1B4ZA

Oligo-peptide binding protein (oppa) complexed with kdk
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
517
structure length
517
Chain Sequence
b'ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 187
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b4zA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b4zA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b4zA02
4RYAA 4FECA 4OHNA 4F1YA 1URSA 1OQHA 3FXRA 1ANFA 1VE4A 2PT2A 3EHUA 4M1VA 3U92A 4FAJA 2XXYA 2QS3A 1Q1KA 1OLCA 3R26A 3OO9A 3D4GA 3OO6A 1B1XA 1ZKBA 1TT1A 1HSLA 4GQOA 3KEIA 4ZDMA 3FVGA 1JVYA 2AL4A 3ILTB 5EYFA 3EQ1A 1PEBA 4BDNA 4NF6B 5H8NA 4F1VA 5HPQA 4QFKA 4ZECA 4RK2A 2XX8A 4Q5TA 1DPEA 2Y7WA 2ANJA 4JSDA 4R72A 4GL0A 4U1ZA 2Q2CA 3U93A 2P2AA 1H45A 3LC8A 4R2FA 2B4LA 4KFQA 2ZMBA 3A3UA 5KDTB 4KI0E 2XXVA 4ISUA 4DXUA 4KD5A 4UA8A 4H6DA 1M5CA 2Z23A 4RA1A 1MXVA 5A5XA 5CBSA 3JYRA 3K6VA 1P1OA 5AE4A 3VLVA 4DXBA 4EQ9A 1S9TA 3VDFA 3G7WA 2V25A 5TPAB 2UVGA 3U94A 3IORA 3OSRA 4LVQA 4KR5A 3SETA 3T96B 1HSEA 3GBAA 3BFUA 1Z7ME 3DP6A 3TTNA 2NWJA 3C36A 1A99A 5I58A 4RPNA 4OFJA 3O9PA 2Z8EA 1FQBA 3DLNA 1US5A 4JB7A 3CVGA 1DSNA 4U4SA 3T66A 2KLFA 4FE8A 1MM7A 3Q28A 2X7QA 3TAJA 4WXJA 2ZNUA 2D21A 4M4GA 3SEWA 4I1DA 1CE2A 4GLIA 4PETA 4F3GA 1B3HA 1PDAA 3RN8A 2FYIA 1MS7A 3MQ9A 1B7UA 4IO2A 1VFDA 2NXOA 3O6PA 4F19A 3T22A 1MQIA 3E3KA 1MQDA 5JTYB 4DLDA 2THIA 3B6QA 4PFUA 4ZZAA 1IUDA 1IEJA 3VFJA 4I9DA 3FZVA 2Q9TA 2D5WA 2UYFA 1LCTA 1IXIA 3R6UA 3KSXA 1MY1A 4P0GA 4F18A 2Q88A 4HCYA 2O1MA 3IOVA 3MPLA 1B0HA 4YAHX 3W15C 3MZBA 3VXBA 3RGYA 2DVZA 2OK2A 2OBGA 3IJOB 3PUVE 4RNSA 3VVDA 4Z7EA 3OEKA 3O6IA 4KQPA 4I62A 4OTEA 3C32A 3ZS6A 1L5TA 3CRBA 1UTHB 4YB6A 1R9LA 1A8EA 1MG1A 1LAXA 1I6QA 4RY1A 2M8CA 4ECFA 1A40A 3MAMA 2QPQA 5TPAA 4PFYA 2QJEA 1MY0A 2O69A 4HTGA 4LUBA 1SD3A 2QRYA 2PX1A 3PUXE 1IQ7A 4BDLA 1FTLA 2GFEA 1N04A 2DE4A 4EF1A 2F6GA 2ZYNA 3PPQA 4FEBA 1B3LA 1JNFA 2XXUA 2OJTA 3DRJA 3RYBA 3MC2A 3MZ1A 3QUFA 4X48A 5DEXB 3VE1B 4R2BA 2XXWA 4AB6A 1GV8A 1RYOA 3KG2A 1NNTA 5KCJB 4R9GA 4NF8A 1ZIUA 2PT1A 3SEYA 1ZTYA 3IB0A 2XXRA 3TKDA 4AB5A 3UORA 3K02A 1H44A 2CMOA 1LBBA 1WVJA 2RF1A 3K0VA 3HPIA 3SKPA 4BDOA 1O64A 2B65A 3QIMA 1J1NA 3OELA 2HXWA 2GRVA 1QULA 3FUZA 3IB2A 3DRIA 1GR2A 4H8JA 5JTYA 4LZ5A 1QUKA 3Q26A 4DCYA 5IAIA 3BBRA 2O1LA 1D4NA 2IEEA 3LSWA 4R6KA 5I59B 4F2QA 2B4MA 2V3TA 2DOJA 2ZYMA 1NKXA 3RTFB 4H5GA 4DXCA 3KN7A 2WKYA 3V5AA 3K4UA 2AL5A 2CZLA 5M2VA 4Z0IA 4C1TA 5AA2B 4OWDA 1SI1A 2Y7RA 4H5FA 1SYHA 1NFTA 5EHMA 1WDNA 4LA9A 2UVHA 3M3KA 1UTBB 1B32A 3CR9A 3FVKA 1NNPA 3DP8A 3IO6A 4NWDA 3RY3A 1P1QA 1Z7NE 2OLBA 1OMPA 3MP8A 4FATA 4POXA 1D3KA 3BFTA 3N6UA 2HAUA 4IY5A 1RYXA 2H9BA 3MBPA 3FJGA 2X26A 2UVIA 1TXFA 2ONKE 4GXSB 4FEDA 5I2NB 1QKAA 3KN8A 3TTKA 3OO8A 4WEPA 4THIA 1USYH 1Y1MA 4O3AA 2NVUB 3H6WA 5EHSA 1II5A 2VP1A 1EU8A 2DWJA 2H99A 3G3JA 3UP9A 5KCJA 4E0XA 3GXAA 3LSFB 2QL3A 1JQFA 1LSTA 5H8FB 1MH3A 4BDQA 2XX7A 1URGA 3PU5A 3O6HA 2Y7PA 3TCHA 1LFIA 5ICTA 3EPEA 3SESA 3KSJA 1N84A 3DP4A 3OEMA 4YB7A 5H8HB 4JBZA 2HAVA 3FV2A 2W7YA 3DRKA 5L9MA 2REGA 2NOOA 1B3FA 1SI0A 3MWBA 1BP5A 3TZAA 1GGGA 2Y7IA 3CI8A 3MVXA 2GH9A 2H5YA 3JZJA 4ZEIA 1P1WA 4OXVA 3C33A 3C4MA 5CMMA 3OO7A 2X7PA 2RCAA 2ONRA 5I2KB 4YZZA 3MVYA 1O7TA 4IO5A 1R9QA 3G3HA 4NF4A 4G4PA 1EZ9A 1MQHA 3A3CA 4YKPA 1HSJA 2I6EA 3TTLA 3H06B 1UIVA 3RNNA 3TELA 3KJ7A 1IXHA 4N07A 2RC7A 3TDJA 1M5FA 4NEDA 2OWSA 1UTBA 3UK4A 3TUSA 3EN3A 2ESNA 3RLFE 4QSDA 4EQBA 2BJJX 1JW1A 2IA4A 4QHQA 2QS4A 4WKMA 3FXQA 4F2OA 1QW0A 4F31B 3B6WA 4ONYA 1P99A 5H8QA 4QFNA 2WOLA 1TWYA 3D4CA 2RC9A 4XKNA 2DXYA 1SVXB 1Y20A 2QSXA 1I69A 1NL5A 1EZPA 4OZ9A 1N7XA 1Y3QA 2V84A 3W9WA 4XKQA 3ONMA 3I5OA 1YTVA 1Y9UA 1LFGA 2OCUA 1SW5A 4GIZA 1FQCA 3CSBA 3KZGA 4G68A 4G8MA 3FJMA 3L6HA 3QAXA 3UIFA 5AA2D 1SBPA 4NE4A 3PMVA 1R1NA 1PB9A 4PFTA 4OVJA 2F36A 1MDQA 2YPNA 3HN0A 3PPPA 4NF5B 3VXCA 3K6XA 3LVUA 5ITOA 5H8HA 3C31A 1PB7A 4RJZA 1P1UA 2DWIA 4EXLA 3O29A 1Y4CA 1MPBA 3K1MA 4H8IA 2DWHA 1XVXA 4G8HA 3O6GA 4L17A 3HSTA 2Z8FA 2D3IA 2OZZA 2I48A 3I6VA 2P1SA 5DTBA 3O2AA 3MZ9A 2HCAA 3IK6B 1PC3A 3RT6B 3LR1A 4EDPA 4TLMB 4MF3A 3Q29A 3TTRA 1JW5A 1O63A 4H0WA 2RKMA 3FVOA 2AYSA 5FHNA 4XTCQ 1LB9A 4NF6A 4H67A 3PPRA 5DVIA 4OERA 3AXFA 4ZE9A 3MJNA 5HBCA 4ELQA 2Q8JA 1OQGA 1OVBA 3VLWA 1GVCA 1M5EA 1M5DA 3PUWE 3FTOA 2HZKA 5FHOA 5KDTA 5ITPA 1KWHA 3IX1A 1DTZA 3TEPA 3QXMA 3OSQA 1ELJA 1LAFE 1OVTA 4Q30B 2I4BA 4MLQA 1VSOA 3MW0A 3A09A 2VD3A 1IIWA 3H4ZA 4GFRA 4OEUA 3PD9A 1FTKA 4G68C 3TQWA 1Y4TA 4ZS9A 1MRPA 3G3GA 2DE2A 3PD8A 1MXZA 2ZYOA 3UN6A 1B3GA 1USYE 3HHGA 5L8DA 3L6GA 5ICQA 1XS5A 4MH5A 1MXUA 3EHSA 1MXWA 3CIJA 3E13X 4RK9A 2VGQA 2I49A 1P1NA 5AA4B 1T0KA 1TFAA 1S7YA 4YKKA 5AA3A 5CI5A 2H25A 5I56B 4MBPA 1N3WA 2XXPA 1N3XA 5CMCA 3TTMA 2A5SA 4P0IA 5TP9B 5JK4A 4R75A 1ZMGA 1B58A 4GRKA 5I84A 4JWYA 4YKIA 1FTMA 1SYIA 4LQ2A 3KJTA 2OWTA 3B7DA 3RUMA 2F6PA 2Y7KA 1B3EA 3TQLA 1AMFA 4EUOA 2I0BA 3HCQA 1YCJA 1N7WA 4YB5A 1NNFA 1LFHA 3T9XB 2LAOA 3S9LC 4KPTA 1QJMA 2A5TB 4OFLA 1OLAA 2UVJA 3M8UA 2XD3A 5CRYA 5HM4B 3CFZA 2DP8A 3WAEA 3PPNA 4R6YA 3IOUA 1JEUA 4QF9A 1MY2A 3FJ7A 2XX9A 4U2RA 3K00A 2FNCA 4G2ZA 1MQJA 5B70A 2E1SA 2XHDA 2DS9A 3WAFA 4OEVA 2O68A 2Z8DA 3H6UA 3DRHA 1DTGA 2F35A 3SEXA 4F39A 1N0TA 1B6HA 4NMYA 5CM6A 2UXAA 3OOAA 3KBRA 1DPPA 1B5IA 4U4XA 4TQUQ 4ESXA 4YKJA 3PUYE 4IGTA 1UTHA 1FQEA 5ISUA 3PAMA 5H8NB 5DYHA 1FTJA 2I0CA 4AQ4A 3TFLA 4GD5A 4LZ7A 1B4HA 1B5JA 5L9SA 3GLBA 2O7IA 4PQJA 1ATGA 1I6AA 3Q27A 1Y3PA 1URDA 1XT8A 4ZEKA 1JVXA 2DQVA 1CB6A 3HV1A 3OXNA 3K6UA 4DIGA 1NH7A 1XOCA 4GWOA 1MQGA 5CMKA 1B05A 4R73A 4R9FA 4IO6A 3T9HB 5FTHA 3G3FA 3W9VA 1NNKA 5AA4A 1UIUA 5DEXA 5BWJA 3FXUA 2I3VA 1H3DA 2ZNSA 3H3GA 1MY3A 1B40A 1ZJLA 3EHTA 4G8NA 4LP2B 4QFPA 2O6AA 2V93A 3O66A 3VVEA 4H1XA 4PE5B 4U21A 2GHBA 1LBCA 2ZNTA 5H8SA 3FV1A 5F7VA 3H6TA 1MPDA 3FVNA 1XVYA 1NMUA 3K1NA 5I58B 5LOMA 1SQYA 1R6ZA 4GXAA 3C35A 4IO7A 1BTJA 5JEIA 1US4A 3S4UA 3OD7A 3T9UA 4ND9A 3FD3A 4MLVA 5I59A 1JETA 2DVCA 2F8DA 3ECRA 4N6PA 1FQDA 4ELOA 1FCKA 3SERA 5AA1A 3Q25A 3V89B 1POTA 1MXXA 1QKBA 2RC8A 2E0SA 2VD2A 4YMBA 2ONSA 5KZTA 2F7CA 1S50A 1A54A 3RQTA 1LAHE 1B1HA 4QSEA 2GHAA 3R7XA 1Y1ZA 4JSOA 2ZYKA 5AA2A 2FA7A 1F9BA 4GL8A 3CHGA 4KCDA 2O7UA 3G3IA 3MP6A 4DE8A 2V3UA 1B9JA 4RPOA 2YLNA 1B4ZA 3HHFA 5K2YA 1XHYA 4OETA 3S9EA 1B0LA 4YMAA 4DCXA 2XXTA 3QK6A 1PBPA 3K2DA 4P11A 3ZKKA 3G3KA 2WOKA 2G93A 3CG1A 5I2NA 3IOWA 4BDRA 3IL1B 4OQOA 1LCFA 3FASA 4KYEA 2AIXA 4IY6A 3H7MA 4OYVA 3DELB 3PUZE 4MFIA 2I58A 1B52A 4X9TA 4OFOA 1BLFA 1AH5A 3S9MC 3E4RA 4ZE8A 3M3LA 3ZKLA 1MDP1 2HEUA 4YU0A 4JWOA 5K2XA 3KFMA 4OENA 2PMSA 2I3WA 2ALUA 1ZU0A 2UYEA 1MM6A 5H8FA 1ZLQA 3F11A 4KYDA 4LZ8A 1RKMA 4LQ5A 3MPKA 1Q35A 4EXKA 1PBQA 2DE3A 4JWXA 1LAGE 2Q2AA 3QYTA 5F1QA 1AL3A 1N76A 3TMGA 4ELRA 3LUYA 3RPWA 2XXXA 5L9OA 4FJPA 4WEDA 2YJPA 3C9HA 3PGFA 4IGRA 4NF8B 4IB2A 1A7LA 4NWCA 2RCBA 4X1BA 3M3FA 4DZ1A 4RXLA 1IZ1A 5I2KA 2B3FA 4TOZA 3K6WA 3S9NC 2HZLA 2F7BA 2XXIA 2WOPA 4BLAA 2ZXTA 1FTOA 3KOSA 1D9YA 3ZSFA 3EF7A 3O28A 1EZOA 3KGCA 1JEVA 2I4CA 3LSLA 3ILUB 1AOVA 3O97A 3B6TA 2HQ0A 4R6HA 3TCFA 4N13A 1LGBC 1MPCA 3PPOA 4DDDA 5DVFA 5IKBA 2P0SA 1Y3NA 3U8QA 3OMBA 5ELVA 1SW1A 4GVOA 2F34A 3E9XA 2DSFA 3MVWA 1VFEA 3MVZA 1LLSA 2DWAA 4PFWA 4XKPA 1SW4A 3PMXA 4XKRA 4YICA 4ELPA 4K3FA 3N6TA 2VHAA 4QRZA 3CFXA 3N5LA 1B5HA 3IOTA 3FATA 3IJXB 5I57B 3UA8A 2RINA 4NTLA 4Q8RA 5CMBA 4ESWA 5CBRA 3RYAA 1B46A 3TCGA 2DYXA 4F3BA 1MH4A 3RTWB 3T9VA 1JW4A 4H65A 4U22A 2H4IA 2B3BA 3V83A 3OENA 2QMXA 3H6VA 4GF8A 3C34A 5CC2A 1B2HA 3K1PA 4JDFA 4OMBA 4BDMA 4G77A 3LSXA 1ZBMA 4NF5A 3I3VA 4EF2A 5B7DA 2F7AA 1QUJA 4Q0CA 4POWA 1SW2A 4O3CA 4C0RA 3FIRA 1A55A 3PMWA 1QVSA 1B51A 1B7ZA 5FTIA 5FHMA 4ZEBA 3TYHA 3ODBA 1DMBA 2ABHA 2REJA 1D9VA 1XC1A 3VV5A 4ZEDA 4HW8A 1IITA 1MY4A 1POY1 5DVJA 4PP0A 1AIVA 2F5XA 3RT8A 4I8CA 3TPAA 2H98A 4ZZEA 3N26A 1FQAA 1H76A 2XXHA 3U1OA 4QFLA 2F97A 2XD2A 3KOTA 4KCCA 3TODA 4U23A 2G29A 1M5BA 4HCWA 3K01A 4QSCA 3VVFA 4IO4A 2XXQA 4KHZE 4E0WA 1MXYA 3T93B 2R71A 2O51A 4JXIA 3USDA 5J1DA 3SEUA 3FGSA 4NF4B 2QS1A 1FW0A 3QUJA 1B7HA 4F22A 4X1DA 1YPNA 3CSGA 3N94A 1VR5A 1QUIA 2PYYA 1TFDA 4U1OA 3JV9A 3SDFA 3IAZA 4XIGQ 5I57A 3THIA 3U72A 4TLLB 3HO7A 2VOZA 2PVUA 2R6GE 3BKIB 3KN3A 1A8FA 3H03A 3SEVA 4F3PA 4OESA 1BIYA 2O84X 2PBWA 3DRFA 4QFOA 5H8QB 1PB8A 1LB8A 3IB1A 1IXGA 4EQ7A 5TU0A 4XXUA 1OIBA 3DRGA 1SDXA 5A5XB 2HFBA 1WODA 1YAEA 3CG3A 5BUUA 1FQFA 1H43A 2Y84A 3QSLA 1DOTA 3DM0A 1GTKA 3V8XB 2Z22A 5DT6A 4C1UA 4F1UA 2Q89A 2NUVA 5I56A 2F78A 2QMWA 3UGWA 4IO3A 4UACA 4G68B 1EH3A 3MP1A 3GZGA 5TP9A 3CFLA 1UQWA 3LBSA 4LATA 2QS2A 4FORA 4F29A 3MUQA 1NH8A 3PV0E 4FIMA 4F3SA 3VLUA 2R9JA 3GBBA 1IXCA 2V3QA 4R74A 4GOTA 4ZEFA 4HS7A 2A5TA 4KYSA 3IR1A 3S2VA 4LONB 1BKAA 3IO4A 4O3BA 2DXRA 1I6BA 3P7IA
chains in the Genus database with same CATH superfamily
4RYAA 4FECA 4OHNA 1NUXA 4F1YA 1URSA 1OQHA 3FXRA 4HXVA 1ANFA 1VE4A 4PGPA 2PT2A 3EHUA 3MSTA 4M1VA 3U92A 2ZZVA 4FAJA 2XXYA 2QS3A 1Q1KA 1OLCA 3R26A 3OO9A 3D4GA 3OO6A 1B1XA 1ZKBA 1TT1A 1HSLA 4GQOA 3KEIA 4ZDMA 3FVGA 1JVYA 2AL4A 1YZ0A 3ILTB 5DW8A 5EYFA 3EQ1A 1PEBA 4PDDA 3A29A 4BDNA 4NF6B 5H8NA 4F1VA 5HPQA 4QFKA 2BJIA 4ZECA 4RK2A 2XX8A 4Q5TA 3U65A 1DPEA 1NV4A 2Y7WA 2ANJA 3BIGA 4JSDA 4R72A 2QFLA 4GL0A 4U1ZA 2Q2CA 4GWXA 3U93A 2P2AA 1H45A 4GX3A 3LC8A 4R2FA 2B4LA 4KFQA 4OA4A 2ZMBA 3A3UA 5KDTB 4KI0E 2XXVA 4ISUA 4DXUA 4KD5A 4UA8A 1FRPA 4H6DA 1M5CA 2Z23A 4RA1A 1MXVA 5A5XA 5CBSA 3JYRA 1FBHA 3K6VA 1P1OA 5AE4A 3VLVA 4DXBA 1FPGA 4EQ9A 1S9TA 1FPFA 3VDFA 3G7WA 2V25A 5TPAB 2UVGA 3LV0A 1G0IA 3U94A 3IORA 3OSRA 4LVQA 4KR5A 3SETA 3T96B 1HSEA 3GBAA 3BFUA 1Z7ME 3DP6A 1IMCA 2PCRA 3TTNA 2NWJA 3C36A 1A99A 5I58A 4RPNA 4OFJA 3O9PA 2Z8EA 1FQBA 3DLNA 1US5A 4JB7A 3CVGA 3ROJA 1DSNA 4U4SA 3T66A 4N6KA 2KLFA 4FE8A 1MM7A 3Q28A 2X7QA 3TAJA 4WXJA 4NHBA 2ZNUA 1KA1A 2D21A 4M4GA 3SEWA 4I1DA 1CE2A 3HFUA 4GLIA 4PETA 4F3GA 1B3HA 1FPJA 1PDAA 3RN8A 2FYIA 1MS7A 3MQ9A 5ET5A 1B7UA 4IO2A 1VFDA 2NXOA 3RPLB 3O6PA 4F19A 3T22A 1MQIA 4NX1A 3E3KA 1MQDA 5JTYB 4DLDA 4PFBA 2THIA 3B6QA 4PFUA 4ZZAA 1IUDA 1IEJA 3VFJA 4I9DA 1VDWA 4PBHA 2HXRA 3FZVA 2Q9TA 2D5WA 2UYFA 1LCTA 1IXIA 3R6UA 3KSXA 1MY1A 4P0GA 4PDHA 4F18A 2Q88A 1NV5A 4HCYA 2O1MA 3IOVA 3MPLA 1B0HA 4YAHX 3W15C 3MZBA 3VXBA 3RGYA 2DVZA 2OK2A 2OBGA 3IJOB 4O7MA 2VT5A 3PUVE 4RNSA 4X8RA 3VVDA 4Z7EA 3OEKA 1D9QA 3O6IA 4KQPA 4I62A 4OTEA 3C32A 3ZS6A 1L5TA 3CRBA 1UTHB 4YB6A 1R9LA 1A8EA 1MG1A 1LAXA 1I6QA 5I3SA 4RY1A 2M8CA 4ECFA 1A40A 3MAMA 2QPQA 4UABA 5TPAA 5LDZA 4PFYA 2QJEA 1MY0A 2O69A 4HTGA 4LUBA 1SD3A 2QRYA 2PX1A 5J16A 1NI9A 3PUXE 5EYGA 1IQ7A 3RYDA 4BDLA 1FTLA 2GFEA 1N04A 2DE4A 4EF1A 2F6GA 2ZYNA 3PPQA 4FEBA 1B3LA 1JNFA 2XXUA 2OJTA 3B50A 3DRJA 3RYBA 3MC2A 3MZ1A 3QUFA 4X48A 4PF8A 5DEXB 3VE1B 4R2BA 2XXWA 4AB6A 1GV8A 1RYOA 3KG2A 1NNTA 5KCJB 3KC1A 4R9GA 4NF8A 1ZIUA 4NF0A 2PT1A 3SEYA 1ZTYA 3IB0A 2XXRA 3TKDA 4AB5A 3UORA 3K02A 1LBXA 1H44A 2OX3A 4N6DA 2CEXA 2CMOA 1LBBA 1WVJA 2RF1A 3K0VA 3HPIA 3SKPA 4BDOA 1O64A 2B65A 3QIMA 4MNCA 1J1NA 2XXKA 3OELA 2HXWA 2GRVA 4HE2A 1QGXA 2WX9A 1QULA 3FUZA 3IB2A 3DRIA 1GR2A 4H8JA 5JTYA 4LZ5A 1QUKA 3Q26A 4DCYA 5IAIA 3BBRA 4GBWA 4I3YA 2O1LA 1AWBA 1D4NA 2IEEA 3LSWA 4R6KA 5I59B 4F2QA 2B4MA 2V3TA 4FBPA 2DOJA 1CNQA 2ZYMA 1NKXA 3FBPA 5IGAA 3RTFB 4IR8A 4H5GA 4DXCA 5IZ1A 3KN7A 2WKYA 3V5AA 3K4UA 2AL5A 2CZLA 5M2VA 4Z0IA 4C1TA 2XWKA 5AA2B 4OWDA 1SI1A 2Y7RA 4H5FA 1SYHA 1NFTA 5EHMA 1WDNA 4LA9A 2UVHA 3M3KA 1UTBB 1B32A 3CR9A 3FVKA 1NNPA 3DP8A 3IO6A 3MYUA 4NWDA 3RY3A 1P1QA 1Z7NE 2OLBA 1OMPA 3MP8A 4FATA 4POXA 1D3KA 3BFTA 2CZHA 3N6UA 2HAUA 4IY5A 1RYXA 3NOHA 2H9BA 1FPLA 2P3NA 3MBPA 3FJGA 2X26A 4MNIA 2UVIA 1TXFA 2ONKE 4GXSB 4FEDA 5I2NB 1QKAA 3KN8A 5I5PA 3TTKA 3OO8A 4JVDA 2HHMA 4WEPA 1NV6A 4THIA 1USYH 1Y1MA 4O3AA 2NVUB 3H6WA 5EHSA 1II5A 2VP1A 1EU8A 2DWJA 2FHYA 2H99A 4N4UA 3G3JA 3UP9A 5KCJA 4E0XA 3GXAA 3LSFB 2QVRA 2QL3A 1JQFA 1LSTA 5H8FB 1MH3A 4BDQA 2XX7A 1URGA 3PU5A 3O6HA 2Y7PA 3TCHA 1LFIA 5ICTA 3EPEA 3SESA 2ZZWA 3KSJA 1N84A 3DP4A 1K9YA 3OEMA 4YB7A 5H8HB 4JBZA 2HAVA 3FV2A 2W7YA 3DRKA 5L9MA 2REGA 2NOOA 1B3FA 1SI0A 3MWBA 1BP5A 3TZAA 1GGGA 2Y7IA 3CI8A 4AS5A 4OANA 3E78A 3MVXA 2GH9A 2Y5LA 2H5YA 4QXDA 3JZJA 4ZEIA 1P1WA 1EYIA 4OXVA 3C33A 3C4MA 4GX6A 5CMMA 4AS4A 3OO7A 2X7PA 2RCAA 2ONRA 5I2KB 4YZZA 3MVYA 1O7TA 4IO5A 1R9QA 3G3HA 4NF4A 5ESYA 4G4PA 1EZ9A 1MQHA 3A3CA 4YKPA 1HSJA 2I6EA 1LBVA 3TTLA 3H06B 1UIVA 2PFYA 3RNNA 4PFIA 3TELA 3KJ7A 1IXHA 4N07A 2HPGA 2RC7A 3PTYA 3TDJA 1IMBA 1M5FA 1FPBA 4NEDA 2OWSA 1UTBA 3UK4A 3TUSA 1IMDA 2QVVA 3EN3A 2ESNA 4GX4A 3RLFE 4QSDA 4EQBA 2BJJX 1JW1A 2IA4A 4QHQA 4NGUA 2QS4A 3T1BA 4WKMA 3FXQA 4F2OA 1QW0A 4PAKA 3GYYA 4F31B 3B6WA 1KZ8A 4ONYA 1P99A 5H8QA 4QFNA 2WOLA 1TWYA 3D4CA 2RC9A 4XKNA 5I7IA 2DXYA 1SVXB 1Y20A 2QSXA 1I69A 4P9KA 1NL5A 1EZPA 4OZ9A 5ET8A 1DBZA 1N7XA 1Y3QA 2V84A 3W9WA 4XKQA 3ONMA 3I5OA 4PC9A 1YTVA 1Y9UA 1LFGA 2OCUA 4PBQA 1SW5A 3IFCA 4GIZA 1FQCA 3CSBA 3KZGA 4G68A 4PF6A 4G8MA 3FJMA 3L6HA 3QAXA 3UIFA 5AA2D 1SBPA 4NE4A 3PMVA 1R1NA 1PB9A 4PFTA 4OVJA 1LBYA 2F36A 4P1EA 1MDQA 2YPNA 3HN0A 3PPPA 4NF5B 3VXCA 1IMAA 3K6XA 3LVUA 4N8GA 5ITOA 1FBGA 5H8HA 2Q8MA 3C31A 1PB7A 4RJZA 1P1UA 2DWIA 4N17A 4EXLA 3O29A 1Y4CA 5IZZA 1IMEA 1MPBA 2VPNA 3K1MA 4H8IA 2DWHA 1XVXA 4QBAA 4G8HA 3O6GA 5EQ8A 4L17A 3HSTA 2Z8FA 2D3IA 2JJKA 2OZZA 4MEVA 2I48A 3I6VA 1RDZA 4H46A 5IZ3B 2P1SA 5DTBA 3O2AA 3MZ9A 2HCAA 3IK6B 1PC3A 3RT6B 3LR1A 4EDPA 4PAFA 4TLMB 1RDXA 4MF3A 3Q29A 3TTRA 2FBPA 1JW5A 4P3LA 1O63A 4H0WA 2RKMA 3FVOA 2AYSA 5FHNA 4XTCQ 1LB9A 4NF6A 4H67A 3PPRA 1RDYA 5DVIA 2L5VA 4OERA 3AXFA 4ZE9A 3MJNA 4N91A 5HBCA 4ELQA 2Q8JA 1OQGA 1OVBA 3VLWA 1GVCA 1M5EA 1M5DA 4P47A 3PUWE 3FTOA 2HZKA 5FHOA 5KDTA 1NV2A 5ITPA 1KWHA 3IX1A 1DTZA 3TEPA 3QXMA 3OSQA 4MAGA 1ELJA 1LAFE 1OVTA 4Q30B 2I4BA 4MLQA 2WYKA 1NV3A 1VSOA 3MW0A 3A09A 2VD3A 1DCUA 1IIWA 4DI4B 1INPA 3H4ZA 4GFRA 4OEUA 3PD9A 1FTKA 4G68C 3TQWA 1Y4TA 4ZS9A 1MRPA 3G3GA 2DE2A 3PD8A 4G61A 1MXZA 2ZYOA 3UN6A 1B3GA 4I40A 1KA0A 3LUZA 1USYE 3HHGA 5L8DA 3L6GA 5ICQA 1XS5A 4MH5A 2CZIA 1MXUA 3EHSA 1MXWA 3CIJA 3E13X 4RK9A 2VGQA 2I49A 1P1NA 5AA4B 1T0KA 1TFAA 2P3VA 1S7YA 4YKKA 5AA3A 5CI5A 2H25A 5I56B 4MBPA 4XFEA 1N3WA 2XXPA 1N3XA 5CMCA 3TTMA 2A5SA 4NAPA 4P0IA 5TP9B 5JK4A 4R75A 1ZMGA 1B58A 4GRKA 5I84A 4JWYA 4YKIA 1FTMA 1SYIA 4LQ2A 3KJTA 2OWTA 1FBFA 3B7DA 3RPLA 3RUMA 2VPOA 2F6PA 4N8YA 2Y7KA 1B3EA 3TQLA 1AMFA 2F3DA 4EUOA 2I0BA 3HCQA 1YCJA 1N7WA 4YB5A 1NNFA 1LFHA 3T9XB 2LAOA 3S9LC 4KPTA 1QJMA 2A5TB 4OFLA 1OLAA 2CZKA 2UVJA 3M8UA 2XA5A 2XD3A 5CRYA 5HM4B 3CFZA 2DP8A 3WAEA 3QMFA 3PPNA 4R6YA 3IOUA 1JEUA 4QF9A 1FTAA 1MY2A 3FJ7A 4MX6A 2WEFA 2XX9A 4U2RA 3K00A 2FNCA 4G2ZA 1MQJA 5B70A 2E1SA 2XHDA 1FBEA 2DS9A 3WAFA 2XWIA 4OEVA 2O68A 2Z8DA 3H6UA 3DRHA 1DTGA 2F35A 3SEXA 4F39A 1N0TA 1B6HA 4NMYA 5CM6A 4XF5A 2UXAA 3OOAA 3KBRA 1DPPA 1B5IA 4U4XA 4TQUQ 4ESXA 4YKJA 3PUYE 4IGTA 1UTHA 1FQEA 5ISUA 3PAMA 1SPIA 5H8NB 5DYHA 1FTJA 2I0CA 4AQ4A 5EYHA 3TFLA 4GD5A 4LZ7A 1B4HA 1B5JA 5L9SA 3GLBA 2O7IA 4PQJA 1ATGA 1I6AA 3Q27A 4P56A 1Y3PA 2KQZA 1URDA 1XT8A 4ZEKA 1JVXA 2DQVA 1CB6A 3HV1A 1LBWA 5LTCA 1FPDA 3OXNA 3K6UA 4DIGA 1NH7A 1XOCA 4GWOA 1MQGA 2OWZA 5CMKA 1B05A 4R73A 4R9FA 4IO6A 3T9HB 5FTHA 3G3FA 3W9VA 1NNKA 5AA4A 2XWOA 1UIUA 5DEXA 5BWJA 3FXUA 2I3VA 1H3DA 2ZNSA 3H3GA 1MY3A 1B40A 1ZJLA 3EHTA 4G8NA 1FBDA 4HE0A 4LP2B 4QFPA 2O6AA 2V93A 3O66A 3VVEA 4H1XA 4PE5B 4U21A 2GHBA 1LBCA 2ZNTA 5H8SA 3FV1A 5F7VA 1LBZA 1MPDA 3H6TA 3FVNA 1XVYA 1NMUA 3K1NA 5I58B 1FBPA 5EQ7A 5LOMA 1SQYA 2GQ1A 1R6ZA 1FJ9A 4GXAA 3C35A 4IO7A 4PAIA 1BTJA 5JEIA 4I3EA 4O7IA 1US4A 2F3BA 3S4UA 3OD7A 3T9UA 4ND9A 3FD3A 4MLVA 5I59A 1JETA 4P8BA 2DVCA 2F8DA 3ECRA 4N6PA 1FQDA 4ELOA 1FCKA 3SERA 5AA1A 3Q25A 3V89B 1POTA 1MXXA 1QKBA 2RC8A 2E0SA 2VD2A 2WBBA 4YMBA 2ONSA 5KZTA 2F7CA 1S50A 1A54A 3RQTA 1LAHE 1B1HA 4QSEA 2GHAA 3R7XA 1Y1ZA 4JSOA 2ZYKA 5AA2A 4PGNA 2FA7A 1F9BA 4GL8A 4N81A 1FPIA 4MIJA 3CHGA 3D1RA 4KCDA 2FVZA 2O7UA 3G3IA 3MP6A 4DE8A 2V3UA 1B9JA 3T0JA 4RPOA 1FJ6A 5EQ9A 2YLNA 1B4ZA 4DI3D 1DK4A 4H45A 3HHFA 5K2YA 1XHYA 4OETA 3S9EA 1B0LA 2ZZXA 4YMAA 4DCXA 2XXTA 2V4CA 3QK6A 1PBPA 2WBDA 3K2DA 4P11A 4XEQA 3ZKKA 3G3KA 1FPKA 2WOKA 2G93A 3CG1A 5I2NA 3IOWA 4BDRA 3IL1B 4OQOA 1LCFA 3FASA 4KYEA 2AIXA 5F24A 4IY6A 3H7MA 4OYVA 4X04A 3DELB 3PUZE 4MFIA 2I58A 1B52A 4X9TA 4OFOA 1BLFA 1AH5A 3S9MC 3E4RA 4ZE8A 3SZPA 2KR0A 3M3LA 3ZKLA 1MDP1 2HEUA 4YU0A 4JWOA 5K2XA 3KFMA 4OENA 2PMSA 2I3WA 3KC0A 2ALUA 4OVSA 1ZU0A 2UYEA 1MM6A 5H8FA 1ZLQA 3F11A 3KBZA 4PE3A 4KYDA 4LZ8A 1RKMA 1G0HA 4LQ5A 3MPKA 1Q35A 4EXKA 4HE1A 2FIEA 2Y5KA 1PBQA 2DE3A 5ET6A 4JWXA 1LAGE 2Q2AA 3QYTA 5F1QA 1AL3A 1N76A 3TMGA 4ELRA 3LUYA 4O94A 3RPWA 2XXXA 5L9OA 4FJPA 1XI6A 4WEDA 2YJPA 3C9HA 3PGFA 4PFRA 4IGRA 4NF8B 3IFAA 4IB2A 1A7LA 4NWCA 2RCBA 4X1BA 3M3FA 4DZ1A 4RXLA 1IZ1A 5I2KA 2B3FA 4TOZA 3K6WA 3S9NC 2HZLA 2F7BA 2XXIA 2WOPA 1FBCA 4BLAA 2FIXA 2ZXTA 1FTOA 3KOSA 1D9YA 3ZSFA 3EF7A 3O28A 1EZOA 3KGCA 1JEVA 2I4CA 3LSLA 3ILUB 1AOVA 4MNPA 3O97A 1NV1A 3B6TA 2HQ0A 1LEVA 4R6HA 3TCFA 4N13A 5IM2A 1LGBC 1MPCA 3PPOA 4DDDA 5DVFA 4MJOA 5IKBA 2P0SA 1Y3NA 3U8QA 3OMBA 5ELVA 1SW1A 4GVOA 2F34A 1YYZA 3E9XA 2DSFA 3MVWA 1VFEA 3MVZA 1LLSA 1FPEA 2DWAA 4PFWA 4NQ8A 4XKPA 1SW4A 3PMXA 4XKRA 4YICA 4GWYA 4ELPA 4K3FA 3N6TA 1BK4A 2VHAA 4QRZA 3CFXA 3N5LA 1B5HA 3IOTA 3FATA 3IJXB 5I57B 4JVCA 3UA8A 4GWWA 1NV0A 1JP4A 5A5LA 2RINA 4NTLA 4PCDA 4MMPA 4Q8RA 5CMBA 2XWVA 4ESWA 3RYAA 5CBRA 1B46A 3TCGA 2DYXA 4JVIA 4F3BA 1MH4A 3RTWB 3T9VA 1JW4A 4H65A 4U22A 2H4IA 2B3BA 3V83A 3OENA 2QMXA 2R8TA 1EYKA 2QVUA 3H6VA 4GWZA 4GF8A 3C34A 5CC2A 1B2HA 3K1PA 4P1LA 1NV7A 4JDFA 4OMBA 4BDMA 2CEYA 4G77A 3LSXA 1ZBMA 4NF5A 3I3VA 4EF2A 5B7DA 2F7AA 1QUJA 4Q0CA 4POWA 2DDKA 1SW2A 2Q74A 4O3CA 4PTKA 4C0RA 3FIRA 1A55A 3PMWA 1QVSA 1B51A 1B7ZA 5FTIA 5FHMA 4ZEBA 3FXBA 4OVQA 3TYHA 5T3JA 3ODBA 1DMBA 1NUWA 2ABHA 2REJA 1D9VA 1XC1A 3VV5A 4ZEDA 4NG7A 4HW8A 1IITA 1MY4A 1POY1 5DVJA 3ISPA 4PP0A 1AIVA 4GWUA 2F5XA 5IZ3A 3RT8A 5ET7A 4I8CA 3TPAA 2H98A 4ZZEA 3N26A 1FQAA 1H76A 2XXHA 3U1OA 4QFLA 2F97A 2XD2A 3KOTA 4OVPA 4KXPA 4MHFA 4KCCA 3B8BA 4MCOA 3TODA 3E79A 4U23A 1Q9DA 2G29A 1M5BA 4HCWA 3K01A 4QSCA 3VVFA 3EKIA 4IO4A 2XXQA 1NUZA 4KHZE 4E0WA 1MXYA 3T93B 2R71A 2O51A 4JXIA 3USDA 5J1DA 1NUYA 3SEUA 3FGSA 4NF4B 2QS1A 1FW0A 3QUJA 1B7HA 4F22A 4X1DA 1YPNA 3CSGA 3N94A 1VR5A 1QUIA 2PYYA 2PFZA 1TFDA 4U1OA 3JV9A 3SDFA 3IAZA 4XIGQ 5I57A 3THIA 3U72A 4TLLB 3HO7A 2VOZA 2PVUA 2R6GE 3BKIB 3KN3A 1A8FA 3H03A 3SEVA 4F3PA 4GWSA 4OESA 1BIYA 2O84X 2PBWA 3DRFA 1FSAA 4QFOA 4GBVA 5H8QB 1YXIA 4NN3A 1PB8A 1LB8A 3IB1A 4LN5A 1IXGA 4EQ7A 5TU0A 4XXUA 1OIBA 3DRGA 1SDXA 5A5XB 2HFBA 1WODA 1YAEA 3CG3A 5BUUA 1EYJA 1FQFA 1H43A 2Y84A 4O8MA 2MKZA 3QSLA 1DOTA 3DM0A 1GTKA 1K9ZA 3V8XB 2Z22A 5DT6A 4C1UA 4F1UA 2Q89A 2NUVA 5FBPA 5I56A 2F78A 2QMWA 4IO3A 4UACA 3UGWA 4G68B 1EH3A 3MP1A 3GZGA 5TP9A 5EQAA 3CFLA 4OVTA 2WYPA 1UQWA 3LBSA 4LATA 2QS2A 4FORA 4F29A 3MUQA 1NH8A 3PV0E 4FIMA 4F3SA 3VLUA 2R9JA 3GBBA 1IXCA 4N15A 2V3QA 4OVRA 4R74A 3BIHA 1IMFA 4GOTA 4ZEFA 4HS7A 2A5TA 4KYSA 3IR1A 3S2VA 4LONB 1BKAA 3IO4A 4O3BA 2DXRA 1I6BA 3P7IA
chains in the Genus database with same CATH topology
4RYAA 4FECA 4OHNA 4F1YA 1URSA 1OQHA 3FXRA 1ANFA 1VE4A 2PT2A 3EHUA 4M1VA 3U92A 4FAJA 2XXYA 2QS3A 1Q1KA 1OLCA 3R26A 3OO9A 3D4GA 3OO6A 1B1XA 1ZKBA 1TT1A 1HSLA 4GQOA 3KEIA 4ZDMA 3FVGA 1JVYA 2AL4A 3ILTB 5EYFA 3EQ1A 1PEBA 4BDNA 4NF6B 5H8NA 4F1VA 5HPQA 4QFKA 4ZECA 4RK2A 2XX8A 4Q5TA 1DPEA 2Y7WA 2ANJA 4JSDA 4R72A 4GL0A 4U1ZA 2Q2CA 3U93A 2P2AA 1H45A 3LC8A 4R2FA 2B4LA 4KFQA 2ZMBA 3A3UA 5KDTB 4KI0E 2XXVA 4ISUA 4DXUA 4KD5A 4UA8A 4H6DA 1M5CA 2Z23A 4RA1A 1MXVA 5A5XA 5CBSA 3JYRA 3K6VA 1P1OA 5AE4A 3VLVA 4DXBA 4EQ9A 1S9TA 3VDFA 3G7WA 2V25A 5TPAB 2UVGA 3U94A 3IORA 3OSRA 4LVQA 4KR5A 3SETA 3T96B 1HSEA 3GBAA 3BFUA 1Z7ME 3DP6A 3TTNA 2NWJA 3C36A 1A99A 5I58A 4RPNA 4OFJA 3O9PA 2Z8EA 1FQBA 3DLNA 1US5A 4JB7A 3CVGA 1DSNA 4U4SA 3T66A 2KLFA 4FE8A 1MM7A 3Q28A 2X7QA 3TAJA 4WXJA 2ZNUA 2D21A 4M4GA 3SEWA 4I1DA 1CE2A 4GLIA 4PETA 4F3GA 1B3HA 1PDAA 3RN8A 2FYIA 1MS7A 3MQ9A 1B7UA 4IO2A 1VFDA 2NXOA 3O6PA 4F19A 3T22A 1MQIA 3E3KA 1MQDA 5JTYB 4DLDA 2THIA 3B6QA 4PFUA 4ZZAA 1IUDA 1IEJA 3VFJA 4I9DA 3FZVA 2Q9TA 2D5WA 2UYFA 1LCTA 1IXIA 3R6UA 3KSXA 1MY1A 4P0GA 4F18A 2Q88A 4HCYA 2O1MA 3IOVA 3MPLA 1B0HA 4YAHX 3W15C 3MZBA 3VXBA 3RGYA 2DVZA 2OK2A 2OBGA 3IJOB 3PUVE 4RNSA 3VVDA 4Z7EA 3OEKA 3O6IA 4KQPA 4I62A 4OTEA 3C32A 3ZS6A 1L5TA 3CRBA 1UTHB 4YB6A 1R9LA 1A8EA 1MG1A 1LAXA 1I6QA 4RY1A 2M8CA 4ECFA 1A40A 3MAMA 2QPQA 5TPAA 4PFYA 2QJEA 1MY0A 2O69A 4HTGA 4LUBA 1SD3A 2QRYA 2PX1A 3PUXE 1IQ7A 4BDLA 1FTLA 2GFEA 1N04A 2DE4A 4EF1A 2F6GA 2ZYNA 3PPQA 4FEBA 1B3LA 1JNFA 2XXUA 2OJTA 3DRJA 3RYBA 3MC2A 3MZ1A 3QUFA 4X48A 5DEXB 3VE1B 4R2BA 2XXWA 4AB6A 1GV8A 1RYOA 3KG2A 1NNTA 5KCJB 4R9GA 4NF8A 1ZIUA 2PT1A 3SEYA 1ZTYA 3IB0A 2XXRA 3TKDA 4AB5A 3UORA 3K02A 1H44A 2CMOA 1LBBA 1WVJA 2RF1A 3K0VA 3HPIA 3SKPA 4BDOA 1O64A 2B65A 3QIMA 1J1NA 3OELA 2HXWA 2GRVA 1QULA 3FUZA 3IB2A 3DRIA 1GR2A 4H8JA 5JTYA 4LZ5A 1QUKA 3Q26A 4DCYA 5IAIA 3BBRA 2O1LA 1D4NA 2IEEA 3LSWA 4R6KA 5I59B 4F2QA 2B4MA 2V3TA 2DOJA 2ZYMA 1NKXA 3RTFB 4H5GA 4DXCA 3KN7A 2WKYA 3V5AA 3K4UA 2AL5A 2CZLA 5M2VA 4Z0IA 4C1TA 5AA2B 4OWDA 1SI1A 2Y7RA 4H5FA 1SYHA 1NFTA 5EHMA 1WDNA 4LA9A 2UVHA 3M3KA 1UTBB 1B32A 3CR9A 3FVKA 1NNPA 3DP8A 3IO6A 4NWDA 3RY3A 1P1QA 1Z7NE 2OLBA 1OMPA 3MP8A 4FATA 4POXA 1D3KA 3BFTA 3N6UA 2HAUA 4IY5A 1RYXA 2H9BA 3MBPA 3FJGA 2X26A 2UVIA 1TXFA 2ONKE 4GXSB 4FEDA 5I2NB 1QKAA 3KN8A 3TTKA 3OO8A 4WEPA 4THIA 1USYH 1Y1MA 4O3AA 2NVUB 3H6WA 5EHSA 1II5A 2VP1A 1EU8A 2DWJA 2H99A 3G3JA 3UP9A 5KCJA 4E0XA 3GXAA 3LSFB 2QL3A 1JQFA 1LSTA 5H8FB 1MH3A 4BDQA 2XX7A 1URGA 3PU5A 3O6HA 2Y7PA 3TCHA 1LFIA 5ICTA 3EPEA 3SESA 3KSJA 1N84A 3DP4A 3OEMA 4YB7A 5H8HB 4JBZA 2HAVA 3FV2A 2W7YA 3DRKA 5L9MA 2REGA 2NOOA 1B3FA 1SI0A 3MWBA 1BP5A 3TZAA 1GGGA 2Y7IA 3CI8A 3MVXA 2GH9A 2H5YA 3JZJA 4ZEIA 1P1WA 4OXVA 3C33A 3C4MA 5CMMA 3OO7A 2X7PA 2RCAA 2ONRA 5I2KB 4YZZA 3MVYA 1O7TA 4IO5A 1R9QA 3G3HA 4NF4A 4G4PA 1EZ9A 1MQHA 3A3CA 4YKPA 1HSJA 2I6EA 3TTLA 3H06B 1UIVA 3RNNA 3TELA 3KJ7A 1IXHA 4N07A 2RC7A 3TDJA 1M5FA 4NEDA 2OWSA 1UTBA 3UK4A 3TUSA 3EN3A 2ESNA 3RLFE 4QSDA 4EQBA 2BJJX 1JW1A 2IA4A 4QHQA 2QS4A 4WKMA 3FXQA 4F2OA 1QW0A 4F31B 3B6WA 4ONYA 1P99A 5H8QA 4QFNA 2WOLA 1TWYA 3D4CA 2RC9A 4XKNA 2DXYA 1SVXB 1Y20A 2QSXA 1I69A 1NL5A 1EZPA 4OZ9A 1N7XA 1Y3QA 2V84A 3W9WA 4XKQA 3ONMA 3I5OA 1YTVA 1Y9UA 1LFGA 2OCUA 1SW5A 4GIZA 1FQCA 3CSBA 3KZGA 4G68A 4G8MA 3FJMA 3L6HA 3QAXA 3UIFA 5AA2D 1SBPA 4NE4A 3PMVA 1R1NA 1PB9A 4PFTA 4OVJA 2F36A 1MDQA 2YPNA 3HN0A 3PPPA 4NF5B 3VXCA 3K6XA 3LVUA 5ITOA 5H8HA 3C31A 1PB7A 4RJZA 1P1UA 2DWIA 4EXLA 3O29A 1Y4CA 1MPBA 3K1MA 4H8IA 2DWHA 1XVXA 4G8HA 3O6GA 4L17A 3HSTA 2Z8FA 2D3IA 2OZZA 2I48A 3I6VA 2P1SA 5DTBA 3O2AA 3MZ9A 2HCAA 3IK6B 1PC3A 3RT6B 3LR1A 4EDPA 4TLMB 4MF3A 3Q29A 3TTRA 1JW5A 1O63A 4H0WA 2RKMA 3FVOA 2AYSA 5FHNA 4XTCQ 1LB9A 4NF6A 4H67A 3PPRA 5DVIA 4OERA 3AXFA 4ZE9A 3MJNA 5HBCA 4ELQA 2Q8JA 1OQGA 1OVBA 3VLWA 1GVCA 1M5EA 1M5DA 3PUWE 3FTOA 2HZKA 5FHOA 5KDTA 5ITPA 1KWHA 3IX1A 1DTZA 3TEPA 3QXMA 3OSQA 1ELJA 1LAFE 1OVTA 4Q30B 2I4BA 4MLQA 1VSOA 3MW0A 3A09A 2VD3A 1IIWA 3H4ZA 4GFRA 4OEUA 3PD9A 1FTKA 4G68C 3TQWA 1Y4TA 4ZS9A 1MRPA 3G3GA 2DE2A 3PD8A 1MXZA 2ZYOA 3UN6A 1B3GA 1USYE 3HHGA 5L8DA 3L6GA 5ICQA 1XS5A 4MH5A 1MXUA 3EHSA 1MXWA 3CIJA 3E13X 4RK9A 2VGQA 2I49A 1P1NA 5AA4B 1T0KA 1TFAA 1S7YA 4YKKA 5AA3A 5CI5A 2H25A 5I56B 4MBPA 1N3WA 2XXPA 1N3XA 5CMCA 3TTMA 2A5SA 4P0IA 5TP9B 5JK4A 4R75A 1ZMGA 1B58A 4GRKA 5I84A 4JWYA 4YKIA 1FTMA 1SYIA 4LQ2A 3KJTA 2OWTA 3B7DA 3RUMA 2F6PA 2Y7KA 1B3EA 3TQLA 1AMFA 4EUOA 2I0BA 3HCQA 1YCJA 1N7WA 4YB5A 1NNFA 1LFHA 3T9XB 2LAOA 3S9LC 4KPTA 1QJMA 2A5TB 4OFLA 1OLAA 2UVJA 3M8UA 2XD3A 5CRYA 5HM4B 3CFZA 2DP8A 3WAEA 3PPNA 4R6YA 3IOUA 1JEUA 4QF9A 1MY2A 3FJ7A 2XX9A 4U2RA 3K00A 2FNCA 4G2ZA 1MQJA 5B70A 2E1SA 2XHDA 2DS9A 3WAFA 4OEVA 2O68A 2Z8DA 3H6UA 3DRHA 1DTGA 2F35A 3SEXA 4F39A 1N0TA 1B6HA 4NMYA 5CM6A 2UXAA 3OOAA 3KBRA 1DPPA 1B5IA 4U4XA 4TQUQ 4ESXA 4YKJA 3PUYE 4IGTA 1UTHA 1FQEA 5ISUA 3PAMA 5H8NB 5DYHA 1FTJA 2I0CA 4AQ4A 3TFLA 4GD5A 4LZ7A 1B4HA 1B5JA 5L9SA 3GLBA 2O7IA 4PQJA 1ATGA 1I6AA 3Q27A 1Y3PA 1URDA 1XT8A 4ZEKA 1JVXA 2DQVA 1CB6A 3HV1A 3OXNA 3K6UA 4DIGA 1NH7A 1XOCA 4GWOA 1MQGA 5CMKA 1B05A 4R73A 4R9FA 4IO6A 3T9HB 5FTHA 3G3FA 3W9VA 1NNKA 5AA4A 1UIUA 5DEXA 5BWJA 3FXUA 2I3VA 1H3DA 2ZNSA 3H3GA 1MY3A 1B40A 1ZJLA 3EHTA 4G8NA 4LP2B 4QFPA 2O6AA 2V93A 3O66A 3VVEA 4H1XA 4PE5B 4U21A 2GHBA 1LBCA 2ZNTA 5H8SA 3FV1A 5F7VA 3H6TA 1MPDA 3FVNA 1XVYA 1NMUA 3K1NA 5I58B 5LOMA 1SQYA 1R6ZA 4GXAA 3C35A 4IO7A 1BTJA 5JEIA 1US4A 3S4UA 3OD7A 3T9UA 4ND9A 3FD3A 4MLVA 5I59A 1JETA 2DVCA 2F8DA 3ECRA 4N6PA 1FQDA 4ELOA 1FCKA 3SERA 5AA1A 3Q25A 3V89B 1POTA 1MXXA 1QKBA 2RC8A 2E0SA 2VD2A 4YMBA 2ONSA 5KZTA 2F7CA 1S50A 1A54A 3RQTA 1LAHE 1B1HA 4QSEA 2GHAA 3R7XA 1Y1ZA 4JSOA 2ZYKA 5AA2A 2FA7A 1F9BA 4GL8A 3CHGA 4KCDA 2O7UA 3G3IA 3MP6A 4DE8A 2V3UA 1B9JA 4RPOA 2YLNA 1B4ZA 3HHFA 5K2YA 1XHYA 4OETA 3S9EA 1B0LA 4YMAA 4DCXA 2XXTA 3QK6A 1PBPA 3K2DA 4P11A 3ZKKA 3G3KA 2WOKA 2G93A 3CG1A 5I2NA 3IOWA 4BDRA 3IL1B 4OQOA 1LCFA 3FASA 4KYEA 2AIXA 4IY6A 3H7MA 4OYVA 3DELB 3PUZE 4MFIA 2I58A 1B52A 4X9TA 4OFOA 1BLFA 1AH5A 3S9MC 3E4RA 4ZE8A 3M3LA 3ZKLA 1MDP1 2HEUA 4YU0A 4JWOA 5K2XA 3KFMA 4OENA 2PMSA 2I3WA 2ALUA 1ZU0A 2UYEA 1MM6A 5H8FA 1ZLQA 3F11A 4KYDA 4LZ8A 1RKMA 4LQ5A 3MPKA 1Q35A 4EXKA 1PBQA 2DE3A 4JWXA 1LAGE 2Q2AA 3QYTA 5F1QA 1AL3A 1N76A 3TMGA 4ELRA 3LUYA 3RPWA 2XXXA 5L9OA 4FJPA 4WEDA 2YJPA 3C9HA 3PGFA 4IGRA 4NF8B 4IB2A 1A7LA 4NWCA 2RCBA 4X1BA 3M3FA 4DZ1A 4RXLA 1IZ1A 5I2KA 2B3FA 4TOZA 3K6WA 3S9NC 2HZLA 2F7BA 2XXIA 2WOPA 4BLAA 2ZXTA 1FTOA 3KOSA 1D9YA 3ZSFA 3EF7A 3O28A 1EZOA 3KGCA 1JEVA 2I4CA 3LSLA 3ILUB 1AOVA 3O97A 3B6TA 2HQ0A 4R6HA 3TCFA 4N13A 1LGBC 1MPCA 3PPOA 4DDDA 5DVFA 5IKBA 2P0SA 1Y3NA 3U8QA 3OMBA 5ELVA 1SW1A 4GVOA 2F34A 3E9XA 2DSFA 3MVWA 1VFEA 3MVZA 1LLSA 2DWAA 4PFWA 4XKPA 1SW4A 3PMXA 4XKRA 4YICA 4ELPA 4K3FA 3N6TA 2VHAA 4QRZA 3CFXA 3N5LA 1B5HA 3IOTA 3FATA 3IJXB 5I57B 3UA8A 2RINA 4NTLA 4Q8RA 5CMBA 4ESWA 5CBRA 3RYAA 1B46A 3TCGA 2DYXA 4F3BA 1MH4A 3RTWB 3T9VA 1JW4A 4H65A 4U22A 2H4IA 2B3BA 3V83A 3OENA 2QMXA 3H6VA 4GF8A 3C34A 5CC2A 1B2HA 3K1PA 4JDFA 4OMBA 4BDMA 4G77A 3LSXA 1ZBMA 4NF5A 3I3VA 4EF2A 5B7DA 2F7AA 1QUJA 4Q0CA 4POWA 1SW2A 4O3CA 4C0RA 3FIRA 1A55A 3PMWA 1QVSA 1B51A 1B7ZA 5FTIA 5FHMA 4ZEBA 3TYHA 3ODBA 1DMBA 2ABHA 2REJA 1D9VA 1XC1A 3VV5A 4ZEDA 4HW8A 1IITA 1MY4A 1POY1 5DVJA 4PP0A 1AIVA 2F5XA 3RT8A 4I8CA 3TPAA 2H98A 4ZZEA 3N26A 1FQAA 1H76A 2XXHA 3U1OA 4QFLA 2F97A 2XD2A 3KOTA 4KCCA 3TODA 4U23A 2G29A 1M5BA 4HCWA 3K01A 4QSCA 3VVFA 4IO4A 2XXQA 4KHZE 4E0WA 1MXYA 3T93B 2R71A 2O51A 4JXIA 3USDA 5J1DA 3SEUA 3FGSA 4NF4B 2QS1A 1FW0A 3QUJA 1B7HA 4F22A 4X1DA 1YPNA 3CSGA 3N94A 1VR5A 1QUIA 2PYYA 1TFDA 4U1OA 3JV9A 3SDFA 3IAZA 4XIGQ 5I57A 3THIA 3U72A 4TLLB 3HO7A 2VOZA 2PVUA 2R6GE 3BKIB 3KN3A 1A8FA 3H03A 3SEVA 4F3PA 4OESA 1BIYA 2O84X 2PBWA 3DRFA 4QFOA 5H8QB 1PB8A 1LB8A 3IB1A 1IXGA 4EQ7A 5TU0A 4XXUA 1OIBA 3DRGA 1SDXA 5A5XB 2HFBA 1WODA 1YAEA 3CG3A 5BUUA 1FQFA 1H43A 2Y84A 3QSLA 1DOTA 3DM0A 1GTKA 3V8XB 2Z22A 5DT6A 4C1UA 4F1UA 2Q89A 2NUVA 5I56A 2F78A 2QMWA 3UGWA 4IO3A 4UACA 4G68B 1EH3A 3MP1A 3GZGA 5TP9A 3CFLA 1UQWA 3LBSA 4LATA 2QS2A 4FORA 4F29A 3MUQA 1NH8A 3PV0E 4FIMA 4F3SA 3VLUA 2R9JA 3GBBA 1IXCA 2V3QA 4R74A 4GOTA 4ZEFA 4HS7A 2A5TA 4KYSA 3IR1A 3S2VA 4LONB 1BKAA 3IO4A 4O3BA 2DXRA 1I6BA 3P7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYA A;  4FEC A;  4OHN A;  4F1Y A;  1URS A;  1OQH A;  3FXR A;  1ANF A;  1VE4 A;  2PT2 A;  3EHU A;  4M1V A;  3U92 A;  4FAJ A;  2XXY A;  2QS3 A;  1Q1K A;  1OLC A;  3R26 A;  3OO9 A;  3D4G A;  3OO6 A;  1B1X A;  1ZKB A;  1TT1 A;  1HSL A;  4GQO A;  3KEI A;  4ZDM A;  3FVG A;  1JVY A;  2AL4 A;  3ILT B;  5EYF A;  3EQ1 A;  1PEB A;  4BDN A;  4NF6 B;  5H8N A;  4F1V A;  5HPQ A;  4QFK A;  4ZEC A;  4RK2 A;  2XX8 A;  4Q5T A;  1DPE A;  2Y7W A;  2ANJ A;  4JSD A;  4R72 A;  4GL0 A;  4U1Z A;  2Q2C A;  3U93 A;  2P2A A;  1H45 A;  3LC8 A;  4R2F A;  2B4L A;  4KFQ A;  2ZMB A;  3A3U A;  5KDT B;  4KI0 E;  2XXV A;  4ISU A;  4DXU A;  4KD5 A;  4UA8 A;  4H6D A;  1M5C A;  2Z23 A;  4RA1 A;  1MXV A;  5A5X A;  5CBS A;  3JYR A;  3K6V A;  1P1O A;  5AE4 A;  3VLV A;  4DXB A;  4EQ9 A;  1S9T A;  3VDF A;  3G7W A;  2V25 A;  5TPA B;  2UVG A;  3U94 A;  3IOR A;  3OSR A;  4LVQ A;  4KR5 A;  3SET A;  3T96 B;  1HSE A;  3GBA A;  3BFU A;  1Z7M E;  3DP6 A;  3TTN A;  2NWJ A;  3C36 A;  1A99 A;  5I58 A;  4RPN A;  4OFJ A;  3O9P A;  2Z8E A;  1FQB A;  3DLN A;  1US5 A;  4JB7 A;  3CVG A;  1DSN A;  4U4S A;  3T66 A;  2KLF A;  4FE8 A;  1MM7 A;  3Q28 A;  2X7Q A;  3TAJ A;  4WXJ A;  2ZNU A;  2D21 A;  4M4G A;  3SEW A;  4I1D A;  1CE2 A;  4GLI A;  4PET A;  4F3G A;  1B3H A;  1PDA A;  3RN8 A;  2FYI A;  1MS7 A;  3MQ9 A;  1B7U A;  4IO2 A;  1VFD A;  2NXO A;  3O6P A;  4F19 A;  3T22 A;  1MQI A;  3E3K A;  1MQD A;  5JTY B;  4DLD A;  2THI A;  3B6Q A;  4PFU A;  4ZZA A;  1IUD A;  1IEJ A;  3VFJ A;  4I9D A;  3FZV A;  2Q9T A;  2D5W A;  2UYF A;  1LCT A;  1IXI A;  3R6U A;  3KSX A;  1MY1 A;  4P0G A;  4F18 A;  2Q88 A;  4HCY A;  2O1M A;  3IOV A;  3MPL A;  1B0H A;  4YAH X;  3W15 C;  3MZB A;  3VXB A;  3RGY A;  2DVZ A;  2OK2 A;  2OBG A;  3IJO B;  3PUV E;  4RNS A;  3VVD A;  4Z7E A;  3OEK A;  3O6I A;  4KQP A;  4I62 A;  4OTE A;  3C32 A;  3ZS6 A;  1L5T A;  3CRB A;  1UTH B;  4YB6 A;  1R9L A;  1A8E A;  1MG1 A;  1LAX A;  1I6Q A;  4RY1 A;  2M8C A;  4ECF A;  1A40 A;  3MAM A;  2QPQ A;  5TPA A;  4PFY A;  2QJE A;  1MY0 A;  2O69 A;  4HTG A;  4LUB A;  1SD3 A;  2QRY A;  2PX1 A;  3PUX E;  1IQ7 A;  4BDL A;  1FTL A;  2GFE A;  1N04 A;  2DE4 A;  4EF1 A;  2F6G A;  2ZYN A;  3PPQ A;  4FEB A;  1B3L A;  1JNF A;  2XXU A;  2OJT A;  3DRJ A;  3RYB A;  3MC2 A;  3MZ1 A;  3QUF A;  4X48 A;  5DEX B;  3VE1 B;  4R2B A;  2XXW A;  4AB6 A;  1GV8 A;  1RYO A;  3KG2 A;  1NNT A;  5KCJ B;  4R9G A;  4NF8 A;  1ZIU A;  2PT1 A;  3SEY A;  1ZTY A;  3IB0 A;  2XXR A;  3TKD A;  4AB5 A;  3UOR A;  3K02 A;  1H44 A;  2CMO A;  1LBB A;  1WVJ A;  2RF1 A;  3K0V A;  3HPI A;  3SKP A;  4BDO A;  1O64 A;  2B65 A;  3QIM A;  1J1N A;  3OEL A;  2HXW A;  2GRV A;  1QUL A;  3FUZ A;  3IB2 A;  3DRI A;  1GR2 A;  4H8J A;  5JTY A;  4LZ5 A;  1QUK A;  3Q26 A;  4DCY A;  5IAI A;  3BBR A;  2O1L A;  1D4N A;  2IEE A;  3LSW A;  4R6K A;  5I59 B;  4F2Q A;  2B4M A;  2V3T A;  2DOJ A;  2ZYM A;  1NKX A;  3RTF B;  4H5G A;  4DXC A;  3KN7 A;  2WKY A;  3V5A A;  3K4U A;  2AL5 A;  2CZL A;  5M2V A;  4Z0I A;  4C1T A;  5AA2 B;  4OWD A;  1SI1 A;  2Y7R A;  4H5F A;  1SYH A;  1NFT A;  5EHM A;  1WDN A;  4LA9 A;  2UVH A;  3M3K A;  1UTB B;  1B32 A;  3CR9 A;  3FVK A;  1NNP A;  3DP8 A;  3IO6 A;  4NWD A;  3RY3 A;  1P1Q A;  1Z7N E;  2OLB A;  1OMP A;  3MP8 A;  4FAT A;  4POX A;  1D3K A;  3BFT A;  3N6U A;  2HAU A;  4IY5 A;  1RYX A;  2H9B A;  3MBP A;  3FJG A;  2X26 A;  2UVI A;  1TXF A;  2ONK E;  4GXS B;  4FED A;  5I2N B;  1QKA A;  3KN8 A;  3TTK A;  3OO8 A;  4WEP A;  4THI A;  1USY H;  1Y1M A;  4O3A A;  2NVU B;  3H6W A;  5EHS A;  1II5 A;  2VP1 A;  1EU8 A;  2DWJ A;  2H99 A;  3G3J A;  3UP9 A;  5KCJ A;  4E0X A;  3GXA A;  3LSF B;  2QL3 A;  1JQF A;  1LST A;  5H8F B;  1MH3 A;  4BDQ A;  2XX7 A;  1URG A;  3PU5 A;  3O6H A;  2Y7P A;  3TCH A;  1LFI A;  5ICT A;  3EPE A;  3SES A;  3KSJ A;  1N84 A;  3DP4 A;  3OEM A;  4YB7 A;  5H8H B;  4JBZ A;  2HAV A;  3FV2 A;  2W7Y A;  3DRK A;  5L9M A;  2REG A;  2NOO A;  1B3F A;  1SI0 A;  3MWB A;  1BP5 A;  3TZA A;  1GGG A;  2Y7I A;  3CI8 A;  3MVX A;  2GH9 A;  2H5Y A;  3JZJ A;  4ZEI A;  1P1W A;  4OXV A;  3C33 A;  3C4M A;  5CMM A;  3OO7 A;  2X7P A;  2RCA A;  2ONR A;  5I2K B;  4YZZ A;  3MVY A;  1O7T A;  4IO5 A;  1R9Q A;  3G3H A;  4NF4 A;  4G4P A;  1EZ9 A;  1MQH A;  3A3C A;  4YKP A;  1HSJ A;  2I6E A;  3TTL A;  3H06 B;  1UIV A;  3RNN A;  3TEL A;  3KJ7 A;  1IXH A;  4N07 A;  2RC7 A;  3TDJ A;  1M5F A;  4NED A;  2OWS A;  1UTB A;  3UK4 A;  3TUS A;  3EN3 A;  2ESN A;  3RLF E;  4QSD A;  4EQB A;  2BJJ X;  1JW1 A;  2IA4 A;  4QHQ A;  2QS4 A;  4WKM A;  3FXQ A;  4F2O A;  1QW0 A;  4F31 B;  3B6W A;  4ONY A;  1P99 A;  5H8Q A;  4QFN A;  2WOL A;  1TWY A;  3D4C A;  2RC9 A;  4XKN A;  2DXY A;  1SVX B;  1Y20 A;  2QSX A;  1I69 A;  1NL5 A;  1EZP A;  4OZ9 A;  1N7X A;  1Y3Q A;  2V84 A;  3W9W A;  4XKQ A;  3ONM A;  3I5O A;  1YTV A;  1Y9U A;  1LFG A;  2OCU A;  1SW5 A;  4GIZ A;  1FQC A;  3CSB A;  3KZG A;  4G68 A;  4G8M A;  3FJM A;  3L6H A;  3QAX A;  3UIF A;  5AA2 D;  1SBP A;  4NE4 A;  3PMV A;  1R1N A;  1PB9 A;  4PFT A;  4OVJ A;  2F36 A;  1MDQ A;  2YPN A;  3HN0 A;  3PPP A;  4NF5 B;  3VXC A;  3K6X A;  3LVU A;  5ITO A;  5H8H A;  3C31 A;  1PB7 A;  4RJZ A;  1P1U A;  2DWI A;  4EXL A;  3O29 A;  1Y4C A;  1MPB A;  3K1M A;  4H8I A;  2DWH A;  1XVX A;  4G8H A;  3O6G A;  4L17 A;  3HST A;  2Z8F A;  2D3I A;  2OZZ A;  2I48 A;  3I6V A;  2P1S A;  5DTB A;  3O2A A;  3MZ9 A;  2HCA A;  3IK6 B;  1PC3 A;  3RT6 B;  3LR1 A;  4EDP A;  4TLM B;  4MF3 A;  3Q29 A;  3TTR A;  1JW5 A;  1O63 A;  4H0W A;  2RKM A;  3FVO A;  2AYS A;  5FHN A;  4XTC Q;  1LB9 A;  4NF6 A;  4H67 A;  3PPR A;  5DVI A;  4OER A;  3AXF A;  4ZE9 A;  3MJN A;  5HBC A;  4ELQ A;  2Q8J A;  1OQG A;  1OVB A;  3VLW A;  1GVC A;  1M5E A;  1M5D A;  3PUW E;  3FTO A;  2HZK A;  5FHO A;  5KDT A;  5ITP A;  1KWH A;  3IX1 A;  1DTZ A;  3TEP A;  3QXM A;  3OSQ A;  1ELJ A;  1LAF E;  1OVT A;  4Q30 B;  2I4B A;  4MLQ A;  1VSO A;  3MW0 A;  3A09 A;  2VD3 A;  1IIW A;  3H4Z A;  4GFR A;  4OEU A;  3PD9 A;  1FTK A;  4G68 C;  3TQW A;  1Y4T A;  4ZS9 A;  1MRP A;  3G3G A;  2DE2 A;  3PD8 A;  1MXZ A;  2ZYO A;  3UN6 A;  1B3G A;  1USY E;  3HHG A;  5L8D A;  3L6G A;  5ICQ A;  1XS5 A;  4MH5 A;  1MXU A;  3EHS A;  1MXW A;  3CIJ A;  3E13 X;  4RK9 A;  2VGQ A;  2I49 A;  1P1N A;  5AA4 B;  1T0K A;  1TFA A;  1S7Y A;  4YKK A;  5AA3 A;  5CI5 A;  2H25 A;  5I56 B;  4MBP A;  1N3W A;  2XXP A;  1N3X A;  5CMC A;  3TTM A;  2A5S A;  4P0I A;  5TP9 B;  5JK4 A;  4R75 A;  1ZMG A;  1B58 A;  4GRK A;  5I84 A;  4JWY A;  4YKI A;  1FTM A;  1SYI A;  4LQ2 A;  3KJT A;  2OWT A;  3B7D A;  3RUM A;  2F6P A;  2Y7K A;  1B3E A;  3TQL A;  1AMF A;  4EUO A;  2I0B A;  3HCQ A;  1YCJ A;  1N7W A;  4YB5 A;  1NNF A;  1LFH A;  3T9X B;  2LAO A;  3S9L C;  4KPT A;  1QJM A;  2A5T B;  4OFL A;  1OLA A;  2UVJ A;  3M8U A;  2XD3 A;  5CRY A;  5HM4 B;  3CFZ A;  2DP8 A;  3WAE A;  3PPN A;  4R6Y A;  3IOU A;  1JEU A;  4QF9 A;  1MY2 A;  3FJ7 A;  2XX9 A;  4U2R A;  3K00 A;  2FNC A;  4G2Z A;  1MQJ A;  5B70 A;  2E1S A;  2XHD A;  2DS9 A;  3WAF A;  4OEV A;  2O68 A;  2Z8D A;  3H6U A;  3DRH A;  1DTG A;  2F35 A;  3SEX A;  4F39 A;  1N0T A;  1B6H A;  4NMY A;  5CM6 A;  2UXA A;  3OOA A;  3KBR A;  1DPP A;  1B5I A;  4U4X A;  4TQU Q;  4ESX A;  4YKJ A;  3PUY E;  4IGT A;  1UTH A;  1FQE A;  5ISU A;  3PAM A;  5H8N B;  5DYH A;  1FTJ A;  2I0C A;  4AQ4 A;  3TFL A;  4GD5 A;  4LZ7 A;  1B4H A;  1B5J A;  5L9S A;  3GLB A;  2O7I A;  4PQJ A;  1ATG A;  1I6A A;  3Q27 A;  1Y3P A;  1URD A;  1XT8 A;  4ZEK A;  1JVX A;  2DQV A;  1CB6 A;  3HV1 A;  3OXN A;  3K6U A;  4DIG A;  1NH7 A;  1XOC A;  4GWO A;  1MQG A;  5CMK A;  1B05 A;  4R73 A;  4R9F A;  4IO6 A;  3T9H B;  5FTH A;  3G3F A;  3W9V A;  1NNK A;  5AA4 A;  1UIU A;  5DEX A;  5BWJ A;  3FXU A;  2I3V A;  1H3D A;  2ZNS A;  3H3G A;  1MY3 A;  1B40 A;  1ZJL A;  3EHT A;  4G8N A;  4LP2 B;  4QFP A;  2O6A A;  2V93 A;  3O66 A;  3VVE A;  4H1X A;  4PE5 B;  4U21 A;  2GHB A;  1LBC A;  2ZNT A;  5H8S A;  3FV1 A;  5F7V A;  3H6T A;  1MPD A;  3FVN A;  1XVY A;  1NMU A;  3K1N A;  5I58 B;  5LOM A;  1SQY A;  1R6Z A;  4GXA A;  3C35 A;  4IO7 A;  1BTJ A;  5JEI A;  1US4 A;  3S4U A;  3OD7 A;  3T9U A;  4ND9 A;  3FD3 A;  4MLV A;  5I59 A;  1JET A;  2DVC A;  2F8D A;  3ECR A;  4N6P A;  1FQD A;  4ELO A;  1FCK A;  3SER A;  5AA1 A;  3Q25 A;  3V89 B;  1POT A;  1MXX A;  1QKB A;  2RC8 A;  2E0S A;  2VD2 A;  4YMB A;  2ONS A;  5KZT A;  2F7C A;  1S50 A;  1A54 A;  3RQT A;  1LAH E;  1B1H A;  4QSE A;  2GHA A;  3R7X A;  1Y1Z A;  4JSO A;  2ZYK A;  5AA2 A;  2FA7 A;  1F9B A;  4GL8 A;  3CHG A;  4KCD A;  2O7U A;  3G3I A;  3MP6 A;  4DE8 A;  2V3U A;  1B9J A;  4RPO A;  2YLN A;  1B4Z A;  3HHF A;  5K2Y A;  1XHY A;  4OET A;  3S9E A;  1B0L A;  4YMA A;  4DCX A;  2XXT A;  3QK6 A;  1PBP A;  3K2D A;  4P11 A;  3ZKK A;  3G3K A;  2WOK A;  2G93 A;  3CG1 A;  5I2N A;  3IOW A;  4BDR A;  3IL1 B;  4OQO A;  1LCF A;  3FAS A;  4KYE A;  2AIX A;  4IY6 A;  3H7M A;  4OYV A;  3DEL B;  3PUZ E;  4MFI A;  2I58 A;  1B52 A;  4X9T A;  4OFO A;  1BLF A;  1AH5 A;  3S9M C;  3E4R A;  4ZE8 A;  3M3L A;  3ZKL A;  1MDP 1;  2HEU A;  4YU0 A;  4JWO A;  5K2X A;  3KFM A;  4OEN A;  2PMS A;  2I3W A;  2ALU A;  1ZU0 A;  2UYE A;  1MM6 A;  5H8F A;  1ZLQ A;  3F11 A;  4KYD A;  4LZ8 A;  1RKM A;  4LQ5 A;  3MPK A;  1Q35 A;  4EXK A;  1PBQ A;  2DE3 A;  4JWX A;  1LAG E;  2Q2A A;  3QYT A;  5F1Q A;  1AL3 A;  1N76 A;  3TMG A;  4ELR A;  3LUY A;  3RPW A;  2XXX A;  5L9O A;  4FJP A;  4WED A;  2YJP A;  3C9H A;  3PGF A;  4IGR A;  4NF8 B;  4IB2 A;  1A7L A;  4NWC A;  2RCB A;  4X1B A;  3M3F A;  4DZ1 A;  4RXL A;  1IZ1 A;  5I2K A;  2B3F A;  4TOZ A;  3K6W A;  3S9N C;  2HZL A;  2F7B A;  2XXI A;  2WOP A;  4BLA A;  2ZXT A;  1FTO A;  3KOS A;  1D9Y A;  3ZSF A;  3EF7 A;  3O28 A;  1EZO A;  3KGC A;  1JEV A;  2I4C A;  3LSL A;  3ILU B;  1AOV A;  3O97 A;  3B6T A;  2HQ0 A;  4R6H A;  3TCF A;  4N13 A;  1LGB C;  1MPC A;  3PPO A;  4DDD A;  5DVF A;  5IKB A;  2P0S A;  1Y3N A;  3U8Q A;  3OMB A;  5ELV A;  1SW1 A;  4GVO A;  2F34 A;  3E9X A;  2DSF A;  3MVW A;  1VFE A;  3MVZ A;  1LLS A;  2DWA A;  4PFW A;  4XKP A;  1SW4 A;  3PMX A;  4XKR A;  4YIC A;  4ELP A;  4K3F A;  3N6T A;  2VHA A;  4QRZ A;  3CFX A;  3N5L A;  1B5H A;  3IOT A;  3FAT A;  3IJX B;  5I57 B;  3UA8 A;  2RIN A;  4NTL A;  4Q8R A;  5CMB A;  4ESW A;  5CBR A;  3RYA A;  1B46 A;  3TCG A;  2DYX A;  4F3B A;  1MH4 A;  3RTW B;  3T9V A;  1JW4 A;  4H65 A;  4U22 A;  2H4I A;  2B3B A;  3V83 A;  3OEN A;  2QMX A;  3H6V A;  4GF8 A;  3C34 A;  5CC2 A;  1B2H A;  3K1P A;  4JDF A;  4OMB A;  4BDM A;  4G77 A;  3LSX A;  1ZBM A;  4NF5 A;  3I3V A;  4EF2 A;  5B7D A;  2F7A A;  1QUJ A;  4Q0C A;  4POW A;  1SW2 A;  4O3C A;  4C0R A;  3FIR A;  1A55 A;  3PMW A;  1QVS A;  1B51 A;  1B7Z A;  5FTI A;  5FHM A;  4ZEB A;  3TYH A;  3ODB A;  1DMB A;  2ABH A;  2REJ A;  1D9V A;  1XC1 A;  3VV5 A;  4ZED A;  4HW8 A;  1IIT A;  1MY4 A;  1POY 1;  5DVJ A;  4PP0 A;  1AIV A;  2F5X A;  3RT8 A;  4I8C A;  3TPA A;  2H98 A;  4ZZE A;  3N26 A;  1FQA A;  1H76 A;  2XXH A;  3U1O A;  4QFL A;  2F97 A;  2XD2 A;  3KOT A;  4KCC A;  3TOD A;  4U23 A;  2G29 A;  1M5B A;  4HCW A;  3K01 A;  4QSC A;  3VVF A;  4IO4 A;  2XXQ A;  4KHZ E;  4E0W A;  1MXY A;  3T93 B;  2R71 A;  2O51 A;  4JXI A;  3USD A;  5J1D A;  3SEU A;  3FGS A;  4NF4 B;  2QS1 A;  1FW0 A;  3QUJ A;  1B7H A;  4F22 A;  4X1D A;  1YPN A;  3CSG A;  3N94 A;  1VR5 A;  1QUI A;  2PYY A;  1TFD A;  4U1O A;  3JV9 A;  3SDF A;  3IAZ A;  4XIG Q;  5I57 A;  3THI A;  3U72 A;  4TLL B;  3HO7 A;  2VOZ A;  2PVU A;  2R6G E;  3BKI B;  3KN3 A;  1A8F A;  3H03 A;  3SEV A;  4F3P A;  4OES A;  1BIY A;  2O84 X;  2PBW A;  3DRF A;  4QFO A;  5H8Q B;  1PB8 A;  1LB8 A;  3IB1 A;  1IXG A;  4EQ7 A;  5TU0 A;  4XXU A;  1OIB A;  3DRG A;  1SDX A;  5A5X B;  2HFB A;  1WOD A;  1YAE A;  3CG3 A;  5BUU A;  1FQF A;  1H43 A;  2Y84 A;  3QSL A;  1DOT A;  3DM0 A;  1GTK A;  3V8X B;  2Z22 A;  5DT6 A;  4C1U A;  4F1U A;  2Q89 A;  2NUV A;  5I56 A;  2F78 A;  2QMW A;  3UGW A;  4IO3 A;  4UAC A;  4G68 B;  1EH3 A;  3MP1 A;  3GZG A;  5TP9 A;  3CFL A;  1UQW A;  3LBS A;  4LAT A;  2QS2 A;  4FOR A;  4F29 A;  3MUQ A;  1NH8 A;  3PV0 E;  4FIM A;  4F3S A;  3VLU A;  2R9J A;  3GBB A;  1IXC A;  2V3Q A;  4R74 A;  4GOT A;  4ZEF A;  4HS7 A;  2A5T A;  4KYS A;  3IR1 A;  3S2V A;  4LON B;  1BKA A;  3IO4 A;  4O3B A;  2DXR A;  1I6B A;  3P7I A; 
#chains in the Genus database with same CATH topology
 4RYA A;  4FEC A;  4OHN A;  1NUX A;  4F1Y A;  1URS A;  1OQH A;  3FXR A;  4HXV A;  1ANF A;  1VE4 A;  4PGP A;  2PT2 A;  3EHU A;  3MST A;  4M1V A;  3U92 A;  2ZZV A;  4FAJ A;  2XXY A;  2QS3 A;  1Q1K A;  1OLC A;  3R26 A;  3OO9 A;  3D4G A;  3OO6 A;  1B1X A;  1ZKB A;  1TT1 A;  1HSL A;  4GQO A;  3KEI A;  4ZDM A;  3FVG A;  1JVY A;  2AL4 A;  1YZ0 A;  3ILT B;  5DW8 A;  5EYF A;  3EQ1 A;  1PEB A;  4PDD A;  3A29 A;  4BDN A;  4NF6 B;  5H8N A;  4F1V A;  5HPQ A;  4QFK A;  2BJI A;  4ZEC A;  4RK2 A;  2XX8 A;  4Q5T A;  3U65 A;  1DPE A;  1NV4 A;  2Y7W A;  2ANJ A;  3BIG A;  4JSD A;  4R72 A;  2QFL A;  4GL0 A;  4U1Z A;  2Q2C A;  4GWX A;  3U93 A;  2P2A A;  1H45 A;  4GX3 A;  3LC8 A;  4R2F A;  2B4L A;  4KFQ A;  4OA4 A;  2ZMB A;  3A3U A;  5KDT B;  4KI0 E;  2XXV A;  4ISU A;  4DXU A;  4KD5 A;  4UA8 A;  1FRP A;  4H6D A;  1M5C A;  2Z23 A;  4RA1 A;  1MXV A;  5A5X A;  5CBS A;  3JYR A;  1FBH A;  3K6V A;  1P1O A;  5AE4 A;  3VLV A;  4DXB A;  1FPG A;  4EQ9 A;  1S9T A;  1FPF A;  3VDF A;  3G7W A;  2V25 A;  5TPA B;  2UVG A;  3LV0 A;  1G0I A;  3U94 A;  3IOR A;  3OSR A;  4LVQ A;  4KR5 A;  3SET A;  3T96 B;  1HSE A;  3GBA A;  3BFU A;  1Z7M E;  3DP6 A;  1IMC A;  2PCR A;  3TTN A;  2NWJ A;  3C36 A;  1A99 A;  5I58 A;  4RPN A;  4OFJ A;  3O9P A;  2Z8E A;  1FQB A;  3DLN A;  1US5 A;  4JB7 A;  3CVG A;  3ROJ A;  1DSN A;  4U4S A;  3T66 A;  4N6K A;  2KLF A;  4FE8 A;  1MM7 A;  3Q28 A;  2X7Q A;  3TAJ A;  4WXJ A;  4NHB A;  2ZNU A;  1KA1 A;  2D21 A;  4M4G A;  3SEW A;  4I1D A;  1CE2 A;  3HFU A;  4GLI A;  4PET A;  4F3G A;  1B3H A;  1FPJ A;  1PDA A;  3RN8 A;  2FYI A;  1MS7 A;  3MQ9 A;  5ET5 A;  1B7U A;  4IO2 A;  1VFD A;  2NXO A;  3RPL B;  3O6P A;  4F19 A;  3T22 A;  1MQI A;  4NX1 A;  3E3K A;  1MQD A;  5JTY B;  4DLD A;  4PFB A;  2THI A;  3B6Q A;  4PFU A;  4ZZA A;  1IUD A;  1IEJ A;  3VFJ A;  4I9D A;  1VDW A;  4PBH A;  2HXR A;  3FZV A;  2Q9T A;  2D5W A;  2UYF A;  1LCT A;  1IXI A;  3R6U A;  3KSX A;  1MY1 A;  4P0G A;  4PDH A;  4F18 A;  2Q88 A;  1NV5 A;  4HCY A;  2O1M A;  3IOV A;  3MPL A;  1B0H A;  4YAH X;  3W15 C;  3MZB A;  3VXB A;  3RGY A;  2DVZ A;  2OK2 A;  2OBG A;  3IJO B;  4O7M A;  2VT5 A;  3PUV E;  4RNS A;  4X8R A;  3VVD A;  4Z7E A;  3OEK A;  1D9Q A;  3O6I A;  4KQP A;  4I62 A;  4OTE A;  3C32 A;  3ZS6 A;  1L5T A;  3CRB A;  1UTH B;  4YB6 A;  1R9L A;  1A8E A;  1MG1 A;  1LAX A;  1I6Q A;  5I3S A;  4RY1 A;  2M8C A;  4ECF A;  1A40 A;  3MAM A;  2QPQ A;  4UAB A;  5TPA A;  5LDZ A;  4PFY A;  2QJE A;  1MY0 A;  2O69 A;  4HTG A;  4LUB A;  1SD3 A;  2QRY A;  2PX1 A;  5J16 A;  1NI9 A;  3PUX E;  5EYG A;  1IQ7 A;  3RYD A;  4BDL A;  1FTL A;  2GFE A;  1N04 A;  2DE4 A;  4EF1 A;  2F6G A;  2ZYN A;  3PPQ A;  4FEB A;  1B3L A;  1JNF A;  2XXU A;  2OJT A;  3B50 A;  3DRJ A;  3RYB A;  3MC2 A;  3MZ1 A;  3QUF A;  4X48 A;  4PF8 A;  5DEX B;  3VE1 B;  4R2B A;  2XXW A;  4AB6 A;  1GV8 A;  1RYO A;  3KG2 A;  1NNT A;  5KCJ B;  3KC1 A;  4R9G A;  4NF8 A;  1ZIU A;  4NF0 A;  2PT1 A;  3SEY A;  1ZTY A;  3IB0 A;  2XXR A;  3TKD A;  4AB5 A;  3UOR A;  3K02 A;  1LBX A;  1H44 A;  2OX3 A;  4N6D A;  2CEX A;  2CMO A;  1LBB A;  1WVJ A;  2RF1 A;  3K0V A;  3HPI A;  3SKP A;  4BDO A;  1O64 A;  2B65 A;  3QIM A;  4MNC A;  1J1N A;  2XXK A;  3OEL A;  2HXW A;  2GRV A;  4HE2 A;  1QGX A;  2WX9 A;  1QUL A;  3FUZ A;  3IB2 A;  3DRI A;  1GR2 A;  4H8J A;  5JTY A;  4LZ5 A;  1QUK A;  3Q26 A;  4DCY A;  5IAI A;  3BBR A;  4GBW A;  4I3Y A;  2O1L A;  1AWB A;  1D4N A;  2IEE A;  3LSW A;  4R6K A;  5I59 B;  4F2Q A;  2B4M A;  2V3T A;  4FBP A;  2DOJ A;  1CNQ A;  2ZYM A;  1NKX A;  3FBP A;  5IGA A;  3RTF B;  4IR8 A;  4H5G A;  4DXC A;  5IZ1 A;  3KN7 A;  2WKY A;  3V5A A;  3K4U A;  2AL5 A;  2CZL A;  5M2V A;  4Z0I A;  4C1T A;  2XWK A;  5AA2 B;  4OWD A;  1SI1 A;  2Y7R A;  4H5F A;  1SYH A;  1NFT A;  5EHM A;  1WDN A;  4LA9 A;  2UVH A;  3M3K A;  1UTB B;  1B32 A;  3CR9 A;  3FVK A;  1NNP A;  3DP8 A;  3IO6 A;  3MYU A;  4NWD A;  3RY3 A;  1P1Q A;  1Z7N E;  2OLB A;  1OMP A;  3MP8 A;  4FAT A;  4POX A;  1D3K A;  3BFT A;  2CZH A;  3N6U A;  2HAU A;  4IY5 A;  1RYX A;  3NOH A;  2H9B A;  1FPL A;  2P3N A;  3MBP A;  3FJG A;  2X26 A;  4MNI A;  2UVI A;  1TXF A;  2ONK E;  4GXS B;  4FED A;  5I2N B;  1QKA A;  3KN8 A;  5I5P A;  3TTK A;  3OO8 A;  4JVD A;  2HHM A;  4WEP A;  1NV6 A;  4THI A;  1USY H;  1Y1M A;  4O3A A;  2NVU B;  3H6W A;  5EHS A;  1II5 A;  2VP1 A;  1EU8 A;  2DWJ A;  2FHY A;  2H99 A;  4N4U A;  3G3J A;  3UP9 A;  5KCJ A;  4E0X A;  3GXA A;  3LSF B;  2QVR A;  2QL3 A;  1JQF A;  1LST A;  5H8F B;  1MH3 A;  4BDQ A;  2XX7 A;  1URG A;  3PU5 A;  3O6H A;  2Y7P A;  3TCH A;  1LFI A;  5ICT A;  3EPE A;  3SES A;  2ZZW A;  3KSJ A;  1N84 A;  3DP4 A;  1K9Y A;  3OEM A;  4YB7 A;  5H8H B;  4JBZ A;  2HAV A;  3FV2 A;  2W7Y A;  3DRK A;  5L9M A;  2REG A;  2NOO A;  1B3F A;  1SI0 A;  3MWB A;  1BP5 A;  3TZA A;  1GGG A;  2Y7I A;  3CI8 A;  4AS5 A;  4OAN A;  3E78 A;  3MVX A;  2GH9 A;  2Y5L A;  2H5Y A;  4QXD A;  3JZJ A;  4ZEI A;  1P1W A;  1EYI A;  4OXV A;  3C33 A;  3C4M A;  4GX6 A;  5CMM A;  4AS4 A;  3OO7 A;  2X7P A;  2RCA A;  2ONR A;  5I2K B;  4YZZ A;  3MVY A;  1O7T A;  4IO5 A;  1R9Q A;  3G3H A;  4NF4 A;  5ESY A;  4G4P A;  1EZ9 A;  1MQH A;  3A3C A;  4YKP A;  1HSJ A;  2I6E A;  1LBV A;  3TTL A;  3H06 B;  1UIV A;  2PFY A;  3RNN A;  4PFI A;  3TEL A;  3KJ7 A;  1IXH A;  4N07 A;  2HPG A;  2RC7 A;  3PTY A;  3TDJ A;  1IMB A;  1M5F A;  1FPB A;  4NED A;  2OWS A;  1UTB A;  3UK4 A;  3TUS A;  1IMD A;  2QVV A;  3EN3 A;  2ESN A;  4GX4 A;  3RLF E;  4QSD A;  4EQB A;  2BJJ X;  1JW1 A;  2IA4 A;  4QHQ A;  4NGU A;  2QS4 A;  3T1B A;  4WKM A;  3FXQ A;  4F2O A;  1QW0 A;  4PAK A;  3GYY A;  4F31 B;  3B6W A;  1KZ8 A;  4ONY A;  1P99 A;  5H8Q A;  4QFN A;  2WOL A;  1TWY A;  3D4C A;  2RC9 A;  4XKN A;  5I7I A;  2DXY A;  1SVX B;  1Y20 A;  2QSX A;  1I69 A;  4P9K A;  1NL5 A;  1EZP A;  4OZ9 A;  5ET8 A;  1DBZ A;  1N7X A;  1Y3Q A;  2V84 A;  3W9W A;  4XKQ A;  3ONM A;  3I5O A;  4PC9 A;  1YTV A;  1Y9U A;  1LFG A;  2OCU A;  4PBQ A;  1SW5 A;  3IFC A;  4GIZ A;  1FQC A;  3CSB A;  3KZG A;  4G68 A;  4PF6 A;  4G8M A;  3FJM A;  3L6H A;  3QAX A;  3UIF A;  5AA2 D;  1SBP A;  4NE4 A;  3PMV A;  1R1N A;  1PB9 A;  4PFT A;  4OVJ A;  1LBY A;  2F36 A;  4P1E A;  1MDQ A;  2YPN A;  3HN0 A;  3PPP A;  4NF5 B;  3VXC A;  1IMA A;  3K6X A;  3LVU A;  4N8G A;  5ITO A;  1FBG A;  5H8H A;  2Q8M A;  3C31 A;  1PB7 A;  4RJZ A;  1P1U A;  2DWI A;  4N17 A;  4EXL A;  3O29 A;  1Y4C A;  5IZZ A;  1IME A;  1MPB A;  2VPN A;  3K1M A;  4H8I A;  2DWH A;  1XVX A;  4QBA A;  4G8H A;  3O6G A;  5EQ8 A;  4L17 A;  3HST A;  2Z8F A;  2D3I A;  2JJK A;  2OZZ A;  4MEV A;  2I48 A;  3I6V A;  1RDZ A;  4H46 A;  5IZ3 B;  2P1S A;  5DTB A;  3O2A A;  3MZ9 A;  2HCA A;  3IK6 B;  1PC3 A;  3RT6 B;  3LR1 A;  4EDP A;  4PAF A;  4TLM B;  1RDX A;  4MF3 A;  3Q29 A;  3TTR A;  2FBP A;  1JW5 A;  4P3L A;  1O63 A;  4H0W A;  2RKM A;  3FVO A;  2AYS A;  5FHN A;  4XTC Q;  1LB9 A;  4NF6 A;  4H67 A;  3PPR A;  1RDY A;  5DVI A;  2L5V A;  4OER A;  3AXF A;  4ZE9 A;  3MJN A;  4N91 A;  5HBC A;  4ELQ A;  2Q8J A;  1OQG A;  1OVB A;  3VLW A;  1GVC A;  1M5E A;  1M5D A;  4P47 A;  3PUW E;  3FTO A;  2HZK A;  5FHO A;  5KDT A;  1NV2 A;  5ITP A;  1KWH A;  3IX1 A;  1DTZ A;  3TEP A;  3QXM A;  3OSQ A;  4MAG A;  1ELJ A;  1LAF E;  1OVT A;  4Q30 B;  2I4B A;  4MLQ A;  2WYK A;  1NV3 A;  1VSO A;  3MW0 A;  3A09 A;  2VD3 A;  1DCU A;  1IIW A;  4DI4 B;  1INP A;  3H4Z A;  4GFR A;  4OEU A;  3PD9 A;  1FTK A;  4G68 C;  3TQW A;  1Y4T A;  4ZS9 A;  1MRP A;  3G3G A;  2DE2 A;  3PD8 A;  4G61 A;  1MXZ A;  2ZYO A;  3UN6 A;  1B3G A;  4I40 A;  1KA0 A;  3LUZ A;  1USY E;  3HHG A;  5L8D A;  3L6G A;  5ICQ A;  1XS5 A;  4MH5 A;  2CZI A;  1MXU A;  3EHS A;  1MXW A;  3CIJ A;  3E13 X;  4RK9 A;  2VGQ A;  2I49 A;  1P1N A;  5AA4 B;  1T0K A;  1TFA A;  2P3V A;  1S7Y A;  4YKK A;  5AA3 A;  5CI5 A;  2H25 A;  5I56 B;  4MBP A;  4XFE A;  1N3W A;  2XXP A;  1N3X A;  5CMC A;  3TTM A;  2A5S A;  4NAP A;  4P0I A;  5TP9 B;  5JK4 A;  4R75 A;  1ZMG A;  1B58 A;  4GRK A;  5I84 A;  4JWY A;  4YKI A;  1FTM A;  1SYI A;  4LQ2 A;  3KJT A;  2OWT A;  1FBF A;  3B7D A;  3RPL A;  3RUM A;  2VPO A;  2F6P A;  4N8Y A;  2Y7K A;  1B3E A;  3TQL A;  1AMF A;  2F3D A;  4EUO A;  2I0B A;  3HCQ A;  1YCJ A;  1N7W A;  4YB5 A;  1NNF A;  1LFH A;  3T9X B;  2LAO A;  3S9L C;  4KPT A;  1QJM A;  2A5T B;  4OFL A;  1OLA A;  2CZK A;  2UVJ A;  3M8U A;  2XA5 A;  2XD3 A;  5CRY A;  5HM4 B;  3CFZ A;  2DP8 A;  3WAE A;  3QMF A;  3PPN A;  4R6Y A;  3IOU A;  1JEU A;  4QF9 A;  1FTA A;  1MY2 A;  3FJ7 A;  4MX6 A;  2WEF A;  2XX9 A;  4U2R A;  3K00 A;  2FNC A;  4G2Z A;  1MQJ A;  5B70 A;  2E1S A;  2XHD A;  1FBE A;  2DS9 A;  3WAF A;  2XWI A;  4OEV A;  2O68 A;  2Z8D A;  3H6U A;  3DRH A;  1DTG A;  2F35 A;  3SEX A;  4F39 A;  1N0T A;  1B6H A;  4NMY A;  5CM6 A;  4XF5 A;  2UXA A;  3OOA A;  3KBR A;  1DPP A;  1B5I A;  4U4X A;  4TQU Q;  4ESX A;  4YKJ A;  3PUY E;  4IGT A;  1UTH A;  1FQE A;  5ISU A;  3PAM A;  1SPI A;  5H8N B;  5DYH A;  1FTJ A;  2I0C A;  4AQ4 A;  5EYH A;  3TFL A;  4GD5 A;  4LZ7 A;  1B4H A;  1B5J A;  5L9S A;  3GLB A;  2O7I A;  4PQJ A;  1ATG A;  1I6A A;  3Q27 A;  4P56 A;  1Y3P A;  2KQZ A;  1URD A;  1XT8 A;  4ZEK A;  1JVX A;  2DQV A;  1CB6 A;  3HV1 A;  1LBW A;  5LTC A;  1FPD A;  3OXN A;  3K6U A;  4DIG A;  1NH7 A;  1XOC A;  4GWO A;  1MQG A;  2OWZ A;  5CMK A;  1B05 A;  4R73 A;  4R9F A;  4IO6 A;  3T9H B;  5FTH A;  3G3F A;  3W9V A;  1NNK A;  5AA4 A;  2XWO A;  1UIU A;  5DEX A;  5BWJ A;  3FXU A;  2I3V A;  1H3D A;  2ZNS A;  3H3G A;  1MY3 A;  1B40 A;  1ZJL A;  3EHT A;  4G8N A;  1FBD A;  4HE0 A;  4LP2 B;  4QFP A;  2O6A A;  2V93 A;  3O66 A;  3VVE A;  4H1X A;  4PE5 B;  4U21 A;  2GHB A;  1LBC A;  2ZNT A;  5H8S A;  3FV1 A;  5F7V A;  1LBZ A;  1MPD A;  3H6T A;  3FVN A;  1XVY A;  1NMU A;  3K1N A;  5I58 B;  1FBP A;  5EQ7 A;  5LOM A;  1SQY A;  2GQ1 A;  1R6Z A;  1FJ9 A;  4GXA A;  3C35 A;  4IO7 A;  4PAI A;  1BTJ A;  5JEI A;  4I3E A;  4O7I A;  1US4 A;  2F3B A;  3S4U A;  3OD7 A;  3T9U A;  4ND9 A;  3FD3 A;  4MLV A;  5I59 A;  1JET A;  4P8B A;  2DVC A;  2F8D A;  3ECR A;  4N6P A;  1FQD A;  4ELO A;  1FCK A;  3SER A;  5AA1 A;  3Q25 A;  3V89 B;  1POT A;  1MXX A;  1QKB A;  2RC8 A;  2E0S A;  2VD2 A;  2WBB A;  4YMB A;  2ONS A;  5KZT A;  2F7C A;  1S50 A;  1A54 A;  3RQT A;  1LAH E;  1B1H A;  4QSE A;  2GHA A;  3R7X A;  1Y1Z A;  4JSO A;  2ZYK A;  5AA2 A;  4PGN A;  2FA7 A;  1F9B A;  4GL8 A;  4N81 A;  1FPI A;  4MIJ A;  3CHG A;  3D1R A;  4KCD A;  2FVZ A;  2O7U A;  3G3I A;  3MP6 A;  4DE8 A;  2V3U A;  1B9J A;  3T0J A;  4RPO A;  1FJ6 A;  5EQ9 A;  2YLN A;  1B4Z A;  4DI3 D;  1DK4 A;  4H45 A;  3HHF A;  5K2Y A;  1XHY A;  4OET A;  3S9E A;  1B0L A;  2ZZX A;  4YMA A;  4DCX A;  2XXT A;  2V4C A;  3QK6 A;  1PBP A;  2WBD A;  3K2D A;  4P11 A;  4XEQ A;  3ZKK A;  3G3K A;  1FPK A;  2WOK A;  2G93 A;  3CG1 A;  5I2N A;  3IOW A;  4BDR A;  3IL1 B;  4OQO A;  1LCF A;  3FAS A;  4KYE A;  2AIX A;  5F24 A;  4IY6 A;  3H7M A;  4OYV A;  4X04 A;  3DEL B;  3PUZ E;  4MFI A;  2I58 A;  1B52 A;  4X9T A;  4OFO A;  1BLF A;  1AH5 A;  3S9M C;  3E4R A;  4ZE8 A;  3SZP A;  2KR0 A;  3M3L A;  3ZKL A;  1MDP 1;  2HEU A;  4YU0 A;  4JWO A;  5K2X A;  3KFM A;  4OEN A;  2PMS A;  2I3W A;  3KC0 A;  2ALU A;  4OVS A;  1ZU0 A;  2UYE A;  1MM6 A;  5H8F A;  1ZLQ A;  3F11 A;  3KBZ A;  4PE3 A;  4KYD A;  4LZ8 A;  1RKM A;  1G0H A;  4LQ5 A;  3MPK A;  1Q35 A;  4EXK A;  4HE1 A;  2FIE A;  2Y5K A;  1PBQ A;  2DE3 A;  5ET6 A;  4JWX A;  1LAG E;  2Q2A A;  3QYT A;  5F1Q A;  1AL3 A;  1N76 A;  3TMG A;  4ELR A;  3LUY A;  4O94 A;  3RPW A;  2XXX A;  5L9O A;  4FJP A;  1XI6 A;  4WED A;  2YJP A;  3C9H A;  3PGF A;  4PFR A;  4IGR A;  4NF8 B;  3IFA A;  4IB2 A;  1A7L A;  4NWC A;  2RCB A;  4X1B A;  3M3F A;  4DZ1 A;  4RXL A;  1IZ1 A;  5I2K A;  2B3F A;  4TOZ A;  3K6W A;  3S9N C;  2HZL A;  2F7B A;  2XXI A;  2WOP A;  1FBC A;  4BLA A;  2FIX A;  2ZXT A;  1FTO A;  3KOS A;  1D9Y A;  3ZSF A;  3EF7 A;  3O28 A;  1EZO A;  3KGC A;  1JEV A;  2I4C A;  3LSL A;  3ILU B;  1AOV A;  4MNP A;  3O97 A;  1NV1 A;  3B6T A;  2HQ0 A;  1LEV A;  4R6H A;  3TCF A;  4N13 A;  5IM2 A;  1LGB C;  1MPC A;  3PPO A;  4DDD A;  5DVF A;  4MJO A;  5IKB A;  2P0S A;  1Y3N A;  3U8Q A;  3OMB A;  5ELV A;  1SW1 A;  4GVO A;  2F34 A;  1YYZ A;  3E9X A;  2DSF A;  3MVW A;  1VFE A;  3MVZ A;  1LLS A;  1FPE A;  2DWA A;  4PFW A;  4NQ8 A;  4XKP A;  1SW4 A;  3PMX A;  4XKR A;  4YIC A;  4GWY A;  4ELP A;  4K3F A;  3N6T A;  1BK4 A;  2VHA A;  4QRZ A;  3CFX A;  3N5L A;  1B5H A;  3IOT A;  3FAT A;  3IJX B;  5I57 B;  4JVC A;  3UA8 A;  4GWW A;  1NV0 A;  1JP4 A;  5A5L A;  2RIN A;  4NTL A;  4PCD A;  4MMP A;  4Q8R A;  5CMB A;  2XWV A;  4ESW A;  3RYA A;  5CBR A;  1B46 A;  3TCG A;  2DYX A;  4JVI A;  4F3B A;  1MH4 A;  3RTW B;  3T9V A;  1JW4 A;  4H65 A;  4U22 A;  2H4I A;  2B3B A;  3V83 A;  3OEN A;  2QMX A;  2R8T A;  1EYK A;  2QVU A;  3H6V A;  4GWZ A;  4GF8 A;  3C34 A;  5CC2 A;  1B2H A;  3K1P A;  4P1L A;  1NV7 A;  4JDF A;  4OMB A;  4BDM A;  2CEY A;  4G77 A;  3LSX A;  1ZBM A;  4NF5 A;  3I3V A;  4EF2 A;  5B7D A;  2F7A A;  1QUJ A;  4Q0C A;  4POW A;  2DDK A;  1SW2 A;  2Q74 A;  4O3C A;  4PTK A;  4C0R A;  3FIR A;  1A55 A;  3PMW A;  1QVS A;  1B51 A;  1B7Z A;  5FTI A;  5FHM A;  4ZEB A;  3FXB A;  4OVQ A;  3TYH A;  5T3J A;  3ODB A;  1DMB A;  1NUW A;  2ABH A;  2REJ A;  1D9V A;  1XC1 A;  3VV5 A;  4ZED A;  4NG7 A;  4HW8 A;  1IIT A;  1MY4 A;  1POY 1;  5DVJ A;  3ISP A;  4PP0 A;  1AIV A;  4GWU A;  2F5X A;  5IZ3 A;  3RT8 A;  5ET7 A;  4I8C A;  3TPA A;  2H98 A;  4ZZE A;  3N26 A;  1FQA A;  1H76 A;  2XXH A;  3U1O A;  4QFL A;  2F97 A;  2XD2 A;  3KOT A;  4OVP A;  4KXP A;  4MHF A;  4KCC A;  3B8B A;  4MCO A;  3TOD A;  3E79 A;  4U23 A;  1Q9D A;  2G29 A;  1M5B A;  4HCW A;  3K01 A;  4QSC A;  3VVF A;  3EKI A;  4IO4 A;  2XXQ A;  1NUZ A;  4KHZ E;  4E0W A;  1MXY A;  3T93 B;  2R71 A;  2O51 A;  4JXI A;  3USD A;  5J1D A;  1NUY A;  3SEU A;  3FGS A;  4NF4 B;  2QS1 A;  1FW0 A;  3QUJ A;  1B7H A;  4F22 A;  4X1D A;  1YPN A;  3CSG A;  3N94 A;  1VR5 A;  1QUI A;  2PYY A;  2PFZ A;  1TFD A;  4U1O A;  3JV9 A;  3SDF A;  3IAZ A;  4XIG Q;  5I57 A;  3THI A;  3U72 A;  4TLL B;  3HO7 A;  2VOZ A;  2PVU A;  2R6G E;  3BKI B;  3KN3 A;  1A8F A;  3H03 A;  3SEV A;  4F3P A;  4GWS A;  4OES A;  1BIY A;  2O84 X;  2PBW A;  3DRF A;  1FSA A;  4QFO A;  4GBV A;  5H8Q B;  1YXI A;  4NN3 A;  1PB8 A;  1LB8 A;  3IB1 A;  4LN5 A;  1IXG A;  4EQ7 A;  5TU0 A;  4XXU A;  1OIB A;  3DRG A;  1SDX A;  5A5X B;  2HFB A;  1WOD A;  1YAE A;  3CG3 A;  5BUU A;  1EYJ A;  1FQF A;  1H43 A;  2Y84 A;  4O8M A;  2MKZ A;  3QSL A;  1DOT A;  3DM0 A;  1GTK A;  1K9Z A;  3V8X B;  2Z22 A;  5DT6 A;  4C1U A;  4F1U A;  2Q89 A;  2NUV A;  5FBP A;  5I56 A;  2F78 A;  2QMW A;  4IO3 A;  4UAC A;  3UGW A;  4G68 B;  1EH3 A;  3MP1 A;  3GZG A;  5TP9 A;  5EQA A;  3CFL A;  4OVT A;  2WYP A;  1UQW A;  3LBS A;  4LAT A;  2QS2 A;  4FOR A;  4F29 A;  3MUQ A;  1NH8 A;  3PV0 E;  4FIM A;  4F3S A;  3VLU A;  2R9J A;  3GBB A;  1IXC A;  4N15 A;  2V3Q A;  4OVR A;  4R74 A;  3BIH A;  1IMF A;  4GOT A;  4ZEF A;  4HS7 A;  2A5T A;  4KYS A;  3IR1 A;  3S2V A;  4LON B;  1BKA A;  3IO4 A;  4O3B A;  2DXR A;  1I6B A;  3P7I A; 
#chains in the Genus database with same CATH homology
 4RYA A;  4FEC A;  4OHN A;  4F1Y A;  1URS A;  1OQH A;  3FXR A;  1ANF A;  1VE4 A;  2PT2 A;  3EHU A;  4M1V A;  3U92 A;  4FAJ A;  2XXY A;  2QS3 A;  1Q1K A;  1OLC A;  3R26 A;  3OO9 A;  3D4G A;  3OO6 A;  1B1X A;  1ZKB A;  1TT1 A;  1HSL A;  4GQO A;  3KEI A;  4ZDM A;  3FVG A;  1JVY A;  2AL4 A;  3ILT B;  5EYF A;  3EQ1 A;  1PEB A;  4BDN A;  4NF6 B;  5H8N A;  4F1V A;  5HPQ A;  4QFK A;  4ZEC A;  4RK2 A;  2XX8 A;  4Q5T A;  1DPE A;  2Y7W A;  2ANJ A;  4JSD A;  4R72 A;  4GL0 A;  4U1Z A;  2Q2C A;  3U93 A;  2P2A A;  1H45 A;  3LC8 A;  4R2F A;  2B4L A;  4KFQ A;  2ZMB A;  3A3U A;  5KDT B;  4KI0 E;  2XXV A;  4ISU A;  4DXU A;  4KD5 A;  4UA8 A;  4H6D A;  1M5C A;  2Z23 A;  4RA1 A;  1MXV A;  5A5X A;  5CBS A;  3JYR A;  3K6V A;  1P1O A;  5AE4 A;  3VLV A;  4DXB A;  4EQ9 A;  1S9T A;  3VDF A;  3G7W A;  2V25 A;  5TPA B;  2UVG A;  3U94 A;  3IOR A;  3OSR A;  4LVQ A;  4KR5 A;  3SET A;  3T96 B;  1HSE A;  3GBA A;  3BFU A;  1Z7M E;  3DP6 A;  3TTN A;  2NWJ A;  3C36 A;  1A99 A;  5I58 A;  4RPN A;  4OFJ A;  3O9P A;  2Z8E A;  1FQB A;  3DLN A;  1US5 A;  4JB7 A;  3CVG A;  1DSN A;  4U4S A;  3T66 A;  2KLF A;  4FE8 A;  1MM7 A;  3Q28 A;  2X7Q A;  3TAJ A;  4WXJ A;  2ZNU A;  2D21 A;  4M4G A;  3SEW A;  4I1D A;  1CE2 A;  4GLI A;  4PET A;  4F3G A;  1B3H A;  1PDA A;  3RN8 A;  2FYI A;  1MS7 A;  3MQ9 A;  1B7U A;  4IO2 A;  1VFD A;  2NXO A;  3O6P A;  4F19 A;  3T22 A;  1MQI A;  3E3K A;  1MQD A;  5JTY B;  4DLD A;  2THI A;  3B6Q A;  4PFU A;  4ZZA A;  1IUD A;  1IEJ A;  3VFJ A;  4I9D A;  3FZV A;  2Q9T A;  2D5W A;  2UYF A;  1LCT A;  1IXI A;  3R6U A;  3KSX A;  1MY1 A;  4P0G A;  4F18 A;  2Q88 A;  4HCY A;  2O1M A;  3IOV A;  3MPL A;  1B0H A;  4YAH X;  3W15 C;  3MZB A;  3VXB A;  3RGY A;  2DVZ A;  2OK2 A;  2OBG A;  3IJO B;  3PUV E;  4RNS A;  3VVD A;  4Z7E A;  3OEK A;  3O6I A;  4KQP A;  4I62 A;  4OTE A;  3C32 A;  3ZS6 A;  1L5T A;  3CRB A;  1UTH B;  4YB6 A;  1R9L A;  1A8E A;  1MG1 A;  1LAX A;  1I6Q A;  4RY1 A;  2M8C A;  4ECF A;  1A40 A;  3MAM A;  2QPQ A;  5TPA A;  4PFY A;  2QJE A;  1MY0 A;  2O69 A;  4HTG A;  4LUB A;  1SD3 A;  2QRY A;  2PX1 A;  3PUX E;  1IQ7 A;  4BDL A;  1FTL A;  2GFE A;  1N04 A;  2DE4 A;  4EF1 A;  2F6G A;  2ZYN A;  3PPQ A;  4FEB A;  1B3L A;  1JNF A;  2XXU A;  2OJT A;  3DRJ A;  3RYB A;  3MC2 A;  3MZ1 A;  3QUF A;  4X48 A;  5DEX B;  3VE1 B;  4R2B A;  2XXW A;  4AB6 A;  1GV8 A;  1RYO A;  3KG2 A;  1NNT A;  5KCJ B;  4R9G A;  4NF8 A;  1ZIU A;  2PT1 A;  3SEY A;  1ZTY A;  3IB0 A;  2XXR A;  3TKD A;  4AB5 A;  3UOR A;  3K02 A;  1H44 A;  2CMO A;  1LBB A;  1WVJ A;  2RF1 A;  3K0V A;  3HPI A;  3SKP A;  4BDO A;  1O64 A;  2B65 A;  3QIM A;  1J1N A;  3OEL A;  2HXW A;  2GRV A;  1QUL A;  3FUZ A;  3IB2 A;  3DRI A;  1GR2 A;  4H8J A;  5JTY A;  4LZ5 A;  1QUK A;  3Q26 A;  4DCY A;  5IAI A;  3BBR A;  2O1L A;  1D4N A;  2IEE A;  3LSW A;  4R6K A;  5I59 B;  4F2Q A;  2B4M A;  2V3T A;  2DOJ A;  2ZYM A;  1NKX A;  3RTF B;  4H5G A;  4DXC A;  3KN7 A;  2WKY A;  3V5A A;  3K4U A;  2AL5 A;  2CZL A;  5M2V A;  4Z0I A;  4C1T A;  5AA2 B;  4OWD A;  1SI1 A;  2Y7R A;  4H5F A;  1SYH A;  1NFT A;  5EHM A;  1WDN A;  4LA9 A;  2UVH A;  3M3K A;  1UTB B;  1B32 A;  3CR9 A;  3FVK A;  1NNP A;  3DP8 A;  3IO6 A;  4NWD A;  3RY3 A;  1P1Q A;  1Z7N E;  2OLB A;  1OMP A;  3MP8 A;  4FAT A;  4POX A;  1D3K A;  3BFT A;  3N6U A;  2HAU A;  4IY5 A;  1RYX A;  2H9B A;  3MBP A;  3FJG A;  2X26 A;  2UVI A;  1TXF A;  2ONK E;  4GXS B;  4FED A;  5I2N B;  1QKA A;  3KN8 A;  3TTK A;  3OO8 A;  4WEP A;  4THI A;  1USY H;  1Y1M A;  4O3A A;  2NVU B;  3H6W A;  5EHS A;  1II5 A;  2VP1 A;  1EU8 A;  2DWJ A;  2H99 A;  3G3J A;  3UP9 A;  5KCJ A;  4E0X A;  3GXA A;  3LSF B;  2QL3 A;  1JQF A;  1LST A;  5H8F B;  1MH3 A;  4BDQ A;  2XX7 A;  1URG A;  3PU5 A;  3O6H A;  2Y7P A;  3TCH A;  1LFI A;  5ICT A;  3EPE A;  3SES A;  3KSJ A;  1N84 A;  3DP4 A;  3OEM A;  4YB7 A;  5H8H B;  4JBZ A;  2HAV A;  3FV2 A;  2W7Y A;  3DRK A;  5L9M A;  2REG A;  2NOO A;  1B3F A;  1SI0 A;  3MWB A;  1BP5 A;  3TZA A;  1GGG A;  2Y7I A;  3CI8 A;  3MVX A;  2GH9 A;  2H5Y A;  3JZJ A;  4ZEI A;  1P1W A;  4OXV A;  3C33 A;  3C4M A;  5CMM A;  3OO7 A;  2X7P A;  2RCA A;  2ONR A;  5I2K B;  4YZZ A;  3MVY A;  1O7T A;  4IO5 A;  1R9Q A;  3G3H A;  4NF4 A;  4G4P A;  1EZ9 A;  1MQH A;  3A3C A;  4YKP A;  1HSJ A;  2I6E A;  3TTL A;  3H06 B;  1UIV A;  3RNN A;  3TEL A;  3KJ7 A;  1IXH A;  4N07 A;  2RC7 A;  3TDJ A;  1M5F A;  4NED A;  2OWS A;  1UTB A;  3UK4 A;  3TUS A;  3EN3 A;  2ESN A;  3RLF E;  4QSD A;  4EQB A;  2BJJ X;  1JW1 A;  2IA4 A;  4QHQ A;  2QS4 A;  4WKM A;  3FXQ A;  4F2O A;  1QW0 A;  4F31 B;  3B6W A;  4ONY A;  1P99 A;  5H8Q A;  4QFN A;  2WOL A;  1TWY A;  3D4C A;  2RC9 A;  4XKN A;  2DXY A;  1SVX B;  1Y20 A;  2QSX A;  1I69 A;  1NL5 A;  1EZP A;  4OZ9 A;  1N7X A;  1Y3Q A;  2V84 A;  3W9W A;  4XKQ A;  3ONM A;  3I5O A;  1YTV A;  1Y9U A;  1LFG A;  2OCU A;  1SW5 A;  4GIZ A;  1FQC A;  3CSB A;  3KZG A;  4G68 A;  4G8M A;  3FJM A;  3L6H A;  3QAX A;  3UIF A;  5AA2 D;  1SBP A;  4NE4 A;  3PMV A;  1R1N A;  1PB9 A;  4PFT A;  4OVJ A;  2F36 A;  1MDQ A;  2YPN A;  3HN0 A;  3PPP A;  4NF5 B;  3VXC A;  3K6X A;  3LVU A;  5ITO A;  5H8H A;  3C31 A;  1PB7 A;  4RJZ A;  1P1U A;  2DWI A;  4EXL A;  3O29 A;  1Y4C A;  1MPB A;  3K1M A;  4H8I A;  2DWH A;  1XVX A;  4G8H A;  3O6G A;  4L17 A;  3HST A;  2Z8F A;  2D3I A;  2OZZ A;  2I48 A;  3I6V A;  2P1S A;  5DTB A;  3O2A A;  3MZ9 A;  2HCA A;  3IK6 B;  1PC3 A;  3RT6 B;  3LR1 A;  4EDP A;  4TLM B;  4MF3 A;  3Q29 A;  3TTR A;  1JW5 A;  1O63 A;  4H0W A;  2RKM A;  3FVO A;  2AYS A;  5FHN A;  4XTC Q;  1LB9 A;  4NF6 A;  4H67 A;  3PPR A;  5DVI A;  4OER A;  3AXF A;  4ZE9 A;  3MJN A;  5HBC A;  4ELQ A;  2Q8J A;  1OQG A;  1OVB A;  3VLW A;  1GVC A;  1M5E A;  1M5D A;  3PUW E;  3FTO A;  2HZK A;  5FHO A;  5KDT A;  5ITP A;  1KWH A;  3IX1 A;  1DTZ A;  3TEP A;  3QXM A;  3OSQ A;  1ELJ A;  1LAF E;  1OVT A;  4Q30 B;  2I4B A;  4MLQ A;  1VSO A;  3MW0 A;  3A09 A;  2VD3 A;  1IIW A;  3H4Z A;  4GFR A;  4OEU A;  3PD9 A;  1FTK A;  4G68 C;  3TQW A;  1Y4T A;  4ZS9 A;  1MRP A;  3G3G A;  2DE2 A;  3PD8 A;  1MXZ A;  2ZYO A;  3UN6 A;  1B3G A;  1USY E;  3HHG A;  5L8D A;  3L6G A;  5ICQ A;  1XS5 A;  4MH5 A;  1MXU A;  3EHS A;  1MXW A;  3CIJ A;  3E13 X;  4RK9 A;  2VGQ A;  2I49 A;  1P1N A;  5AA4 B;  1T0K A;  1TFA A;  1S7Y A;  4YKK A;  5AA3 A;  5CI5 A;  2H25 A;  5I56 B;  4MBP A;  1N3W A;  2XXP A;  1N3X A;  5CMC A;  3TTM A;  2A5S A;  4P0I A;  5TP9 B;  5JK4 A;  4R75 A;  1ZMG A;  1B58 A;  4GRK A;  5I84 A;  4JWY A;  4YKI A;  1FTM A;  1SYI A;  4LQ2 A;  3KJT A;  2OWT A;  3B7D A;  3RUM A;  2F6P A;  2Y7K A;  1B3E A;  3TQL A;  1AMF A;  4EUO A;  2I0B A;  3HCQ A;  1YCJ A;  1N7W A;  4YB5 A;  1NNF A;  1LFH A;  3T9X B;  2LAO A;  3S9L C;  4KPT A;  1QJM A;  2A5T B;  4OFL A;  1OLA A;  2UVJ A;  3M8U A;  2XD3 A;  5CRY A;  5HM4 B;  3CFZ A;  2DP8 A;  3WAE A;  3PPN A;  4R6Y A;  3IOU A;  1JEU A;  4QF9 A;  1MY2 A;  3FJ7 A;  2XX9 A;  4U2R A;  3K00 A;  2FNC A;  4G2Z A;  1MQJ A;  5B70 A;  2E1S A;  2XHD A;  2DS9 A;  3WAF A;  4OEV A;  2O68 A;  2Z8D A;  3H6U A;  3DRH A;  1DTG A;  2F35 A;  3SEX A;  4F39 A;  1N0T A;  1B6H A;  4NMY A;  5CM6 A;  2UXA A;  3OOA A;  3KBR A;  1DPP A;  1B5I A;  4U4X A;  4TQU Q;  4ESX A;  4YKJ A;  3PUY E;  4IGT A;  1UTH A;  1FQE A;  5ISU A;  3PAM A;  5H8N B;  5DYH A;  1FTJ A;  2I0C A;  4AQ4 A;  3TFL A;  4GD5 A;  4LZ7 A;  1B4H A;  1B5J A;  5L9S A;  3GLB A;  2O7I A;  4PQJ A;  1ATG A;  1I6A A;  3Q27 A;  1Y3P A;  1URD A;  1XT8 A;  4ZEK A;  1JVX A;  2DQV A;  1CB6 A;  3HV1 A;  3OXN A;  3K6U A;  4DIG A;  1NH7 A;  1XOC A;  4GWO A;  1MQG A;  5CMK A;  1B05 A;  4R73 A;  4R9F A;  4IO6 A;  3T9H B;  5FTH A;  3G3F A;  3W9V A;  1NNK A;  5AA4 A;  1UIU A;  5DEX A;  5BWJ A;  3FXU A;  2I3V A;  1H3D A;  2ZNS A;  3H3G A;  1MY3 A;  1B40 A;  1ZJL A;  3EHT A;  4G8N A;  4LP2 B;  4QFP A;  2O6A A;  2V93 A;  3O66 A;  3VVE A;  4H1X A;  4PE5 B;  4U21 A;  2GHB A;  1LBC A;  2ZNT A;  5H8S A;  3FV1 A;  5F7V A;  3H6T A;  1MPD A;  3FVN A;  1XVY A;  1NMU A;  3K1N A;  5I58 B;  5LOM A;  1SQY A;  1R6Z A;  4GXA A;  3C35 A;  4IO7 A;  1BTJ A;  5JEI A;  1US4 A;  3S4U A;  3OD7 A;  3T9U A;  4ND9 A;  3FD3 A;  4MLV A;  5I59 A;  1JET A;  2DVC A;  2F8D A;  3ECR A;  4N6P A;  1FQD A;  4ELO A;  1FCK A;  3SER A;  5AA1 A;  3Q25 A;  3V89 B;  1POT A;  1MXX A;  1QKB A;  2RC8 A;  2E0S A;  2VD2 A;  4YMB A;  2ONS A;  5KZT A;  2F7C A;  1S50 A;  1A54 A;  3RQT A;  1LAH E;  1B1H A;  4QSE A;  2GHA A;  3R7X A;  1Y1Z A;  4JSO A;  2ZYK A;  5AA2 A;  2FA7 A;  1F9B A;  4GL8 A;  3CHG A;  4KCD A;  2O7U A;  3G3I A;  3MP6 A;  4DE8 A;  2V3U A;  1B9J A;  4RPO A;  2YLN A;  1B4Z A;  3HHF A;  5K2Y A;  1XHY A;  4OET A;  3S9E A;  1B0L A;  4YMA A;  4DCX A;  2XXT A;  3QK6 A;  1PBP A;  3K2D A;  4P11 A;  3ZKK A;  3G3K A;  2WOK A;  2G93 A;  3CG1 A;  5I2N A;  3IOW A;  4BDR A;  3IL1 B;  4OQO A;  1LCF A;  3FAS A;  4KYE A;  2AIX A;  4IY6 A;  3H7M A;  4OYV A;  3DEL B;  3PUZ E;  4MFI A;  2I58 A;  1B52 A;  4X9T A;  4OFO A;  1BLF A;  1AH5 A;  3S9M C;  3E4R A;  4ZE8 A;  3M3L A;  3ZKL A;  1MDP 1;  2HEU A;  4YU0 A;  4JWO A;  5K2X A;  3KFM A;  4OEN A;  2PMS A;  2I3W A;  2ALU A;  1ZU0 A;  2UYE A;  1MM6 A;  5H8F A;  1ZLQ A;  3F11 A;  4KYD A;  4LZ8 A;  1RKM A;  4LQ5 A;  3MPK A;  1Q35 A;  4EXK A;  1PBQ A;  2DE3 A;  4JWX A;  1LAG E;  2Q2A A;  3QYT A;  5F1Q A;  1AL3 A;  1N76 A;  3TMG A;  4ELR A;  3LUY A;  3RPW A;  2XXX A;  5L9O A;  4FJP A;  4WED A;  2YJP A;  3C9H A;  3PGF A;  4IGR A;  4NF8 B;  4IB2 A;  1A7L A;  4NWC A;  2RCB A;  4X1B A;  3M3F A;  4DZ1 A;  4RXL A;  1IZ1 A;  5I2K A;  2B3F A;  4TOZ A;  3K6W A;  3S9N C;  2HZL A;  2F7B A;  2XXI A;  2WOP A;  4BLA A;  2ZXT A;  1FTO A;  3KOS A;  1D9Y A;  3ZSF A;  3EF7 A;  3O28 A;  1EZO A;  3KGC A;  1JEV A;  2I4C A;  3LSL A;  3ILU B;  1AOV A;  3O97 A;  3B6T A;  2HQ0 A;  4R6H A;  3TCF A;  4N13 A;  1LGB C;  1MPC A;  3PPO A;  4DDD A;  5DVF A;  5IKB A;  2P0S A;  1Y3N A;  3U8Q A;  3OMB A;  5ELV A;  1SW1 A;  4GVO A;  2F34 A;  3E9X A;  2DSF A;  3MVW A;  1VFE A;  3MVZ A;  1LLS A;  2DWA A;  4PFW A;  4XKP A;  1SW4 A;  3PMX A;  4XKR A;  4YIC A;  4ELP A;  4K3F A;  3N6T A;  2VHA A;  4QRZ A;  3CFX A;  3N5L A;  1B5H A;  3IOT A;  3FAT A;  3IJX B;  5I57 B;  3UA8 A;  2RIN A;  4NTL A;  4Q8R A;  5CMB A;  4ESW A;  5CBR A;  3RYA A;  1B46 A;  3TCG A;  2DYX A;  4F3B A;  1MH4 A;  3RTW B;  3T9V A;  1JW4 A;  4H65 A;  4U22 A;  2H4I A;  2B3B A;  3V83 A;  3OEN A;  2QMX A;  3H6V A;  4GF8 A;  3C34 A;  5CC2 A;  1B2H A;  3K1P A;  4JDF A;  4OMB A;  4BDM A;  4G77 A;  3LSX A;  1ZBM A;  4NF5 A;  3I3V A;  4EF2 A;  5B7D A;  2F7A A;  1QUJ A;  4Q0C A;  4POW A;  1SW2 A;  4O3C A;  4C0R A;  3FIR A;  1A55 A;  3PMW A;  1QVS A;  1B51 A;  1B7Z A;  5FTI A;  5FHM A;  4ZEB A;  3TYH A;  3ODB A;  1DMB A;  2ABH A;  2REJ A;  1D9V A;  1XC1 A;  3VV5 A;  4ZED A;  4HW8 A;  1IIT A;  1MY4 A;  1POY 1;  5DVJ A;  4PP0 A;  1AIV A;  2F5X A;  3RT8 A;  4I8C A;  3TPA A;  2H98 A;  4ZZE A;  3N26 A;  1FQA A;  1H76 A;  2XXH A;  3U1O A;  4QFL A;  2F97 A;  2XD2 A;  3KOT A;  4KCC A;  3TOD A;  4U23 A;  2G29 A;  1M5B A;  4HCW A;  3K01 A;  4QSC A;  3VVF A;  4IO4 A;  2XXQ A;  4KHZ E;  4E0W A;  1MXY A;  3T93 B;  2R71 A;  2O51 A;  4JXI A;  3USD A;  5J1D A;  3SEU A;  3FGS A;  4NF4 B;  2QS1 A;  1FW0 A;  3QUJ A;  1B7H A;  4F22 A;  4X1D A;  1YPN A;  3CSG A;  3N94 A;  1VR5 A;  1QUI A;  2PYY A;  1TFD A;  4U1O A;  3JV9 A;  3SDF A;  3IAZ A;  4XIG Q;  5I57 A;  3THI A;  3U72 A;  4TLL B;  3HO7 A;  2VOZ A;  2PVU A;  2R6G E;  3BKI B;  3KN3 A;  1A8F A;  3H03 A;  3SEV A;  4F3P A;  4OES A;  1BIY A;  2O84 X;  2PBW A;  3DRF A;  4QFO A;  5H8Q B;  1PB8 A;  1LB8 A;  3IB1 A;  1IXG A;  4EQ7 A;  5TU0 A;  4XXU A;  1OIB A;  3DRG A;  1SDX A;  5A5X B;  2HFB A;  1WOD A;  1YAE A;  3CG3 A;  5BUU A;  1FQF A;  1H43 A;  2Y84 A;  3QSL A;  1DOT A;  3DM0 A;  1GTK A;  3V8X B;  2Z22 A;  5DT6 A;  4C1U A;  4F1U A;  2Q89 A;  2NUV A;  5I56 A;  2F78 A;  2QMW A;  3UGW A;  4IO3 A;  4UAC A;  4G68 B;  1EH3 A;  3MP1 A;  3GZG A;  5TP9 A;  3CFL A;  1UQW A;  3LBS A;  4LAT A;  2QS2 A;  4FOR A;  4F29 A;  3MUQ A;  1NH8 A;  3PV0 E;  4FIM A;  4F3S A;  3VLU A;  2R9J A;  3GBB A;  1IXC A;  2V3Q A;  4R74 A;  4GOT A;  4ZEF A;  4HS7 A;  2A5T A;  4KYS A;  3IR1 A;  3S2V A;  4LON B;  1BKA A;  3IO4 A;  4O3B A;  2DXR A;  1I6B A;  3P7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...