1JETA

Oligo-peptide binding protein (oppa) complexed with kak
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title The role of water in sequence-independent ligand binding by an oligopeptide transporter protein.
pubmed doi rcsb
molecule tags Complex (peptide transport/peptide)
total genus 187
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1996-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1jetA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1jetA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1jetA02
4FEDA 2XX7A 5CRYA 5ICTA 4JSOA 2DWHA 4YMBA 3GBAA 3H03A 4PQJA 1BP5A 2H25A 1N0TA 1N7XA 5CBSA 4NWDA 5AA3A 1MH3A 3KBRA 3TQWA 4DXUA 1P1WA 3S9LC 1NFTA 2F6GA 2IEEA 1PB8A 4OYVA 3K6VA 4WEPA 3E3KA 1M5FA 3T9HB 4ONYA 3GZGA 3S4UA 4YMAA 3HHFA 4GXAA 2GRVA 4ESWA 5TPAB 1VFDA 4F1VA 1S9TA 1Y3NA 3I3VA 1B46A 1JVYA 1JW5A 4KYEA 1ANFA 4G2ZA 1HSJA 4ECFA 2GHBA 4U23A 1NNFA 3UGWA 4QSDA 2P2AA 1VR5A 3FXUA 4N6PA 1MXZA 3LSLA 3UP9A 4ZZEA 3FVGA 2PX1A 2X26A 1N7WA 5JEIA 4YKPA 1AIVA 3O28A 3LSFB 4FJPA 3TCGA 2V84A 2Z22A 5H8NA 5CMBA 5KDTA 2F7CA 2G93A 4H5FA 4MLQA 3S9NC 1WODA 3LC8A 4GF8A 4FAJA 4R72A 4R2BA 2QL3A 1FQCA 1IXGA 1SDXA 3KZGA 1FTJA 4EUOA 2XHDA 4DE8A 2NOOA 2ZNSA 3OD7A 1MG1A 5DTBA 5TP9A 3W9WA 1DTGA 2Q8JA 5K2YA 4LQ2A 3MP1A 4FEBA 1MXXA 2OWSA 1LBCA 3W15C 1MH4A 3TEPA 5JK4A 4YKJA 3N6UA 3C36A 3H6UA 4RK2A 4H65A 3R7XA 1TWYA 2I6EA 1US4A 3B6WA 1SD3A 2R6GE 1OLAA 2AIXA 1LSTA 2F35A 4F3GA 4KCCA 1B4ZA 3M3LA 3QUJA 3GBBA 2O51A 3K2DA 3V5AA 1MXYA 2V3QA 1EH3A 1S50A 3MVYA 3K6UA 4ZEKA 1S7YA 3IAZA 3USDA 3SEVA 2V93A 4M4GA 3IOWA 4GRKA 4OFJA 3PMWA 1B6HA 1F9BA 1Y20A 5K2XA 5KCJA 1I6AA 2QMXA 2B3BA 1A8EA 3MC2A 2HEUA 2OLBA 1MDQA 2V25A 1IQ7A 2XD2A 2DXYA 1TFAA 4XKRA 3FVOA 2FYIA 3A3UA 1A54A 5HM4B 3TCFA 3C33A 4IGRA 1DOTA 5CM6A 5DEXB 2OBGA 4X1BA 2THIA 5AA2D 1RKMA 2UVJA 3T9VA 3B6TA 5IKBA 1B3EA 3T9UA 4BDRA 4F19A 4ZZAA 4AB6A 3EN3A 1B2HA 3IORA 2M8CA 1XOCA 4LZ7A 2DE3A 1SI0A 4IB2A 5DVIA 5ICQA 3HO7A 4R6HA 4H0WA 1P1QA 3FJMA 3A3CA 1P99A 3ONMA 1Y9UA 4R73A 5I84A 3OENA 4R6YA 3O2AA 4G77A 3N94A 5TPAA 5AA1A 1MPCA 2QS3A 2F6PA 3IJXB 1M5DA 3T9XB 2W7YA 5I58B 4BDNA 3QSLA 5F7VA 5M2VA 2I4BA 4H8JA 2Q2AA 1JW4A 4DZ1A 1AH5A 4JXIA 3W9VA 4X1DA 4H8IA 4U1ZA 3RPWA 4EF2A 2E1SA 1MQDA 1NH8A 3G3KA 2XX8A 5CBRA 2B4MA 3KSJA 4U22A 2QJEA 3EQ1A 2Z8EA 3IB0A 3U93A 3H06B 1B5IA 4IO5A 3JYRA 1A55A 2DWJA 1JVXA 3M3FA 2XD3A 3O6IA 1EU8A 4ELQA 4MLVA 3U94A 3E9XA 2R71A 4QSEA 5FHOA 2Y7RA 1SYHA 2KLFA 1N3XA 1B40A 3TFLA 3TTLA 4IO3A 3OXNA 2XXQA 4NF5B 3K00A 4I62A 4ZE9A 4YB5A 4F39A 4G4PA 3OMBA 1A8FA 3K4UA 3VLVA 1LFHA 3PD9A 3CFLA 4RK9A 3VVEA 1QKAA 2CZLA 4LA9A 3TODA 1QJMA 2ZYKA 3HV1A 4I9DA 5EYFA 2QS2A 1YTVA 4DLDA 1H45A 2I58A 3A09A 2UXAA 2VOZA 2E0SA 3CG1A 1QUKA 2O6AA 4PFTA 3DRKA 2XXXA 1LB8A 5AA2B 3F11A 1YAEA 1ATGA 3FXQA 3Q26A 1LGBC 5B7DA 1MDP1 3Q27A 1PC3A 3G3JA 3PUZE 1LCFA 4POXA 4KR5A 4X48A 1A7LA 3OEMA 4IO7A 4OEUA 2DWAA 5I57B 1M5BA 3K0VA 3Q29A 4KQPA 3OO6A 3SEYA 3G3FA 5L9OA 4F1UA 2DE2A 3EHUA 3QK6A 2HZLA 1SBPA 2V3TA 3P7IA 3BBRA 3VLWA 1DTZA 1ELJA 3OO9A 1LFGA 2A5TA 2DS9A 3HN0A 1XVYA 4QFKA 4ISUA 3CVGA 5DEXA 1JEUA 4NF6B 2ONRA 4O3AA 4OXVA 3IOUA 3MPLA 3TTKA 3FV1A 2XXWA 4F2OA 2O69A 4YZZA 3M8UA 2H4IA 1ZMGA 4K3FA 4JWXA 2OJTA 3IK6B 1L5TA 3G3IA 1FTMA 4QHQA 1US5A 4XXUA 2IA4A 4FECA 4Z7EA 4JDFA 4EQBA 5CI5A 3LR1A 1JW1A 2H99A 5ITPA 1LFIA 2GFEA 2ZYNA 2QMWA 1Y1MA 4FATA 1R1NA 3OO8A 3RYBA 4EQ7A 1JEVA 1OQGA 3FD3A 3HCQA 3RY3A 4KHZE 3CSGA 2Q9TA 3PD8A 3TCHA 1FQAA 4MF3A 2HFBA 2Y7IA 4ZEFA 1UTHA 3H6TA 4MH5A 3RQTA 1D4NA 3VFJA 5I58A 1Y4TA 1B3LA 3V89B 3HHGA 4Q0CA 3PPQA 4U4SA 4KI0E 1O63A 4OHNA 4OVJA 4Z0IA 4DXBA 2H9BA 1MQGA 4QFPA 1MXWA 2XX9A 3IB1A 2OCUA 3OOAA 3MW0A 3DRGA 3IB2A 1FQBA 3B7DA 1MQIA 2YJPA 3SEWA 2H98A 3PPOA 1FW0A 1I6BA 3PV0E 1B05A 4BDOA 1MQJA 5FHNA 1VSOA 1OQHA 3KJ7A 1MXUA 4Q5TA 4F2QA 2DOJA 2UVGA 1URDA 1MRPA 3VDFA 1LCTA 3D4CA 3ILUB 2Z8DA 3IL1B 3RNNA 3DP6A 4I1DA 1Y4CA 1SW1A 4L17A 1M5EA 3VE1B 1B52A 4LZ5A 3MZBA 3SEXA 4XKQA 1Q1KA 2ZYMA 3UK4A 3E13X 2O1LA 2GHAA 2I3VA 1PB9A 2NXOA 3EHTA 2Y84A 2XXUA 5CMMA 1ZKBA 2VD3A 3GXAA 4YKIA 3TAJA 4G68A 1ZTYA 3O66A 4NMYA 3IO6A 3G3HA 3ECRA 3H4ZA 3IO4A 4PFUA 3T22A 5L9SA 2XXVA 4GQOA 2DSFA 3FV2A 1FQEA 3C31A 3MVWA 3PAMA 1PB7A 3TPAA 3TTNA 2Y7KA 4QFOA 1Y3PA 1TXFA 5ELVA 1B7ZA 1MM6A 4H1XA 1UTBB 1WDNA 1B4HA 4ZE8A 3CHGA 5H8QB 1B5JA 4GL8A 1XHYA 3K01A 4OETA 3C35A 1LAGE 1B32A 4NEDA 2DE4A 3ILTB 5AA2A 3FTOA 1NMUA 2G29A 3CSBA 2NWJA 2F5XA 4LONB 2YLNA 4LZ8A 1ZU0A 1ZLQA 1P1NA 1OMPA 4C1UA 1B51A 5I57A 4DCYA 5KZTA 4JBZA 5CMKA 2ALUA 2CMOA 1TT1A 4JWOA 4IO2A 3DP8A 4YB7A 2B4LA 2DWIA 3DRFA 1J1NA 3CFZA 3U8QA 3IX1A 4U4XA 4OFLA 3EF7A 5B70A 1DPEA 4YU0A 4NF6A 2D21A 2HAVA 3S2VA 2OZZA 2D3IA 3DRJA 3DLNA 5F1QA 3THIA 1B3GA 4RY1A 5FTIA 1PEBA 1PBPA 3S9MC 2F7AA 1MXVA 3ZSFA 2ONKE 3WAEA 1XT8A 2UYEA 1QVSA 1B5HA 4HCWA 4R6KA 1USYE 1AOVA 1QUJA 2RCAA 3M3KA 4DDDA 2ZXTA 3RT8A 3KG2A 3SKPA 3OELA 3VXCA 1H76A 5EHSA 2R9JA 2Q88A 3QUFA 1H3DA 3EHSA 4GFRA 5I59B 3LBSA 3DRHA 3MVZA 2ANJA 4HCYA 4KCDA 4RNSA 4QSCA 3VXBA 2VHAA 1B0HA 1NNTA 4PFYA 4H5GA 1XVXA 2HZKA 1ZBMA 2NUVA 3TDJA 4H67A 3IOVA 1OIBA 1GTKA 2ZMBA 1R6ZA 3KEIA 2ZYOA 1RYOA 2RC7A 3TZAA 3Q25A 5IAIA 3T66A 4RPOA 3ODBA 2Y7WA 4LATA 2F97A 3O97A 2RF1A 4XIGQ 2AYSA 4G68C 4GL0A 4U2RA 5H8FB 2XXHA 1UQWA 4XTCQ 3JZJA 1LBBA 4P0GA 1M5CA 1B7UA 3PMVA 3FGSA 1OLCA 1GV8A 4JSDA 1KWHA 4F3PA 2PT2A 4O3CA 1FTKA 4GWOA 3MVXA 2O68A 3K6WA 1N3WA 4P11A 1FTLA 4ZEBA 2VP1A 2AL5A 3FJGA 3MQ9A 4QF9A 3V83A 3O29A 3QYTA 3N6TA 4R9FA 4F3BA 1YCJA 1MQHA 1UTBA 4OMBA 3PUVE 3N26A 3SETA 4ZS9A 3V8XB 5H8QA 4NWCA 2F8DA 4OFOA 4LP2B 4IO4A 1BLFA 4JWYA 3FVNA 2O7UA 4EXKA 4GIZA 5DVFA 1FTOA 2QS4A 1IXCA 2RC9A 3LVUA 2PYYA 1VE4A 3PPNA 5AA4B 4IO6A 1BIYA 3L6HA 1CB6A 1D9VA 4RYAA 2PBWA 3RTFB 3TELA 3KOSA 2ABHA 3O6HA 3I6VA 2XXTA 2RC8A 4G8NA 4Q30B 1WVJA 3KGCA 4QFNA 3QIMA 1Y3QA 4NF8B 4RA1A 2Q2CA 4U21A 4PP0A 2PMSA 4F3SA 4IGTA 5BWJA 4HS7A 3MBPA 1IZ1A 4TLMB 2F36A 1BTJA 3FXRA 2HQ0A 1MPBA 1LLSA 2AL4A 2DXRA 4R9GA 2D5WA 1BKAA 3VLUA 1H44A 1EZOA 3QAXA 4R2FA 1LAHE 1O64A 5JTYB 2O7IA 2DP8A 3H6VA 3OEKA 3C9HA 1SW2A 3MZ1A 4RJZA 1RYXA 3PU5A 2REJA 1H43A 4FORA 3EPEA 3LSXA 3R6UA 3RUMA 5HPQA 4OQOA 3KJTA 5FTHA 4X9TA 3KN3A 1D3KA 4EQ9A 5I59A 3CG3A 1JETA 4NE4A 3IOTA 3CI8A 1FCKA 4XKNA 2V3UA 4YAHX 3RTWB 4ELPA 3K1PA 5BUUA 2B65A 4WEDA 2UVHA 5HBCA 2QRYA 3LUYA 2O1MA 4KYDA 1B3FA 4H6DA 1GGGA 3ZKLA 5I2NB 3FVKA 4TQUQ 3TQLA 3PGFA 4ZDMA 3MWBA 1P1OA 4Q8RA 4M1VA 4PETA 1AL3A 4QFLA 1QKBA 1XS5A 5A5XB 1GVCA 4IY6A 5H8FA 2YPNA 1LAFE 4C0RA 3H7MA 4BDLA 4E0WA 3G3GA 2O84X 1QUIA 3C4MA 1URSA 4NF4B 2F34A 2DVZA 4UA8A 1CE2A 5AE4A 3ZS6A 1FQDA 2QSXA 3TKDA 1DMBA 3KOTA 2DVCA 3BKIB 1D9YA 4XKPA 1VFEA 1A40A 2Z23A 3JV9A 1POY1 1URGA 4AQ4A 4FIMA 4LVQA 3K6XA 4F22A 1NNKA 1IUDA 4PFWA 4NF5A 4EF1A 2WKYA 3DP4A 4DXCA 4OZ9A 1FQFA 3FASA 3O6GA 1B7HA 1GR2A 1POTA 4TOZA 1IITA 3TTRA 1Y1ZA 2LAOA 5H8SA 4GVOA 3DELB 1YPNA 1MPDA 2REGA 1R9QA 3CFXA 4FE8A 2XXRA 3T96B 4OTEA 3KN7A 1SVXB 3MJNA 5AA4A 1JQFA 3O6PA 4QRZA 3DM0A 5DVJA 3ZKKA 4KYSA 5I2KB 4F18A 4R74A 4N07A 5H8HB 2F7BA 2DYXA 1HSEA 2RCBA 1EZPA 4YICA 1N76A 4ELRA 3KN8A 4GXSB 2RKMA 1B3HA 4OERA 4E0XA 4NF8A 2X7QA 2FNCA 3B6QA 3L6GA 4YB6A 3D4GA 3UN6A 2ZNTA 4YKKA 3O9PA 3C32A 3PPRA 1Z7ME 2ONSA 4ESXA 3TTMA 5I56B 4WKMA 3FZVA 3OSQA 3CRBA 4OENA 1XC1A 3CIJA 2QPQA 1MY2A 4P0IA 2OK2A 3HSTA 3SEUA 5JTYA 2Z8FA 4BDMA 4UACA 1N04A 3MP8A 1IEJA 1UIUA 2XXPA 3G7WA 2B3FA 1DSNA 2I4CA 1DPPA 2A5TB 1EZ9A 4N13A 3BFTA 4MFIA 4WXJA 3TMGA 1MS7A 1ZJLA 1N84A 4LQ5A 4OEVA 3H3GA 4AB5A 2HAUA 2DQVA 2ESNA 1OVBA 3PUXE 5TU0A 1SYIA 3IJOB 4O3BA 1I6QA 2I0CA 3MUQA 5ISUA 3K02A 3HPIA 3PMXA 1UIVA 5I2NA 5FHMA 3CR9A 5CMCA 1SI1A 3C34A 2HCAA 3RN8A 2ZNUA 4R75A 5DT6A 3U1OA 4HW8A 1UTHB 3MAMA 2PT1A 3FATA 5A5XA 3WAFA 2WOKA 3I5OA 4PE5B 2A5SA 2OWTA 4DIGA 4OESA 4NF4A 3FJ7A 2I48A 3PPPA 1JNFA 3SERA 1Q35A 1B0LA 4KPTA 4ZEIA 4TLLB 3OO7A 4GLIA 4F31B 5CC2A 1AMFA 1T0KA 4EXLA 4KD5A 3VVDA 5H8NB 4F1YA 1O7TA 3RYAA 1IXHA 3LSWA 1B1HA 5KDTB 2PVUA 1NL5A 3MZ9A 2RINA 1QW0A 1IIWA 3IR1A 4ZECA 1NNPA 2WOLA 3SESA 1R9LA 3TYHA 4RXLA 4DCXA 4ZEDA 1USYH 2XXIA 5J1DA 5ITOA 3OSRA 4HTGA 2HXWA 4G8MA 4NTLA 2X7PA 3H6WA 1OVTA 3AXFA 4G68B 4BDQA 1LB9A 3UIFA 3N5LA 5I2KA 3U72A 2UYFA 4G8HA 5EHMA 5H8HA 3U92A 1MM7A 1ZIUA 5TP9B 3RT6B 2WOPA 3FUZA 2F78A 3UORA 1PDAA 1B9JA 1QULA 4GOTA 2VD2A 3TUSA 3Q28A 4BLAA 4POWA 3KFMA 5L8DA 2Y7PA 4ND9A 4KFQA 4RPNA 4F29A 2P0SA 3BFUA 1SW4A 2UVIA 2VGQA 4GD5A 1MY4A 4LUBA 5L9MA 3VVFA 1MY3A 2Q89A 1B1XA 2FA7A 3FIRA 3MP6A 1NKXA 4EDPA 2I49A 5LOMA 2I0BA 1Z7NE 1MY0A 5I56A 1II5A 1B58A 3VV5A 4OWDA 4IY5A 4C1TA 1PBQA 3R26A 4U1OA 3DRIA 3E4RA 2BJJX 2P1SA 3RLFE 3MPKA 2I3WA 3PUWE 3UA8A 2NVUB 4MBPA 3RGYA 1P1UA 5KCJB 1I69A 1NH7A 3KSXA 1TFDA 2XXYA 3GLBA 1IXIA 3K1MA 4THIA 4ELOA 4JB7A 1HSLA 3S9EA 3SDFA 1MY1A 2H5YA 5DYHA 4I8CA 3PUYE 1SQYA 3T93B 1A99A 3K1NA 2GH9A 1LAXA 1SW5A 2QS1A 3QXMA
chains in the Genus database with same CATH superfamily
4FEDA 2XX7A 5CRYA 5ICTA 1IMCA 4JSOA 2DWHA 4YMBA 3GBAA 3H03A 4PQJA 1BP5A 5IZ3B 2H25A 1N0TA 1N7XA 5CBSA 4NWDA 5AA3A 1G0HA 1MH3A 3KBRA 3TQWA 4DXUA 1P1WA 1RDYA 1KA0A 3S9LC 2XWKA 1NFTA 2F6GA 2IEEA 1PB8A 4OYVA 3K6VA 1IMBA 4WEPA 3E3KA 1M5FA 3T9HB 4ONYA 3GZGA 1FJ9A 1IMFA 3S4UA 4YMAA 3HHFA 4GXAA 2GRVA 4ESWA 5TPAB 1VFDA 4F1VA 1S9TA 1Y3NA 3I3VA 1B46A 1JVYA 1JW5A 4KYEA 1ANFA 1NUXA 4G2ZA 1HSJA 4ECFA 2GHBA 4U23A 1NNFA 2HHMA 3UGWA 4QSDA 2P2AA 1VR5A 4MX6A 3FXUA 4N6PA 1MXZA 3LSLA 4MEVA 3UP9A 4ZZEA 3FVGA 2PX1A 2X26A 1N7WA 5JEIA 4YKPA 1K9YA 1NV2A 1AIVA 3O28A 3LSFB 2CZHA 4FJPA 3TCGA 1EYJA 2V84A 2Z22A 5H8NA 5CMBA 4HE0A 5KDTA 2F7CA 3T0JA 2G93A 4H5FA 4MLQA 3S9NC 1WODA 4H46A 3LC8A 4GF8A 4FAJA 4R72A 4R2BA 2QL3A 1FRPA 4OA4A 1FQCA 1IXGA 1SDXA 3KZGA 5I7IA 2P3VA 1FTJA 3EKIA 4EUOA 2XHDA 4HE1A 4MIJA 1EYKA 4DE8A 2NOOA 2ZNSA 3OD7A 4OVQA 1MG1A 5DTBA 5TP9A 3W9WA 1DTGA 2Q8JA 5K2YA 4LQ2A 3MP1A 4FEBA 1MXXA 2VPNA 2OWSA 1LBCA 3W15C 1MH4A 4G61A 3TEPA 5JK4A 4YKJA 3N6UA 3C36A 4OANA 3H6UA 4RK2A 4H65A 3R7XA 1TWYA 2I6EA 1US4A 3B6WA 1SD3A 2R6GE 1OLAA 2AIXA 1LSTA 2F35A 1G0IA 1BK4A 4F3GA 4KCCA 1B4ZA 1FPJA 3M3LA 1FPBA 3QUJA 3GBBA 2O51A 3K2DA 3V5AA 1MXYA 2V3QA 1EH3A 1S50A 5IZZA 3MVYA 3K6UA 4ZEKA 1S7YA 3IAZA 3USDA 3SEVA 2V93A 4M4GA 3IOWA 4GRKA 4OFJA 3PMWA 1B6HA 4GWSA 1F9BA 1Y20A 5K2XA 5KCJA 4PDDA 1I6AA 2QMXA 2B3BA 1A8EA 3MC2A 2HEUA 2OLBA 1MDQA 2V25A 3RPLA 1IQ7A 2XD2A 2DXYA 1TFAA 4XKRA 3FVOA 2FYIA 2VT5A 3A3UA 3FBPA 2XWIA 1A54A 5HM4B 3TCFA 2FIXA 3C33A 4IGRA 1DOTA 5CM6A 4P8BA 5DEXB 2OBGA 4PTKA 4X1BA 2THIA 5AA2D 1RKMA 2UVJA 3T9VA 3B6TA 5IKBA 1B3EA 3T9UA 4BDRA 4F19A 4ZZAA 4AB6A 3EN3A 1KA1A 1FPIA 1B2HA 3IORA 2M8CA 1XOCA 4LZ7A 2DE3A 4MNIA 3IFAA 1IMAA 2PCRA 1SI0A 4IB2A 5DVIA 5ICQA 3HO7A 4R6HA 4H0WA 1P1QA 3FJMA 3A3CA 1P99A 2WBBA 3ONMA 1Y9UA 4R73A 4JVIA 5I84A 3OENA 4HXVA 4R6YA 4PAKA 3O2AA 4G77A 3N94A 5TPAA 5AA1A 1MPCA 2QS3A 2F6PA 3IJXB 1FBGA 1M5DA 3T9XB 2W7YA 5I58B 4BDNA 3QSLA 5F7VA 5M2VA 2I4BA 4H8JA 2Q2AA 1JW4A 4DZ1A 1AH5A 4JXIA 3W9VA 4X1DA 4H8IA 1FPKA 4U1ZA 3RPWA 4EF2A 2E1SA 1MQDA 1NH8A 3G3KA 2XX8A 5CBRA 2B4MA 3KSJA 4U22A 2QJEA 3EQ1A 2MKZA 2Z8EA 5EYHA 3IB0A 1YXIA 3NOHA 3U93A 3H06B 1B5IA 4IO5A 4PBQA 3JYRA 1A55A 1FSAA 2DWJA 1FBFA 1JVXA 3M3FA 2XD3A 4O7MA 3O6IA 1EU8A 4ELQA 4MLVA 3U94A 3E9XA 2WX9A 4GWWA 2R71A 4QSEA 1NV3A 5FHOA 4O7IA 2Y7RA 1SYHA 2KLFA 1NUWA 5ET6A 2F3BA 1N3XA 1B40A 3TFLA 3TTLA 4IO3A 3OXNA 2XXQA 4NF5B 3K00A 4I62A 4ZE9A 4YB5A 4F39A 4G4PA 4N17A 3OMBA 3IFCA 1A8FA 3K4UA 4GX3A 1FTAA 3VLVA 1LFHA 3PD9A 3CFLA 4RK9A 3VVEA 1QKAA 2CZLA 4LA9A 3TODA 1QJMA 2ZYKA 3HV1A 4I9DA 5EYFA 2QS2A 1YTVA 1YYZA 1RDXA 4DLDA 1H45A 2I58A 4UABA 3A09A 2UXAA 2VOZA 2E0SA 2WYPA 3CG1A 1QUKA 2O6AA 4PFTA 3DRKA 2XXXA 1LB8A 4O8MA 5AA2B 3F11A 1YAEA 2QVVA 1ATGA 3FXQA 3Q26A 4DI3D 1LGBC 5ET7A 5B7DA 1MDP1 3Q27A 1PC3A 3G3JA 3PUZE 1LCFA 4POXA 4KR5A 4X48A 1A7LA 3OEMA 4IO7A 4OEUA 2DWAA 5I57B 1M5BA 3K0VA 3Q29A 4KQPA 3OO6A 3SEYA 3G3FA 5L9OA 4F1UA 2DE2A 3EHUA 3QK6A 2HZLA 1SBPA 2V3TA 3P7IA 3BBRA 3VLWA 1DTZA 1IMDA 1ELJA 3OO9A 1LFGA 2A5TA 2DS9A 3HN0A 1XVYA 4QFKA 4ISUA 3CVGA 5DEXA 1JEUA 4NF6B 2ONRA 4O3AA 4OXVA 3IOUA 2Y5KA 3MPLA 2ZZWA 3GYYA 4PFRA 3TTKA 3FV1A 2XXWA 4F2OA 2O69A 4P1EA 4YZZA 2ZZVA 3M8UA 2WYKA 2H4IA 1ZMGA 4K3FA 4JWXA 2OJTA 3IK6B 1L5TA 3G3IA 1FTMA 4GWYA 4QHQA 1US5A 4XXUA 2XWOA 2IA4A 4FECA 4Z7EA 4JDFA 4EQBA 5CI5A 3LR1A 2QVRA 1JW1A 2WEFA 2H99A 5ITPA 1LFIA 2GFEA 2ZYNA 1LBWA 2QMWA 1Y1MA 4FATA 1R1NA 3OO8A 3RYBA 4EQ7A 1JEVA 1OQGA 3FD3A 3HCQA 3RY3A 4KHZE 3CSGA 2Q9TA 3PD8A 3TCHA 2L5VA 1FQAA 4MF3A 4NGUA 2HFBA 2Y7IA 4ZEFA 1UTHA 3H6TA 4MH5A 2ZZXA 3RQTA 1D4NA 3VFJA 5I58A 1Y4TA 1B3LA 3V89B 3HHGA 4Q0CA 3PPQA 4U4SA 4KI0E 1O63A 4OHNA 4OVJA 4PBHA 4Z0IA 4DXBA 2H9BA 1MQGA 4QFPA 1MXWA 2XX9A 3IB1A 2OCUA 5IM2A 3ISPA 3OOAA 3MW0A 3DRGA 3IB2A 1FQBA 4FBPA 3B7DA 4XEQA 1MQIA 2YJPA 3SEWA 2H98A 3PPOA 1FW0A 1I6BA 3PV0E 1B05A 4BDOA 1MQJA 5FHNA 1VSOA 1OQHA 3KJ7A 1MXUA 4Q5TA 4F2QA 2DOJA 2UVGA 1URDA 1MRPA 3VDFA 1LCTA 3D4CA 3ILUB 2Z8DA 3IL1B 3RNNA 3DP6A 4I1DA 1Y4CA 3E78A 1SW1A 4L17A 1M5EA 3VE1B 1B52A 4LZ5A 3MZBA 3SEXA 3KC0A 4XKQA 1Q1KA 2ZYMA 3UK4A 3E13X 2O1LA 2GHAA 4P56A 2I3VA 1PB9A 2NXOA 3EHTA 3BIHA 2Y84A 2XXUA 5CMMA 1ZKBA 2VD3A 3GXAA 4YKIA 3TAJA 4G68A 4N8YA 1ZTYA 3O66A 4NMYA 3IO6A 3G3HA 3ECRA 1FBPA 3H4ZA 3IO4A 4PFUA 3T22A 5L9SA 2XXVA 4GQOA 2DSFA 3FV2A 1FQEA 3C31A 3MVWA 3PAMA 1PB7A 3TPAA 3TTNA 2Y7KA 4QFOA 1Y3PA 1TXFA 5ELVA 1B7ZA 1MM6A 4H1XA 1UTBB 1WDNA 1B4HA 4ZE8A 3CHGA 5H8QB 1B5JA 1NUYA 4GL8A 1XHYA 3K01A 4OETA 3C35A 1LAGE 5J16A 1B32A 4NEDA 2DE4A 3ILTB 5AA2A 4I3EA 4OVTA 3FTOA 2CEYA 1NMUA 2G29A 1NI9A 3CSBA 2NWJA 2CZIA 2F5XA 4LONB 2YLNA 4LZ8A 1ZU0A 1ZLQA 5ESYA 1P1NA 1OMPA 4IR8A 4C1UA 1B51A 5I57A 4DCYA 5KZTA 4JBZA 5CMKA 2ALUA 2CMOA 1TT1A 4JWOA 4IO2A 3DP8A 1DBZA 4YB7A 2B4LA 2DWIA 3DRFA 1J1NA 3CFZA 3U8QA 3IX1A 4U4XA 4KXPA 4OFLA 4PAIA 3EF7A 5B70A 1DPEA 4YU0A 4NF6A 2CEXA 2D21A 2HAVA 3S2VA 2OZZA 2D3IA 3DRJA 3DLNA 5F1QA 3THIA 3PTYA 1B3GA 4RY1A 5FTIA 1PEBA 1PBPA 3S9MC 1NV6A 2F7AA 1MXVA 3ZSFA 2ONKE 3WAEA 4QBAA 1XT8A 2UYEA 3A29A 1QVSA 4I3YA 1B5HA 4HCWA 4R6KA 1DCUA 1USYE 1AOVA 2VPOA 1QUJA 2RCAA 3M3KA 2PFYA 4DDDA 4N91A 2ZXTA 3RT8A 3KG2A 3SKPA 5IZ3A 3OELA 3VXCA 1H76A 5EHSA 2R9JA 2Q88A 3QUFA 1H3DA 3EHSA 4GFRA 2HPGA 5I59B 3LBSA 3DRHA 3MVZA 2KR0A 2ANJA 4HCYA 4KCDA 2BJIA 4RNSA 4QSCA 3VXBA 2VHAA 1B0HA 1NNTA 4PFYA 4H5GA 1XVXA 2HZKA 1ZBMA 2NUVA 3TDJA 4H67A 3IOVA 1LBVA 1OIBA 1GTKA 2ZMBA 1R6ZA 3KEIA 2ZYOA 1RYOA 2RC7A 4PCDA 3TZAA 3Q25A 5IAIA 3T66A 5I3SA 4RPOA 3ODBA 2Y7WA 4LATA 2F97A 3O97A 2RF1A 1LBZA 4NQ8A 4XIGQ 2AYSA 4G68C 4GL0A 4U2RA 5H8FB 2XXHA 1UQWA 4XTCQ 5F24A 3JZJA 1LBBA 4P0GA 1M5CA 3U65A 1B7UA 3PMVA 3FGSA 1OLCA 1GV8A 4JSDA 1INPA 1KWHA 4F3PA 2PT2A 4O3CA 5LDZA 1FTKA 4P1LA 4GWOA 3MVXA 2O68A 3K6WA 2CZKA 1N3WA 4P11A 1FTLA 4ZEBA 2VP1A 4I40A 2AL5A 3FJGA 5IZ1A 3MQ9A 4QF9A 3V83A 3O29A 3QYTA 3N6TA 2HXRA 4R9FA 4F3BA 1YCJA 1MQHA 1UTBA 4OMBA 3PUVE 3N26A 3SETA 4ZS9A 3V8XB 5H8QA 4NWCA 2F8DA 3LV0A 4OFOA 4LP2B 4IO4A 1BLFA 4JWYA 3FVNA 2O7UA 4EXKA 4GIZA 4NG7A 5DVFA 1FTOA 2QS4A 1IXCA 2RC9A 3B50A 3LVUA 2PYYA 2Y5LA 4PE3A 5A5LA 1VE4A 3PPNA 5AA4B 4IO6A 2P3NA 3HFUA 2XWVA 1BIYA 5EQ7A 3L6HA 1CB6A 1D9VA 4RYAA 2PBWA 3RTFB 4JVDA 3KOSA 2ABHA 3O6HA 3TELA 3I6VA 2XXTA 2RC8A 4G8NA 1XI6A 4Q30B 1WVJA 3KGCA 4QFNA 3QIMA 1Y3QA 4NF8B 4RA1A 2Q2CA 4U21A 5DW8A 1RDZA 2PMSA 4PP0A 4F3SA 4LN5A 4IGTA 5BWJA 4HS7A 3MBPA 1IZ1A 4P3LA 4TLMB 2F36A 4N8GA 4XF5A 1BTJA 3FXRA 2HQ0A 1MPBA 1LLSA 2AL4A 2DXRA 4R9GA 2D5WA 1BKAA 3VLUA 4GWUA 1H44A 1NV4A 1EZOA 3QAXA 4R2FA 1LAHE 3MYUA 1D9QA 1O64A 2O7IA 5JTYB 2DP8A 3OEKA 1FPLA 3C9HA 3H6VA 4PFIA 1SW2A 3MZ1A 4RJZA 1RYXA 3PU5A 2REJA 2PFZA 1H43A 1JP4A 4FORA 4X04A 3EPEA 3LSXA 3R6UA 3RUMA 5HPQA 4OQOA 3KJTA 5FTHA 1FPEA 4X9TA 3KN3A 1D3KA 4EQ9A 5I59A 3CG3A 1JETA 4NE4A 3IOTA 2FHYA 2JJKA 3CI8A 4PGPA 1FCKA 3RYDA 4XKNA 2V3UA 4YAHX 3RTWB 4ELPA 3K1PA 5BUUA 2B65A 4WEDA 2UVHA 5HBCA 2QRYA 3LUYA 1AWBA 2O1MA 4KYDA 1B3FA 4H6DA 4GWXA 4MMPA 1GGGA 3ZKLA 2XXKA 5I2NB 3FVKA 4TQUQ 3TQLA 3PGFA 4ZDMA 3MWBA 1P1OA 4Q8RA 4M1VA 4PETA 1AL3A 4QFLA 1QKBA 1XS5A 5A5XB 1GVCA 4IY6A 5H8FA 2YPNA 1LAFE 4GWZA 4C0RA 3H7MA 4BDLA 4E0WA 2DDKA 3G3GA 2O84X 1QUIA 3C4MA 1URSA 4NF4B 2F34A 1FPDA 2DVZA 4UA8A 1CE2A 5AE4A 3ZS6A 1FQDA 2QSXA 3TKDA 1VDWA 1DMBA 4N15A 2V4CA 3KOTA 2DVCA 3BKIB 1D9YA 4XKPA 1VFEA 1A40A 2Z23A 3JV9A 1POY1 1URGA 4AQ4A 1FBEA 4FIMA 4LVQA 3K6XA 4F22A 1NNKA 1IUDA 4PFWA 3FXBA 4NF5A 4EF1A 2KQZA 2WKYA 3DP4A 4DXCA 4OZ9A 1FQFA 4JVCA 1LBXA 3FASA 3O6GA 1B7HA 1GR2A 1POTA 4TOZA 1IITA 1NV1A 3TTRA 4PF6A 2FVZA 1Y1ZA 2LAOA 5H8SA 4GVOA 3DELB 1YPNA 4GBWA 1MPDA 2REGA 1R9QA 4PAFA 4MCOA 3CFXA 4FE8A 2XXRA 3T96B 4OTEA 3KN7A 1SVXB 3MJNA 5AA4A 1JQFA 3O6PA 5T3JA 1Q9DA 1KZ8A 4QRZA 3DM0A 1CNQA 5DVJA 4KYSA 5I2KB 3ZKKA 4F18A 1IMEA 4R74A 4N07A 5H8HB 2F7BA 1QGXA 2DYXA 1HSEA 2RCBA 1EZPA 4YICA 4OVSA 1EYIA 1N76A 4ELRA 3KN8A 4GXSB 2RKMA 1B3HA 4OERA 4E0XA 4MNPA 4NF8A 2X7QA 2FNCA 3B6QA 3L6GA 4YB6A 4PDHA 3D4GA 3UN6A 2ZNTA 4YKKA 3O9PA 2FBPA 4O94A 1LEVA 3C32A 3PPRA 1Z7ME 2ONSA 4ESXA 3D1RA 4DI4B 2GQ1A 3TTMA 3E79A 5I56B 4WKMA 3FZVA 3OSQA 3CRBA 1NV0A 4OENA 1XC1A 3CIJA 4OVPA 2QPQA 1MY2A 4P0IA 3BIGA 2OK2A 3HSTA 3SEUA 5JTYA 2Z8FA 4BDMA 4UACA 1N04A 3MP8A 1IEJA 1UIUA 4AS5A 2XXPA 3G7WA 2B3FA 1DSNA 2I4CA 4MAGA 5IGAA 1DPPA 2A5TB 1FPGA 4HE2A 1EZ9A 4N13A 3BFTA 4P9KA 4MFIA 5EYGA 4WXJA 3TMGA 1MS7A 1ZJLA 1N84A 4LQ5A 4OEVA 5ET8A 3H3GA 4AB5A 3ROJA 4N6DA 2HAUA 2DQVA 2ESNA 1OVBA 3PUXE 5TU0A 1SYIA 3IJOB 4O3BA 4NN3A 1I6QA 2I0CA 4OVRA 3MUQA 1NV5A 4NHBA 5ISUA 3QMFA 3K02A 3HPIA 3PMXA 4GBVA 1UIVA 5I2NA 5FHMA 3CR9A 3LUZA 5CMCA 1SI1A 3C34A 2HCAA 3RN8A 1YZ0A 2ZNUA 1FPFA 4R75A 5DT6A 3U1OA 4HW8A 1UTHB 3MAMA 2PT1A 3FATA 5EQAA 5A5XA 3WAFA 4PGNA 2WOKA 3I5OA 4PE5B 1DK4A 2A5SA 4N81A 2OWTA 4DIGA 5EQ9A 4OESA 1NV7A 4NF4A 3FJ7A 2I48A 3PPPA 4N6KA 1JNFA 3SERA 1Q35A 1B0LA 4KPTA 3B8BA 4ZEIA 5ET5A 4TLLB 3OO7A 4GX4A 4GLIA 4F31B 5CC2A 4PFBA 1FBHA 4XFEA 1AMFA 2OX3A 1SPIA 4QXDA 1T0KA 4EXLA 1FBDA 2QVUA 4KD5A 3VVDA 4MJOA 4F1YA 5H8NB 3KC1A 1O7TA 4N4UA 2OWZA 3RYAA 1IXHA 3LSWA 1B1HA 5KDTB 2PVUA 1NUZA 1NL5A 2WBDA 4MNCA 3MZ9A 4PF8A 2RINA 1QW0A 1IIWA 3IR1A 4ZECA 1NNPA 2WOLA 3SESA 1R9LA 4X8RA 3TYHA 2Q74A 4RXLA 4DCXA 1K9ZA 4ZEDA 1USYH 2XA5A 2XXIA 5J1DA 3OSRA 4HTGA 5ITOA 2HXWA 4G8MA 3KBZA 4NTLA 2X7PA 3H6WA 5LTCA 1OVTA 3AXFA 4G68B 4BDQA 1LB9A 3UIFA 3N5LA 5I2KA 3U72A 2UYFA 4G8HA 2FIEA 5EHMA 5H8HA 3U92A 1MM7A 1ZIUA 4PC9A 5TP9B 3RT6B 2WOPA 3FUZA 2F78A 5EQ8A 4NX1A 3UORA 1PDAA 1B9JA 1QULA 3T1BA 4MHFA 4GOTA 2VD2A 3TUSA 5I5PA 3Q28A 4BLAA 4POWA 3KFMA 5L8DA 2Y7PA 4ND9A 4KFQA 2F3DA 4RPNA 4F29A 2P0SA 3BFUA 1FBCA 1SW4A 2UVIA 2VGQA 4GD5A 1MY4A 4LUBA 5L9MA 3VVFA 1MY3A 2Q89A 1B1XA 2FA7A 3FIRA 3MP6A 5FBPA 1FJ6A 1NKXA 4EDPA 2Q8MA 2I49A 1LBYA 5LOMA 2I0BA 1Z7NE 1MY0A 5I56A 1II5A 1B58A 3VV5A 4OWDA 4IY5A 4C1TA 1PBQA 3R26A 2R8TA 3SZPA 4U1OA 3DRIA 3E4RA 4AS4A 2BJJX 2P1SA 3RLFE 3MPKA 2I3WA 3PUWE 4GX6A 3UA8A 2NVUB 4MBPA 3RGYA 1P1UA 5KCJB 1I69A 1NH7A 3KSXA 4NF0A 2QFLA 1TFDA 2XXYA 3GLBA 3RPLB 1IXIA 3K1MA 4THIA 4ELOA 4JB7A 1HSLA 3S9EA 4NAPA 3SDFA 1MY1A 2H5YA 4H45A 5DYHA 4I8CA 3PUYE 1SQYA 3T93B 4P47A 1A99A 3K1NA 2GH9A 1LAXA 1SW5A 2QS1A 3QXMA 3MSTA
chains in the Genus database with same CATH topology
4FEDA 2XX7A 5CRYA 5ICTA 4JSOA 2DWHA 4YMBA 3GBAA 3H03A 4PQJA 1BP5A 2H25A 1N0TA 1N7XA 5CBSA 4NWDA 5AA3A 1MH3A 3KBRA 3TQWA 4DXUA 1P1WA 3S9LC 1NFTA 2F6GA 2IEEA 1PB8A 4OYVA 3K6VA 4WEPA 3E3KA 1M5FA 3T9HB 4ONYA 3GZGA 3S4UA 4YMAA 3HHFA 4GXAA 2GRVA 4ESWA 5TPAB 1VFDA 4F1VA 1S9TA 1Y3NA 3I3VA 1B46A 1JVYA 1JW5A 4KYEA 1ANFA 4G2ZA 1HSJA 4ECFA 2GHBA 4U23A 1NNFA 3UGWA 4QSDA 2P2AA 1VR5A 3FXUA 4N6PA 1MXZA 3LSLA 3UP9A 4ZZEA 3FVGA 2PX1A 2X26A 1N7WA 5JEIA 4YKPA 1AIVA 3O28A 3LSFB 4FJPA 3TCGA 2V84A 2Z22A 5H8NA 5CMBA 5KDTA 2F7CA 2G93A 4H5FA 4MLQA 3S9NC 1WODA 3LC8A 4GF8A 4FAJA 4R72A 4R2BA 2QL3A 1FQCA 1IXGA 1SDXA 3KZGA 1FTJA 4EUOA 2XHDA 4DE8A 2NOOA 2ZNSA 3OD7A 1MG1A 5DTBA 5TP9A 3W9WA 1DTGA 2Q8JA 5K2YA 4LQ2A 3MP1A 4FEBA 1MXXA 2OWSA 1LBCA 3W15C 1MH4A 3TEPA 5JK4A 4YKJA 3N6UA 3C36A 3H6UA 4RK2A 4H65A 3R7XA 1TWYA 2I6EA 1US4A 3B6WA 1SD3A 2R6GE 1OLAA 2AIXA 1LSTA 2F35A 4F3GA 4KCCA 1B4ZA 3M3LA 3QUJA 3GBBA 2O51A 3K2DA 3V5AA 1MXYA 2V3QA 1EH3A 1S50A 3MVYA 3K6UA 4ZEKA 1S7YA 3IAZA 3USDA 3SEVA 2V93A 4M4GA 3IOWA 4GRKA 4OFJA 3PMWA 1B6HA 1F9BA 1Y20A 5K2XA 5KCJA 1I6AA 2QMXA 2B3BA 1A8EA 3MC2A 2HEUA 2OLBA 1MDQA 2V25A 1IQ7A 2XD2A 2DXYA 1TFAA 4XKRA 3FVOA 2FYIA 3A3UA 1A54A 5HM4B 3TCFA 3C33A 4IGRA 1DOTA 5CM6A 5DEXB 2OBGA 4X1BA 2THIA 5AA2D 1RKMA 2UVJA 3T9VA 3B6TA 5IKBA 1B3EA 3T9UA 4BDRA 4F19A 4ZZAA 4AB6A 3EN3A 1B2HA 3IORA 2M8CA 1XOCA 4LZ7A 2DE3A 1SI0A 4IB2A 5DVIA 5ICQA 3HO7A 4R6HA 4H0WA 1P1QA 3FJMA 3A3CA 1P99A 3ONMA 1Y9UA 4R73A 5I84A 3OENA 4R6YA 3O2AA 4G77A 3N94A 5TPAA 5AA1A 1MPCA 2QS3A 2F6PA 3IJXB 1M5DA 3T9XB 2W7YA 5I58B 4BDNA 3QSLA 5F7VA 5M2VA 2I4BA 4H8JA 2Q2AA 1JW4A 4DZ1A 1AH5A 4JXIA 3W9VA 4X1DA 4H8IA 4U1ZA 3RPWA 4EF2A 2E1SA 1MQDA 1NH8A 3G3KA 2XX8A 5CBRA 2B4MA 3KSJA 4U22A 2QJEA 3EQ1A 2Z8EA 3IB0A 3U93A 3H06B 1B5IA 4IO5A 3JYRA 1A55A 2DWJA 1JVXA 3M3FA 2XD3A 3O6IA 1EU8A 4ELQA 4MLVA 3U94A 3E9XA 2R71A 4QSEA 5FHOA 2Y7RA 1SYHA 2KLFA 1N3XA 1B40A 3TFLA 3TTLA 4IO3A 3OXNA 2XXQA 4NF5B 3K00A 4I62A 4ZE9A 4YB5A 4F39A 4G4PA 3OMBA 1A8FA 3K4UA 3VLVA 1LFHA 3PD9A 3CFLA 4RK9A 3VVEA 1QKAA 2CZLA 4LA9A 3TODA 1QJMA 2ZYKA 3HV1A 4I9DA 5EYFA 2QS2A 1YTVA 4DLDA 1H45A 2I58A 3A09A 2UXAA 2VOZA 2E0SA 3CG1A 1QUKA 2O6AA 4PFTA 3DRKA 2XXXA 1LB8A 5AA2B 3F11A 1YAEA 1ATGA 3FXQA 3Q26A 1LGBC 5B7DA 1MDP1 3Q27A 1PC3A 3G3JA 3PUZE 1LCFA 4POXA 4KR5A 4X48A 1A7LA 3OEMA 4IO7A 4OEUA 2DWAA 5I57B 1M5BA 3K0VA 3Q29A 4KQPA 3OO6A 3SEYA 3G3FA 5L9OA 4F1UA 2DE2A 3EHUA 3QK6A 2HZLA 1SBPA 2V3TA 3P7IA 3BBRA 3VLWA 1DTZA 1ELJA 3OO9A 1LFGA 2A5TA 2DS9A 3HN0A 1XVYA 4QFKA 4ISUA 3CVGA 5DEXA 1JEUA 4NF6B 2ONRA 4O3AA 4OXVA 3IOUA 3MPLA 3TTKA 3FV1A 2XXWA 4F2OA 2O69A 4YZZA 3M8UA 2H4IA 1ZMGA 4K3FA 4JWXA 2OJTA 3IK6B 1L5TA 3G3IA 1FTMA 4QHQA 1US5A 4XXUA 2IA4A 4FECA 4Z7EA 4JDFA 4EQBA 5CI5A 3LR1A 1JW1A 2H99A 5ITPA 1LFIA 2GFEA 2ZYNA 2QMWA 1Y1MA 4FATA 1R1NA 3OO8A 3RYBA 4EQ7A 1JEVA 1OQGA 3FD3A 3HCQA 3RY3A 4KHZE 3CSGA 2Q9TA 3PD8A 3TCHA 1FQAA 4MF3A 2HFBA 2Y7IA 4ZEFA 1UTHA 3H6TA 4MH5A 3RQTA 1D4NA 3VFJA 5I58A 1Y4TA 1B3LA 3V89B 3HHGA 4Q0CA 3PPQA 4U4SA 4KI0E 1O63A 4OHNA 4OVJA 4Z0IA 4DXBA 2H9BA 1MQGA 4QFPA 1MXWA 2XX9A 3IB1A 2OCUA 3OOAA 3MW0A 3DRGA 3IB2A 1FQBA 3B7DA 1MQIA 2YJPA 3SEWA 2H98A 3PPOA 1FW0A 1I6BA 3PV0E 1B05A 4BDOA 1MQJA 5FHNA 1VSOA 1OQHA 3KJ7A 1MXUA 4Q5TA 4F2QA 2DOJA 2UVGA 1URDA 1MRPA 3VDFA 1LCTA 3D4CA 3ILUB 2Z8DA 3IL1B 3RNNA 3DP6A 4I1DA 1Y4CA 1SW1A 4L17A 1M5EA 3VE1B 1B52A 4LZ5A 3MZBA 3SEXA 4XKQA 1Q1KA 2ZYMA 3UK4A 3E13X 2O1LA 2GHAA 2I3VA 1PB9A 2NXOA 3EHTA 2Y84A 2XXUA 5CMMA 1ZKBA 2VD3A 3GXAA 4YKIA 3TAJA 4G68A 1ZTYA 3O66A 4NMYA 3IO6A 3G3HA 3ECRA 3H4ZA 3IO4A 4PFUA 3T22A 5L9SA 2XXVA 4GQOA 2DSFA 3FV2A 1FQEA 3C31A 3MVWA 3PAMA 1PB7A 3TPAA 3TTNA 2Y7KA 4QFOA 1Y3PA 1TXFA 5ELVA 1B7ZA 1MM6A 4H1XA 1UTBB 1WDNA 1B4HA 4ZE8A 3CHGA 5H8QB 1B5JA 4GL8A 1XHYA 3K01A 4OETA 3C35A 1LAGE 1B32A 4NEDA 2DE4A 3ILTB 5AA2A 3FTOA 1NMUA 2G29A 3CSBA 2NWJA 2F5XA 4LONB 2YLNA 4LZ8A 1ZU0A 1ZLQA 1P1NA 1OMPA 4C1UA 1B51A 5I57A 4DCYA 5KZTA 4JBZA 5CMKA 2ALUA 2CMOA 1TT1A 4JWOA 4IO2A 3DP8A 4YB7A 2B4LA 2DWIA 3DRFA 1J1NA 3CFZA 3U8QA 3IX1A 4U4XA 4OFLA 3EF7A 5B70A 1DPEA 4YU0A 4NF6A 2D21A 2HAVA 3S2VA 2OZZA 2D3IA 3DRJA 3DLNA 5F1QA 3THIA 1B3GA 4RY1A 5FTIA 1PEBA 1PBPA 3S9MC 2F7AA 1MXVA 3ZSFA 2ONKE 3WAEA 1XT8A 2UYEA 1QVSA 1B5HA 4HCWA 4R6KA 1USYE 1AOVA 1QUJA 2RCAA 3M3KA 4DDDA 2ZXTA 3RT8A 3KG2A 3SKPA 3OELA 3VXCA 1H76A 5EHSA 2R9JA 2Q88A 3QUFA 1H3DA 3EHSA 4GFRA 5I59B 3LBSA 3DRHA 3MVZA 2ANJA 4HCYA 4KCDA 4RNSA 4QSCA 3VXBA 2VHAA 1B0HA 1NNTA 4PFYA 4H5GA 1XVXA 2HZKA 1ZBMA 2NUVA 3TDJA 4H67A 3IOVA 1OIBA 1GTKA 2ZMBA 1R6ZA 3KEIA 2ZYOA 1RYOA 2RC7A 3TZAA 3Q25A 5IAIA 3T66A 4RPOA 3ODBA 2Y7WA 4LATA 2F97A 3O97A 2RF1A 4XIGQ 2AYSA 4G68C 4GL0A 4U2RA 5H8FB 2XXHA 1UQWA 4XTCQ 3JZJA 1LBBA 4P0GA 1M5CA 1B7UA 3PMVA 3FGSA 1OLCA 1GV8A 4JSDA 1KWHA 4F3PA 2PT2A 4O3CA 1FTKA 4GWOA 3MVXA 2O68A 3K6WA 1N3WA 4P11A 1FTLA 4ZEBA 2VP1A 2AL5A 3FJGA 3MQ9A 4QF9A 3V83A 3O29A 3QYTA 3N6TA 4R9FA 4F3BA 1YCJA 1MQHA 1UTBA 4OMBA 3PUVE 3N26A 3SETA 4ZS9A 3V8XB 5H8QA 4NWCA 2F8DA 4OFOA 4LP2B 4IO4A 1BLFA 4JWYA 3FVNA 2O7UA 4EXKA 4GIZA 5DVFA 1FTOA 2QS4A 1IXCA 2RC9A 3LVUA 2PYYA 1VE4A 3PPNA 5AA4B 4IO6A 1BIYA 3L6HA 1CB6A 1D9VA 4RYAA 2PBWA 3RTFB 3TELA 3KOSA 2ABHA 3O6HA 3I6VA 2XXTA 2RC8A 4G8NA 4Q30B 1WVJA 3KGCA 4QFNA 3QIMA 1Y3QA 4NF8B 4RA1A 2Q2CA 4U21A 4PP0A 2PMSA 4F3SA 4IGTA 5BWJA 4HS7A 3MBPA 1IZ1A 4TLMB 2F36A 1BTJA 3FXRA 2HQ0A 1MPBA 1LLSA 2AL4A 2DXRA 4R9GA 2D5WA 1BKAA 3VLUA 1H44A 1EZOA 3QAXA 4R2FA 1LAHE 1O64A 5JTYB 2O7IA 2DP8A 3H6VA 3OEKA 3C9HA 1SW2A 3MZ1A 4RJZA 1RYXA 3PU5A 2REJA 1H43A 4FORA 3EPEA 3LSXA 3R6UA 3RUMA 5HPQA 4OQOA 3KJTA 5FTHA 4X9TA 3KN3A 1D3KA 4EQ9A 5I59A 3CG3A 1JETA 4NE4A 3IOTA 3CI8A 1FCKA 4XKNA 2V3UA 4YAHX 3RTWB 4ELPA 3K1PA 5BUUA 2B65A 4WEDA 2UVHA 5HBCA 2QRYA 3LUYA 2O1MA 4KYDA 1B3FA 4H6DA 1GGGA 3ZKLA 5I2NB 3FVKA 4TQUQ 3TQLA 3PGFA 4ZDMA 3MWBA 1P1OA 4Q8RA 4M1VA 4PETA 1AL3A 4QFLA 1QKBA 1XS5A 5A5XB 1GVCA 4IY6A 5H8FA 2YPNA 1LAFE 4C0RA 3H7MA 4BDLA 4E0WA 3G3GA 2O84X 1QUIA 3C4MA 1URSA 4NF4B 2F34A 2DVZA 4UA8A 1CE2A 5AE4A 3ZS6A 1FQDA 2QSXA 3TKDA 1DMBA 3KOTA 2DVCA 3BKIB 1D9YA 4XKPA 1VFEA 1A40A 2Z23A 3JV9A 1POY1 1URGA 4AQ4A 4FIMA 4LVQA 3K6XA 4F22A 1NNKA 1IUDA 4PFWA 4NF5A 4EF1A 2WKYA 3DP4A 4DXCA 4OZ9A 1FQFA 3FASA 3O6GA 1B7HA 1GR2A 1POTA 4TOZA 1IITA 3TTRA 1Y1ZA 2LAOA 5H8SA 4GVOA 3DELB 1YPNA 1MPDA 2REGA 1R9QA 3CFXA 4FE8A 2XXRA 3T96B 4OTEA 3KN7A 1SVXB 3MJNA 5AA4A 1JQFA 3O6PA 4QRZA 3DM0A 5DVJA 3ZKKA 4KYSA 5I2KB 4F18A 4R74A 4N07A 5H8HB 2F7BA 2DYXA 1HSEA 2RCBA 1EZPA 4YICA 1N76A 4ELRA 3KN8A 4GXSB 2RKMA 1B3HA 4OERA 4E0XA 4NF8A 2X7QA 2FNCA 3B6QA 3L6GA 4YB6A 3D4GA 3UN6A 2ZNTA 4YKKA 3O9PA 3C32A 3PPRA 1Z7ME 2ONSA 4ESXA 3TTMA 5I56B 4WKMA 3FZVA 3OSQA 3CRBA 4OENA 1XC1A 3CIJA 2QPQA 1MY2A 4P0IA 2OK2A 3HSTA 3SEUA 5JTYA 2Z8FA 4BDMA 4UACA 1N04A 3MP8A 1IEJA 1UIUA 2XXPA 3G7WA 2B3FA 1DSNA 2I4CA 1DPPA 2A5TB 1EZ9A 4N13A 3BFTA 4MFIA 4WXJA 3TMGA 1MS7A 1ZJLA 1N84A 4LQ5A 4OEVA 3H3GA 4AB5A 2HAUA 2DQVA 2ESNA 1OVBA 3PUXE 5TU0A 1SYIA 3IJOB 4O3BA 1I6QA 2I0CA 3MUQA 5ISUA 3K02A 3HPIA 3PMXA 1UIVA 5I2NA 5FHMA 3CR9A 5CMCA 1SI1A 3C34A 2HCAA 3RN8A 2ZNUA 4R75A 5DT6A 3U1OA 4HW8A 1UTHB 3MAMA 2PT1A 3FATA 5A5XA 3WAFA 2WOKA 3I5OA 4PE5B 2A5SA 2OWTA 4DIGA 4OESA 4NF4A 3FJ7A 2I48A 3PPPA 1JNFA 3SERA 1Q35A 1B0LA 4KPTA 4ZEIA 4TLLB 3OO7A 4GLIA 4F31B 5CC2A 1AMFA 1T0KA 4EXLA 4KD5A 3VVDA 5H8NB 4F1YA 1O7TA 3RYAA 1IXHA 3LSWA 1B1HA 5KDTB 2PVUA 1NL5A 3MZ9A 2RINA 1QW0A 1IIWA 3IR1A 4ZECA 1NNPA 2WOLA 3SESA 1R9LA 3TYHA 4RXLA 4DCXA 4ZEDA 1USYH 2XXIA 5J1DA 5ITOA 3OSRA 4HTGA 2HXWA 4G8MA 4NTLA 2X7PA 3H6WA 1OVTA 3AXFA 4G68B 4BDQA 1LB9A 3UIFA 3N5LA 5I2KA 3U72A 2UYFA 4G8HA 5EHMA 5H8HA 3U92A 1MM7A 1ZIUA 5TP9B 3RT6B 2WOPA 3FUZA 2F78A 3UORA 1PDAA 1B9JA 1QULA 4GOTA 2VD2A 3TUSA 3Q28A 4BLAA 4POWA 3KFMA 5L8DA 2Y7PA 4ND9A 4KFQA 4RPNA 4F29A 2P0SA 3BFUA 1SW4A 2UVIA 2VGQA 4GD5A 1MY4A 4LUBA 5L9MA 3VVFA 1MY3A 2Q89A 1B1XA 2FA7A 3FIRA 3MP6A 1NKXA 4EDPA 2I49A 5LOMA 2I0BA 1Z7NE 1MY0A 5I56A 1II5A 1B58A 3VV5A 4OWDA 4IY5A 4C1TA 1PBQA 3R26A 4U1OA 3DRIA 3E4RA 2BJJX 2P1SA 3RLFE 3MPKA 2I3WA 3PUWE 3UA8A 2NVUB 4MBPA 3RGYA 1P1UA 5KCJB 1I69A 1NH7A 3KSXA 1TFDA 2XXYA 3GLBA 1IXIA 3K1MA 4THIA 4ELOA 4JB7A 1HSLA 3S9EA 3SDFA 1MY1A 2H5YA 5DYHA 4I8CA 3PUYE 1SQYA 3T93B 1A99A 3K1NA 2GH9A 1LAXA 1SW5A 2QS1A 3QXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FED A;  2XX7 A;  5CRY A;  5ICT A;  4JSO A;  2DWH A;  4YMB A;  3GBA A;  3H03 A;  4PQJ A;  1BP5 A;  2H25 A;  1N0T A;  1N7X A;  5CBS A;  4NWD A;  5AA3 A;  1MH3 A;  3KBR A;  3TQW A;  4DXU A;  1P1W A;  3S9L C;  1NFT A;  2F6G A;  2IEE A;  1PB8 A;  4OYV A;  3K6V A;  4WEP A;  3E3K A;  1M5F A;  3T9H B;  4ONY A;  3GZG A;  3S4U A;  4YMA A;  3HHF A;  4GXA A;  2GRV A;  4ESW A;  5TPA B;  1VFD A;  4F1V A;  1S9T A;  1Y3N A;  3I3V A;  1B46 A;  1JVY A;  1JW5 A;  4KYE A;  1ANF A;  4G2Z A;  1HSJ A;  4ECF A;  2GHB A;  4U23 A;  1NNF A;  3UGW A;  4QSD A;  2P2A A;  1VR5 A;  3FXU A;  4N6P A;  1MXZ A;  3LSL A;  3UP9 A;  4ZZE A;  3FVG A;  2PX1 A;  2X26 A;  1N7W A;  5JEI A;  4YKP A;  1AIV A;  3O28 A;  3LSF B;  4FJP A;  3TCG A;  2V84 A;  2Z22 A;  5H8N A;  5CMB A;  5KDT A;  2F7C A;  2G93 A;  4H5F A;  4MLQ A;  3S9N C;  1WOD A;  3LC8 A;  4GF8 A;  4FAJ A;  4R72 A;  4R2B A;  2QL3 A;  1FQC A;  1IXG A;  1SDX A;  3KZG A;  1FTJ A;  4EUO A;  2XHD A;  4DE8 A;  2NOO A;  2ZNS A;  3OD7 A;  1MG1 A;  5DTB A;  5TP9 A;  3W9W A;  1DTG A;  2Q8J A;  5K2Y A;  4LQ2 A;  3MP1 A;  4FEB A;  1MXX A;  2OWS A;  1LBC A;  3W15 C;  1MH4 A;  3TEP A;  5JK4 A;  4YKJ A;  3N6U A;  3C36 A;  3H6U A;  4RK2 A;  4H65 A;  3R7X A;  1TWY A;  2I6E A;  1US4 A;  3B6W A;  1SD3 A;  2R6G E;  1OLA A;  2AIX A;  1LST A;  2F35 A;  4F3G A;  4KCC A;  1B4Z A;  3M3L A;  3QUJ A;  3GBB A;  2O51 A;  3K2D A;  3V5A A;  1MXY A;  2V3Q A;  1EH3 A;  1S50 A;  3MVY A;  3K6U A;  4ZEK A;  1S7Y A;  3IAZ A;  3USD A;  3SEV A;  2V93 A;  4M4G A;  3IOW A;  4GRK A;  4OFJ A;  3PMW A;  1B6H A;  1F9B A;  1Y20 A;  5K2X A;  5KCJ A;  1I6A A;  2QMX A;  2B3B A;  1A8E A;  3MC2 A;  2HEU A;  2OLB A;  1MDQ A;  2V25 A;  1IQ7 A;  2XD2 A;  2DXY A;  1TFA A;  4XKR A;  3FVO A;  2FYI A;  3A3U A;  1A54 A;  5HM4 B;  3TCF A;  3C33 A;  4IGR A;  1DOT A;  5CM6 A;  5DEX B;  2OBG A;  4X1B A;  2THI A;  5AA2 D;  1RKM A;  2UVJ A;  3T9V A;  3B6T A;  5IKB A;  1B3E A;  3T9U A;  4BDR A;  4F19 A;  4ZZA A;  4AB6 A;  3EN3 A;  1B2H A;  3IOR A;  2M8C A;  1XOC A;  4LZ7 A;  2DE3 A;  1SI0 A;  4IB2 A;  5DVI A;  5ICQ A;  3HO7 A;  4R6H A;  4H0W A;  1P1Q A;  3FJM A;  3A3C A;  1P99 A;  3ONM A;  1Y9U A;  4R73 A;  5I84 A;  3OEN A;  4R6Y A;  3O2A A;  4G77 A;  3N94 A;  5TPA A;  5AA1 A;  1MPC A;  2QS3 A;  2F6P A;  3IJX B;  1M5D A;  3T9X B;  2W7Y A;  5I58 B;  4BDN A;  3QSL A;  5F7V A;  5M2V A;  2I4B A;  4H8J A;  2Q2A A;  1JW4 A;  4DZ1 A;  1AH5 A;  4JXI A;  3W9V A;  4X1D A;  4H8I A;  4U1Z A;  3RPW A;  4EF2 A;  2E1S A;  1MQD A;  1NH8 A;  3G3K A;  2XX8 A;  5CBR A;  2B4M A;  3KSJ A;  4U22 A;  2QJE A;  3EQ1 A;  2Z8E A;  3IB0 A;  3U93 A;  3H06 B;  1B5I A;  4IO5 A;  3JYR A;  1A55 A;  2DWJ A;  1JVX A;  3M3F A;  2XD3 A;  3O6I A;  1EU8 A;  4ELQ A;  4MLV A;  3U94 A;  3E9X A;  2R71 A;  4QSE A;  5FHO A;  2Y7R A;  1SYH A;  2KLF A;  1N3X A;  1B40 A;  3TFL A;  3TTL A;  4IO3 A;  3OXN A;  2XXQ A;  4NF5 B;  3K00 A;  4I62 A;  4ZE9 A;  4YB5 A;  4F39 A;  4G4P A;  3OMB A;  1A8F A;  3K4U A;  3VLV A;  1LFH A;  3PD9 A;  3CFL A;  4RK9 A;  3VVE A;  1QKA A;  2CZL A;  4LA9 A;  3TOD A;  1QJM A;  2ZYK A;  3HV1 A;  4I9D A;  5EYF A;  2QS2 A;  1YTV A;  4DLD A;  1H45 A;  2I58 A;  3A09 A;  2UXA A;  2VOZ A;  2E0S A;  3CG1 A;  1QUK A;  2O6A A;  4PFT A;  3DRK A;  2XXX A;  1LB8 A;  5AA2 B;  3F11 A;  1YAE A;  1ATG A;  3FXQ A;  3Q26 A;  1LGB C;  5B7D A;  1MDP 1;  3Q27 A;  1PC3 A;  3G3J A;  3PUZ E;  1LCF A;  4POX A;  4KR5 A;  4X48 A;  1A7L A;  3OEM A;  4IO7 A;  4OEU A;  2DWA A;  5I57 B;  1M5B A;  3K0V A;  3Q29 A;  4KQP A;  3OO6 A;  3SEY A;  3G3F A;  5L9O A;  4F1U A;  2DE2 A;  3EHU A;  3QK6 A;  2HZL A;  1SBP A;  2V3T A;  3P7I A;  3BBR A;  3VLW A;  1DTZ A;  1ELJ A;  3OO9 A;  1LFG A;  2A5T A;  2DS9 A;  3HN0 A;  1XVY A;  4QFK A;  4ISU A;  3CVG A;  5DEX A;  1JEU A;  4NF6 B;  2ONR A;  4O3A A;  4OXV A;  3IOU A;  3MPL A;  3TTK A;  3FV1 A;  2XXW A;  4F2O A;  2O69 A;  4YZZ A;  3M8U A;  2H4I A;  1ZMG A;  4K3F A;  4JWX A;  2OJT A;  3IK6 B;  1L5T A;  3G3I A;  1FTM A;  4QHQ A;  1US5 A;  4XXU A;  2IA4 A;  4FEC A;  4Z7E A;  4JDF A;  4EQB A;  5CI5 A;  3LR1 A;  1JW1 A;  2H99 A;  5ITP A;  1LFI A;  2GFE A;  2ZYN A;  2QMW A;  1Y1M A;  4FAT A;  1R1N A;  3OO8 A;  3RYB A;  4EQ7 A;  1JEV A;  1OQG A;  3FD3 A;  3HCQ A;  3RY3 A;  4KHZ E;  3CSG A;  2Q9T A;  3PD8 A;  3TCH A;  1FQA A;  4MF3 A;  2HFB A;  2Y7I A;  4ZEF A;  1UTH A;  3H6T A;  4MH5 A;  3RQT A;  1D4N A;  3VFJ A;  5I58 A;  1Y4T A;  1B3L A;  3V89 B;  3HHG A;  4Q0C A;  3PPQ A;  4U4S A;  4KI0 E;  1O63 A;  4OHN A;  4OVJ A;  4Z0I A;  4DXB A;  2H9B A;  1MQG A;  4QFP A;  1MXW A;  2XX9 A;  3IB1 A;  2OCU A;  3OOA A;  3MW0 A;  3DRG A;  3IB2 A;  1FQB A;  3B7D A;  1MQI A;  2YJP A;  3SEW A;  2H98 A;  3PPO A;  1FW0 A;  1I6B A;  3PV0 E;  1B05 A;  4BDO A;  1MQJ A;  5FHN A;  1VSO A;  1OQH A;  3KJ7 A;  1MXU A;  4Q5T A;  4F2Q A;  2DOJ A;  2UVG A;  1URD A;  1MRP A;  3VDF A;  1LCT A;  3D4C A;  3ILU B;  2Z8D A;  3IL1 B;  3RNN A;  3DP6 A;  4I1D A;  1Y4C A;  1SW1 A;  4L17 A;  1M5E A;  3VE1 B;  1B52 A;  4LZ5 A;  3MZB A;  3SEX A;  4XKQ A;  1Q1K A;  2ZYM A;  3UK4 A;  3E13 X;  2O1L A;  2GHA A;  2I3V A;  1PB9 A;  2NXO A;  3EHT A;  2Y84 A;  2XXU A;  5CMM A;  1ZKB A;  2VD3 A;  3GXA A;  4YKI A;  3TAJ A;  4G68 A;  1ZTY A;  3O66 A;  4NMY A;  3IO6 A;  3G3H A;  3ECR A;  3H4Z A;  3IO4 A;  4PFU A;  3T22 A;  5L9S A;  2XXV A;  4GQO A;  2DSF A;  3FV2 A;  1FQE A;  3C31 A;  3MVW A;  3PAM A;  1PB7 A;  3TPA A;  3TTN A;  2Y7K A;  4QFO A;  1Y3P A;  1TXF A;  5ELV A;  1B7Z A;  1MM6 A;  4H1X A;  1UTB B;  1WDN A;  1B4H A;  4ZE8 A;  3CHG A;  5H8Q B;  1B5J A;  4GL8 A;  1XHY A;  3K01 A;  4OET A;  3C35 A;  1LAG E;  1B32 A;  4NED A;  2DE4 A;  3ILT B;  5AA2 A;  3FTO A;  1NMU A;  2G29 A;  3CSB A;  2NWJ A;  2F5X A;  4LON B;  2YLN A;  4LZ8 A;  1ZU0 A;  1ZLQ A;  1P1N A;  1OMP A;  4C1U A;  1B51 A;  5I57 A;  4DCY A;  5KZT A;  4JBZ A;  5CMK A;  2ALU A;  2CMO A;  1TT1 A;  4JWO A;  4IO2 A;  3DP8 A;  4YB7 A;  2B4L A;  2DWI A;  3DRF A;  1J1N A;  3CFZ A;  3U8Q A;  3IX1 A;  4U4X A;  4OFL A;  3EF7 A;  5B70 A;  1DPE A;  4YU0 A;  4NF6 A;  2D21 A;  2HAV A;  3S2V A;  2OZZ A;  2D3I A;  3DRJ A;  3DLN A;  5F1Q A;  3THI A;  1B3G A;  4RY1 A;  5FTI A;  1PEB A;  1PBP A;  3S9M C;  2F7A A;  1MXV A;  3ZSF A;  2ONK E;  3WAE A;  1XT8 A;  2UYE A;  1QVS A;  1B5H A;  4HCW A;  4R6K A;  1USY E;  1AOV A;  1QUJ A;  2RCA A;  3M3K A;  4DDD A;  2ZXT A;  3RT8 A;  3KG2 A;  3SKP A;  3OEL A;  3VXC A;  1H76 A;  5EHS A;  2R9J A;  2Q88 A;  3QUF A;  1H3D A;  3EHS A;  4GFR A;  5I59 B;  3LBS A;  3DRH A;  3MVZ A;  2ANJ A;  4HCY A;  4KCD A;  4RNS A;  4QSC A;  3VXB A;  2VHA A;  1B0H A;  1NNT A;  4PFY A;  4H5G A;  1XVX A;  2HZK A;  1ZBM A;  2NUV A;  3TDJ A;  4H67 A;  3IOV A;  1OIB A;  1GTK A;  2ZMB A;  1R6Z A;  3KEI A;  2ZYO A;  1RYO A;  2RC7 A;  3TZA A;  3Q25 A;  5IAI A;  3T66 A;  4RPO A;  3ODB A;  2Y7W A;  4LAT A;  2F97 A;  3O97 A;  2RF1 A;  4XIG Q;  2AYS A;  4G68 C;  4GL0 A;  4U2R A;  5H8F B;  2XXH A;  1UQW A;  4XTC Q;  3JZJ A;  1LBB A;  4P0G A;  1M5C A;  1B7U A;  3PMV A;  3FGS A;  1OLC A;  1GV8 A;  4JSD A;  1KWH A;  4F3P A;  2PT2 A;  4O3C A;  1FTK A;  4GWO A;  3MVX A;  2O68 A;  3K6W A;  1N3W A;  4P11 A;  1FTL A;  4ZEB A;  2VP1 A;  2AL5 A;  3FJG A;  3MQ9 A;  4QF9 A;  3V83 A;  3O29 A;  3QYT A;  3N6T A;  4R9F A;  4F3B A;  1YCJ A;  1MQH A;  1UTB A;  4OMB A;  3PUV E;  3N26 A;  3SET A;  4ZS9 A;  3V8X B;  5H8Q A;  4NWC A;  2F8D A;  4OFO A;  4LP2 B;  4IO4 A;  1BLF A;  4JWY A;  3FVN A;  2O7U A;  4EXK A;  4GIZ A;  5DVF A;  1FTO A;  2QS4 A;  1IXC A;  2RC9 A;  3LVU A;  2PYY A;  1VE4 A;  3PPN A;  5AA4 B;  4IO6 A;  1BIY A;  3L6H A;  1CB6 A;  1D9V A;  4RYA A;  2PBW A;  3RTF B;  3TEL A;  3KOS A;  2ABH A;  3O6H A;  3I6V A;  2XXT A;  2RC8 A;  4G8N A;  4Q30 B;  1WVJ A;  3KGC A;  4QFN A;  3QIM A;  1Y3Q A;  4NF8 B;  4RA1 A;  2Q2C A;  4U21 A;  4PP0 A;  2PMS A;  4F3S A;  4IGT A;  5BWJ A;  4HS7 A;  3MBP A;  1IZ1 A;  4TLM B;  2F36 A;  1BTJ A;  3FXR A;  2HQ0 A;  1MPB A;  1LLS A;  2AL4 A;  2DXR A;  4R9G A;  2D5W A;  1BKA A;  3VLU A;  1H44 A;  1EZO A;  3QAX A;  4R2F A;  1LAH E;  1O64 A;  5JTY B;  2O7I A;  2DP8 A;  3H6V A;  3OEK A;  3C9H A;  1SW2 A;  3MZ1 A;  4RJZ A;  1RYX A;  3PU5 A;  2REJ A;  1H43 A;  4FOR A;  3EPE A;  3LSX A;  3R6U A;  3RUM A;  5HPQ A;  4OQO A;  3KJT A;  5FTH A;  4X9T A;  3KN3 A;  1D3K A;  4EQ9 A;  5I59 A;  3CG3 A;  1JET A;  4NE4 A;  3IOT A;  3CI8 A;  1FCK A;  4XKN A;  2V3U A;  4YAH X;  3RTW B;  4ELP A;  3K1P A;  5BUU A;  2B65 A;  4WED A;  2UVH A;  5HBC A;  2QRY A;  3LUY A;  2O1M A;  4KYD A;  1B3F A;  4H6D A;  1GGG A;  3ZKL A;  5I2N B;  3FVK A;  4TQU Q;  3TQL A;  3PGF A;  4ZDM A;  3MWB A;  1P1O A;  4Q8R A;  4M1V A;  4PET A;  1AL3 A;  4QFL A;  1QKB A;  1XS5 A;  5A5X B;  1GVC A;  4IY6 A;  5H8F A;  2YPN A;  1LAF E;  4C0R A;  3H7M A;  4BDL A;  4E0W A;  3G3G A;  2O84 X;  1QUI A;  3C4M A;  1URS A;  4NF4 B;  2F34 A;  2DVZ A;  4UA8 A;  1CE2 A;  5AE4 A;  3ZS6 A;  1FQD A;  2QSX A;  3TKD A;  1DMB A;  3KOT A;  2DVC A;  3BKI B;  1D9Y A;  4XKP A;  1VFE A;  1A40 A;  2Z23 A;  3JV9 A;  1POY 1;  1URG A;  4AQ4 A;  4FIM A;  4LVQ A;  3K6X A;  4F22 A;  1NNK A;  1IUD A;  4PFW A;  4NF5 A;  4EF1 A;  2WKY A;  3DP4 A;  4DXC A;  4OZ9 A;  1FQF A;  3FAS A;  3O6G A;  1B7H A;  1GR2 A;  1POT A;  4TOZ A;  1IIT A;  3TTR A;  1Y1Z A;  2LAO A;  5H8S A;  4GVO A;  3DEL B;  1YPN A;  1MPD A;  2REG A;  1R9Q A;  3CFX A;  4FE8 A;  2XXR A;  3T96 B;  4OTE A;  3KN7 A;  1SVX B;  3MJN A;  5AA4 A;  1JQF A;  3O6P A;  4QRZ A;  3DM0 A;  5DVJ A;  3ZKK A;  4KYS A;  5I2K B;  4F18 A;  4R74 A;  4N07 A;  5H8H B;  2F7B A;  2DYX A;  1HSE A;  2RCB A;  1EZP A;  4YIC A;  1N76 A;  4ELR A;  3KN8 A;  4GXS B;  2RKM A;  1B3H A;  4OER A;  4E0X A;  4NF8 A;  2X7Q A;  2FNC A;  3B6Q A;  3L6G A;  4YB6 A;  3D4G A;  3UN6 A;  2ZNT A;  4YKK A;  3O9P A;  3C32 A;  3PPR A;  1Z7M E;  2ONS A;  4ESX A;  3TTM A;  5I56 B;  4WKM A;  3FZV A;  3OSQ A;  3CRB A;  4OEN A;  1XC1 A;  3CIJ A;  2QPQ A;  1MY2 A;  4P0I A;  2OK2 A;  3HST A;  3SEU A;  5JTY A;  2Z8F A;  4BDM A;  4UAC A;  1N04 A;  3MP8 A;  1IEJ A;  1UIU A;  2XXP A;  3G7W A;  2B3F A;  1DSN A;  2I4C A;  1DPP A;  2A5T B;  1EZ9 A;  4N13 A;  3BFT A;  4MFI A;  4WXJ A;  3TMG A;  1MS7 A;  1ZJL A;  1N84 A;  4LQ5 A;  4OEV A;  3H3G A;  4AB5 A;  2HAU A;  2DQV A;  2ESN A;  1OVB A;  3PUX E;  5TU0 A;  1SYI A;  3IJO B;  4O3B A;  1I6Q A;  2I0C A;  3MUQ A;  5ISU A;  3K02 A;  3HPI A;  3PMX A;  1UIV A;  5I2N A;  5FHM A;  3CR9 A;  5CMC A;  1SI1 A;  3C34 A;  2HCA A;  3RN8 A;  2ZNU A;  4R75 A;  5DT6 A;  3U1O A;  4HW8 A;  1UTH B;  3MAM A;  2PT1 A;  3FAT A;  5A5X A;  3WAF A;  2WOK A;  3I5O A;  4PE5 B;  2A5S A;  2OWT A;  4DIG A;  4OES A;  4NF4 A;  3FJ7 A;  2I48 A;  3PPP A;  1JNF A;  3SER A;  1Q35 A;  1B0L A;  4KPT A;  4ZEI A;  4TLL B;  3OO7 A;  4GLI A;  4F31 B;  5CC2 A;  1AMF A;  1T0K A;  4EXL A;  4KD5 A;  3VVD A;  5H8N B;  4F1Y A;  1O7T A;  3RYA A;  1IXH A;  3LSW A;  1B1H A;  5KDT B;  2PVU A;  1NL5 A;  3MZ9 A;  2RIN A;  1QW0 A;  1IIW A;  3IR1 A;  4ZEC A;  1NNP A;  2WOL A;  3SES A;  1R9L A;  3TYH A;  4RXL A;  4DCX A;  4ZED A;  1USY H;  2XXI A;  5J1D A;  5ITO A;  3OSR A;  4HTG A;  2HXW A;  4G8M A;  4NTL A;  2X7P A;  3H6W A;  1OVT A;  3AXF A;  4G68 B;  4BDQ A;  1LB9 A;  3UIF A;  3N5L A;  5I2K A;  3U72 A;  2UYF A;  4G8H A;  5EHM A;  5H8H A;  3U92 A;  1MM7 A;  1ZIU A;  5TP9 B;  3RT6 B;  2WOP A;  3FUZ A;  2F78 A;  3UOR A;  1PDA A;  1B9J A;  1QUL A;  4GOT A;  2VD2 A;  3TUS A;  3Q28 A;  4BLA A;  4POW A;  3KFM A;  5L8D A;  2Y7P A;  4ND9 A;  4KFQ A;  4RPN A;  4F29 A;  2P0S A;  3BFU A;  1SW4 A;  2UVI A;  2VGQ A;  4GD5 A;  1MY4 A;  4LUB A;  5L9M A;  3VVF A;  1MY3 A;  2Q89 A;  1B1X A;  2FA7 A;  3FIR A;  3MP6 A;  1NKX A;  4EDP A;  2I49 A;  5LOM A;  2I0B A;  1Z7N E;  1MY0 A;  5I56 A;  1II5 A;  1B58 A;  3VV5 A;  4OWD A;  4IY5 A;  4C1T A;  1PBQ A;  3R26 A;  4U1O A;  3DRI A;  3E4R A;  2BJJ X;  2P1S A;  3RLF E;  3MPK A;  2I3W A;  3PUW E;  3UA8 A;  2NVU B;  4MBP A;  3RGY A;  1P1U A;  5KCJ B;  1I69 A;  1NH7 A;  3KSX A;  1TFD A;  2XXY A;  3GLB A;  1IXI A;  3K1M A;  4THI A;  4ELO A;  4JB7 A;  1HSL A;  3S9E A;  3SDF A;  1MY1 A;  2H5Y A;  5DYH A;  4I8C A;  3PUY E;  1SQY A;  3T93 B;  1A99 A;  3K1N A;  2GH9 A;  1LAX A;  1SW5 A;  2QS1 A;  3QXM A; 
#chains in the Genus database with same CATH topology
 4FED A;  2XX7 A;  5CRY A;  5ICT A;  1IMC A;  4JSO A;  2DWH A;  4YMB A;  3GBA A;  3H03 A;  4PQJ A;  1BP5 A;  5IZ3 B;  2H25 A;  1N0T A;  1N7X A;  5CBS A;  4NWD A;  5AA3 A;  1G0H A;  1MH3 A;  3KBR A;  3TQW A;  4DXU A;  1P1W A;  1RDY A;  1KA0 A;  3S9L C;  2XWK A;  1NFT A;  2F6G A;  2IEE A;  1PB8 A;  4OYV A;  3K6V A;  1IMB A;  4WEP A;  3E3K A;  1M5F A;  3T9H B;  4ONY A;  3GZG A;  1FJ9 A;  1IMF A;  3S4U A;  4YMA A;  3HHF A;  4GXA A;  2GRV A;  4ESW A;  5TPA B;  1VFD A;  4F1V A;  1S9T A;  1Y3N A;  3I3V A;  1B46 A;  1JVY A;  1JW5 A;  4KYE A;  1ANF A;  1NUX A;  4G2Z A;  1HSJ A;  4ECF A;  2GHB A;  4U23 A;  1NNF A;  2HHM A;  3UGW A;  4QSD A;  2P2A A;  1VR5 A;  4MX6 A;  3FXU A;  4N6P A;  1MXZ A;  3LSL A;  4MEV A;  3UP9 A;  4ZZE A;  3FVG A;  2PX1 A;  2X26 A;  1N7W A;  5JEI A;  4YKP A;  1K9Y A;  1NV2 A;  1AIV A;  3O28 A;  3LSF B;  2CZH A;  4FJP A;  3TCG A;  1EYJ A;  2V84 A;  2Z22 A;  5H8N A;  5CMB A;  4HE0 A;  5KDT A;  2F7C A;  3T0J A;  2G93 A;  4H5F A;  4MLQ A;  3S9N C;  1WOD A;  4H46 A;  3LC8 A;  4GF8 A;  4FAJ A;  4R72 A;  4R2B A;  2QL3 A;  1FRP A;  4OA4 A;  1FQC A;  1IXG A;  1SDX A;  3KZG A;  5I7I A;  2P3V A;  1FTJ A;  3EKI A;  4EUO A;  2XHD A;  4HE1 A;  4MIJ A;  1EYK A;  4DE8 A;  2NOO A;  2ZNS A;  3OD7 A;  4OVQ A;  1MG1 A;  5DTB A;  5TP9 A;  3W9W A;  1DTG A;  2Q8J A;  5K2Y A;  4LQ2 A;  3MP1 A;  4FEB A;  1MXX A;  2VPN A;  2OWS A;  1LBC A;  3W15 C;  1MH4 A;  4G61 A;  3TEP A;  5JK4 A;  4YKJ A;  3N6U A;  3C36 A;  4OAN A;  3H6U A;  4RK2 A;  4H65 A;  3R7X A;  1TWY A;  2I6E A;  1US4 A;  3B6W A;  1SD3 A;  2R6G E;  1OLA A;  2AIX A;  1LST A;  2F35 A;  1G0I A;  1BK4 A;  4F3G A;  4KCC A;  1B4Z A;  1FPJ A;  3M3L A;  1FPB A;  3QUJ A;  3GBB A;  2O51 A;  3K2D A;  3V5A A;  1MXY A;  2V3Q A;  1EH3 A;  1S50 A;  5IZZ A;  3MVY A;  3K6U A;  4ZEK A;  1S7Y A;  3IAZ A;  3USD A;  3SEV A;  2V93 A;  4M4G A;  3IOW A;  4GRK A;  4OFJ A;  3PMW A;  1B6H A;  4GWS A;  1F9B A;  1Y20 A;  5K2X A;  5KCJ A;  4PDD A;  1I6A A;  2QMX A;  2B3B A;  1A8E A;  3MC2 A;  2HEU A;  2OLB A;  1MDQ A;  2V25 A;  3RPL A;  1IQ7 A;  2XD2 A;  2DXY A;  1TFA A;  4XKR A;  3FVO A;  2FYI A;  2VT5 A;  3A3U A;  3FBP A;  2XWI A;  1A54 A;  5HM4 B;  3TCF A;  2FIX A;  3C33 A;  4IGR A;  1DOT A;  5CM6 A;  4P8B A;  5DEX B;  2OBG A;  4PTK A;  4X1B A;  2THI A;  5AA2 D;  1RKM A;  2UVJ A;  3T9V A;  3B6T A;  5IKB A;  1B3E A;  3T9U A;  4BDR A;  4F19 A;  4ZZA A;  4AB6 A;  3EN3 A;  1KA1 A;  1FPI A;  1B2H A;  3IOR A;  2M8C A;  1XOC A;  4LZ7 A;  2DE3 A;  4MNI A;  3IFA A;  1IMA A;  2PCR A;  1SI0 A;  4IB2 A;  5DVI A;  5ICQ A;  3HO7 A;  4R6H A;  4H0W A;  1P1Q A;  3FJM A;  3A3C A;  1P99 A;  2WBB A;  3ONM A;  1Y9U A;  4R73 A;  4JVI A;  5I84 A;  3OEN A;  4HXV A;  4R6Y A;  4PAK A;  3O2A A;  4G77 A;  3N94 A;  5TPA A;  5AA1 A;  1MPC A;  2QS3 A;  2F6P A;  3IJX B;  1FBG A;  1M5D A;  3T9X B;  2W7Y A;  5I58 B;  4BDN A;  3QSL A;  5F7V A;  5M2V A;  2I4B A;  4H8J A;  2Q2A A;  1JW4 A;  4DZ1 A;  1AH5 A;  4JXI A;  3W9V A;  4X1D A;  4H8I A;  1FPK A;  4U1Z A;  3RPW A;  4EF2 A;  2E1S A;  1MQD A;  1NH8 A;  3G3K A;  2XX8 A;  5CBR A;  2B4M A;  3KSJ A;  4U22 A;  2QJE A;  3EQ1 A;  2MKZ A;  2Z8E A;  5EYH A;  3IB0 A;  1YXI A;  3NOH A;  3U93 A;  3H06 B;  1B5I A;  4IO5 A;  4PBQ A;  3JYR A;  1A55 A;  1FSA A;  2DWJ A;  1FBF A;  1JVX A;  3M3F A;  2XD3 A;  4O7M A;  3O6I A;  1EU8 A;  4ELQ A;  4MLV A;  3U94 A;  3E9X A;  2WX9 A;  4GWW A;  2R71 A;  4QSE A;  1NV3 A;  5FHO A;  4O7I A;  2Y7R A;  1SYH A;  2KLF A;  1NUW A;  5ET6 A;  2F3B A;  1N3X A;  1B40 A;  3TFL A;  3TTL A;  4IO3 A;  3OXN A;  2XXQ A;  4NF5 B;  3K00 A;  4I62 A;  4ZE9 A;  4YB5 A;  4F39 A;  4G4P A;  4N17 A;  3OMB A;  3IFC A;  1A8F A;  3K4U A;  4GX3 A;  1FTA A;  3VLV A;  1LFH A;  3PD9 A;  3CFL A;  4RK9 A;  3VVE A;  1QKA A;  2CZL A;  4LA9 A;  3TOD A;  1QJM A;  2ZYK A;  3HV1 A;  4I9D A;  5EYF A;  2QS2 A;  1YTV A;  1YYZ A;  1RDX A;  4DLD A;  1H45 A;  2I58 A;  4UAB A;  3A09 A;  2UXA A;  2VOZ A;  2E0S A;  2WYP A;  3CG1 A;  1QUK A;  2O6A A;  4PFT A;  3DRK A;  2XXX A;  1LB8 A;  4O8M A;  5AA2 B;  3F11 A;  1YAE A;  2QVV A;  1ATG A;  3FXQ A;  3Q26 A;  4DI3 D;  1LGB C;  5ET7 A;  5B7D A;  1MDP 1;  3Q27 A;  1PC3 A;  3G3J A;  3PUZ E;  1LCF A;  4POX A;  4KR5 A;  4X48 A;  1A7L A;  3OEM A;  4IO7 A;  4OEU A;  2DWA A;  5I57 B;  1M5B A;  3K0V A;  3Q29 A;  4KQP A;  3OO6 A;  3SEY A;  3G3F A;  5L9O A;  4F1U A;  2DE2 A;  3EHU A;  3QK6 A;  2HZL A;  1SBP A;  2V3T A;  3P7I A;  3BBR A;  3VLW A;  1DTZ A;  1IMD A;  1ELJ A;  3OO9 A;  1LFG A;  2A5T A;  2DS9 A;  3HN0 A;  1XVY A;  4QFK A;  4ISU A;  3CVG A;  5DEX A;  1JEU A;  4NF6 B;  2ONR A;  4O3A A;  4OXV A;  3IOU A;  2Y5K A;  3MPL A;  2ZZW A;  3GYY A;  4PFR A;  3TTK A;  3FV1 A;  2XXW A;  4F2O A;  2O69 A;  4P1E A;  4YZZ A;  2ZZV A;  3M8U A;  2WYK A;  2H4I A;  1ZMG A;  4K3F A;  4JWX A;  2OJT A;  3IK6 B;  1L5T A;  3G3I A;  1FTM A;  4GWY A;  4QHQ A;  1US5 A;  4XXU A;  2XWO A;  2IA4 A;  4FEC A;  4Z7E A;  4JDF A;  4EQB A;  5CI5 A;  3LR1 A;  2QVR A;  1JW1 A;  2WEF A;  2H99 A;  5ITP A;  1LFI A;  2GFE A;  2ZYN A;  1LBW A;  2QMW A;  1Y1M A;  4FAT A;  1R1N A;  3OO8 A;  3RYB A;  4EQ7 A;  1JEV A;  1OQG A;  3FD3 A;  3HCQ A;  3RY3 A;  4KHZ E;  3CSG A;  2Q9T A;  3PD8 A;  3TCH A;  2L5V A;  1FQA A;  4MF3 A;  4NGU A;  2HFB A;  2Y7I A;  4ZEF A;  1UTH A;  3H6T A;  4MH5 A;  2ZZX A;  3RQT A;  1D4N A;  3VFJ A;  5I58 A;  1Y4T A;  1B3L A;  3V89 B;  3HHG A;  4Q0C A;  3PPQ A;  4U4S A;  4KI0 E;  1O63 A;  4OHN A;  4OVJ A;  4PBH A;  4Z0I A;  4DXB A;  2H9B A;  1MQG A;  4QFP A;  1MXW A;  2XX9 A;  3IB1 A;  2OCU A;  5IM2 A;  3ISP A;  3OOA A;  3MW0 A;  3DRG A;  3IB2 A;  1FQB A;  4FBP A;  3B7D A;  4XEQ A;  1MQI A;  2YJP A;  3SEW A;  2H98 A;  3PPO A;  1FW0 A;  1I6B A;  3PV0 E;  1B05 A;  4BDO A;  1MQJ A;  5FHN A;  1VSO A;  1OQH A;  3KJ7 A;  1MXU A;  4Q5T A;  4F2Q A;  2DOJ A;  2UVG A;  1URD A;  1MRP A;  3VDF A;  1LCT A;  3D4C A;  3ILU B;  2Z8D A;  3IL1 B;  3RNN A;  3DP6 A;  4I1D A;  1Y4C A;  3E78 A;  1SW1 A;  4L17 A;  1M5E A;  3VE1 B;  1B52 A;  4LZ5 A;  3MZB A;  3SEX A;  3KC0 A;  4XKQ A;  1Q1K A;  2ZYM A;  3UK4 A;  3E13 X;  2O1L A;  2GHA A;  4P56 A;  2I3V A;  1PB9 A;  2NXO A;  3EHT A;  3BIH A;  2Y84 A;  2XXU A;  5CMM A;  1ZKB A;  2VD3 A;  3GXA A;  4YKI A;  3TAJ A;  4G68 A;  4N8Y A;  1ZTY A;  3O66 A;  4NMY A;  3IO6 A;  3G3H A;  3ECR A;  1FBP A;  3H4Z A;  3IO4 A;  4PFU A;  3T22 A;  5L9S A;  2XXV A;  4GQO A;  2DSF A;  3FV2 A;  1FQE A;  3C31 A;  3MVW A;  3PAM A;  1PB7 A;  3TPA A;  3TTN A;  2Y7K A;  4QFO A;  1Y3P A;  1TXF A;  5ELV A;  1B7Z A;  1MM6 A;  4H1X A;  1UTB B;  1WDN A;  1B4H A;  4ZE8 A;  3CHG A;  5H8Q B;  1B5J A;  1NUY A;  4GL8 A;  1XHY A;  3K01 A;  4OET A;  3C35 A;  1LAG E;  5J16 A;  1B32 A;  4NED A;  2DE4 A;  3ILT B;  5AA2 A;  4I3E A;  4OVT A;  3FTO A;  2CEY A;  1NMU A;  2G29 A;  1NI9 A;  3CSB A;  2NWJ A;  2CZI A;  2F5X A;  4LON B;  2YLN A;  4LZ8 A;  1ZU0 A;  1ZLQ A;  5ESY A;  1P1N A;  1OMP A;  4IR8 A;  4C1U A;  1B51 A;  5I57 A;  4DCY A;  5KZT A;  4JBZ A;  5CMK A;  2ALU A;  2CMO A;  1TT1 A;  4JWO A;  4IO2 A;  3DP8 A;  1DBZ A;  4YB7 A;  2B4L A;  2DWI A;  3DRF A;  1J1N A;  3CFZ A;  3U8Q A;  3IX1 A;  4U4X A;  4KXP A;  4OFL A;  4PAI A;  3EF7 A;  5B70 A;  1DPE A;  4YU0 A;  4NF6 A;  2CEX A;  2D21 A;  2HAV A;  3S2V A;  2OZZ A;  2D3I A;  3DRJ A;  3DLN A;  5F1Q A;  3THI A;  3PTY A;  1B3G A;  4RY1 A;  5FTI A;  1PEB A;  1PBP A;  3S9M C;  1NV6 A;  2F7A A;  1MXV A;  3ZSF A;  2ONK E;  3WAE A;  4QBA A;  1XT8 A;  2UYE A;  3A29 A;  1QVS A;  4I3Y A;  1B5H A;  4HCW A;  4R6K A;  1DCU A;  1USY E;  1AOV A;  2VPO A;  1QUJ A;  2RCA A;  3M3K A;  2PFY A;  4DDD A;  4N91 A;  2ZXT A;  3RT8 A;  3KG2 A;  3SKP A;  5IZ3 A;  3OEL A;  3VXC A;  1H76 A;  5EHS A;  2R9J A;  2Q88 A;  3QUF A;  1H3D A;  3EHS A;  4GFR A;  2HPG A;  5I59 B;  3LBS A;  3DRH A;  3MVZ A;  2KR0 A;  2ANJ A;  4HCY A;  4KCD A;  2BJI A;  4RNS A;  4QSC A;  3VXB A;  2VHA A;  1B0H A;  1NNT A;  4PFY A;  4H5G A;  1XVX A;  2HZK A;  1ZBM A;  2NUV A;  3TDJ A;  4H67 A;  3IOV A;  1LBV A;  1OIB A;  1GTK A;  2ZMB A;  1R6Z A;  3KEI A;  2ZYO A;  1RYO A;  2RC7 A;  4PCD A;  3TZA A;  3Q25 A;  5IAI A;  3T66 A;  5I3S A;  4RPO A;  3ODB A;  2Y7W A;  4LAT A;  2F97 A;  3O97 A;  2RF1 A;  1LBZ A;  4NQ8 A;  4XIG Q;  2AYS A;  4G68 C;  4GL0 A;  4U2R A;  5H8F B;  2XXH A;  1UQW A;  4XTC Q;  5F24 A;  3JZJ A;  1LBB A;  4P0G A;  1M5C A;  3U65 A;  1B7U A;  3PMV A;  3FGS A;  1OLC A;  1GV8 A;  4JSD A;  1INP A;  1KWH A;  4F3P A;  2PT2 A;  4O3C A;  5LDZ A;  1FTK A;  4P1L A;  4GWO A;  3MVX A;  2O68 A;  3K6W A;  2CZK A;  1N3W A;  4P11 A;  1FTL A;  4ZEB A;  2VP1 A;  4I40 A;  2AL5 A;  3FJG A;  5IZ1 A;  3MQ9 A;  4QF9 A;  3V83 A;  3O29 A;  3QYT A;  3N6T A;  2HXR A;  4R9F A;  4F3B A;  1YCJ A;  1MQH A;  1UTB A;  4OMB A;  3PUV E;  3N26 A;  3SET A;  4ZS9 A;  3V8X B;  5H8Q A;  4NWC A;  2F8D A;  3LV0 A;  4OFO A;  4LP2 B;  4IO4 A;  1BLF A;  4JWY A;  3FVN A;  2O7U A;  4EXK A;  4GIZ A;  4NG7 A;  5DVF A;  1FTO A;  2QS4 A;  1IXC A;  2RC9 A;  3B50 A;  3LVU A;  2PYY A;  2Y5L A;  4PE3 A;  5A5L A;  1VE4 A;  3PPN A;  5AA4 B;  4IO6 A;  2P3N A;  3HFU A;  2XWV A;  1BIY A;  5EQ7 A;  3L6H A;  1CB6 A;  1D9V A;  4RYA A;  2PBW A;  3RTF B;  4JVD A;  3KOS A;  2ABH A;  3O6H A;  3TEL A;  3I6V A;  2XXT A;  2RC8 A;  4G8N A;  1XI6 A;  4Q30 B;  1WVJ A;  3KGC A;  4QFN A;  3QIM A;  1Y3Q A;  4NF8 B;  4RA1 A;  2Q2C A;  4U21 A;  5DW8 A;  1RDZ A;  2PMS A;  4PP0 A;  4F3S A;  4LN5 A;  4IGT A;  5BWJ A;  4HS7 A;  3MBP A;  1IZ1 A;  4P3L A;  4TLM B;  2F36 A;  4N8G A;  4XF5 A;  1BTJ A;  3FXR A;  2HQ0 A;  1MPB A;  1LLS A;  2AL4 A;  2DXR A;  4R9G A;  2D5W A;  1BKA A;  3VLU A;  4GWU A;  1H44 A;  1NV4 A;  1EZO A;  3QAX A;  4R2F A;  1LAH E;  3MYU A;  1D9Q A;  1O64 A;  2O7I A;  5JTY B;  2DP8 A;  3OEK A;  1FPL A;  3C9H A;  3H6V A;  4PFI A;  1SW2 A;  3MZ1 A;  4RJZ A;  1RYX A;  3PU5 A;  2REJ A;  2PFZ A;  1H43 A;  1JP4 A;  4FOR A;  4X04 A;  3EPE A;  3LSX A;  3R6U A;  3RUM A;  5HPQ A;  4OQO A;  3KJT A;  5FTH A;  1FPE A;  4X9T A;  3KN3 A;  1D3K A;  4EQ9 A;  5I59 A;  3CG3 A;  1JET A;  4NE4 A;  3IOT A;  2FHY A;  2JJK A;  3CI8 A;  4PGP A;  1FCK A;  3RYD A;  4XKN A;  2V3U A;  4YAH X;  3RTW B;  4ELP A;  3K1P A;  5BUU A;  2B65 A;  4WED A;  2UVH A;  5HBC A;  2QRY A;  3LUY A;  1AWB A;  2O1M A;  4KYD A;  1B3F A;  4H6D A;  4GWX A;  4MMP A;  1GGG A;  3ZKL A;  2XXK A;  5I2N B;  3FVK A;  4TQU Q;  3TQL A;  3PGF A;  4ZDM A;  3MWB A;  1P1O A;  4Q8R A;  4M1V A;  4PET A;  1AL3 A;  4QFL A;  1QKB A;  1XS5 A;  5A5X B;  1GVC A;  4IY6 A;  5H8F A;  2YPN A;  1LAF E;  4GWZ A;  4C0R A;  3H7M A;  4BDL A;  4E0W A;  2DDK A;  3G3G A;  2O84 X;  1QUI A;  3C4M A;  1URS A;  4NF4 B;  2F34 A;  1FPD A;  2DVZ A;  4UA8 A;  1CE2 A;  5AE4 A;  3ZS6 A;  1FQD A;  2QSX A;  3TKD A;  1VDW A;  1DMB A;  4N15 A;  2V4C A;  3KOT A;  2DVC A;  3BKI B;  1D9Y A;  4XKP A;  1VFE A;  1A40 A;  2Z23 A;  3JV9 A;  1POY 1;  1URG A;  4AQ4 A;  1FBE A;  4FIM A;  4LVQ A;  3K6X A;  4F22 A;  1NNK A;  1IUD A;  4PFW A;  3FXB A;  4NF5 A;  4EF1 A;  2KQZ A;  2WKY A;  3DP4 A;  4DXC A;  4OZ9 A;  1FQF A;  4JVC A;  1LBX A;  3FAS A;  3O6G A;  1B7H A;  1GR2 A;  1POT A;  4TOZ A;  1IIT A;  1NV1 A;  3TTR A;  4PF6 A;  2FVZ A;  1Y1Z A;  2LAO A;  5H8S A;  4GVO A;  3DEL B;  1YPN A;  4GBW A;  1MPD A;  2REG A;  1R9Q A;  4PAF A;  4MCO A;  3CFX A;  4FE8 A;  2XXR A;  3T96 B;  4OTE A;  3KN7 A;  1SVX B;  3MJN A;  5AA4 A;  1JQF A;  3O6P A;  5T3J A;  1Q9D A;  1KZ8 A;  4QRZ A;  3DM0 A;  1CNQ A;  5DVJ A;  4KYS A;  5I2K B;  3ZKK A;  4F18 A;  1IME A;  4R74 A;  4N07 A;  5H8H B;  2F7B A;  1QGX A;  2DYX A;  1HSE A;  2RCB A;  1EZP A;  4YIC A;  4OVS A;  1EYI A;  1N76 A;  4ELR A;  3KN8 A;  4GXS B;  2RKM A;  1B3H A;  4OER A;  4E0X A;  4MNP A;  4NF8 A;  2X7Q A;  2FNC A;  3B6Q A;  3L6G A;  4YB6 A;  4PDH A;  3D4G A;  3UN6 A;  2ZNT A;  4YKK A;  3O9P A;  2FBP A;  4O94 A;  1LEV A;  3C32 A;  3PPR A;  1Z7M E;  2ONS A;  4ESX A;  3D1R A;  4DI4 B;  2GQ1 A;  3TTM A;  3E79 A;  5I56 B;  4WKM A;  3FZV A;  3OSQ A;  3CRB A;  1NV0 A;  4OEN A;  1XC1 A;  3CIJ A;  4OVP A;  2QPQ A;  1MY2 A;  4P0I A;  3BIG A;  2OK2 A;  3HST A;  3SEU A;  5JTY A;  2Z8F A;  4BDM A;  4UAC A;  1N04 A;  3MP8 A;  1IEJ A;  1UIU A;  4AS5 A;  2XXP A;  3G7W A;  2B3F A;  1DSN A;  2I4C A;  4MAG A;  5IGA A;  1DPP A;  2A5T B;  1FPG A;  4HE2 A;  1EZ9 A;  4N13 A;  3BFT A;  4P9K A;  4MFI A;  5EYG A;  4WXJ A;  3TMG A;  1MS7 A;  1ZJL A;  1N84 A;  4LQ5 A;  4OEV A;  5ET8 A;  3H3G A;  4AB5 A;  3ROJ A;  4N6D A;  2HAU A;  2DQV A;  2ESN A;  1OVB A;  3PUX E;  5TU0 A;  1SYI A;  3IJO B;  4O3B A;  4NN3 A;  1I6Q A;  2I0C A;  4OVR A;  3MUQ A;  1NV5 A;  4NHB A;  5ISU A;  3QMF A;  3K02 A;  3HPI A;  3PMX A;  4GBV A;  1UIV A;  5I2N A;  5FHM A;  3CR9 A;  3LUZ A;  5CMC A;  1SI1 A;  3C34 A;  2HCA A;  3RN8 A;  1YZ0 A;  2ZNU A;  1FPF A;  4R75 A;  5DT6 A;  3U1O A;  4HW8 A;  1UTH B;  3MAM A;  2PT1 A;  3FAT A;  5EQA A;  5A5X A;  3WAF A;  4PGN A;  2WOK A;  3I5O A;  4PE5 B;  1DK4 A;  2A5S A;  4N81 A;  2OWT A;  4DIG A;  5EQ9 A;  4OES A;  1NV7 A;  4NF4 A;  3FJ7 A;  2I48 A;  3PPP A;  4N6K A;  1JNF A;  3SER A;  1Q35 A;  1B0L A;  4KPT A;  3B8B A;  4ZEI A;  5ET5 A;  4TLL B;  3OO7 A;  4GX4 A;  4GLI A;  4F31 B;  5CC2 A;  4PFB A;  1FBH A;  4XFE A;  1AMF A;  2OX3 A;  1SPI A;  4QXD A;  1T0K A;  4EXL A;  1FBD A;  2QVU A;  4KD5 A;  3VVD A;  4MJO A;  4F1Y A;  5H8N B;  3KC1 A;  1O7T A;  4N4U A;  2OWZ A;  3RYA A;  1IXH A;  3LSW A;  1B1H A;  5KDT B;  2PVU A;  1NUZ A;  1NL5 A;  2WBD A;  4MNC A;  3MZ9 A;  4PF8 A;  2RIN A;  1QW0 A;  1IIW A;  3IR1 A;  4ZEC A;  1NNP A;  2WOL A;  3SES A;  1R9L A;  4X8R A;  3TYH A;  2Q74 A;  4RXL A;  4DCX A;  1K9Z A;  4ZED A;  1USY H;  2XA5 A;  2XXI A;  5J1D A;  3OSR A;  4HTG A;  5ITO A;  2HXW A;  4G8M A;  3KBZ A;  4NTL A;  2X7P A;  3H6W A;  5LTC A;  1OVT A;  3AXF A;  4G68 B;  4BDQ A;  1LB9 A;  3UIF A;  3N5L A;  5I2K A;  3U72 A;  2UYF A;  4G8H A;  2FIE A;  5EHM A;  5H8H A;  3U92 A;  1MM7 A;  1ZIU A;  4PC9 A;  5TP9 B;  3RT6 B;  2WOP A;  3FUZ A;  2F78 A;  5EQ8 A;  4NX1 A;  3UOR A;  1PDA A;  1B9J A;  1QUL A;  3T1B A;  4MHF A;  4GOT A;  2VD2 A;  3TUS A;  5I5P A;  3Q28 A;  4BLA A;  4POW A;  3KFM A;  5L8D A;  2Y7P A;  4ND9 A;  4KFQ A;  2F3D A;  4RPN A;  4F29 A;  2P0S A;  3BFU A;  1FBC A;  1SW4 A;  2UVI A;  2VGQ A;  4GD5 A;  1MY4 A;  4LUB A;  5L9M A;  3VVF A;  1MY3 A;  2Q89 A;  1B1X A;  2FA7 A;  3FIR A;  3MP6 A;  5FBP A;  1FJ6 A;  1NKX A;  4EDP A;  2Q8M A;  2I49 A;  1LBY A;  5LOM A;  2I0B A;  1Z7N E;  1MY0 A;  5I56 A;  1II5 A;  1B58 A;  3VV5 A;  4OWD A;  4IY5 A;  4C1T A;  1PBQ A;  3R26 A;  2R8T A;  3SZP A;  4U1O A;  3DRI A;  3E4R A;  4AS4 A;  2BJJ X;  2P1S A;  3RLF E;  3MPK A;  2I3W A;  3PUW E;  4GX6 A;  3UA8 A;  2NVU B;  4MBP A;  3RGY A;  1P1U A;  5KCJ B;  1I69 A;  1NH7 A;  3KSX A;  4NF0 A;  2QFL A;  1TFD A;  2XXY A;  3GLB A;  3RPL B;  1IXI A;  3K1M A;  4THI A;  4ELO A;  4JB7 A;  1HSL A;  3S9E A;  4NAP A;  3SDF A;  1MY1 A;  2H5Y A;  4H45 A;  5DYH A;  4I8C A;  3PUY E;  1SQY A;  3T93 B;  4P47 A;  1A99 A;  3K1N A;  2GH9 A;  1LAX A;  1SW5 A;  2QS1 A;  3QXM A;  3MST A; 
#chains in the Genus database with same CATH homology
 4FED A;  2XX7 A;  5CRY A;  5ICT A;  4JSO A;  2DWH A;  4YMB A;  3GBA A;  3H03 A;  4PQJ A;  1BP5 A;  2H25 A;  1N0T A;  1N7X A;  5CBS A;  4NWD A;  5AA3 A;  1MH3 A;  3KBR A;  3TQW A;  4DXU A;  1P1W A;  3S9L C;  1NFT A;  2F6G A;  2IEE A;  1PB8 A;  4OYV A;  3K6V A;  4WEP A;  3E3K A;  1M5F A;  3T9H B;  4ONY A;  3GZG A;  3S4U A;  4YMA A;  3HHF A;  4GXA A;  2GRV A;  4ESW A;  5TPA B;  1VFD A;  4F1V A;  1S9T A;  1Y3N A;  3I3V A;  1B46 A;  1JVY A;  1JW5 A;  4KYE A;  1ANF A;  4G2Z A;  1HSJ A;  4ECF A;  2GHB A;  4U23 A;  1NNF A;  3UGW A;  4QSD A;  2P2A A;  1VR5 A;  3FXU A;  4N6P A;  1MXZ A;  3LSL A;  3UP9 A;  4ZZE A;  3FVG A;  2PX1 A;  2X26 A;  1N7W A;  5JEI A;  4YKP A;  1AIV A;  3O28 A;  3LSF B;  4FJP A;  3TCG A;  2V84 A;  2Z22 A;  5H8N A;  5CMB A;  5KDT A;  2F7C A;  2G93 A;  4H5F A;  4MLQ A;  3S9N C;  1WOD A;  3LC8 A;  4GF8 A;  4FAJ A;  4R72 A;  4R2B A;  2QL3 A;  1FQC A;  1IXG A;  1SDX A;  3KZG A;  1FTJ A;  4EUO A;  2XHD A;  4DE8 A;  2NOO A;  2ZNS A;  3OD7 A;  1MG1 A;  5DTB A;  5TP9 A;  3W9W A;  1DTG A;  2Q8J A;  5K2Y A;  4LQ2 A;  3MP1 A;  4FEB A;  1MXX A;  2OWS A;  1LBC A;  3W15 C;  1MH4 A;  3TEP A;  5JK4 A;  4YKJ A;  3N6U A;  3C36 A;  3H6U A;  4RK2 A;  4H65 A;  3R7X A;  1TWY A;  2I6E A;  1US4 A;  3B6W A;  1SD3 A;  2R6G E;  1OLA A;  2AIX A;  1LST A;  2F35 A;  4F3G A;  4KCC A;  1B4Z A;  3M3L A;  3QUJ A;  3GBB A;  2O51 A;  3K2D A;  3V5A A;  1MXY A;  2V3Q A;  1EH3 A;  1S50 A;  3MVY A;  3K6U A;  4ZEK A;  1S7Y A;  3IAZ A;  3USD A;  3SEV A;  2V93 A;  4M4G A;  3IOW A;  4GRK A;  4OFJ A;  3PMW A;  1B6H A;  1F9B A;  1Y20 A;  5K2X A;  5KCJ A;  1I6A A;  2QMX A;  2B3B A;  1A8E A;  3MC2 A;  2HEU A;  2OLB A;  1MDQ A;  2V25 A;  1IQ7 A;  2XD2 A;  2DXY A;  1TFA A;  4XKR A;  3FVO A;  2FYI A;  3A3U A;  1A54 A;  5HM4 B;  3TCF A;  3C33 A;  4IGR A;  1DOT A;  5CM6 A;  5DEX B;  2OBG A;  4X1B A;  2THI A;  5AA2 D;  1RKM A;  2UVJ A;  3T9V A;  3B6T A;  5IKB A;  1B3E A;  3T9U A;  4BDR A;  4F19 A;  4ZZA A;  4AB6 A;  3EN3 A;  1B2H A;  3IOR A;  2M8C A;  1XOC A;  4LZ7 A;  2DE3 A;  1SI0 A;  4IB2 A;  5DVI A;  5ICQ A;  3HO7 A;  4R6H A;  4H0W A;  1P1Q A;  3FJM A;  3A3C A;  1P99 A;  3ONM A;  1Y9U A;  4R73 A;  5I84 A;  3OEN A;  4R6Y A;  3O2A A;  4G77 A;  3N94 A;  5TPA A;  5AA1 A;  1MPC A;  2QS3 A;  2F6P A;  3IJX B;  1M5D A;  3T9X B;  2W7Y A;  5I58 B;  4BDN A;  3QSL A;  5F7V A;  5M2V A;  2I4B A;  4H8J A;  2Q2A A;  1JW4 A;  4DZ1 A;  1AH5 A;  4JXI A;  3W9V A;  4X1D A;  4H8I A;  4U1Z A;  3RPW A;  4EF2 A;  2E1S A;  1MQD A;  1NH8 A;  3G3K A;  2XX8 A;  5CBR A;  2B4M A;  3KSJ A;  4U22 A;  2QJE A;  3EQ1 A;  2Z8E A;  3IB0 A;  3U93 A;  3H06 B;  1B5I A;  4IO5 A;  3JYR A;  1A55 A;  2DWJ A;  1JVX A;  3M3F A;  2XD3 A;  3O6I A;  1EU8 A;  4ELQ A;  4MLV A;  3U94 A;  3E9X A;  2R71 A;  4QSE A;  5FHO A;  2Y7R A;  1SYH A;  2KLF A;  1N3X A;  1B40 A;  3TFL A;  3TTL A;  4IO3 A;  3OXN A;  2XXQ A;  4NF5 B;  3K00 A;  4I62 A;  4ZE9 A;  4YB5 A;  4F39 A;  4G4P A;  3OMB A;  1A8F A;  3K4U A;  3VLV A;  1LFH A;  3PD9 A;  3CFL A;  4RK9 A;  3VVE A;  1QKA A;  2CZL A;  4LA9 A;  3TOD A;  1QJM A;  2ZYK A;  3HV1 A;  4I9D A;  5EYF A;  2QS2 A;  1YTV A;  4DLD A;  1H45 A;  2I58 A;  3A09 A;  2UXA A;  2VOZ A;  2E0S A;  3CG1 A;  1QUK A;  2O6A A;  4PFT A;  3DRK A;  2XXX A;  1LB8 A;  5AA2 B;  3F11 A;  1YAE A;  1ATG A;  3FXQ A;  3Q26 A;  1LGB C;  5B7D A;  1MDP 1;  3Q27 A;  1PC3 A;  3G3J A;  3PUZ E;  1LCF A;  4POX A;  4KR5 A;  4X48 A;  1A7L A;  3OEM A;  4IO7 A;  4OEU A;  2DWA A;  5I57 B;  1M5B A;  3K0V A;  3Q29 A;  4KQP A;  3OO6 A;  3SEY A;  3G3F A;  5L9O A;  4F1U A;  2DE2 A;  3EHU A;  3QK6 A;  2HZL A;  1SBP A;  2V3T A;  3P7I A;  3BBR A;  3VLW A;  1DTZ A;  1ELJ A;  3OO9 A;  1LFG A;  2A5T A;  2DS9 A;  3HN0 A;  1XVY A;  4QFK A;  4ISU A;  3CVG A;  5DEX A;  1JEU A;  4NF6 B;  2ONR A;  4O3A A;  4OXV A;  3IOU A;  3MPL A;  3TTK A;  3FV1 A;  2XXW A;  4F2O A;  2O69 A;  4YZZ A;  3M8U A;  2H4I A;  1ZMG A;  4K3F A;  4JWX A;  2OJT A;  3IK6 B;  1L5T A;  3G3I A;  1FTM A;  4QHQ A;  1US5 A;  4XXU A;  2IA4 A;  4FEC A;  4Z7E A;  4JDF A;  4EQB A;  5CI5 A;  3LR1 A;  1JW1 A;  2H99 A;  5ITP A;  1LFI A;  2GFE A;  2ZYN A;  2QMW A;  1Y1M A;  4FAT A;  1R1N A;  3OO8 A;  3RYB A;  4EQ7 A;  1JEV A;  1OQG A;  3FD3 A;  3HCQ A;  3RY3 A;  4KHZ E;  3CSG A;  2Q9T A;  3PD8 A;  3TCH A;  1FQA A;  4MF3 A;  2HFB A;  2Y7I A;  4ZEF A;  1UTH A;  3H6T A;  4MH5 A;  3RQT A;  1D4N A;  3VFJ A;  5I58 A;  1Y4T A;  1B3L A;  3V89 B;  3HHG A;  4Q0C A;  3PPQ A;  4U4S A;  4KI0 E;  1O63 A;  4OHN A;  4OVJ A;  4Z0I A;  4DXB A;  2H9B A;  1MQG A;  4QFP A;  1MXW A;  2XX9 A;  3IB1 A;  2OCU A;  3OOA A;  3MW0 A;  3DRG A;  3IB2 A;  1FQB A;  3B7D A;  1MQI A;  2YJP A;  3SEW A;  2H98 A;  3PPO A;  1FW0 A;  1I6B A;  3PV0 E;  1B05 A;  4BDO A;  1MQJ A;  5FHN A;  1VSO A;  1OQH A;  3KJ7 A;  1MXU A;  4Q5T A;  4F2Q A;  2DOJ A;  2UVG A;  1URD A;  1MRP A;  3VDF A;  1LCT A;  3D4C A;  3ILU B;  2Z8D A;  3IL1 B;  3RNN A;  3DP6 A;  4I1D A;  1Y4C A;  1SW1 A;  4L17 A;  1M5E A;  3VE1 B;  1B52 A;  4LZ5 A;  3MZB A;  3SEX A;  4XKQ A;  1Q1K A;  2ZYM A;  3UK4 A;  3E13 X;  2O1L A;  2GHA A;  2I3V A;  1PB9 A;  2NXO A;  3EHT A;  2Y84 A;  2XXU A;  5CMM A;  1ZKB A;  2VD3 A;  3GXA A;  4YKI A;  3TAJ A;  4G68 A;  1ZTY A;  3O66 A;  4NMY A;  3IO6 A;  3G3H A;  3ECR A;  3H4Z A;  3IO4 A;  4PFU A;  3T22 A;  5L9S A;  2XXV A;  4GQO A;  2DSF A;  3FV2 A;  1FQE A;  3C31 A;  3MVW A;  3PAM A;  1PB7 A;  3TPA A;  3TTN A;  2Y7K A;  4QFO A;  1Y3P A;  1TXF A;  5ELV A;  1B7Z A;  1MM6 A;  4H1X A;  1UTB B;  1WDN A;  1B4H A;  4ZE8 A;  3CHG A;  5H8Q B;  1B5J A;  4GL8 A;  1XHY A;  3K01 A;  4OET A;  3C35 A;  1LAG E;  1B32 A;  4NED A;  2DE4 A;  3ILT B;  5AA2 A;  3FTO A;  1NMU A;  2G29 A;  3CSB A;  2NWJ A;  2F5X A;  4LON B;  2YLN A;  4LZ8 A;  1ZU0 A;  1ZLQ A;  1P1N A;  1OMP A;  4C1U A;  1B51 A;  5I57 A;  4DCY A;  5KZT A;  4JBZ A;  5CMK A;  2ALU A;  2CMO A;  1TT1 A;  4JWO A;  4IO2 A;  3DP8 A;  4YB7 A;  2B4L A;  2DWI A;  3DRF A;  1J1N A;  3CFZ A;  3U8Q A;  3IX1 A;  4U4X A;  4OFL A;  3EF7 A;  5B70 A;  1DPE A;  4YU0 A;  4NF6 A;  2D21 A;  2HAV A;  3S2V A;  2OZZ A;  2D3I A;  3DRJ A;  3DLN A;  5F1Q A;  3THI A;  1B3G A;  4RY1 A;  5FTI A;  1PEB A;  1PBP A;  3S9M C;  2F7A A;  1MXV A;  3ZSF A;  2ONK E;  3WAE A;  1XT8 A;  2UYE A;  1QVS A;  1B5H A;  4HCW A;  4R6K A;  1USY E;  1AOV A;  1QUJ A;  2RCA A;  3M3K A;  4DDD A;  2ZXT A;  3RT8 A;  3KG2 A;  3SKP A;  3OEL A;  3VXC A;  1H76 A;  5EHS A;  2R9J A;  2Q88 A;  3QUF A;  1H3D A;  3EHS A;  4GFR A;  5I59 B;  3LBS A;  3DRH A;  3MVZ A;  2ANJ A;  4HCY A;  4KCD A;  4RNS A;  4QSC A;  3VXB A;  2VHA A;  1B0H A;  1NNT A;  4PFY A;  4H5G A;  1XVX A;  2HZK A;  1ZBM A;  2NUV A;  3TDJ A;  4H67 A;  3IOV A;  1OIB A;  1GTK A;  2ZMB A;  1R6Z A;  3KEI A;  2ZYO A;  1RYO A;  2RC7 A;  3TZA A;  3Q25 A;  5IAI A;  3T66 A;  4RPO A;  3ODB A;  2Y7W A;  4LAT A;  2F97 A;  3O97 A;  2RF1 A;  4XIG Q;  2AYS A;  4G68 C;  4GL0 A;  4U2R A;  5H8F B;  2XXH A;  1UQW A;  4XTC Q;  3JZJ A;  1LBB A;  4P0G A;  1M5C A;  1B7U A;  3PMV A;  3FGS A;  1OLC A;  1GV8 A;  4JSD A;  1KWH A;  4F3P A;  2PT2 A;  4O3C A;  1FTK A;  4GWO A;  3MVX A;  2O68 A;  3K6W A;  1N3W A;  4P11 A;  1FTL A;  4ZEB A;  2VP1 A;  2AL5 A;  3FJG A;  3MQ9 A;  4QF9 A;  3V83 A;  3O29 A;  3QYT A;  3N6T A;  4R9F A;  4F3B A;  1YCJ A;  1MQH A;  1UTB A;  4OMB A;  3PUV E;  3N26 A;  3SET A;  4ZS9 A;  3V8X B;  5H8Q A;  4NWC A;  2F8D A;  4OFO A;  4LP2 B;  4IO4 A;  1BLF A;  4JWY A;  3FVN A;  2O7U A;  4EXK A;  4GIZ A;  5DVF A;  1FTO A;  2QS4 A;  1IXC A;  2RC9 A;  3LVU A;  2PYY A;  1VE4 A;  3PPN A;  5AA4 B;  4IO6 A;  1BIY A;  3L6H A;  1CB6 A;  1D9V A;  4RYA A;  2PBW A;  3RTF B;  3TEL A;  3KOS A;  2ABH A;  3O6H A;  3I6V A;  2XXT A;  2RC8 A;  4G8N A;  4Q30 B;  1WVJ A;  3KGC A;  4QFN A;  3QIM A;  1Y3Q A;  4NF8 B;  4RA1 A;  2Q2C A;  4U21 A;  4PP0 A;  2PMS A;  4F3S A;  4IGT A;  5BWJ A;  4HS7 A;  3MBP A;  1IZ1 A;  4TLM B;  2F36 A;  1BTJ A;  3FXR A;  2HQ0 A;  1MPB A;  1LLS A;  2AL4 A;  2DXR A;  4R9G A;  2D5W A;  1BKA A;  3VLU A;  1H44 A;  1EZO A;  3QAX A;  4R2F A;  1LAH E;  1O64 A;  5JTY B;  2O7I A;  2DP8 A;  3H6V A;  3OEK A;  3C9H A;  1SW2 A;  3MZ1 A;  4RJZ A;  1RYX A;  3PU5 A;  2REJ A;  1H43 A;  4FOR A;  3EPE A;  3LSX A;  3R6U A;  3RUM A;  5HPQ A;  4OQO A;  3KJT A;  5FTH A;  4X9T A;  3KN3 A;  1D3K A;  4EQ9 A;  5I59 A;  3CG3 A;  1JET A;  4NE4 A;  3IOT A;  3CI8 A;  1FCK A;  4XKN A;  2V3U A;  4YAH X;  3RTW B;  4ELP A;  3K1P A;  5BUU A;  2B65 A;  4WED A;  2UVH A;  5HBC A;  2QRY A;  3LUY A;  2O1M A;  4KYD A;  1B3F A;  4H6D A;  1GGG A;  3ZKL A;  5I2N B;  3FVK A;  4TQU Q;  3TQL A;  3PGF A;  4ZDM A;  3MWB A;  1P1O A;  4Q8R A;  4M1V A;  4PET A;  1AL3 A;  4QFL A;  1QKB A;  1XS5 A;  5A5X B;  1GVC A;  4IY6 A;  5H8F A;  2YPN A;  1LAF E;  4C0R A;  3H7M A;  4BDL A;  4E0W A;  3G3G A;  2O84 X;  1QUI A;  3C4M A;  1URS A;  4NF4 B;  2F34 A;  2DVZ A;  4UA8 A;  1CE2 A;  5AE4 A;  3ZS6 A;  1FQD A;  2QSX A;  3TKD A;  1DMB A;  3KOT A;  2DVC A;  3BKI B;  1D9Y A;  4XKP A;  1VFE A;  1A40 A;  2Z23 A;  3JV9 A;  1POY 1;  1URG A;  4AQ4 A;  4FIM A;  4LVQ A;  3K6X A;  4F22 A;  1NNK A;  1IUD A;  4PFW A;  4NF5 A;  4EF1 A;  2WKY A;  3DP4 A;  4DXC A;  4OZ9 A;  1FQF A;  3FAS A;  3O6G A;  1B7H A;  1GR2 A;  1POT A;  4TOZ A;  1IIT A;  3TTR A;  1Y1Z A;  2LAO A;  5H8S A;  4GVO A;  3DEL B;  1YPN A;  1MPD A;  2REG A;  1R9Q A;  3CFX A;  4FE8 A;  2XXR A;  3T96 B;  4OTE A;  3KN7 A;  1SVX B;  3MJN A;  5AA4 A;  1JQF A;  3O6P A;  4QRZ A;  3DM0 A;  5DVJ A;  3ZKK A;  4KYS A;  5I2K B;  4F18 A;  4R74 A;  4N07 A;  5H8H B;  2F7B A;  2DYX A;  1HSE A;  2RCB A;  1EZP A;  4YIC A;  1N76 A;  4ELR A;  3KN8 A;  4GXS B;  2RKM A;  1B3H A;  4OER A;  4E0X A;  4NF8 A;  2X7Q A;  2FNC A;  3B6Q A;  3L6G A;  4YB6 A;  3D4G A;  3UN6 A;  2ZNT A;  4YKK A;  3O9P A;  3C32 A;  3PPR A;  1Z7M E;  2ONS A;  4ESX A;  3TTM A;  5I56 B;  4WKM A;  3FZV A;  3OSQ A;  3CRB A;  4OEN A;  1XC1 A;  3CIJ A;  2QPQ A;  1MY2 A;  4P0I A;  2OK2 A;  3HST A;  3SEU A;  5JTY A;  2Z8F A;  4BDM A;  4UAC A;  1N04 A;  3MP8 A;  1IEJ A;  1UIU A;  2XXP A;  3G7W A;  2B3F A;  1DSN A;  2I4C A;  1DPP A;  2A5T B;  1EZ9 A;  4N13 A;  3BFT A;  4MFI A;  4WXJ A;  3TMG A;  1MS7 A;  1ZJL A;  1N84 A;  4LQ5 A;  4OEV A;  3H3G A;  4AB5 A;  2HAU A;  2DQV A;  2ESN A;  1OVB A;  3PUX E;  5TU0 A;  1SYI A;  3IJO B;  4O3B A;  1I6Q A;  2I0C A;  3MUQ A;  5ISU A;  3K02 A;  3HPI A;  3PMX A;  1UIV A;  5I2N A;  5FHM A;  3CR9 A;  5CMC A;  1SI1 A;  3C34 A;  2HCA A;  3RN8 A;  2ZNU A;  4R75 A;  5DT6 A;  3U1O A;  4HW8 A;  1UTH B;  3MAM A;  2PT1 A;  3FAT A;  5A5X A;  3WAF A;  2WOK A;  3I5O A;  4PE5 B;  2A5S A;  2OWT A;  4DIG A;  4OES A;  4NF4 A;  3FJ7 A;  2I48 A;  3PPP A;  1JNF A;  3SER A;  1Q35 A;  1B0L A;  4KPT A;  4ZEI A;  4TLL B;  3OO7 A;  4GLI A;  4F31 B;  5CC2 A;  1AMF A;  1T0K A;  4EXL A;  4KD5 A;  3VVD A;  5H8N B;  4F1Y A;  1O7T A;  3RYA A;  1IXH A;  3LSW A;  1B1H A;  5KDT B;  2PVU A;  1NL5 A;  3MZ9 A;  2RIN A;  1QW0 A;  1IIW A;  3IR1 A;  4ZEC A;  1NNP A;  2WOL A;  3SES A;  1R9L A;  3TYH A;  4RXL A;  4DCX A;  4ZED A;  1USY H;  2XXI A;  5J1D A;  5ITO A;  3OSR A;  4HTG A;  2HXW A;  4G8M A;  4NTL A;  2X7P A;  3H6W A;  1OVT A;  3AXF A;  4G68 B;  4BDQ A;  1LB9 A;  3UIF A;  3N5L A;  5I2K A;  3U72 A;  2UYF A;  4G8H A;  5EHM A;  5H8H A;  3U92 A;  1MM7 A;  1ZIU A;  5TP9 B;  3RT6 B;  2WOP A;  3FUZ A;  2F78 A;  3UOR A;  1PDA A;  1B9J A;  1QUL A;  4GOT A;  2VD2 A;  3TUS A;  3Q28 A;  4BLA A;  4POW A;  3KFM A;  5L8D A;  2Y7P A;  4ND9 A;  4KFQ A;  4RPN A;  4F29 A;  2P0S A;  3BFU A;  1SW4 A;  2UVI A;  2VGQ A;  4GD5 A;  1MY4 A;  4LUB A;  5L9M A;  3VVF A;  1MY3 A;  2Q89 A;  1B1X A;  2FA7 A;  3FIR A;  3MP6 A;  1NKX A;  4EDP A;  2I49 A;  5LOM A;  2I0B A;  1Z7N E;  1MY0 A;  5I56 A;  1II5 A;  1B58 A;  3VV5 A;  4OWD A;  4IY5 A;  4C1T A;  1PBQ A;  3R26 A;  4U1O A;  3DRI A;  3E4R A;  2BJJ X;  2P1S A;  3RLF E;  3MPK A;  2I3W A;  3PUW E;  3UA8 A;  2NVU B;  4MBP A;  3RGY A;  1P1U A;  5KCJ B;  1I69 A;  1NH7 A;  3KSX A;  1TFD A;  2XXY A;  3GLB A;  1IXI A;  3K1M A;  4THI A;  4ELO A;  4JB7 A;  1HSL A;  3S9E A;  3SDF A;  1MY1 A;  2H5Y A;  5DYH A;  4I8C A;  3PUY E;  1SQY A;  3T93 B;  1A99 A;  3K1N A;  2GH9 A;  1LAX A;  1SW5 A;  2QS1 A;  3QXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...