 4PF6A 5FTIA 2QMWA 4PAKA 1GTKA 3KGCA 1QUIA 1LAHE 4JVCA 3PMWA 3M8UA 3GBBA 4N13A 3TDJA 1Y9UA 2FYIA 1MDP1 2OJTA 4ELPA 4ELOA 3FVKA 4JVDA 4FAJA 4EDPA 2XD3A 1EZPA 3PPPA 5IM2A 4BLAA 5AE4A 4MH5A 4TOZA 2B3BA 4YMBA 4ECFA 3IB0A 1QW0A 3K6WA 3PAMA 1M5DA 1FPKA 4F31B 2RC8A 4OESA 2O69A 3FD3A 2F36A 3NOHA 2QVRA 1H43A 1N3WA 4PFRA 4U1ZA 4YKKA 4OVPA 2WX9A 3PPQA 1B5IA 3IR1A 3VXCA 4PP0A 5JEIA 3KC0A 1UIUA 4NMYA 4EF2A 4XKQA 5F1QA 3PU5A 3SETA 1EU8A 4P56A 3DM0A 3KJ7A 1LAXA 4JSOA 3Q25A 4H5FA 2REGA 4XXUA 1SPIA 3GXAA 1ATGA 1IMEA 2Z22A 4X1BA 1TT1A 3LVUA 2Y7WA 4WEPA 3UN6A 3B6WA 1KZ8A 4GQOA 1R1NA 4IGTA 5I59B 5L8DA 2Q2AA 4XKNA 3K01A 2CEYA 2X26A 4MLVA 3C9HA 4XEQA 5I2NA 4POXA 2Y5LA 2YJPA 1FQEA 4O3AA 4RJZA 4GWXA 5I58B 5IZZA 3L6GA 4DIGA 3SESA 4N4UA 3H06B 1PEBA 1O63A 4LN5A 5CMBA 3LSWA 4AS5A 4MMPA 3C33A 1SD3A 2FA7A 1NL5A 2P0SA 3U94A 2RKMA 2M8CA 2F3DA 3TQLA 1YAEA 1MH3A 3N94A 1B7UA 4U2RA 2XHDA 2XX9A 5JK4A 3D1RA 5H8HA 5I7IA 4MJOA 2HXWA 3RNNA 3Q27A 2XWIA 4C1UA 1IZ1A 1LBZA 5A5XA 3M3LA 4PFIA 3LUZA 3T66A 4LUBA 1NKXA 2JJKA 4EQ7A 2I4BA 1P1UA 4ZEBA 5H8QA 2KQZA 2ESNA 4XTCQ 2OWTA 5ESYA 3S9NC 2GHAA 2ONSA 1A7LA 4NF6A 3IB2A 1SDXA 2Q88A 2PCRA 4O8MA 3U72A 1XOCA 1LLSA 2Q8MA 1B05A 2D5WA 4OVRA 4R2FA 4PGNA 1DTZA 2O6AA 3VV5A 2RINA 2ZYOA 4Z0IA 1MPDA 4FEDA 4H8IA 2DS9A 5A5LA 2V25A 1FBCA 4Q0CA 1MM6A 4PFWA 2I49A 2WBBA 4QHQA 1HSEA 1CE2A 3DRKA 3B50A 1DK4A 1Q1KA 1SI0A 4P1LA 5I2NB 3OSRA 1EYKA 2Y7PA 4XIGQ 1SVXB 3EPEA 3RPWA 4RNSA 2I3VA 3SDFA 5AA1A 5ET5A 2P2AA 4G2ZA 3VVFA 1R9LA 5L9OA 3RN8A 1SYHA 3RYAA 2GHBA 4HCYA 2Q74A 2CMOA 3IL1B 1B0LA 1OQGA 2XXTA 4HCWA 4RYAA 4O3BA 1J1NA 3HHGA 3PTYA 2ZZVA 1AWBA 2HAUA 1NUZA 4F18A 5CMMA 1K9YA 1USYE 1POTA 3PUYE 1B40A 3S9MC 5A5XB 4O94A 3MUQA 2I0CA 4Q30B 2F78A 4ND9A 5ISUA 1IUDA 4LVQA 4YU0A 3PPRA 5IZ3A 1UTBA 5H8QB 4F3PA 1B9JA 1XHYA 3TODA 5KCJA 5EYGA 2V4CA 2QVVA 3H03A 4NF6B 4MHFA 2V93A 4Q8RA 2PVUA 3K2DA 1MXWA 1ZKBA 4I40A 3MP8A 2NVUB 2NOOA 3ILUB 3KSXA 3KOSA 2Q89A 4HTGA 5LOMA 3MPLA 5H8FA 4FATA 3HCQA 4R2BA 3C35A 4EUOA 4YKPA 4LQ5A 4IO7A 2DDKA 4PDHA 3U8QA 4H45A 1B51A 5I57A 3FBPA 3PUWE 2DVZA 2FIEA 4F3GA 2Z8FA 2GRVA 3TELA 3IAZA 4NWDA 4KYSA 1NV0A 2ZXTA 4GVOA 4U1OA 1FQAA 3TTLA 3KBRA 4F2OA 1H76A 5I3SA 2WEFA 3OOAA 3OXNA 1OLAA 4G4PA 4MIJA 2QS4A 1VFEA 3C34A 4THIA 1NUXA 2DE3A 3I5OA 3C31A 4DE8A 4MNPA 2DWHA 1PBPA 3DP6A 1XC1A 1SI1A 4DDDA 1AMFA 3LSXA 5FHNA 1MS7A 4NWCA 3FGSA 4GXAA 3PUVE 3FUZA 3DRJA 4PFBA 4BDRA 5J16A 5IAIA 3A3UA 2F7CA 1GVCA 1UTBB 4ELRA 1IMCA 1I6QA 3LSFB 3KZGA 3LBSA 4ZEKA 1LBVA 5KCJB 5I56A 2MKZA 1FPIA 3U1OA 3RT6B 3LV0A 4QSDA 1NNPA 3MBPA 1XVXA 3F11A 1FSAA 1B6HA 2VPOA 5EQAA 4GRKA 1JW5A 1FPEA 1NV2A 3FXRA 4NAPA 1FW0A 1B1HA 3FXQA 1MM7A 5H8FB 1INPA 1URDA 1LGBC 3SEXA 3D4GA 2F8DA 2OZZA 2F34A 2VD2A 4X8RA 1ZTYA 4NEDA 4RPOA 4GWOA 5I57B 4PTKA 5HM4B 4H8JA 4NF5A 4DZ1A 2XXRA 4G68A 1PDAA 3CFXA 5ET6A 1BLFA 3BFUA 1FTJA 2PFYA 4P8BA 1K9ZA 4OWDA 4HS7A 2QFLA 2XXQA 3R7XA 3BKIB 5LDZA 1SW4A 2AL5A 1JETA 1MQDA 2QVUA 3CHGA 5K2YA 2WOKA 3DRFA 3HFUA 1KA0A 1B1XA 2B4MA 2F7AA 4YKIA 2X7PA 3IO6A 3IOUA 1ZLQA 3CSBA 4GFRA 1Y4CA 3A09A 3MQ9A 3T93B 4GL8A 5F24A 1JEUA 2CZLA 4RXLA 4GBWA 5BWJA 4U4SA 5AA3A 1DPPA 2B65A 1EZ9A 1MG1A 2XWVA 1I6BA 3PPOA 5I56B 4NX1A 2WOPA 1ZIUA 1SBPA 2NWJA 3OO8A 4NG7A 4FBPA 2ABHA 2A5TA 2QS3A 4MFIA 3T9XB 2ZNTA 3PPNA 2VT5A 1NUWA 4OFJA 2Q8JA 1LFGA 2ZNUA 2HEUA 4LQ2A 1AL3A 3QYTA 1G0HA 4NF5B 1D9YA 5J1DA 1US5A 4BDOA 4G68B 1PB7A 1RDXA 1OLCA 3QXMA 3EHSA 4OFLA 1NNFA 3MZBA 1IEJA 5CMCA 3OO6A 2I0BA 5ET8A 3FV1A 3N6UA 3G3GA 5HPQA 4PFUA 4NN3A 3MW0A 5EYFA 4KD5A 2X7QA 4OMBA 4U23A 3I6VA 4IO4A 2HCAA 3UIFA 2XD2A 4JB7A 3U92A 3T9HB 4OERA 1GV8A 2E1SA 4L17A 3FTOA 2AL4A 4G77A 4DCXA 1MY4A 5EYHA 4PFYA 1NV1A 1BP5A 5AA4B 2RCBA 1A8EA 1FTAA 2THIA 3HPIA 3O6PA 2OBGA 1FTOA 2L5VA 3LSLA 4N17A 3R26A 3N26A 2ZYNA 1XVYA 1L5TA 1FPGA 2PYYA 1XI6A 3QMFA 1DOTA 4PQJA 5B70A 4F3SA 4ESXA 4GL0A 1JEVA 2H99A 5DYHA 2DE2A 5HBCA 2Y5KA 2A5TB 2B3FA 1QVSA 4GWSA 2R6GE 1WODA 4QSCA 4G8MA 3THIA 3B7DA 1N04A 4OHNA 4TQUQ 4O7IA
chains in the Genus database with same CATH topology
1PB8A 1IXGA 5ICTA 3H6VA 1LBCA 1B4HA 1AH5A 3OSQA 2RC7A 4KYDA 1HSJA 1OIBA 3CFZA 4EXLA 3K02A 3ZKLA 2HFBA 3PMVA 3IORA 3EQ1A 3VVEA 5TU0A 3SEWA 3H6UA 3SKPA 2H5YA 2OK2A 1N0TA 1PC3A 3VXBA 1LB8A 3O29A 4FJPA 4H65A 4MF3A 4BDMA 3N6TA 3O97A 2RCAA 1EZOA 1XS5A 1DPEA 1A55A 1GR2A 1N7WA 3K4UA 2HAVA 1ZJLA 3FZVA 5CBSA 2KLFA 3T9UA 3TUSA 5FHOA 2I48A 4X48A 4I62A 1OMPA 5AA2D 2ONKE 4JWYA 3OMBA 3TCHA 2R9JA 2AIXA 2VHAA 1LCFA 3OEKA 4MLQA 4YB6A 2IEEA 4GIZA 3ZSFA 4KPTA 3EHTA 4ZEIA 3IO4A 1ZU0A 5ICQA 1T0KA 1MXYA 4H6DA 4FIMA 1IXCA 3DP8A 3TFLA 1LAFE 2XXVA 2F6GA 3FATA 4DCYA 4RA1A 3SEVA 4OYVA 3CVGA 3LUYA 1NNKA 4ZEFA 1JVXA 1QUJA 1P1NA 5L9MA 1OVTA 3KEIA 4QRZA 5DEXA 3MVWA 1RKMA 2E0SA 4QFKA 5M2VA 2XXIA 5B7DA 1UTHA 1URSA 5F7VA 3RYBA 2PMSA 5TP9A 3PD8A 2O7UA 4YZZA 1S9TA 5H8HB 3MZ1A 4OXVA 2XXXA 2H25A 4PETA 1PBQA 1M5CA 4JXIA 3RT8A 1AOVA 5AA2A 3Q26A 1D9VA 2PX1A 3KSJA 3DELB 2LAOA 1B3EA 4OENA 1FTLA 1O7TA 4ZE8A 1B3FA 2DOJA 2GH9A 1NMUA 5H8NA 1R9QA 4H67A 1BIYA 1N76A 5FHMA 5I84A 3S4UA 5KDTA 2DWAA 3OO7A 4TLLB 5EHMA 1B4ZA 1M5EA 4HW8A 3DRHA 4LA9A 4IB2A 3G7WA 4UACA 1IXIA 3MJNA 5CC2A 3SEYA 5K2XA 4ZECA 2UVGA 2ANJA 3B6TA 5CRYA 3IB1A 2Y84A 1P1WA 4OETA 3UA8A 3FV2A 2REJA 4F39A 3FJMA 5DEXB 1N7XA 1ZBMA 3E3KA 1SW2A 1UTHB 5TP9B 4NE4A 3H6WA 4E0XA 4F22A 5I2KA 2HZKA 1BKAA 3K1PA 3FVGA 4ELQA 3FJGA 4R72A 4RK2A 1QUKA 4O3CA 3DRIA 2ZYKA 4XKPA 2FNCA 2XXYA 4KI0E 4LZ8A 3UP9A 5JTYA 3P7IA 5AA2B 4MBPA 4AB6A 3HV1A 4ZZAA 2D3IA 4H0WA 5L9SA 4H5GA 3KFMA 2IA4A 1FQBA 4YICA 5DVIA 1D3KA 3IOTA 4GD5A 4LONB 5DTBA 1LB9A 1IXHA 2G93A 2DWIA 3TTRA 4R6HA 3C36A 3ILTB 3VDFA 3IJXB 2UXAA 4IY5A 4ZE9A 3H6TA 4QFNA 1Y20A 4C1TA 3O6HA 1USYH 2Y7IA 4IGRA 4RY1A 1MQGA 4RK9A 1JVYA 3R6UA 3ZS6A 4GF8A 3MWBA 1LAGE 3W9WA 5DVFA 3KN8A 1TWYA 2ZYMA 3MZ9A 3PD9A 1JW1A 3N5LA 1B32A 4DXBA 2QMXA 3E4RA 3CI8A 4KR5A 1MY0A 4YB7A 1A54A 3MVZA 3K1NA 4H1XA 4F3BA 5I2KB 3PUXE 3QK6A 3BBRA 3IOWA 5EHSA 3ONMA 1MXZA 4DXCA 4BDNA 1P1QA 5TPAA 3OEMA 4ZDMA 4I1DA 1UIVA 2I6EA 2VD3A 4FEBA 2QL3A 4AB5A 5JTYB 4U21A 4IY6A 1SW5A 1MY2A 1OVBA 3PV0E 1M5FA 3UK4A 3VLWA 3VVDA 4POWA 1TFAA 2DQVA 1H3DA 3EF7A 2UVJA 2OLBA 1P1OA 3FVOA 4OEVA 3TTKA 4KQPA 3TZAA 3L6HA 1B3LA 3MVYA 2F35A 2UYEA 3B6QA 3Q28A 2O84X 4N6PA 2XXUA 2XX7A 3BFTA 1S50A 3RTWB 2I3WA 2V3TA 3LC8A 3MP6A 3QAXA 3O9PA 4YKJA 3RTFB 4JSDA 4LZ7A 3M3KA 4LZ5A 1NFTA 3CIJA 2O51A 1B3GA 5I59A 4IO5A 3RLFE 4OFOA 1US4A 3PUZE 5CM6A 4JWXA 1VE4A 2YPNA 4OQOA 3EN3A 4GOTA 2B4LA 3G3KA 1D4NA 1FCKA 4PFTA 3G3HA 2QRYA 2XXPA 2F97A 5TPAB 4KFQA 1JW4A 2RF1A 1H45A 2PT2A 1ELJA 4F1UA 3MAMA 2XX8A 4JWOA 1DMBA 4QFLA 3KJTA 2QJEA 3K0VA 2O68A 1YCJA 1MPBA 4Q5TA 4I8CA 2I58A 1NNTA 3TYHA 2QS1A 3WAEA 4G68C 3RY3A 4GLIA 4F2QA 1SQYA 3O6GA 1IQ7A 1MQJA 3M3FA 2V84A 3K1MA 3VE1B 4NF8A 2QS2A 3TAJA 3QUFA 1QJMA 4YB5A 2XXHA 1LFHA 2DVCA 1AIVA 3WAFA 4JDFA 4FE8A 2O7IA 2DYXA 2WOLA 1A99A 3TCFA 1QKBA 1Y3QA 4OZ9A 4R9FA 1IITA 3CG3A 4IO2A 3PGFA 1MRPA 2Z8DA 1PB9A 3CFLA 3W15C 4G8NA 2A5SA 5CMKA 1F9BA 3JZJA 1Y4TA 2AYSA 1GGGA 1WVJA 2BJJX 4EQ9A 1S7YA 4I9DA 1DTGA 4LP2B 3K6UA 1VR5A 4EQBA 2DXYA 3JV9A 2ZNSA 2DP8A 2WKYA 4EXKA 4N07A 1RYOA 3EHUA 3W9VA 3V8XB 1MXVA 2OWSA 4NF4A 5FTHA 1URGA 2YLNA 3TMGA 1QULA 4OVJA 3S2VA 4G8HA 3CRBA 3I3VA 1POY1 2QSXA 1JNFA 4NF8B 1MY3A 2R71A 5CI5A 3E9XA 2H4IA 3ECRA 1LSTA 4X1DA 4YMAA 3JYRA 1UQWA 4Z7EA 1R6ZA 4QF9A 3U93A 5KZTA 4U22A 4DXUA 3TEPA 1B5HA 3H4ZA 1N84A 2DSFA 1Y3PA 4WKMA 5ITPA 1RYXA 1MXXA 3ODBA 2PBWA 1O64A 2UYFA 1LFIA 3O2AA 4KCDA 2DWJA 1XT8A 2HZLA 3RGYA 3QUJA 3QIMA 3DRGA 3CG1A 1B7ZA 3FVNA 4R74A 1LCTA 3DP4A 1Y1MA 3MPKA 3GZGA 2I4CA 2HQ0A 1QKAA 1FQFA 3SERA 3KN3A 4R73A 1Y1ZA 2DXRA 4JBZA 5H8SA 4M4GA 4QFOA 1VSOA 4DLDA 3MP1A 4ESWA 1MDQA 1MPCA 4NF4B 3KG2A 4AQ4A 1B58A 3PMXA 3S9LC 1FQDA 3D4CA 3FXUA 1Q35A 4ONYA 4ISUA 3TQWA 3OD7A 1EH3A 3S9EA 3HSTA 2VOZA 3H7MA 1FTMA 4XKRA 2Q2CA 3C32A 3VLUA 4R9GA 3AXFA 1I69A 1B52A 1FTKA 2VGQA 4U4XA 1M5BA 3Q29A 4BDQA 3TKDA 4F19A 4ZZEA 3H3GA 3TTMA 1WDNA 3O6IA 2PT1A 2VP1A 2UVIA 4YAHX 3C4MA 4IO3A 5IKBA 4FECA 1MH4A 2ZMBA 1LBBA 3VLVA 5CBRA 4KHZE 3FIRA 3RQTA 4BDLA 4NTLA 3QSLA 3VFJA 3CR9A 3KOTA 1YPNA 4KCCA 1B2HA 4OEUA 2QPQA 3TPAA 1BTJA 4P0IA 1Y3NA 3GBAA 1N3XA 2GFEA 3ZKKA 4EF1A 5DT6A 4GXSB 3IX1A 3T22A 3HN0A 1MY1A 5H8NB 4R6YA 2RC9A 2DE4A 1VFDA 2Z8EA 3FJ7A 3V89B 4FORA 3T96B 3OENA 4P11A 5KDTB 3OO9A 5BUUA 4OTEA 4PE5B 1B46A 2UVHA 1JQFA 3MC2A 4K3FA 3A3CA 3DLNA 1P99A 2Q9TA 3KN7A 4P0GA 1FQCA 2F7BA 2P1SA 3IOVA 4F1VA 1TFDA 1B3HA 2G29A 4R75A 4QSEA 3SEUA 1ZMGA 1Z7NE 4IO6A 3MVXA 1B0HA 4WXJA 4RPNA 1Z7ME 1HSLA 1ANFA 1CB6A 3USDA 3O66A 2Z23A 4X9TA 4TLMB 4ZEDA 1MQIA 1II5A 3UGWA 2NXOA 4UA8A 2XXWA 3LR1A 3CSGA 2H98A 4QFPA 4E0WA 4R6KA 3RUMA 3G3IA 2V3UA 2ONRA 4F1YA 1OQHA 3T9VA 5AA4A 3IK6B 2F6PA 3GLBA 3G3JA 1H44A 3E13X 1NH8A 2V3QA 1TXFA 1SYIA 3K6XA 2ALUA 1NH7A 2O1MA 1KWHA 1A8FA 4ZS9A 3IJOB 3V83A 1A40A 3K00A 3V5AA 3HHFA 3O28A 1B5JA 4LATA 4M1VA 3TTNA 2H9BA 1I6AA 1MQHA 3G3FA 5ITOA 2OCUA 4KYEA 2Y7RA 3FASA 2NUVA 3HO7A 1MXUA 2Y7KA 5ELVA 1YTVA 4F29A 2O1LA 1B7HA 4C0RA 3OELA 5DVJA 2F5XA 2W7YA 1SW1A 3K6VA 3TCGA 5I58A 2D21A 1IIWA 4WEDA 1DSNA 3UORA 5FTIA 2QMWA 1GTKA 3KGCA 1QUIA 1LAHE 3PMWA 3M8UA 3GBBA 4N13A 3TDJA 1Y9UA 2FYIA 1MDP1 2OJTA 4ELPA 4ELOA 3FVKA 4FAJA 4EDPA 2XD3A 1EZPA 3PPPA 4BLAA 5AE4A 4MH5A 4TOZA 2B3BA 4YMBA 4ECFA 3IB0A 1QW0A 3K6WA 3PAMA 1M5DA 4F31B 2RC8A 4OESA 2O69A 3FD3A 2F36A 1H43A 1N3WA 4U1ZA 4YKKA 3PPQA 1B5IA 3IR1A 3VXCA 4PP0A 5JEIA 1UIUA 4NMYA 4EF2A 4XKQA 5F1QA 3PU5A 3SETA 1EU8A 3DM0A 3KJ7A 1LAXA 4JSOA 3Q25A 4H5FA 2REGA 4XXUA 3GXAA 1ATGA 2Z22A 4X1BA 1TT1A 3LVUA 2Y7WA 4WEPA 3UN6A 3B6WA 4GQOA 1R1NA 4IGTA 5I59B 5L8DA 2Q2AA 4XKNA 3K01A 2X26A 4MLVA 3C9HA 5I2NA 4POXA 2YJPA 1FQEA 4O3AA 4RJZA 5I58B 3L6GA 4DIGA 3SESA 3H06B 1PEBA 1O63A 5CMBA 3LSWA 3C33A 1SD3A 2FA7A 1NL5A 2P0SA 3U94A 2RKMA 2M8CA 3TQLA 1YAEA 1MH3A 3N94A 1B7UA 4U2RA 2XHDA 2XX9A 5JK4A 5H8HA 2HXWA 3RNNA 3Q27A 4C1UA 1IZ1A 5A5XA 3M3LA 3T66A 4LUBA 1NKXA 4EQ7A 2I4BA 1P1UA 4ZEBA 5H8QA 2ESNA 4XTCQ 2OWTA 3S9NC 2GHAA 2ONSA 1A7LA 4NF6A 3IB2A 1SDXA 2Q88A 3U72A 1XOCA 1LLSA 1B05A 2D5WA 4R2FA 1DTZA 2O6AA 3VV5A 2RINA 2ZYOA 4Z0IA 1MPDA 4FEDA 4H8IA 2DS9A 2V25A 4Q0CA 1MM6A 4PFWA 2I49A 4QHQA 1HSEA 1CE2A 3DRKA 1SI0A 1Q1KA 5I2NB 3OSRA 2Y7PA 4XIGQ 1SVXB 3EPEA 3RPWA 4RNSA 2I3VA 3SDFA 5AA1A 2P2AA 4G2ZA 3VVFA 1R9LA 5L9OA 3RN8A 1SYHA 3RYAA 2GHBA 4HCYA 2CMOA 3IL1B 1B0LA 1OQGA 2XXTA 4HCWA 4RYAA 4O3BA 1J1NA 3HHGA 2HAUA 4F18A 5CMMA 1USYE 1POTA 3PUYE 1B40A 3S9MC 5A5XB 3MUQA 2I0CA 4Q30B 2F78A 4ND9A 5ISUA 1IUDA 4LVQA 4YU0A 3PPRA 1UTBA 5H8QB 4F3PA 1B9JA 1XHYA 3TODA 5KCJA 3H03A 4NF6B 2V93A 4Q8RA 2PVUA 3K2DA 1MXWA 1ZKBA 3MP8A 2NVUB 2NOOA 3ILUB 3KSXA 3KOSA 2Q89A 4HTGA 5LOMA 3MPLA 5H8FA 4FATA 3HCQA 4R2BA 3C35A 4EUOA 4YKPA 4LQ5A 4IO7A 3U8QA 1B51A 5I57A 3PUWE 2DVZA 4F3GA 2Z8FA 2GRVA 3TELA 3IAZA 4NWDA 4KYSA 2ZXTA 4GVOA 4U1OA 1FQAA 3TTLA 3KBRA 4F2OA 1H76A 3OOAA 3OXNA 4G4PA 1OLAA 2QS4A 1VFEA 3C34A 4THIA 2DE3A 3I5OA 3C31A 4DE8A 2DWHA 1PBPA 3DP6A 1XC1A 1SI1A 4DDDA 1AMFA 3LSXA 5FHNA 1MS7A 4NWCA 3FGSA 4GXAA 3PUVE 3FUZA 3DRJA 4BDRA 5IAIA 3A3UA 2F7CA 1GVCA 1UTBB 4ELRA 1I6QA 3LSFB 3KZGA 3LBSA 4ZEKA 5KCJB 5I56A 3U1OA 3RT6B 4QSDA 1NNPA 3MBPA 1XVXA 3F11A 1B6HA 4GRKA 1JW5A 3FXRA 1FW0A 1B1HA 3FXQA 1MM7A 5H8FB 1URDA 1LGBC 3SEXA 3D4GA 2F8DA 2OZZA 2F34A 2VD2A 1ZTYA 4NEDA 4RPOA 4GWOA 5I57B 5HM4B 4H8JA 4NF5A 4DZ1A 2XXRA 4G68A 1PDAA 3CFXA 1BLFA 3BFUA 1FTJA 4OWDA 4HS7A 2XXQA 3R7XA 3BKIB 1SW4A 2AL5A 1JETA 1MQDA 3CHGA 5K2YA 2WOKA 3DRFA 1B1XA 2B4MA 2F7AA 4YKIA 2X7PA 3IO6A 3IOUA 1ZLQA 3CSBA 4GFRA 1Y4CA 3A09A 3MQ9A 3T93B 4GL8A 1JEUA 2CZLA 4RXLA 5BWJA 4U4SA 5AA3A 1DPPA 2B65A 1EZ9A 1MG1A 1I6BA 3PPOA 5I56B 2WOPA 1ZIUA 1SBPA 2NWJA 3OO8A 2ABHA 2A5TA 2QS3A 4MFIA 3T9XB 2ZNTA 3PPNA 4OFJA 2Q8JA 1LFGA 2ZNUA 2HEUA 4LQ2A 1AL3A 3QYTA 4NF5B 1D9YA 5J1DA 1US5A 4BDOA 4G68B 1PB7A 1OLCA 3QXMA 3EHSA 4OFLA 1NNFA 3MZBA 1IEJA 5CMCA 3OO6A 2I0BA 3FV1A 3N6UA 3G3GA 5HPQA 4PFUA 3MW0A 5EYFA 4KD5A 2X7QA 4OMBA 4U23A 3I6VA 4IO4A 2HCAA 3UIFA 2XD2A 4JB7A 3U92A 3T9HB 4OERA 1GV8A 2E1SA 4L17A 3FTOA 2AL4A 4G77A 4DCXA 1MY4A 4PFYA 1BP5A 5AA4B 2RCBA 1A8EA 2THIA 3HPIA 3O6PA 2OBGA 1FTOA 3LSLA 3R26A 3N26A 2ZYNA 1XVYA 1L5TA 2PYYA 1DOTA 4PQJA 5B70A 4F3SA 4ESXA 4GL0A 1JEVA 2H99A 5DYHA 2DE2A 5HBCA 2A5TB 2B3FA 1QVSA 2R6GE 1WODA 4QSCA 4G8MA 3THIA 3B7DA 1N04A 4OHNA 4TQUQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PB8 A;  1IXG A;  5ICT A;  3H6V A;  1LBC A;  1B4H A;  1AH5 A;  3OSQ A;  2RC7 A;  4KYD A;  1HSJ A;  1OIB A;  3CFZ A;  4EXL A;  3K02 A;  3ZKL A;  2HFB A;  3PMV A;  3IOR A;  3EQ1 A;  3VVE A;  5TU0 A;  3SEW A;  3H6U A;  3SKP A;  2H5Y A;  2OK2 A;  1N0T A;  1PC3 A;  3VXB A;  1LB8 A;  3O29 A;  4FJP A;  4H65 A;  4MF3 A;  4BDM A;  3N6T A;  3O97 A;  2RCA A;  1EZO A;  1XS5 A;  1DPE A;  1A55 A;  1GR2 A;  1N7W A;  3K4U A;  2HAV A;  1ZJL A;  3FZV A;  5CBS A;  2KLF A;  3T9U A;  3TUS A;  5FHO A;  2I48 A;  4X48 A;  4I62 A;  1OMP A;  5AA2 D;  2ONK E;  4JWY A;  3OMB A;  3TCH A;  2R9J A;  2AIX A;  2VHA A;  1LCF A;  3OEK A;  4MLQ A;  4YB6 A;  2IEE A;  4GIZ A;  3ZSF A;  4KPT A;  3EHT A;  4ZEI A;  3IO4 A;  1ZU0 A;  5ICQ A;  1T0K A;  1MXY A;  4H6D A;  4FIM A;  1IXC A;  3DP8 A;  3TFL A;  1LAF E;  2XXV A;  2F6G A;  3FAT A;  4DCY A;  4RA1 A;  3SEV A;  4OYV A;  3CVG A;  3LUY A;  1NNK A;  4ZEF A;  1JVX A;  1QUJ A;  1P1N A;  5L9M A;  1OVT A;  3KEI A;  4QRZ A;  5DEX A;  3MVW A;  1RKM A;  2E0S A;  4QFK A;  5M2V A;  2XXI A;  5B7D A;  1UTH A;  1URS A;  5F7V A;  3RYB A;  2PMS A;  5TP9 A;  3PD8 A;  2O7U A;  4YZZ A;  1S9T A;  5H8H B;  3MZ1 A;  4OXV A;  2XXX A;  2H25 A;  4PET A;  1PBQ A;  1M5C A;  4JXI A;  3RT8 A;  1AOV A;  5AA2 A;  3Q26 A;  1D9V A;  2PX1 A;  3KSJ A;  3DEL B;  2LAO A;  1B3E A;  4OEN A;  1FTL A;  1O7T A;  4ZE8 A;  1B3F A;  2DOJ A;  2GH9 A;  1NMU A;  5H8N A;  1R9Q A;  4H67 A;  1BIY A;  1N76 A;  5FHM A;  5I84 A;  3S4U A;  5KDT A;  2DWA A;  3OO7 A;  4TLL B;  5EHM A;  1B4Z A;  1M5E A;  4HW8 A;  3DRH A;  4LA9 A;  4IB2 A;  3G7W A;  4UAC A;  1IXI A;  3MJN A;  5CC2 A;  3SEY A;  5K2X A;  4ZEC A;  2UVG A;  2ANJ A;  3B6T A;  5CRY A;  3IB1 A;  2Y84 A;  1P1W A;  4OET A;  3UA8 A;  3FV2 A;  2REJ A;  4F39 A;  3FJM A;  5DEX B;  1N7X A;  1ZBM A;  3E3K A;  1SW2 A;  1UTH B;  5TP9 B;  4NE4 A;  3H6W A;  4E0X A;  4F22 A;  5I2K A;  2HZK A;  1BKA A;  3K1P A;  3FVG A;  4ELQ A;  3FJG A;  4R72 A;  4RK2 A;  1QUK A;  4O3C A;  3DRI A;  2ZYK A;  4XKP A;  2FNC A;  2XXY A;  4KI0 E;  4LZ8 A;  3UP9 A;  5JTY A;  3P7I A;  5AA2 B;  4MBP A;  4AB6 A;  3HV1 A;  4ZZA A;  2D3I A;  4H0W A;  5L9S A;  4H5G A;  3KFM A;  2IA4 A;  1FQB A;  4YIC A;  5DVI A;  1D3K A;  3IOT A;  4GD5 A;  4LON B;  5DTB A;  1LB9 A;  1IXH A;  2G93 A;  2DWI A;  3TTR A;  4R6H A;  3C36 A;  3ILT B;  3VDF A;  3IJX B;  2UXA A;  4IY5 A;  4ZE9 A;  3H6T A;  4QFN A;  1Y20 A;  4C1T A;  3O6H A;  1USY H;  2Y7I A;  4IGR A;  4RY1 A;  1MQG A;  4RK9 A;  1JVY A;  3R6U A;  3ZS6 A;  4GF8 A;  3MWB A;  1LAG E;  3W9W A;  5DVF A;  3KN8 A;  1TWY A;  2ZYM A;  3MZ9 A;  3PD9 A;  1JW1 A;  3N5L A;  1B32 A;  4DXB A;  2QMX A;  3E4R A;  3CI8 A;  4KR5 A;  1MY0 A;  4YB7 A;  1A54 A;  3MVZ A;  3K1N A;  4H1X A;  4F3B A;  5I2K B;  3PUX E;  3QK6 A;  3BBR A;  3IOW A;  5EHS A;  3ONM A;  1MXZ A;  4DXC A;  4BDN A;  1P1Q A;  5TPA A;  3OEM A;  4ZDM A;  4I1D A;  1UIV A;  2I6E A;  2VD3 A;  4FEB A;  2QL3 A;  4AB5 A;  5JTY B;  4U21 A;  4IY6 A;  1SW5 A;  1MY2 A;  1OVB A;  3PV0 E;  1M5F A;  3UK4 A;  3VLW A;  3VVD A;  4POW A;  1TFA A;  2DQV A;  1H3D A;  3EF7 A;  2UVJ A;  2OLB A;  1P1O A;  3FVO A;  4OEV A;  3TTK A;  4KQP A;  3TZA A;  3L6H A;  1B3L A;  3MVY A;  2F35 A;  2UYE A;  3B6Q A;  3Q28 A;  2O84 X;  4N6P A;  2XXU A;  2XX7 A;  3BFT A;  1S50 A;  3RTW B;  2I3W A;  2V3T A;  3LC8 A;  3MP6 A;  3QAX A;  3O9P A;  4YKJ A;  3RTF B;  4JSD A;  4LZ7 A;  3M3K A;  4LZ5 A;  1NFT A;  3CIJ A;  2O51 A;  1B3G A;  5I59 A;  4IO5 A;  3RLF E;  4OFO A;  1US4 A;  3PUZ E;  5CM6 A;  4JWX A;  1VE4 A;  2YPN A;  4OQO A;  3EN3 A;  4GOT A;  2B4L A;  3G3K A;  1D4N A;  1FCK A;  4PFT A;  3G3H A;  2QRY A;  2XXP A;  2F97 A;  5TPA B;  4KFQ A;  1JW4 A;  2RF1 A;  1H45 A;  2PT2 A;  1ELJ A;  4F1U A;  3MAM A;  2XX8 A;  4JWO A;  1DMB A;  4QFL A;  3KJT A;  2QJE A;  3K0V A;  2O68 A;  1YCJ A;  1MPB A;  4Q5T A;  4I8C A;  2I58 A;  1NNT A;  3TYH A;  2QS1 A;  3WAE A;  4G68 C;  3RY3 A;  4GLI A;  4F2Q A;  1SQY A;  3O6G A;  1IQ7 A;  1MQJ A;  3M3F A;  2V84 A;  3K1M A;  3VE1 B;  4NF8 A;  2QS2 A;  3TAJ A;  3QUF A;  1QJM A;  4YB5 A;  2XXH A;  1LFH A;  2DVC A;  1AIV A;  3WAF A;  4JDF A;  4FE8 A;  2O7I A;  2DYX A;  2WOL A;  1A99 A;  3TCF A;  1QKB A;  1Y3Q A;  4OZ9 A;  4R9F A;  1IIT A;  3CG3 A;  4IO2 A;  3PGF A;  1MRP A;  2Z8D A;  1PB9 A;  3CFL A;  3W15 C;  4G8N A;  2A5S A;  5CMK A;  1F9B A;  3JZJ A;  1Y4T A;  2AYS A;  1GGG A;  1WVJ A;  2BJJ X;  4EQ9 A;  1S7Y A;  4I9D A;  1DTG A;  4LP2 B;  3K6U A;  1VR5 A;  4EQB A;  2DXY A;  3JV9 A;  2ZNS A;  2DP8 A;  2WKY A;  4EXK A;  4N07 A;  1RYO A;  3EHU A;  3W9V A;  3V8X B;  1MXV A;  2OWS A;  4NF4 A;  5FTH A;  1URG A;  2YLN A;  3TMG A;  1QUL A;  4OVJ A;  3S2V A;  4G8H A;  3CRB A;  3I3V A;  1POY 1;  2QSX A;  1JNF A;  4NF8 B;  1MY3 A;  2R71 A;  5CI5 A;  3E9X A;  2H4I A;  3ECR A;  1LST A;  4X1D A;  4YMA A;  3JYR A;  1UQW A;  4Z7E A;  1R6Z A;  4QF9 A;  3U93 A;  5KZT A;  4U22 A;  4DXU A;  3TEP A;  1B5H A;  3H4Z A;  1N84 A;  2DSF A;  1Y3P A;  4WKM A;  5ITP A;  1RYX A;  1MXX A;  3ODB A;  2PBW A;  1O64 A;  2UYF A;  1LFI A;  3O2A A;  4KCD A;  2DWJ A;  1XT8 A;  2HZL A;  3RGY A;  3QUJ A;  3QIM A;  3DRG A;  3CG1 A;  1B7Z A;  3FVN A;  4R74 A;  1LCT A;  3DP4 A;  1Y1M A;  3MPK A;  3GZG A;  2I4C A;  2HQ0 A;  1QKA A;  1FQF A;  3SER A;  3KN3 A;  4R73 A;  1Y1Z A;  2DXR A;  4JBZ A;  5H8S A;  4M4G A;  4QFO A;  1VSO A;  4DLD A;  3MP1 A;  4ESW A;  1MDQ A;  1MPC A;  4NF4 B;  3KG2 A;  4AQ4 A;  1B58 A;  3PMX A;  3S9L C;  1FQD A;  3D4C A;  3FXU A;  1Q35 A;  4ONY A;  4ISU A;  3TQW A;  3OD7 A;  1EH3 A;  3S9E A;  3HST A;  2VOZ A;  3H7M A;  1FTM A;  4XKR A;  2Q2C A;  3C32 A;  3VLU A;  4R9G A;  3AXF A;  1I69 A;  1B52 A;  1FTK A;  2VGQ A;  4U4X A;  1M5B A;  3Q29 A;  4BDQ A;  3TKD A;  4F19 A;  4ZZE A;  3H3G A;  3TTM A;  1WDN A;  3O6I A;  2PT1 A;  2VP1 A;  2UVI A;  4YAH X;  3C4M A;  4IO3 A;  5IKB A;  4FEC A;  1MH4 A;  2ZMB A;  1LBB A;  3VLV A;  5CBR A;  4KHZ E;  3FIR A;  3RQT A;  4BDL A;  4NTL A;  3QSL A;  3VFJ A;  3CR9 A;  3KOT A;  1YPN A;  4KCC A;  1B2H A;  4OEU A;  2QPQ A;  3TPA A;  1BTJ A;  4P0I A;  1Y3N A;  3GBA A;  1N3X A;  2GFE A;  3ZKK A;  4EF1 A;  5DT6 A;  4GXS B;  3IX1 A;  3T22 A;  3HN0 A;  1MY1 A;  5H8N B;  4R6Y A;  2RC9 A;  2DE4 A;  1VFD A;  2Z8E A;  3FJ7 A;  3V89 B;  4FOR A;  3T96 B;  3OEN A;  4P11 A;  5KDT B;  3OO9 A;  5BUU A;  4OTE A;  4PE5 B;  1B46 A;  2UVH A;  1JQF A;  3MC2 A;  4K3F A;  3A3C A;  3DLN A;  1P99 A;  2Q9T A;  3KN7 A;  4P0G A;  1FQC A;  2F7B A;  2P1S A;  3IOV A;  4F1V A;  1TFD A;  1B3H A;  2G29 A;  4R75 A;  4QSE A;  3SEU A;  1ZMG A;  1Z7N E;  4IO6 A;  3MVX A;  1B0H A;  4WXJ A;  4RPN A;  1Z7M E;  1HSL A;  1ANF A;  1CB6 A;  3USD A;  3O66 A;  2Z23 A;  4X9T A;  4TLM B;  4ZED A;  1MQI A;  1II5 A;  3UGW A;  2NXO A;  4UA8 A;  2XXW A;  3LR1 A;  3CSG A;  2H98 A;  4QFP A;  4E0W A;  4R6K A;  3RUM A;  3G3I A;  2V3U A;  2ONR A;  4F1Y A;  1OQH A;  3T9V A;  5AA4 A;  3IK6 B;  2F6P A;  3GLB A;  3G3J A;  1H44 A;  3E13 X;  1NH8 A;  2V3Q A;  1TXF A;  1SYI A;  3K6X A;  2ALU A;  1NH7 A;  2O1M A;  1KWH A;  1A8F A;  4ZS9 A;  3IJO B;  3V83 A;  1A40 A;  3K00 A;  3V5A A;  3HHF A;  3O28 A;  1B5J A;  4LAT A;  4M1V A;  3TTN A;  2H9B A;  1I6A A;  1MQH A;  3G3F A;  5ITO A;  2OCU A;  4KYE A;  2Y7R A;  3FAS A;  2NUV A;  3HO7 A;  1MXU A;  2Y7K A;  5ELV A;  1YTV A;  4F29 A;  2O1L A;  1B7H A;  4C0R A;  3OEL A;  5DVJ A;  2F5X A;  2W7Y A;  1SW1 A;  3K6V A;  3TCG A;  5I58 A;  2D21 A;  1IIW A;  4WED A;  1DSN A;  3UOR A;  5FTI A;  2QMW A;  1GTK A;  3KGC A;  1QUI A;  1LAH E;  3PMW A;  3M8U A;  3GBB A;  4N13 A;  3TDJ A;  1Y9U A;  2FYI A;  1MDP 1;  2OJT A;  4ELP A;  4ELO A;  3FVK A;  4FAJ A;  4EDP A;  2XD3 A;  1EZP A;  3PPP A;  4BLA A;  5AE4 A;  4MH5 A;  4TOZ A;  2B3B A;  4YMB A;  4ECF A;  3IB0 A;  1QW0 A;  3K6W A;  3PAM A;  1M5D A;  4F31 B;  2RC8 A;  4OES A;  2O69 A;  3FD3 A;  2F36 A;  1H43 A;  1N3W A;  4U1Z A;  4YKK A;  3PPQ A;  1B5I A;  3IR1 A;  3VXC A;  4PP0 A;  5JEI A;  1UIU A;  4NMY A;  4EF2 A;  4XKQ A;  5F1Q A;  3PU5 A;  3SET A;  1EU8 A;  3DM0 A;  3KJ7 A;  1LAX A;  4JSO A;  3Q25 A;  4H5F A;  2REG A;  4XXU A;  3GXA A;  1ATG A;  2Z22 A;  4X1B A;  1TT1 A;  3LVU A;  2Y7W A;  4WEP A;  3UN6 A;  3B6W A;  4GQO A;  1R1N A;  4IGT A;  5I59 B;  5L8D A;  2Q2A A;  4XKN A;  3K01 A;  2X26 A;  4MLV A;  3C9H A;  5I2N A;  4POX A;  2YJP A;  1FQE A;  4O3A A;  4RJZ A;  5I58 B;  3L6G A;  4DIG A;  3SES A;  3H06 B;  1PEB A;  1O63 A;  5CMB A;  3LSW A;  3C33 A;  1SD3 A;  2FA7 A;  1NL5 A;  2P0S A;  3U94 A;  2RKM A;  2M8C A;  3TQL A;  1YAE A;  1MH3 A;  3N94 A;  1B7U A;  4U2R A;  2XHD A;  2XX9 A;  5JK4 A;  5H8H A;  2HXW A;  3RNN A;  3Q27 A;  4C1U A;  1IZ1 A;  5A5X A;  3M3L A;  3T66 A;  4LUB A;  1NKX A;  4EQ7 A;  2I4B A;  1P1U A;  4ZEB A;  5H8Q A;  2ESN A;  4XTC Q;  2OWT A;  3S9N C;  2GHA A;  2ONS A;  1A7L A;  4NF6 A;  3IB2 A;  1SDX A;  2Q88 A;  3U72 A;  1XOC A;  1LLS A;  1B05 A;  2D5W A;  4R2F A;  1DTZ A;  2O6A A;  3VV5 A;  2RIN A;  2ZYO A;  4Z0I A;  1MPD A;  4FED A;  4H8I A;  2DS9 A;  2V25 A;  4Q0C A;  1MM6 A;  4PFW A;  2I49 A;  4QHQ A;  1HSE A;  1CE2 A;  3DRK A;  1SI0 A;  1Q1K A;  5I2N B;  3OSR A;  2Y7P A;  4XIG Q;  1SVX B;  3EPE A;  3RPW A;  4RNS A;  2I3V A;  3SDF A;  5AA1 A;  2P2A A;  4G2Z A;  3VVF A;  1R9L A;  5L9O A;  3RN8 A;  1SYH A;  3RYA A;  2GHB A;  4HCY A;  2CMO A;  3IL1 B;  1B0L A;  1OQG A;  2XXT A;  4HCW A;  4RYA A;  4O3B A;  1J1N A;  3HHG A;  2HAU A;  4F18 A;  5CMM A;  1USY E;  1POT A;  3PUY E;  1B40 A;  3S9M C;  5A5X B;  3MUQ A;  2I0C A;  4Q30 B;  2F78 A;  4ND9 A;  5ISU A;  1IUD A;  4LVQ A;  4YU0 A;  3PPR A;  1UTB A;  5H8Q B;  4F3P A;  1B9J A;  1XHY A;  3TOD A;  5KCJ A;  3H03 A;  4NF6 B;  2V93 A;  4Q8R A;  2PVU A;  3K2D A;  1MXW A;  1ZKB A;  3MP8 A;  2NVU B;  2NOO A;  3ILU B;  3KSX A;  3KOS A;  2Q89 A;  4HTG A;  5LOM A;  3MPL A;  5H8F A;  4FAT A;  3HCQ A;  4R2B A;  3C35 A;  4EUO A;  4YKP A;  4LQ5 A;  4IO7 A;  3U8Q A;  1B51 A;  5I57 A;  3PUW E;  2DVZ A;  4F3G A;  2Z8F A;  2GRV A;  3TEL A;  3IAZ A;  4NWD A;  4KYS A;  2ZXT A;  4GVO A;  4U1O A;  1FQA A;  3TTL A;  3KBR A;  4F2O A;  1H76 A;  3OOA A;  3OXN A;  4G4P A;  1OLA A;  2QS4 A;  1VFE A;  3C34 A;  4THI A;  2DE3 A;  3I5O A;  3C31 A;  4DE8 A;  2DWH A;  1PBP A;  3DP6 A;  1XC1 A;  1SI1 A;  4DDD A;  1AMF A;  3LSX A;  5FHN A;  1MS7 A;  4NWC A;  3FGS A;  4GXA A;  3PUV E;  3FUZ A;  3DRJ A;  4BDR A;  5IAI A;  3A3U A;  2F7C A;  1GVC A;  1UTB B;  4ELR A;  1I6Q A;  3LSF B;  3KZG A;  3LBS A;  4ZEK A;  5KCJ B;  5I56 A;  3U1O A;  3RT6 B;  4QSD A;  1NNP A;  3MBP A;  1XVX A;  3F11 A;  1B6H A;  4GRK A;  1JW5 A;  3FXR A;  1FW0 A;  1B1H A;  3FXQ A;  1MM7 A;  5H8F B;  1URD A;  1LGB C;  3SEX A;  3D4G A;  2F8D A;  2OZZ A;  2F34 A;  2VD2 A;  1ZTY A;  4NED A;  4RPO A;  4GWO A;  5I57 B;  5HM4 B;  4H8J A;  4NF5 A;  4DZ1 A;  2XXR A;  4G68 A;  1PDA A;  3CFX A;  1BLF A;  3BFU A;  1FTJ A;  4OWD A;  4HS7 A;  2XXQ A;  3R7X A;  3BKI B;  1SW4 A;  2AL5 A;  1JET A;  1MQD A;  3CHG A;  5K2Y A;  2WOK A;  3DRF A;  1B1X A;  2B4M A;  2F7A A;  4YKI A;  2X7P A;  3IO6 A;  3IOU A;  1ZLQ A;  3CSB A;  4GFR A;  1Y4C A;  3A09 A;  3MQ9 A;  3T93 B;  4GL8 A;  1JEU A;  2CZL A;  4RXL A;  5BWJ A;  4U4S A;  5AA3 A;  1DPP A;  2B65 A;  1EZ9 A;  1MG1 A;  1I6B A;  3PPO A;  5I56 B;  2WOP A;  1ZIU A;  1SBP A;  2NWJ A;  3OO8 A;  2ABH A;  2A5T A;  2QS3 A;  4MFI A;  3T9X B;  2ZNT A;  3PPN A;  4OFJ A;  2Q8J A;  1LFG A;  2ZNU A;  2HEU A;  4LQ2 A;  1AL3 A;  3QYT A;  4NF5 B;  1D9Y A;  5J1D A;  1US5 A;  4BDO A;  4G68 B;  1PB7 A;  1OLC A;  3QXM A;  3EHS A;  4OFL A;  1NNF A;  3MZB A;  1IEJ A;  5CMC A;  3OO6 A;  2I0B A;  3FV1 A;  3N6U A;  3G3G A;  5HPQ A;  4PFU A;  3MW0 A;  5EYF A;  4KD5 A;  2X7Q A;  4OMB A;  4U23 A;  3I6V A;  4IO4 A;  2HCA A;  3UIF A;  2XD2 A;  4JB7 A;  3U92 A;  3T9H B;  4OER A;  1GV8 A;  2E1S A;  4L17 A;  3FTO A;  2AL4 A;  4G77 A;  4DCX A;  1MY4 A;  4PFY A;  1BP5 A;  5AA4 B;  2RCB A;  1A8E A;  2THI A;  3HPI A;  3O6P A;  2OBG A;  1FTO A;  3LSL A;  3R26 A;  3N26 A;  2ZYN A;  1XVY A;  1L5T A;  2PYY A;  1DOT A;  4PQJ A;  5B70 A;  4F3S A;  4ESX A;  4GL0 A;  1JEV A;  2H99 A;  5DYH A;  2DE2 A;  5HBC A;  2A5T B;  2B3F A;  1QVS A;  2R6G E;  1WOD A;  4QSC A;  4G8M A;  3THI A;  3B7D A;  1N04 A;  4OHN A;  4TQU Q; 
#chains in the Genus database with same CATH topology
 1PB8 A;  1IXG A;  4PAF A;  5ICT A;  3H6V A;  1LBC A;  1B4H A;  1AH5 A;  3OSQ A;  2RC7 A;  5FBP A;  4KYD A;  1HSJ A;  1LBW A;  1FJ9 A;  1OIB A;  1FBG A;  3CFZ A;  4EXL A;  3K02 A;  3ZKL A;  2HFB A;  2XWO A;  3BIG A;  3PMV A;  3IOR A;  3EQ1 A;  3VVE A;  5TU0 A;  3SEW A;  3H6U A;  3SKP A;  4H46 A;  2H5Y A;  2OK2 A;  1N0T A;  1PC3 A;  3VXB A;  4N6K A;  1NV4 A;  1LB8 A;  2XXK A;  3RYD A;  3O29 A;  4FJP A;  4H65 A;  1IMD A;  4MF3 A;  4OVS A;  4BDM A;  4OVQ A;  4PBH A;  3N6T A;  3O97 A;  2RCA A;  4P47 A;  1EZO A;  1XS5 A;  1DPE A;  1A55 A;  1GR2 A;  1N7W A;  1FBD A;  3K4U A;  2HAV A;  3T1B A;  1ZJL A;  2WYK A;  3FZV A;  5CBS A;  3IFA A;  2KLF A;  3T9U A;  3TUS A;  5FHO A;  2I48 A;  4I62 A;  1OMP A;  4GX6 A;  4X48 A;  2ONK E;  5AA2 D;  4JWY A;  3OMB A;  3TCH A;  2R9J A;  4GX3 A;  4MX6 A;  2AIX A;  2VHA A;  1LCF A;  3OEK A;  4MLQ A;  4YB6 A;  2IEE A;  1IMB A;  4GIZ A;  3ZSF A;  4KPT A;  3EHT A;  4ZEI A;  3IO4 A;  1ZU0 A;  5ICQ A;  1T0K A;  1MXY A;  4H6D A;  4PAI A;  4FIM A;  1IXC A;  4OAN A;  3DP8 A;  3TFL A;  1LAF E;  2XXV A;  2F6G A;  3FAT A;  4DCY A;  4MNC A;  4RA1 A;  3SEV A;  4OYV A;  3CVG A;  1FPB A;  3LUY A;  1NNK A;  4ZEF A;  1JVX A;  1QUJ A;  1P1N A;  5L9M A;  1OVT A;  3KEI A;  4QRZ A;  5DEX A;  3MVW A;  1RKM A;  2E0S A;  4QFK A;  5M2V A;  3ISP A;  2XXI A;  5B7D A;  1UTH A;  1URS A;  5F7V A;  3RYB A;  2PMS A;  5TP9 A;  3PD8 A;  2O7U A;  4YZZ A;  1S9T A;  5H8H B;  3MZ1 A;  1YXI A;  4OXV A;  2XXX A;  4PGP A;  1Q9D A;  2H25 A;  4PET A;  1PBQ A;  1M5C A;  4JXI A;  3RT8 A;  2P3V A;  1AOV A;  5AA2 A;  3Q26 A;  3EKI A;  1D9V A;  2PX1 A;  1NI9 A;  3KSJ A;  3DEL B;  2LAO A;  1B3E A;  4OEN A;  1FTL A;  2WBD A;  1O7T A;  4ZE8 A;  1B3F A;  2DOJ A;  2GH9 A;  1NMU A;  3SZP A;  5H8N A;  1R9Q A;  4H67 A;  1BIY A;  1N76 A;  4QXD A;  5FHM A;  5I84 A;  3S4U A;  2XWK A;  5KDT A;  4PC9 A;  2DWA A;  2OX3 A;  3OO7 A;  4TLL B;  5EHM A;  1CNQ A;  1B4Z A;  1M5E A;  4N91 A;  4HW8 A;  3DRH A;  4LA9 A;  4IB2 A;  3G7W A;  4UAC A;  1IXI A;  3MJN A;  4KXP A;  1KA1 A;  5CC2 A;  3SEY A;  5K2X A;  4ZEC A;  2UVG A;  2ANJ A;  3B6T A;  5CRY A;  3IB1 A;  2Y84 A;  4HE2 A;  1P1W A;  4OET A;  3UA8 A;  3FV2 A;  2REJ A;  4P9K A;  4F39 A;  2CZH A;  3FJM A;  5DEX B;  1N7X A;  1BK4 A;  1ZBM A;  3E3K A;  1SW2 A;  1UTH B;  5TP9 B;  4NE4 A;  3H6W A;  2KR0 A;  4E0X A;  4F22 A;  2HZK A;  5I2K A;  1BKA A;  3K1P A;  3FVG A;  4N15 A;  4ELQ A;  4OA4 A;  3FJG A;  3T0J A;  4R72 A;  4RK2 A;  1QUK A;  4O3C A;  3DRI A;  1YYZ A;  3KBZ A;  2ZYK A;  4XKP A;  5T3J A;  2FNC A;  4KI0 E;  2XXY A;  4LZ8 A;  3UP9 A;  5JTY A;  3P7I A;  5IZ3 B;  5AA2 B;  4MBP A;  4AB6 A;  3HV1 A;  4ZZA A;  2D3I A;  4H0W A;  5L9S A;  4H5G A;  3KFM A;  2IA4 A;  1FQB A;  4YIC A;  5DVI A;  1D3K A;  3IOT A;  4GD5 A;  4LON B;  5DTB A;  2ZZX A;  1LB9 A;  3ROJ A;  5EQ7 A;  1IXH A;  1FBP A;  2G93 A;  1FBH A;  2DWI A;  3TTR A;  4R6H A;  3C36 A;  3ILT B;  3IJX B;  2UXA A;  3VDF A;  4P1E A;  4IY5 A;  4ZE9 A;  3H6T A;  4QFN A;  1Y20 A;  4C1T A;  3O6H A;  1USY H;  2Y7I A;  4IGR A;  2CZK A;  4RY1 A;  1MQG A;  3GYY A;  4RK9 A;  1JVY A;  3R6U A;  3ZS6 A;  4GF8 A;  3MWB A;  1LAG E;  3W9W A;  5DVF A;  3KN8 A;  1TWY A;  2ZYM A;  3MZ9 A;  3PD9 A;  1RDZ A;  1JW1 A;  3N5L A;  1B32 A;  4DXB A;  2QMX A;  1LBX A;  3E4R A;  4NF0 A;  3CI8 A;  1QGX A;  4KR5 A;  1MY0 A;  4YB7 A;  1A54 A;  3MVZ A;  3K1N A;  4H1X A;  4F3B A;  5I2K B;  3PUX E;  3QK6 A;  3BBR A;  3IOW A;  1NUY A;  5EHS A;  3ONM A;  1MXZ A;  4DXC A;  4BDN A;  1P1Q A;  5TPA A;  4N6D A;  3OEM A;  4ZDM A;  4I1D A;  1UIV A;  2I6E A;  2VD3 A;  4FEB A;  2QL3 A;  4AB5 A;  5JTY B;  4U21 A;  4IY6 A;  1SW5 A;  1MY2 A;  1OVB A;  3PV0 E;  1M5F A;  3UK4 A;  4X04 A;  3VLW A;  3VVD A;  4POW A;  1TFA A;  2DQV A;  1H3D A;  3EF7 A;  2UVJ A;  4NQ8 A;  2OLB A;  1P1O A;  3FVO A;  4OEV A;  3TTK A;  4KQP A;  3BIH A;  4G61 A;  3TZA A;  3L6H A;  4NGU A;  1B3L A;  3MVY A;  2F35 A;  2UYE A;  3B6Q A;  3Q28 A;  2O84 X;  4N6P A;  2XXU A;  2XX7 A;  3BFT A;  4IR8 A;  1S50 A;  3RTW B;  2I3W A;  2V3T A;  3LC8 A;  3MP6 A;  3QAX A;  3MYU A;  3O9P A;  4YKJ A;  3RTF B;  4JSD A;  4LZ7 A;  3M3K A;  4LZ5 A;  1NFT A;  3CIJ A;  2O51 A;  1B3G A;  5I59 A;  4IO5 A;  3RLF E;  2VPN A;  4OFO A;  1US4 A;  3PUZ E;  5CM6 A;  4JWX A;  1VE4 A;  2FVZ A;  2YPN A;  4OQO A;  3EN3 A;  4GOT A;  2B4L A;  3G3K A;  1D4N A;  1FCK A;  4PFT A;  3G3H A;  2QRY A;  1LBY A;  2XXP A;  3RPL A;  2F97 A;  5TPA B;  4KFQ A;  4AS4 A;  1JW4 A;  1NV6 A;  2RF1 A;  1H45 A;  2PT2 A;  1ELJ A;  4F1U A;  3MAM A;  2XX8 A;  4JWO A;  1DMB A;  4QFL A;  3KJT A;  4MCO A;  2QJE A;  3K0V A;  2O68 A;  1YCJ A;  1MPB A;  3KC1 A;  4I8C A;  4Q5T A;  2I58 A;  1NNT A;  3TYH A;  2QS1 A;  3WAE A;  4G68 C;  3RY3 A;  4GLI A;  4F2Q A;  1SQY A;  3O6G A;  5I5P A;  1IQ7 A;  1MQJ A;  3M3F A;  2V84 A;  4XF5 A;  3K1M A;  2CZI A;  3VE1 B;  4NF8 A;  2QS2 A;  3TAJ A;  3QUF A;  1QJM A;  4MNI A;  4YB5 A;  3A29 A;  2XXH A;  5DW8 A;  1LFH A;  2DVC A;  1AIV A;  5IZ1 A;  3WAF A;  4JDF A;  4FE8 A;  1FJ6 A;  2O7I A;  2DYX A;  2WOL A;  1A99 A;  3TCF A;  3B8B A;  2HHM A;  1QKB A;  4UAB A;  2BJI A;  1Y3Q A;  4OZ9 A;  4XFE A;  4R9F A;  1IIT A;  3CG3 A;  4IO2 A;  2XA5 A;  3PGF A;  4PDD A;  1MRP A;  2Z8D A;  1PB9 A;  3CFL A;  3W15 C;  4G8N A;  2A5S A;  5CMK A;  1F9B A;  3JZJ A;  3RPL B;  1Y4T A;  2AYS A;  1GGG A;  1WVJ A;  2BJJ X;  4EQ9 A;  1S7Y A;  4I9D A;  1DTG A;  4GX4 A;  4LP2 B;  3K6U A;  4N81 A;  1VR5 A;  4EQB A;  2DXY A;  3JV9 A;  2ZNS A;  2DP8 A;  2WKY A;  4EXK A;  4N07 A;  1RYO A;  3EHU A;  3W9V A;  4I3Y A;  1DCU A;  3V8X B;  1MXV A;  2OWS A;  4NF4 A;  5FTH A;  1URG A;  2YLN A;  3TMG A;  1QUL A;  4OVJ A;  4DI4 B;  3S2V A;  4G8H A;  4OVT A;  3CRB A;  3I3V A;  1POY 1;  4GWW A;  2QSX A;  1JNF A;  1FBE A;  4NF8 B;  4QBA A;  1MY3 A;  2R71 A;  5CI5 A;  3E78 A;  3E9X A;  2H4I A;  4I3E A;  4PCD A;  3ECR A;  1LST A;  4X1D A;  4YMA A;  3JYR A;  1UQW A;  2PFZ A;  4Z7E A;  1R6Z A;  4QF9 A;  3U93 A;  5KZT A;  4U22 A;  4DXU A;  3TEP A;  1FPD A;  1B5H A;  3H4Z A;  1N84 A;  2DSF A;  1Y3P A;  4WKM A;  5ITP A;  1NV5 A;  1RYX A;  1MXX A;  3ODB A;  2PBW A;  1O64 A;  5ET7 A;  2UYF A;  1LFI A;  3O2A A;  4KCD A;  1IMA A;  2DWJ A;  1XT8 A;  2HZL A;  3RGY A;  3QUJ A;  3QIM A;  1G0I A;  3DRG A;  1FBF A;  1VDW A;  3CG1 A;  1B7Z A;  3FVN A;  4R74 A;  1LCT A;  3DP4 A;  1Y1M A;  3MPK A;  3GZG A;  2I4C A;  2HQ0 A;  1QKA A;  1FQF A;  3SER A;  3KN3 A;  4R73 A;  2F3B A;  1Y1Z A;  2GQ1 A;  2DXR A;  4JBZ A;  5H8S A;  4M4G A;  4QFO A;  1FPL A;  1VSO A;  3IFC A;  4DLD A;  3MP1 A;  2FIX A;  4ESW A;  1MDQ A;  1MPC A;  4NF4 B;  3KG2 A;  2P3N A;  4AQ4 A;  1B58 A;  3PMX A;  3S9L C;  1FQD A;  3D4C A;  3FXU A;  1Q35 A;  1EYJ A;  1D9Q A;  4ONY A;  4ISU A;  3U65 A;  3TQW A;  3OD7 A;  1EH3 A;  3S9E A;  3HST A;  2VOZ A;  3H7M A;  1FTM A;  4XKR A;  2Q2C A;  3C32 A;  3VLU A;  4R9G A;  3AXF A;  1I69 A;  1B52 A;  4PE3 A;  1FTK A;  2VGQ A;  4MAG A;  4U4X A;  1M5B A;  3Q29 A;  1JP4 A;  4BDQ A;  3TKD A;  4F19 A;  4ZZE A;  3H3G A;  2WYP A;  3TTM A;  1WDN A;  3O6I A;  2PT1 A;  2VP1 A;  2UVI A;  4YAH X;  3C4M A;  4IO3 A;  5IKB A;  4FEC A;  1MH4 A;  2ZMB A;  1LBB A;  3VLV A;  1FRP A;  4PF8 A;  2R8T A;  5CBR A;  4KHZ E;  1YZ0 A;  3FIR A;  3RQT A;  1NV7 A;  2FBP A;  3MST A;  4BDL A;  5EQ8 A;  4NTL A;  3QSL A;  3VFJ A;  3CR9 A;  5LTC A;  3KOT A;  1YPN A;  4KCC A;  1B2H A;  2HXR A;  4OEU A;  2QPQ A;  3TPA A;  1IMF A;  4HE1 A;  1BTJ A;  4P0I A;  5EQ9 A;  1Y3N A;  3GBA A;  3FXB A;  1N3X A;  2GFE A;  3ZKK A;  4EF1 A;  5DT6 A;  4GXS B;  3IX1 A;  4NHB A;  3T22 A;  3HN0 A;  1MY1 A;  2FHY A;  5H8N B;  4R6Y A;  1NV3 A;  2RC9 A;  2DE4 A;  1VFD A;  2Z8E A;  4GWU A;  4N8Y A;  3FJ7 A;  3V89 B;  4FOR A;  3OEN A;  3T96 B;  2CEX A;  4P11 A;  5KDT B;  3OO9 A;  5BUU A;  4OTE A;  1EYI A;  4PE5 B;  1B46 A;  2UVH A;  1JQF A;  2ZZW A;  3MC2 A;  3E79 A;  4HE0 A;  4K3F A;  4GWY A;  3A3C A;  3DLN A;  1P99 A;  4O7M A;  2Q9T A;  3KN7 A;  4P0G A;  1FQC A;  2F7B A;  2P1S A;  3IOV A;  4F1V A;  1TFD A;  1B3H A;  4GWZ A;  2G29 A;  4R75 A;  4QSE A;  3SEU A;  1ZMG A;  1Z7N E;  4IO6 A;  3MVX A;  1B0H A;  4WXJ A;  4RPN A;  1Z7M E;  1HSL A;  1ANF A;  1CB6 A;  3USD A;  3O66 A;  2Z23 A;  4X9T A;  1LEV A;  4TLM B;  4ZED A;  1MQI A;  1II5 A;  3UGW A;  2NXO A;  4UA8 A;  2XXW A;  3LR1 A;  4P3L A;  3CSG A;  2H98 A;  4QFP A;  4E0W A;  5IGA A;  4R6K A;  3RUM A;  1DBZ A;  3G3I A;  2V3U A;  2ONR A;  4F1Y A;  1OQH A;  3T9V A;  5AA4 A;  3IK6 B;  3GLB A;  2F6P A;  3G3J A;  1H44 A;  3E13 X;  1NH8 A;  2V3Q A;  1TXF A;  1SYI A;  3K6X A;  2ALU A;  1NH7 A;  2O1M A;  1KWH A;  1A8F A;  1FPF A;  4ZS9 A;  3IJO B;  3V83 A;  1A40 A;  1RDY A;  1FPJ A;  3K00 A;  3V5A A;  2HPG A;  4HXV A;  3HHF A;  3O28 A;  1B5J A;  4LAT A;  4M1V A;  3TTN A;  2H9B A;  1I6A A;  1MQH A;  3G3F A;  2OWZ A;  5ITO A;  2OCU A;  4KYE A;  2Y7R A;  4JVI A;  4N8G A;  3FAS A;  2NUV A;  3HO7 A;  1MXU A;  2Y7K A;  5ELV A;  1YTV A;  4F29 A;  4PBQ A;  2O1L A;  1B7H A;  4C0R A;  3OEL A;  5DVJ A;  2F5X A;  2W7Y A;  1SW1 A;  3K6V A;  4GBV A;  3TCG A;  5I58 A;  2D21 A;  4DI3 D;  1IIW A;  4WED A;  1DSN A;  4MEV A;  3UOR A;  4PF6 A;  5FTI A;  2QMW A;  4PAK A;  1GTK A;  3KGC A;  1QUI A;  1LAH E;  4JVC A;  3PMW A;  3M8U A;  3GBB A;  4N13 A;  3TDJ A;  1Y9U A;  2FYI A;  1MDP 1;  2OJT A;  4ELP A;  4ELO A;  3FVK A;  4JVD A;  4FAJ A;  4EDP A;  2XD3 A;  1EZP A;  3PPP A;  5IM2 A;  4BLA A;  5AE4 A;  4MH5 A;  4TOZ A;  2B3B A;  4YMB A;  4ECF A;  3IB0 A;  1QW0 A;  3K6W A;  3PAM A;  1M5D A;  1FPK A;  4F31 B;  2RC8 A;  4OES A;  2O69 A;  3FD3 A;  2F36 A;  3NOH A;  2QVR A;  1H43 A;  1N3W A;  4PFR A;  4U1Z A;  4YKK A;  4OVP A;  2WX9 A;  3PPQ A;  1B5I A;  3IR1 A;  3VXC A;  4PP0 A;  5JEI A;  3KC0 A;  1UIU A;  4NMY A;  4EF2 A;  4XKQ A;  5F1Q A;  3PU5 A;  3SET A;  1EU8 A;  4P56 A;  3DM0 A;  3KJ7 A;  1LAX A;  4JSO A;  3Q25 A;  4H5F A;  2REG A;  4XXU A;  1SPI A;  3GXA A;  1ATG A;  1IME A;  2Z22 A;  4X1B A;  1TT1 A;  3LVU A;  2Y7W A;  4WEP A;  3UN6 A;  3B6W A;  1KZ8 A;  4GQO A;  1R1N A;  4IGT A;  5I59 B;  5L8D A;  2Q2A A;  4XKN A;  3K01 A;  2CEY A;  2X26 A;  4MLV A;  3C9H A;  4XEQ A;  5I2N A;  4POX A;  2Y5L A;  2YJP A;  1FQE A;  4O3A A;  4RJZ A;  4GWX A;  5I58 B;  5IZZ A;  3L6G A;  4DIG A;  3SES A;  4N4U A;  3H06 B;  1PEB A;  1O63 A;  4LN5 A;  5CMB A;  3LSW A;  4AS5 A;  4MMP A;  3C33 A;  1SD3 A;  2FA7 A;  1NL5 A;  2P0S A;  3U94 A;  2RKM A;  2M8C A;  2F3D A;  3TQL A;  1YAE A;  1MH3 A;  3N94 A;  1B7U A;  4U2R A;  2XHD A;  2XX9 A;  5JK4 A;  3D1R A;  5H8H A;  5I7I A;  4MJO A;  2HXW A;  3RNN A;  3Q27 A;  2XWI A;  4C1U A;  1IZ1 A;  1LBZ A;  5A5X A;  3M3L A;  4PFI A;  3LUZ A;  3T66 A;  4LUB A;  1NKX A;  2JJK A;  4EQ7 A;  2I4B A;  1P1U A;  4ZEB A;  5H8Q A;  2KQZ A;  2ESN A;  4XTC Q;  2OWT A;  5ESY A;  3S9N C;  2GHA A;  2ONS A;  1A7L A;  4NF6 A;  3IB2 A;  1SDX A;  2Q88 A;  2PCR A;  4O8M A;  3U72 A;  1XOC A;  1LLS A;  2Q8M A;  1B05 A;  2D5W A;  4OVR A;  4R2F A;  4PGN A;  1DTZ A;  2O6A A;  3VV5 A;  2RIN A;  2ZYO A;  4Z0I A;  1MPD A;  4FED A;  4H8I A;  2DS9 A;  5A5L A;  2V25 A;  1FBC A;  4Q0C A;  1MM6 A;  4PFW A;  2I49 A;  2WBB A;  4QHQ A;  1HSE A;  1CE2 A;  3DRK A;  3B50 A;  1DK4 A;  1Q1K A;  1SI0 A;  4P1L A;  5I2N B;  3OSR A;  1EYK A;  2Y7P A;  4XIG Q;  1SVX B;  3EPE A;  3RPW A;  4RNS A;  2I3V A;  3SDF A;  5AA1 A;  5ET5 A;  2P2A A;  4G2Z A;  3VVF A;  1R9L A;  5L9O A;  3RN8 A;  1SYH A;  3RYA A;  2GHB A;  4HCY A;  2Q74 A;  2CMO A;  3IL1 B;  1B0L A;  1OQG A;  2XXT A;  4HCW A;  4RYA A;  4O3B A;  1J1N A;  3HHG A;  3PTY A;  2ZZV A;  1AWB A;  2HAU A;  1NUZ A;  4F18 A;  5CMM A;  1K9Y A;  1USY E;  1POT A;  3PUY E;  1B40 A;  3S9M C;  5A5X B;  4O94 A;  3MUQ A;  2I0C A;  4Q30 B;  2F78 A;  4ND9 A;  5ISU A;  1IUD A;  4LVQ A;  4YU0 A;  3PPR A;  5IZ3 A;  1UTB A;  5H8Q B;  4F3P A;  1B9J A;  1XHY A;  3TOD A;  5KCJ A;  5EYG A;  2V4C A;  2QVV A;  3H03 A;  4NF6 B;  4MHF A;  2V93 A;  4Q8R A;  2PVU A;  3K2D A;  1MXW A;  1ZKB A;  4I40 A;  3MP8 A;  2NVU B;  2NOO A;  3ILU B;  3KSX A;  3KOS A;  2Q89 A;  4HTG A;  5LOM A;  3MPL A;  5H8F A;  4FAT A;  3HCQ A;  4R2B A;  3C35 A;  4EUO A;  4YKP A;  4LQ5 A;  4IO7 A;  2DDK A;  4PDH A;  3U8Q A;  4H45 A;  1B51 A;  5I57 A;  3FBP A;  3PUW E;  2DVZ A;  2FIE A;  4F3G A;  2Z8F A;  2GRV A;  3TEL A;  3IAZ A;  4NWD A;  4KYS A;  1NV0 A;  2ZXT A;  4GVO A;  4U1O A;  1FQA A;  3TTL A;  3KBR A;  4F2O A;  1H76 A;  5I3S A;  2WEF A;  3OOA A;  3OXN A;  1OLA A;  4G4P A;  4MIJ A;  2QS4 A;  1VFE A;  3C34 A;  4THI A;  1NUX A;  2DE3 A;  3I5O A;  3C31 A;  4DE8 A;  4MNP A;  2DWH A;  1PBP A;  3DP6 A;  1XC1 A;  1SI1 A;  4DDD A;  1AMF A;  3LSX A;  5FHN A;  1MS7 A;  4NWC A;  3FGS A;  4GXA A;  3PUV E;  3FUZ A;  3DRJ A;  4PFB A;  4BDR A;  5J16 A;  5IAI A;  3A3U A;  2F7C A;  1GVC A;  1UTB B;  4ELR A;  1IMC A;  1I6Q A;  3LSF B;  3KZG A;  3LBS A;  4ZEK A;  1LBV A;  5KCJ B;  5I56 A;  2MKZ A;  1FPI A;  3U1O A;  3RT6 B;  3LV0 A;  4QSD A;  1NNP A;  3MBP A;  1XVX A;  3F11 A;  1FSA A;  1B6H A;  2VPO A;  5EQA A;  4GRK A;  1JW5 A;  1FPE A;  1NV2 A;  3FXR A;  4NAP A;  1FW0 A;  1B1H A;  3FXQ A;  1MM7 A;  5H8F B;  1INP A;  1URD A;  1LGB C;  3SEX A;  3D4G A;  2F8D A;  2OZZ A;  2F34 A;  2VD2 A;  4X8R A;  1ZTY A;  4NED A;  4RPO A;  4GWO A;  5I57 B;  4PTK A;  5HM4 B;  4H8J A;  4NF5 A;  4DZ1 A;  2XXR A;  4G68 A;  1PDA A;  3CFX A;  5ET6 A;  1BLF A;  3BFU A;  1FTJ A;  2PFY A;  4P8B A;  1K9Z A;  4OWD A;  4HS7 A;  2QFL A;  2XXQ A;  3R7X A;  3BKI B;  5LDZ A;  1SW4 A;  2AL5 A;  1JET A;  1MQD A;  2QVU A;  3CHG A;  5K2Y A;  2WOK A;  3DRF A;  3HFU A;  1KA0 A;  1B1X A;  2B4M A;  2F7A A;  4YKI A;  2X7P A;  3IO6 A;  3IOU A;  1ZLQ A;  3CSB A;  4GFR A;  1Y4C A;  3A09 A;  3MQ9 A;  3T93 B;  4GL8 A;  5F24 A;  1JEU A;  2CZL A;  4RXL A;  4GBW A;  5BWJ A;  4U4S A;  5AA3 A;  1DPP A;  2B65 A;  1EZ9 A;  1MG1 A;  2XWV A;  1I6B A;  3PPO A;  5I56 B;  4NX1 A;  2WOP A;  1ZIU A;  1SBP A;  2NWJ A;  3OO8 A;  4NG7 A;  4FBP A;  2ABH A;  2A5T A;  2QS3 A;  4MFI A;  3T9X B;  2ZNT A;  3PPN A;  2VT5 A;  1NUW A;  4OFJ A;  2Q8J A;  1LFG A;  2ZNU A;  2HEU A;  4LQ2 A;  1AL3 A;  3QYT A;  1G0H A;  4NF5 B;  1D9Y A;  5J1D A;  1US5 A;  4BDO A;  4G68 B;  1PB7 A;  1RDX A;  1OLC A;  3QXM A;  3EHS A;  4OFL A;  1NNF A;  3MZB A;  1IEJ A;  5CMC A;  3OO6 A;  2I0B A;  5ET8 A;  3FV1 A;  3N6U A;  3G3G A;  5HPQ A;  4PFU A;  4NN3 A;  3MW0 A;  5EYF A;  4KD5 A;  2X7Q A;  4OMB A;  4U23 A;  3I6V A;  4IO4 A;  2HCA A;  3UIF A;  2XD2 A;  4JB7 A;  3U92 A;  3T9H B;  4OER A;  1GV8 A;  2E1S A;  4L17 A;  3FTO A;  2AL4 A;  4G77 A;  4DCX A;  1MY4 A;  5EYH A;  4PFY A;  1NV1 A;  1BP5 A;  5AA4 B;  2RCB A;  1A8E A;  1FTA A;  2THI A;  3HPI A;  3O6P A;  2OBG A;  1FTO A;  2L5V A;  3LSL A;  4N17 A;  3R26 A;  3N26 A;  2ZYN A;  1XVY A;  1L5T A;  1FPG A;  2PYY A;  1XI6 A;  3QMF A;  1DOT A;  4PQJ A;  5B70 A;  4F3S A;  4ESX A;  4GL0 A;  1JEV A;  2H99 A;  5DYH A;  2DE2 A;  5HBC A;  2Y5K A;  2A5T B;  2B3F A;  1QVS A;  4GWS A;  2R6G E;  1WOD A;  4QSC A;  4G8M A;  3THI A;  3B7D A;  1N04 A;  4OHN A;  4TQU Q;  4O7I A; 
#chains in the Genus database with same CATH homology
 1PB8 A;  1IXG A;  5ICT A;  3H6V A;  1LBC A;  1B4H A;  1AH5 A;  3OSQ A;  2RC7 A;  4KYD A;  1HSJ A;  1OIB A;  3CFZ A;  4EXL A;  3K02 A;  3ZKL A;  2HFB A;  3PMV A;  3IOR A;  3EQ1 A;  3VVE A;  5TU0 A;  3SEW A;  3H6U A;  3SKP A;  2H5Y A;  2OK2 A;  1N0T A;  1PC3 A;  3VXB A;  1LB8 A;  3O29 A;  4FJP A;  4H65 A;  4MF3 A;  4BDM A;  3N6T A;  3O97 A;  2RCA A;  1EZO A;  1XS5 A;  1DPE A;  1A55 A;  1GR2 A;  1N7W A;  3K4U A;  2HAV A;  1ZJL A;  3FZV A;  5CBS A;  2KLF A;  3T9U A;  3TUS A;  5FHO A;  2I48 A;  4X48 A;  4I62 A;  1OMP A;  5AA2 D;  2ONK E;  4JWY A;  3OMB A;  3TCH A;  2R9J A;  2AIX A;  2VHA A;  1LCF A;  3OEK A;  4MLQ A;  4YB6 A;  2IEE A;  4GIZ A;  3ZSF A;  4KPT A;  3EHT A;  4ZEI A;  3IO4 A;  1ZU0 A;  5ICQ A;  1T0K A;  1MXY A;  4H6D A;  4FIM A;  1IXC A;  3DP8 A;  3TFL A;  1LAF E;  2XXV A;  2F6G A;  3FAT A;  4DCY A;  4RA1 A;  3SEV A;  4OYV A;  3CVG A;  3LUY A;  1NNK A;  4ZEF A;  1JVX A;  1QUJ A;  1P1N A;  5L9M A;  1OVT A;  3KEI A;  4QRZ A;  5DEX A;  3MVW A;  1RKM A;  2E0S A;  4QFK A;  5M2V A;  2XXI A;  5B7D A;  1UTH A;  1URS A;  5F7V A;  3RYB A;  2PMS A;  5TP9 A;  3PD8 A;  2O7U A;  4YZZ A;  1S9T A;  5H8H B;  3MZ1 A;  4OXV A;  2XXX A;  2H25 A;  4PET A;  1PBQ A;  1M5C A;  4JXI A;  3RT8 A;  1AOV A;  5AA2 A;  3Q26 A;  1D9V A;  2PX1 A;  3KSJ A;  3DEL B;  2LAO A;  1B3E A;  4OEN A;  1FTL A;  1O7T A;  4ZE8 A;  1B3F A;  2DOJ A;  2GH9 A;  1NMU A;  5H8N A;  1R9Q A;  4H67 A;  1BIY A;  1N76 A;  5FHM A;  5I84 A;  3S4U A;  5KDT A;  2DWA A;  3OO7 A;  4TLL B;  5EHM A;  1B4Z A;  1M5E A;  4HW8 A;  3DRH A;  4LA9 A;  4IB2 A;  3G7W A;  4UAC A;  1IXI A;  3MJN A;  5CC2 A;  3SEY A;  5K2X A;  4ZEC A;  2UVG A;  2ANJ A;  3B6T A;  5CRY A;  3IB1 A;  2Y84 A;  1P1W A;  4OET A;  3UA8 A;  3FV2 A;  2REJ A;  4F39 A;  3FJM A;  5DEX B;  1N7X A;  1ZBM A;  3E3K A;  1SW2 A;  1UTH B;  5TP9 B;  4NE4 A;  3H6W A;  4E0X A;  4F22 A;  5I2K A;  2HZK A;  1BKA A;  3K1P A;  3FVG A;  4ELQ A;  3FJG A;  4R72 A;  4RK2 A;  1QUK A;  4O3C A;  3DRI A;  2ZYK A;  4XKP A;  2FNC A;  2XXY A;  4KI0 E;  4LZ8 A;  3UP9 A;  5JTY A;  3P7I A;  5AA2 B;  4MBP A;  4AB6 A;  3HV1 A;  4ZZA A;  2D3I A;  4H0W A;  5L9S A;  4H5G A;  3KFM A;  2IA4 A;  1FQB A;  4YIC A;  5DVI A;  1D3K A;  3IOT A;  4GD5 A;  4LON B;  5DTB A;  1LB9 A;  1IXH A;  2G93 A;  2DWI A;  3TTR A;  4R6H A;  3C36 A;  3ILT B;  3VDF A;  3IJX B;  2UXA A;  4IY5 A;  4ZE9 A;  3H6T A;  4QFN A;  1Y20 A;  4C1T A;  3O6H A;  1USY H;  2Y7I A;  4IGR A;  4RY1 A;  1MQG A;  4RK9 A;  1JVY A;  3R6U A;  3ZS6 A;  4GF8 A;  3MWB A;  1LAG E;  3W9W A;  5DVF A;  3KN8 A;  1TWY A;  2ZYM A;  3MZ9 A;  3PD9 A;  1JW1 A;  3N5L A;  1B32 A;  4DXB A;  2QMX A;  3E4R A;  3CI8 A;  4KR5 A;  1MY0 A;  4YB7 A;  1A54 A;  3MVZ A;  3K1N A;  4H1X A;  4F3B A;  5I2K B;  3PUX E;  3QK6 A;  3BBR A;  3IOW A;  5EHS A;  3ONM A;  1MXZ A;  4DXC A;  4BDN A;  1P1Q A;  5TPA A;  3OEM A;  4ZDM A;  4I1D A;  1UIV A;  2I6E A;  2VD3 A;  4FEB A;  2QL3 A;  4AB5 A;  5JTY B;  4U21 A;  4IY6 A;  1SW5 A;  1MY2 A;  1OVB A;  3PV0 E;  1M5F A;  3UK4 A;  3VLW A;  3VVD A;  4POW A;  1TFA A;  2DQV A;  1H3D A;  3EF7 A;  2UVJ A;  2OLB A;  1P1O A;  3FVO A;  4OEV A;  3TTK A;  4KQP A;  3TZA A;  3L6H A;  1B3L A;  3MVY A;  2F35 A;  2UYE A;  3B6Q A;  3Q28 A;  2O84 X;  4N6P A;  2XXU A;  2XX7 A;  3BFT A;  1S50 A;  3RTW B;  2I3W A;  2V3T A;  3LC8 A;  3MP6 A;  3QAX A;  3O9P A;  4YKJ A;  3RTF B;  4JSD A;  4LZ7 A;  3M3K A;  4LZ5 A;  1NFT A;  3CIJ A;  2O51 A;  1B3G A;  5I59 A;  4IO5 A;  3RLF E;  4OFO A;  1US4 A;  3PUZ E;  5CM6 A;  4JWX A;  1VE4 A;  2YPN A;  4OQO A;  3EN3 A;  4GOT A;  2B4L A;  3G3K A;  1D4N A;  1FCK A;  4PFT A;  3G3H A;  2QRY A;  2XXP A;  2F97 A;  5TPA B;  4KFQ A;  1JW4 A;  2RF1 A;  1H45 A;  2PT2 A;  1ELJ A;  4F1U A;  3MAM A;  2XX8 A;  4JWO A;  1DMB A;  4QFL A;  3KJT A;  2QJE A;  3K0V A;  2O68 A;  1YCJ A;  1MPB A;  4Q5T A;  4I8C A;  2I58 A;  1NNT A;  3TYH A;  2QS1 A;  3WAE A;  4G68 C;  3RY3 A;  4GLI A;  4F2Q A;  1SQY A;  3O6G A;  1IQ7 A;  1MQJ A;  3M3F A;  2V84 A;  3K1M A;  3VE1 B;  4NF8 A;  2QS2 A;  3TAJ A;  3QUF A;  1QJM A;  4YB5 A;  2XXH A;  1LFH A;  2DVC A;  1AIV A;  3WAF A;  4JDF A;  4FE8 A;  2O7I A;  2DYX A;  2WOL A;  1A99 A;  3TCF A;  1QKB A;  1Y3Q A;  4OZ9 A;  4R9F A;  1IIT A;  3CG3 A;  4IO2 A;  3PGF A;  1MRP A;  2Z8D A;  1PB9 A;  3CFL A;  3W15 C;  4G8N A;  2A5S A;  5CMK A;  1F9B A;  3JZJ A;  1Y4T A;  2AYS A;  1GGG A;  1WVJ A;  2BJJ X;  4EQ9 A;  1S7Y A;  4I9D A;  1DTG A;  4LP2 B;  3K6U A;  1VR5 A;  4EQB A;  2DXY A;  3JV9 A;  2ZNS A;  2DP8 A;  2WKY A;  4EXK A;  4N07 A;  1RYO A;  3EHU A;  3W9V A;  3V8X B;  1MXV A;  2OWS A;  4NF4 A;  5FTH A;  1URG A;  2YLN A;  3TMG A;  1QUL A;  4OVJ A;  3S2V A;  4G8H A;  3CRB A;  3I3V A;  1POY 1;  2QSX A;  1JNF A;  4NF8 B;  1MY3 A;  2R71 A;  5CI5 A;  3E9X A;  2H4I A;  3ECR A;  1LST A;  4X1D A;  4YMA A;  3JYR A;  1UQW A;  4Z7E A;  1R6Z A;  4QF9 A;  3U93 A;  5KZT A;  4U22 A;  4DXU A;  3TEP A;  1B5H A;  3H4Z A;  1N84 A;  2DSF A;  1Y3P A;  4WKM A;  5ITP A;  1RYX A;  1MXX A;  3ODB A;  2PBW A;  1O64 A;  2UYF A;  1LFI A;  3O2A A;  4KCD A;  2DWJ A;  1XT8 A;  2HZL A;  3RGY A;  3QUJ A;  3QIM A;  3DRG A;  3CG1 A;  1B7Z A;  3FVN A;  4R74 A;  1LCT A;  3DP4 A;  1Y1M A;  3MPK A;  3GZG A;  2I4C A;  2HQ0 A;  1QKA A;  1FQF A;  3SER A;  3KN3 A;  4R73 A;  1Y1Z A;  2DXR A;  4JBZ A;  5H8S A;  4M4G A;  4QFO A;  1VSO A;  4DLD A;  3MP1 A;  4ESW A;  1MDQ A;  1MPC A;  4NF4 B;  3KG2 A;  4AQ4 A;  1B58 A;  3PMX A;  3S9L C;  1FQD A;  3D4C A;  3FXU A;  1Q35 A;  4ONY A;  4ISU A;  3TQW A;  3OD7 A;  1EH3 A;  3S9E A;  3HST A;  2VOZ A;  3H7M A;  1FTM A;  4XKR A;  2Q2C A;  3C32 A;  3VLU A;  4R9G A;  3AXF A;  1I69 A;  1B52 A;  1FTK A;  2VGQ A;  4U4X A;  1M5B A;  3Q29 A;  4BDQ A;  3TKD A;  4F19 A;  4ZZE A;  3H3G A;  3TTM A;  1WDN A;  3O6I A;  2PT1 A;  2VP1 A;  2UVI A;  4YAH X;  3C4M A;  4IO3 A;  5IKB A;  4FEC A;  1MH4 A;  2ZMB A;  1LBB A;  3VLV A;  5CBR A;  4KHZ E;  3FIR A;  3RQT A;  4BDL A;  4NTL A;  3QSL A;  3VFJ A;  3CR9 A;  3KOT A;  1YPN A;  4KCC A;  1B2H A;  4OEU A;  2QPQ A;  3TPA A;  1BTJ A;  4P0I A;  1Y3N A;  3GBA A;  1N3X A;  2GFE A;  3ZKK A;  4EF1 A;  5DT6 A;  4GXS B;  3IX1 A;  3T22 A;  3HN0 A;  1MY1 A;  5H8N B;  4R6Y A;  2RC9 A;  2DE4 A;  1VFD A;  2Z8E A;  3FJ7 A;  3V89 B;  4FOR A;  3T96 B;  3OEN A;  4P11 A;  5KDT B;  3OO9 A;  5BUU A;  4OTE A;  4PE5 B;  1B46 A;  2UVH A;  1JQF A;  3MC2 A;  4K3F A;  3A3C A;  3DLN A;  1P99 A;  2Q9T A;  3KN7 A;  4P0G A;  1FQC A;  2F7B A;  2P1S A;  3IOV A;  4F1V A;  1TFD A;  1B3H A;  2G29 A;  4R75 A;  4QSE A;  3SEU A;  1ZMG A;  1Z7N E;  4IO6 A;  3MVX A;  1B0H A;  4WXJ A;  4RPN A;  1Z7M E;  1HSL A;  1ANF A;  1CB6 A;  3USD A;  3O66 A;  2Z23 A;  4X9T A;  4TLM B;  4ZED A;  1MQI A;  1II5 A;  3UGW A;  2NXO A;  4UA8 A;  2XXW A;  3LR1 A;  3CSG A;  2H98 A;  4QFP A;  4E0W A;  4R6K A;  3RUM A;  3G3I A;  2V3U A;  2ONR A;  4F1Y A;  1OQH A;  3T9V A;  5AA4 A;  3IK6 B;  2F6P A;  3GLB A;  3G3J A;  1H44 A;  3E13 X;  1NH8 A;  2V3Q A;  1TXF A;  1SYI A;  3K6X A;  2ALU A;  1NH7 A;  2O1M A;  1KWH A;  1A8F A;  4ZS9 A;  3IJO B;  3V83 A;  1A40 A;  3K00 A;  3V5A A;  3HHF A;  3O28 A;  1B5J A;  4LAT A;  4M1V A;  3TTN A;  2H9B A;  1I6A A;  1MQH A;  3G3F A;  5ITO A;  2OCU A;  4KYE A;  2Y7R A;  3FAS A;  2NUV A;  3HO7 A;  1MXU A;  2Y7K A;  5ELV A;  1YTV A;  4F29 A;  2O1L A;  1B7H A;  4C0R A;  3OEL A;  5DVJ A;  2F5X A;  2W7Y A;  1SW1 A;  3K6V A;  3TCG A;  5I58 A;  2D21 A;  1IIW A;  4WED A;  1DSN A;  3UOR A;  5FTI A;  2QMW A;  1GTK A;  3KGC A;  1QUI A;  1LAH E;  3PMW A;  3M8U A;  3GBB A;  4N13 A;  3TDJ A;  1Y9U A;  2FYI A;  1MDP 1;  2OJT A;  4ELP A;  4ELO A;  3FVK A;  4FAJ A;  4EDP A;  2XD3 A;  1EZP A;  3PPP A;  4BLA A;  5AE4 A;  4MH5 A;  4TOZ A;  2B3B A;  4YMB A;  4ECF A;  3IB0 A;  1QW0 A;  3K6W A;  3PAM A;  1M5D A;  4F31 B;  2RC8 A;  4OES A;  2O69 A;  3FD3 A;  2F36 A;  1H43 A;  1N3W A;  4U1Z A;  4YKK A;  3PPQ A;  1B5I A;  3IR1 A;  3VXC A;  4PP0 A;  5JEI A;  1UIU A;  4NMY A;  4EF2 A;  4XKQ A;  5F1Q A;  3PU5 A;  3SET A;  1EU8 A;  3DM0 A;  3KJ7 A;  1LAX A;  4JSO A;  3Q25 A;  4H5F A;  2REG A;  4XXU A;  3GXA A;  1ATG A;  2Z22 A;  4X1B A;  1TT1 A;  3LVU A;  2Y7W A;  4WEP A;  3UN6 A;  3B6W A;  4GQO A;  1R1N A;  4IGT A;  5I59 B;  5L8D A;  2Q2A A;  4XKN A;  3K01 A;  2X26 A;  4MLV A;  3C9H A;  5I2N A;  4POX A;  2YJP A;  1FQE A;  4O3A A;  4RJZ A;  5I58 B;  3L6G A;  4DIG A;  3SES A;  3H06 B;  1PEB A;  1O63 A;  5CMB A;  3LSW A;  3C33 A;  1SD3 A;  2FA7 A;  1NL5 A;  2P0S A;  3U94 A;  2RKM A;  2M8C A;  3TQL A;  1YAE A;  1MH3 A;  3N94 A;  1B7U A;  4U2R A;  2XHD A;  2XX9 A;  5JK4 A;  5H8H A;  2HXW A;  3RNN A;  3Q27 A;  4C1U A;  1IZ1 A;  5A5X A;  3M3L A;  3T66 A;  4LUB A;  1NKX A;  4EQ7 A;  2I4B A;  1P1U A;  4ZEB A;  5H8Q A;  2ESN A;  4XTC Q;  2OWT A;  3S9N C;  2GHA A;  2ONS A;  1A7L A;  4NF6 A;  3IB2 A;  1SDX A;  2Q88 A;  3U72 A;  1XOC A;  1LLS A;  1B05 A;  2D5W A;  4R2F A;  1DTZ A;  2O6A A;  3VV5 A;  2RIN A;  2ZYO A;  4Z0I A;  1MPD A;  4FED A;  4H8I A;  2DS9 A;  2V25 A;  4Q0C A;  1MM6 A;  4PFW A;  2I49 A;  4QHQ A;  1HSE A;  1CE2 A;  3DRK A;  1SI0 A;  1Q1K A;  5I2N B;  3OSR A;  2Y7P A;  4XIG Q;  1SVX B;  3EPE A;  3RPW A;  4RNS A;  2I3V A;  3SDF A;  5AA1 A;  2P2A A;  4G2Z A;  3VVF A;  1R9L A;  5L9O A;  3RN8 A;  1SYH A;  3RYA A;  2GHB A;  4HCY A;  2CMO A;  3IL1 B;  1B0L A;  1OQG A;  2XXT A;  4HCW A;  4RYA A;  4O3B A;  1J1N A;  3HHG A;  2HAU A;  4F18 A;  5CMM A;  1USY E;  1POT A;  3PUY E;  1B40 A;  3S9M C;  5A5X B;  3MUQ A;  2I0C A;  4Q30 B;  2F78 A;  4ND9 A;  5ISU A;  1IUD A;  4LVQ A;  4YU0 A;  3PPR A;  1UTB A;  5H8Q B;  4F3P A;  1B9J A;  1XHY A;  3TOD A;  5KCJ A;  3H03 A;  4NF6 B;  2V93 A;  4Q8R A;  2PVU A;  3K2D A;  1MXW A;  1ZKB A;  3MP8 A;  2NVU B;  2NOO A;  3ILU B;  3KSX A;  3KOS A;  2Q89 A;  4HTG A;  5LOM A;  3MPL A;  5H8F A;  4FAT A;  3HCQ A;  4R2B A;  3C35 A;  4EUO A;  4YKP A;  4LQ5 A;  4IO7 A;  3U8Q A;  1B51 A;  5I57 A;  3PUW E;  2DVZ A;  4F3G A;  2Z8F A;  2GRV A;  3TEL A;  3IAZ A;  4NWD A;  4KYS A;  2ZXT A;  4GVO A;  4U1O A;  1FQA A;  3TTL A;  3KBR A;  4F2O A;  1H76 A;  3OOA A;  3OXN A;  4G4P A;  1OLA A;  2QS4 A;  1VFE A;  3C34 A;  4THI A;  2DE3 A;  3I5O A;  3C31 A;  4DE8 A;  2DWH A;  1PBP A;  3DP6 A;  1XC1 A;  1SI1 A;  4DDD A;  1AMF A;  3LSX A;  5FHN A;  1MS7 A;  4NWC A;  3FGS A;  4GXA A;  3PUV E;  3FUZ A;  3DRJ A;  4BDR A;  5IAI A;  3A3U A;  2F7C A;  1GVC A;  1UTB B;  4ELR A;  1I6Q A;  3LSF B;  3KZG A;  3LBS A;  4ZEK A;  5KCJ B;  5I56 A;  3U1O A;  3RT6 B;  4QSD A;  1NNP A;  3MBP A;  1XVX A;  3F11 A;  1B6H A;  4GRK A;  1JW5 A;  3FXR A;  1FW0 A;  1B1H A;  3FXQ A;  1MM7 A;  5H8F B;  1URD A;  1LGB C;  3SEX A;  3D4G A;  2F8D A;  2OZZ A;  2F34 A;  2VD2 A;  1ZTY A;  4NED A;  4RPO A;  4GWO A;  5I57 B;  5HM4 B;  4H8J A;  4NF5 A;  4DZ1 A;  2XXR A;  4G68 A;  1PDA A;  3CFX A;  1BLF A;  3BFU A;  1FTJ A;  4OWD A;  4HS7 A;  2XXQ A;  3R7X A;  3BKI B;  1SW4 A;  2AL5 A;  1JET A;  1MQD A;  3CHG A;  5K2Y A;  2WOK A;  3DRF A;  1B1X A;  2B4M A;  2F7A A;  4YKI A;  2X7P A;  3IO6 A;  3IOU A;  1ZLQ A;  3CSB A;  4GFR A;  1Y4C A;  3A09 A;  3MQ9 A;  3T93 B;  4GL8 A;  1JEU A;  2CZL A;  4RXL A;  5BWJ A;  4U4S A;  5AA3 A;  1DPP A;  2B65 A;  1EZ9 A;  1MG1 A;  1I6B A;  3PPO A;  5I56 B;  2WOP A;  1ZIU A;  1SBP A;  2NWJ A;  3OO8 A;  2ABH A;  2A5T A;  2QS3 A;  4MFI A;  3T9X B;  2ZNT A;  3PPN A;  4OFJ A;  2Q8J A;  1LFG A;  2ZNU A;  2HEU A;  4LQ2 A;  1AL3 A;  3QYT A;  4NF5 B;  1D9Y A;  5J1D A;  1US5 A;  4BDO A;  4G68 B;  1PB7 A;  1OLC A;  3QXM A;  3EHS A;  4OFL A;  1NNF A;  3MZB A;  1IEJ A;  5CMC A;  3OO6 A;  2I0B A;  3FV1 A;  3N6U A;  3G3G A;  5HPQ A;  4PFU A;  3MW0 A;  5EYF A;  4KD5 A;  2X7Q A;  4OMB A;  4U23 A;  3I6V A;  4IO4 A;  2HCA A;  3UIF A;  2XD2 A;  4JB7 A;  3U92 A;  3T9H B;  4OER A;  1GV8 A;  2E1S A;  4L17 A;  3FTO A;  2AL4 A;  4G77 A;  4DCX A;  1MY4 A;  4PFY A;  1BP5 A;  5AA4 B;  2RCB A;  1A8E A;  2THI A;  3HPI A;  3O6P A;  2OBG A;  1FTO A;  3LSL A;  3R26 A;  3N26 A;  2ZYN A;  1XVY A;  1L5T A;  2PYY A;  1DOT A;  4PQJ A;  5B70 A;  4F3S A;  4ESX A;  4GL0 A;  1JEV A;  2H99 A;  5DYH A;  2DE2 A;  5HBC A;  2A5T B;  2B3F A;  1QVS A;  2R6G E;  1WOD A;  4QSC A;  4G8M A;  3THI A;  3B7D A;  1N04 A;  4OHN A;  4TQU Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...