1B4ZA

Oligo-peptide binding protein (oppa) complexed with kdk
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 187
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b4zA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b4zA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b4zA02
1MQJA 2DE3A 2PT1A 3MAMA 1PC3A 3LUYA 1L5TA 3EF7A 4QSDA 4LZ7A 2XXPA 4F19A 5JEIA 3W9VA 2P1SA 1H44A 5HPQA 4EF2A 2V25A 1ELJA 3RGYA 1A7LA 2I3VA 4WEPA 4YB5A 3MQ9A 4EXKA 1HSLA 3TODA 1JVXA 3DP8A 2V3TA 1OQGA 1A99A 1B05A 4OETA 2CMOA 4TLLB 2B4MA 3CHGA 3M8UA 3MUQA 1N3WA 2F5XA 1Y4TA 3SERA 4OFJA 3K6XA 5FHMA 4GF8A 2H25A 2YLNA 2Z8DA 3VXBA 5DVJA 1DTGA 4G77A 4H1XA 1QUKA 3KBRA 2D3IA 5CMMA 3H06B 3K02A 3O2AA 4POXA 1LB8A 5AA3A 3CFXA 4R6KA 1MPCA 3TYHA 4RYAA 1DMBA 3QXMA 4RXLA 1R9LA 3U72A 1LAFE 3SEUA 4RK2A 3QUFA 4Q8RA 5KDTB 4R6YA 1HSEA 4JDFA 3G3IA 5AE4A 3RT6B 3RT8A 3PU5A 1SYIA 2RCBA 3E4RA 5L9SA 4YKJA 1I6BA 3E13X 1Y1ZA 4NF6A 1MY1A 1A8FA 1YAEA 1CB6A 2RINA 1Q1KA 4RA1A 3HV1A 3H6UA 3ILUB 1B5JA 1USYE 3K00A 5I2NB 3LSXA 1PB9A 3FVOA 3VVEA 4JSOA 4HS7A 3UP9A 2F7CA 2F7BA 2XXHA 1M5EA 1B6HA 3UN6A 3EPEA 3H6TA 3FVGA 2LAOA 3DELB 5I57A 1LFGA 1S7YA 5I2KB 4YB6A 4PQJA 4ZE8A 3B6WA 3RY3A 4KR5A 1IQ7A 1PBQA 1Y20A 1MDQA 4JWXA 4RY1A 2I6EA 3KZGA 1FQEA 1FQDA 1P1NA 3IO4A 1OMPA 5DTBA 1UTBA 1B5IA 4JXIA 4DXUA 1N04A 2XX9A 4OERA 1XT8A 2ESNA 1SI0A 3DRKA 1VSOA 1N0TA 4F18A 4QFOA 2E0SA 1UTBB 3UA8A 3FD3A 3K6UA 2NWJA 4PP0A 1LBCA 3C31A 3O66A 4KYEA 3VVDA 2Z8EA 1A8EA 4OQOA 4GXSB 3PPQA 1FQCA 3RTWB 4BDOA 1II5A 4QHQA 2IA4A 5CBSA 4FORA 2DE4A 2IEEA 4KCDA 2QMXA 4ZEDA 3MVXA 3U92A 3FJGA 2QS4A 4YKPA 5LOMA 2VOZA 3LSLA 5A5XA 3D4GA 3FATA 4GQOA 4FE8A 1Y3QA 1MXVA 3G3KA 5A5XB 1FQBA 1MG1A 1MY2A 3M3KA 1MY3A 3HSTA 3S9NC 3TEPA 1BLFA 2F97A 5FHOA 4O3CA 4NMYA 2B3BA 4ZZAA 3V5AA 3HHFA 1NNFA 3LSFB 2V3QA 3QYTA 4F3GA 3OELA 4GRKA 1DSNA 3K1PA 4XKRA 2HZLA 3VE1B 2OCUA 3QAXA 1LCFA 3PPOA 2Z22A 3KN8A 4GLIA 2OWTA 2QJEA 4RJZA 1M5CA 3MP1A 2X7QA 2DOJA 3TMGA 4NE4A 3PAMA 4NTLA 3O28A 4AB5A 3E9XA 4P11A 4FEBA 3B6QA 4P0IA 3IOUA 4QSCA 1B3HA 1P1QA 1MXZA 2Y84A 3K01A 2Y7WA 4JWOA 4XKNA 1PB7A 2ZNSA 4GOTA 1MQDA 1GR2A 3A09A 1ZIUA 3C4MA 5ICTA 3SEXA 3IAZA 4KPTA 4Q30B 4F1VA 1I6AA 2XXVA 1FTMA 4YKKA 2Y7PA 3MW0A 1PDAA 4I8CA 3CG3A 3JZJA 2REJA 1S9TA 5F1QA 5ITOA 3T22A 1NL5A 1MRPA 3QK6A 3T9HB 1N7XA 3MZ1A 4HTGA 5H8HA 5FTIA 5HM4B 2Y7RA 4ZE9A 3RQTA 4QRZA 1LGBC 3KGCA 1QKAA 4GVOA 5H8HB 3HHGA 3QIMA 1NMUA 3GBAA 4YAHX 5J1DA 2HFBA 1T0KA 1Y4CA 1EZPA 4MH5A 2QMWA 5CMBA 3KJTA 4QF9A 2UVGA 3RNNA 5ELVA 3SEYA 2GRVA 3RN8A 4DCXA 3O6IA 5DYHA 4ESXA 2UYFA 2F6PA 3EHUA 4EUOA 4OEVA 4LVQA 1NKXA 2O84X 5B70A 4O3AA 3K4UA 1D9VA 4UACA 4ZEIA 1B3LA 3BFUA 4U1OA 2PYYA 5FTHA 3RUMA 1FQAA 3JYRA 1I69A 1XOCA 3IB0A 4BDMA 3S2VA 3KJ7A 4N13A 3SEVA 3BBRA 4QFPA 2GHBA 1ZJLA 1A55A 3K6WA 4JBZA 3L6GA 3VLUA 3N6TA 3IL1B 3T9UA 5CRYA 4DLDA 4R75A 4E0WA 2FA7A 2ONKE 2ONRA 3UIFA 3RPWA 3B7DA 3AXFA 3KSXA 2XD2A 3QSLA 3UGWA 4N07A 4X48A 5HBCA 3FVKA 1LSTA 3N6UA 3IX1A 1B3FA 5DEXA 4F1UA 2F34A 4KI0E 2FNCA 1TXFA 1OVTA 4NWDA 5DEXB 5BWJA 2AIXA 4BLAA 3KSJA 1H43A 4HCWA 1B0HA 4E0XA 5K2XA 1P1OA 5FHNA 3H03A 4NF5A 5EHSA 1OIBA 4BDRA 3PUZE 3H6WA 3FV2A 4PFWA 3PD8A 4BDNA 4NF5B 3G3GA 1FCKA 2QS1A 4HW8A 4NF4B 3RYBA 4Z0IA 4LZ5A 3UORA 3DRHA 3SETA 3SESA 2DWHA 3UK4A 1IUDA 4O3BA 1MQIA 1WDNA 3M3FA 1TFDA 3OO6A 3GXAA 3A3UA 4U2RA 1GVCA 4DE8A 5AA4A 3V8XB 1O64A 3USDA 2R6GE 3LBSA 2WOKA 1VFEA 4OZ9A 4ESWA 3MP6A 3Q29A 5AA4B 4QFNA 3IR1A 2A5SA 5KDTA 4ISUA 1N76A 3BFTA 5H8SA 4Q5TA 4GFRA 1DPPA 4X1DA 3KN7A 1BTJA 5DT6A 3THIA 4DIGA 4LATA 1TT1A 4G8NA 4OMBA 1B58A 3FUZA 1P1WA 1R6ZA 3TCGA 2OZZA 4IO2A 3MP8A 2I4BA 2QL3A 1SW2A 3PUVE 3WAEA 4PETA 4KD5A 3MPLA 3MPKA 5I2NA 3CRBA 4OENA 3MVWA 1QUJA 3GLBA 1FTOA 1B4HA 2OWSA 1AIVA 1XC1A 3C32A 3KG2A 2ZNUA 3C9HA 4ZEBA 3C33A 3FXRA 3OEMA 2VHAA 3MC2A 1MPBA 5I2KA 1JVYA 3K1NA 4Z7EA 4HCYA 2XX7A 1B7HA 2H99A 3DP4A 2PT2A 4ELOA 2B65A 3OMBA 3RLFE 4I1DA 5IAIA 2I0BA 1LFIA 1UIUA 4Q0CA 5KZTA 2OBGA 3TCFA 4R6HA 5TP9A 1B3GA 2F6GA 3VFJA 3G3HA 4ZZEA 1POY1 1IIWA 2DXYA 3MZBA 3K0VA 1CE2A 2I3WA 5TP9B 3U94A 3KEIA 4GD5A 2HAVA 2F78A 1Y3PA 5DVFA 3VLVA 1SD3A 2RCAA 2O68A 1D3KA 5ITPA 1GV8A 1IZ1A 1QKBA 2VD2A 4YZZA 4H5GA 2ONSA 3S9EA 3S4UA 4C1UA 3DRJA 3PMVA 1J1NA 1OLAA 4EQBA 2DVCA 1Y1MA 5ICQA 3FXUA 3FXQA 2DS9A 1IITA 2NXOA 3IJXB 1B5HA 1QJMA 1OQHA 5L8DA 3EHTA 5I84A 5H8FB 2XXYA 5L9MA 2F36A 4WKMA 3ECRA 1EH3A 4U21A 5K2YA 3K2DA 3GBBA 4PE5B 2KLFA 3KOTA 4QFKA 3TPAA 3MWBA 3LC8A 1SVXB 3PV0E 4IY6A 4RPOA 1O63A 5CBRA 1AOVA 4F3BA 1IXGA 4MF3A 3PUYE 4AB6A 3QUJA 3G7WA 4IY5A 2RC7A 3IO6A 1JNFA 4YU0A 3VVFA 1JETA 3TTRA 2AL5A 4LZ8A 1AMFA 4IO3A 1D9YA 2R9JA 3GZGA 4LONB 2GH9A 3TDJA 2XX8A 1ATGA 2HEUA 2H9BA 3VV5A 2WOPA 1DTZA 4RPNA 1NNTA 4F3PA 5AA2A 3M3LA 1ZMGA 3FV1A 1URDA 4IGRA 1AL3A 2H5YA 2UVIA 3IJOB 5AA2B 1MXYA 1US4A 2DVZA 5JTYB 3W9WA 5BUUA 3MJNA 3TTKA 3DP6A 2Q2AA 3VXCA 1POTA 4DXCA 4EXLA 4H0WA 3PGFA 3S9MC 3F11A 4ELPA 1FTJA 2ANJA 1MY4A 1YCJA 2M8CA 2XD3A 1LAXA 2O7IA 3TUSA 5F7VA 1USYH 1UTHA 2G29A 1ZKBA 5IKBA 4KYDA 3N26A 1MXXA 4R2FA 2RF1A 1B3EA 3LR1A 1UTHB 3E3KA 2O7UA 4JWYA 3H4ZA 4DXBA 3T93B 1ZLQA 3MVYA 1B9JA 2WOLA 2I49A 4OVJA 4EQ9A 1SW5A 4G8HA 4OXVA 3A3CA 3D4CA 4H8IA 1DOTA 1N3XA 1LAGE 3HN0A 1MXUA 2Z23A 2Q8JA 3SKPA 4FJPA 5EYFA 1MQGA 3OSQA 1PBPA 2VD3A 2UVJA 1JEUA 4GIZA 3U8QA 1JW5A 1B4ZA 4ZECA 3ONMA 3O97A 4XKQA 4ELQA 3SDFA 1S50A 4RK9A 1IEJA 1I6QA 4LA9A 4ZDMA 2DE2A 4F3SA 4LQ2A 1MY0A 1TWYA 1M5FA 3K6VA 3TCHA 2HAUA 1YPNA 5I59B 3RTFB 1KWHA 2HXWA 3R6UA 2Q89A 2UVHA 1Y3NA 4YKIA 3T9VA 2AL4A 1RYOA 4YB7A 3OEKA 1XVXA 3Q28A 2ZYMA 1H76A 3TKDA 4IO6A 1VFDA 4H65A 1SDXA 1QULA 1JW4A 3PUXE 2HQ0A 3T66A 3CIJA 4ZEFA 4K3FA 3FVNA 2ZYNA 4NF8A 4IO7A 1NFTA 3BKIB 4GXAA 4WXJA 5TPAA 2XXIA 2UYEA 3N5LA 1MQHA 1N7WA 5H8QA 5TU0A 1IXIA 4NF4A 4NF8B 3PMWA 4OYVA 5TPAB 1FTLA 5H8QB 2DWJA 4F22A 5B7DA 2OLBA 1FTKA 3OO9A 1MXWA 1PEBA 2FYIA 1UIVA 1B2HA 1LCTA 1SI1A 2O1LA 1JW1A 3C36A 4UA8A 5CI5A 2DWAA 1IXHA 1RYXA 2BJJX 5I56A 2B4LA 3TAJA 2O69A 4R9GA 1B40A 3ZSFA 3S9LC 5H8NA 3OENA 2Q9TA 5I56B 1B1XA 3FTOA 5H8NB 3PPPA 1SYHA 2QS3A 4WEDA 1AH5A 1WVJA 1R9QA 4P0GA 1OLCA 4X9TA 2XXXA 2W7YA 3G3JA 4QSEA 3IOWA 1YTVA 2RKMA 2GHAA 2PMSA 2X26A 5AA2D 2DQVA 4OFOA 1NH7A 1VE4A 3H6VA 4C1TA 2ZYKA 4KQPA 3VLWA 3MZ9A 3I6VA 1A54A 2YPNA 1MM7A 1M5DA 2HZKA 4POWA 4F31B 4TOZA 2THIA 4G68A 3PPRA 5CC2A 4DZ1A 3I5OA 2O51A 2P2AA 4ECFA 2XXQA 4OESA 1D4NA 4G68C 3H7MA 5CMCA 4MBPA 4G68B 2RC8A 4C0RA 2I0CA 3CFZA 3CSGA 2GFEA 2D21A 4H5FA 4IB2A 1Z7ME 4NF6B 5I58A 4R2BA 2PX1A 1B46A 4EQ7A 4FAJA 4TLMB 1ZBMA 5I58B 1NNKA 1Q35A 1MS7A 3DLNA 3EHSA 3HPIA 1LAHE 3FJ7A 4YMAA 4KHZE 5M2VA 1VR5A 2O1MA 4BDLA 2R71A 3RYAA 3OXNA 4U23A 2XHDA 2ZXTA 1MM6A 3U93A 4I9DA 1P99A 2I58A 3CVGA 2Y7IA 4MFIA 2Q2CA 1MPDA 2XXUA 5I57B 4KYSA 2UXAA 2HCAA 3P7IA 1MH4A 4H6DA 2AYSA 3TELA 2OJTA 2F7AA 4IO5A 3OO7A 1UQWA 2Z8FA 1NH8A 1N84A 1ZU0A 2O6AA 3O9PA 4OEUA 3DRFA 4IO4A 3TFLA 4EDPA 3C34A 2F8DA 3OSRA 3JV9A 5AA1A 4NEDA 3TQWA 1XHYA 3N94A 4H8JA 3I3VA 3CR9A 1WODA 3IORA 4U22A 3T96B 4F39A 4OWDA 4G2ZA 4U1ZA 4F1YA 5H8FA 2ABHA 3W15C 2DWIA 1SBPA 4PFTA 3ZKKA 4XTCQ 4R72A 2XXWA 1BP5A 4FEDA 5KCJA 3Q26A 4JB7A 4MLVA 3L6HA 3O6HA 2ZNTA 3DM0A 2PBWA 2H98A 1XS5A 4F2OA 2YJPA 5KCJB 1SW1A 4F29A 1LLSA 1ZTYA 1H45A 1SQYA 4DDDA 1URSA 3Q25A 2CZLA 3OD7A 4ELRA 4I62A 1RKMA 2I48A 3ILTB 1LB9A 2ALUA 4OHNA 2B3FA 4PFUA 4KCCA 5CMKA 3V89B 4FATA 3R26A 3H3GA 4AQ4A 4F2QA 4BDQA 3ZS6A 2I4CA 4LP2B 4OFLA 3CG1A 4JSDA 3K1MA 1JEVA 4XIGQ 4U4XA 2DP8A 2OK2A 3Q27A 1EZ9A 1B7ZA 1QW0A 4MLQA 3O6GA 3LVUA 3HCQA 4FECA 3KN3A 3ZKLA 1R1NA 4QFLA 4DCYA 4G8MA 5JTYA 1LFHA 4X1BA 3FGSA 3O6PA 1US5A 3EQ1A 2QSXA 1B7UA 4IGTA 1FQFA 4OTEA 4M1VA 2E1SA 3FZVA 4FIMA 2NUVA 4ZEKA 2DYXA 3IK6B 3DRIA 1HSJA 3TQLA 4R74A 2F35A 3DRGA 3CI8A 4TQUQ 5L9OA 3ODBA 1QUIA 2DSFA 4U4SA 1BKAA 1Z7NE 4EF1A 3KOSA 3OOAA 3B6TA 2VGQA 2NVUB 3SEWA 5JK4A 2RC9A 3LSWA 3V83A 2D5WA 2P0SA 1Y9UA 3OO8A 3TTMA 4XXUA 1DPEA 5ISUA 1H3DA 2NOOA 2H4IA 1JQFA 4KFQA 2QRYA 3MVZA 1B32A 4LQ5A 4YMBA 1QVSA 1O7TA 2XXTA 2X7PA 3U1OA 2ZMBA 3C35A 2A5TA 4THIA 1XVYA 1URGA 3IB1A 1BIYA 4ONYA 1TFAA 4N6PA 2A5TB 2WKYA 3WAFA 1SW4A 4L17A 1B52A 2PVUA 3HO7A 3KFMA 3G3FA 4LUBA 4R9FA 1FW0A 4PFYA 1IXCA 3IB2A 3MBPA 5I59A 3PMXA 1GGGA 3O29A 1NNPA 1GTKA 2ZYOA 1OVBA 3FIRA 5DVIA 5CM6A 2Y7KA 3PD9A 3IOTA 4M4GA 4GWOA 1B51A 2REGA 4YICA 4RNSA 3FASA 1PB8A 3FJMA 3CFLA 3IOVA 2DXRA 4GL0A 1EU8A 1A40A 1F9BA 3PUWE 4R73A 1M5BA 3T9XB 1B0LA 1B1HA 1P1UA 3PPNA 2G93A 3TTLA 4H67A 2V3UA 2V84A 1LBBA 1MDP1 1MH3A 3R7XA 2XXRA 3TTNA 4GL8A 5EHMA 4XKPA 1ANFA 3TZAA 2QS2A 4ZS9A 2V93A 4ND9A 2Q88A 2VP1A 3EN3A 3VDFA 2QPQA 1EZOA 4NWCA 4G4PA 3CSBA
chains in the Genus database with same CATH superfamily
1MQJA 4GX3A 2DE3A 2PT1A 3MAMA 1PC3A 3LUYA 1L5TA 3EF7A 2XWOA 4QSDA 4LZ7A 2XXPA 4F19A 5JEIA 2HHMA 3W9VA 2P1SA 1H44A 5HPQA 4EF2A 2V25A 1ELJA 4P8BA 3RGYA 1A7LA 2I3VA 4WEPA 4YB5A 3MQ9A 4EXKA 1HSLA 4N17A 1JVXA 3TODA 3DP8A 2V3TA 1OQGA 1A99A 1B05A 4OETA 2CMOA 1NV5A 4TLLB 2B4MA 3CHGA 3M8UA 1EYIA 1N3WA 3MUQA 2F5XA 3T1BA 1Y4TA 3SERA 4OFJA 3K6XA 5FHMA 4GF8A 2H25A 2YLNA 2Z8DA 3VXBA 5DVJA 1DTGA 4G77A 4H1XA 1QUKA 3KBRA 2D3IA 5CMMA 3H06B 3K02A 3O2AA 4POXA 1LB8A 1DBZA 5AA3A 3CFXA 4R6KA 1MPCA 3TYHA 4RYAA 1DMBA 1VDWA 3QXMA 4RXLA 4X8RA 1R9LA 5IZ3A 1LAFE 3U72A 3SEUA 1FBCA 4RK2A 3QUFA 4Q8RA 5KDTB 4R6YA 1FBHA 1HSEA 4JDFA 1IMDA 3G3IA 5AE4A 3RT6B 3RT8A 3PU5A 5EQAA 1SYIA 2RCBA 3E4RA 1IMFA 5L9SA 1I6BA 3E13X 4YKJA 2PCRA 1Y1ZA 4NF6A 1MY1A 1A8FA 4OVSA 1YAEA 4PE3A 1CB6A 2RINA 1Q1KA 4RA1A 3HV1A 3H6UA 3ILUB 1B5JA 1USYE 4PGPA 3K00A 5I2NB 3LSXA 2P3VA 1PB9A 3FVOA 3VVEA 4NQ8A 4JSOA 4HS7A 3UP9A 1FPDA 2F7CA 2F7BA 2XXHA 1M5EA 1B6HA 3UN6A 3EPEA 4HE2A 2XWKA 3H6TA 1FPLA 1NI9A 4PAFA 3MYUA 3FVGA 3ROJA 2LAOA 3DELB 5I57A 1LFGA 1S7YA 5I2KB 5EYGA 4PGNA 2ZZVA 4YB6A 4PQJA 4ZE8A 3B6WA 3RY3A 4KR5A 1IQ7A 1PBQA 1Y20A 1MDQA 4AS5A 4JWXA 4RY1A 2I6EA 3KZGA 1FQEA 1FQDA 1P1NA 3IO4A 4XF5A 3BIGA 1OMPA 5DTBA 1UTBA 1B5IA 4JXIA 2FIEA 4MEVA 4DXUA 1N04A 2XX9A 4OERA 1XT8A 2ESNA 1SI0A 3DRKA 1VSOA 1N0TA 4F18A 4QFOA 2E0SA 1UTBB 3UA8A 3FD3A 3K6UA 3EKIA 2NWJA 4PP0A 1LBCA 3C31A 3O66A 4KYEA 3VVDA 2Z8EA 1A8EA 2HXRA 4OQOA 5A5LA 4GXSB 3PPQA 4GWXA 4MHFA 3E79A 1FQCA 3RTWB 4BDOA 1II5A 4QHQA 2IA4A 5CBSA 2ZZWA 4FORA 2DE4A 2IEEA 4KCDA 2QMXA 4ZEDA 3MVXA 3U92A 3FJGA 2QS4A 4YKPA 5LOMA 4PBQA 2VOZA 3LSLA 4P47A 2L5VA 5A5XA 3D4GA 3FATA 4GQOA 4FE8A 2FVZA 1Y3QA 1MXVA 2XWVA 1FPBA 3G3KA 5A5XB 1MG1A 1FQBA 1MY2A 1YZ0A 3M3KA 5ET8A 1MY3A 3HSTA 3S9NC 3TEPA 4P56A 1BLFA 2F97A 5FHOA 4O3CA 4GBWA 4NMYA 2B3BA 3ISPA 4ZZAA 3HHFA 1NNFA 3V5AA 3LSFB 2V3QA 3QYTA 4F3GA 1FBEA 3OELA 4GRKA 1DSNA 3K1PA 4XKRA 3KC1A 1FPGA 2HZLA 3VE1B 4KXPA 2OCUA 3QAXA 1LCFA 3PPOA 3RYDA 2Z22A 3KN8A 4GLIA 2OWTA 4GX4A 2QJEA 4RJZA 1M5CA 3MP1A 1NUYA 2DOJA 2X7QA 3TMGA 4NE4A 3PAMA 4NTLA 3O28A 4AB5A 4XEQA 3E9XA 4P11A 2WYKA 4FEBA 3B6QA 4P0IA 3IOUA 4QSCA 1B3HA 1P1QA 1MXZA 1YXIA 4I3YA 2Y84A 3K01A 2Y7WA 4JWOA 4XKNA 1PB7A 1RDZA 2ZNSA 4OVRA 4GOTA 1MQDA 2V4CA 1GR2A 3A09A 1ZIUA 3C4MA 5ICTA 3SEXA 3IAZA 4KPTA 4Q30B 4F1VA 1I6AA 2XXVA 1FTMA 4I40A 4YKKA 2Y7PA 3MW0A 1PDAA 4I8CA 3CG3A 3JZJA 2REJA 1S9TA 5F1QA 2F3BA 5ITOA 3T22A 2HPGA 4I3EA 1FPEA 1NL5A 1MRPA 2CZIA 3QK6A 1N7XA 3T9HB 2WBDA 3MZ1A 4HTGA 5H8HA 5FTIA 5HM4B 2Y7RA 4ZE9A 4NN3A 3RQTA 4QRZA 1LGBC 3KGCA 1QKAA 4GVOA 5H8HB 2DDKA 3HHGA 4NG7A 3QIMA 1NMUA 3GBAA 4YAHX 5J1DA 4MX6A 2HFBA 1T0KA 1Y4CA 2PFZA 1EZPA 4MH5A 2QMWA 3KJTA 5CMBA 4QF9A 5ET5A 1Q9DA 2UVGA 3RNNA 4OVTA 5ELVA 3SEYA 1FBPA 2GRVA 3RN8A 4DCXA 3O6IA 5EQ9A 5DYHA 4ESXA 2UYFA 2F6PA 3EHUA 4EUOA 4OEVA 4LVQA 1NV0A 1NKXA 2O84X 5B70A 4O3AA 5DW8A 3K4UA 1D9VA 4UACA 4ZEIA 4PBHA 1B3LA 3BFUA 4U1OA 2PYYA 5FTHA 3RUMA 1FQAA 3JYRA 1I69A 1XOCA 3IB0A 4BDMA 2WX9A 1KA1A 3S2VA 1DK4A 3KJ7A 4N13A 3SEVA 3BBRA 4QFPA 2GHBA 1ZJLA 1A55A 3FXBA 3K6WA 3L6GA 4JBZA 4PAKA 3VLUA 3N6TA 4PDHA 3IL1B 3T9UA 5CRYA 4DLDA 1KZ8A 4R75A 4E0WA 4N91A 2FA7A 2ONKE 2ONRA 3UIFA 4NX1A 3RPWA 4DI4B 3B7DA 1SPIA 3AXFA 3KSXA 2XD2A 3QSLA 3UGWA 4N07A 4X48A 5HBCA 4O7MA 3FVKA 1LSTA 3N6UA 3IX1A 1B3FA 5DEXA 5FBPA 4HE1A 4F1UA 2F34A 4KI0E 2FNCA 4O7IA 1TXFA 1OVTA 4NWDA 5DEXB 5BWJA 3E78A 2AIXA 4H46A 4BLAA 3KSJA 3HFUA 4UABA 1H43A 4HCWA 1B0HA 4E0XA 5K2XA 1P1OA 5FHNA 3H03A 4NF5A 5IM2A 5EHSA 4PFRA 1OIBA 1NV6A 4BDRA 4GWSA 3PUZE 3H6WA 3FV2A 4PFWA 3PD8A 4BDNA 4NF5B 3G3GA 1FCKA 2QS1A 4HW8A 4NF4B 3RYBA 4Z0IA 4LZ5A 3UORA 3DRHA 3SETA 2VPNA 2DWHA 3SESA 3UK4A 1IUDA 1LBXA 4O3BA 1MQIA 1WDNA 3M3FA 1TFDA 3OO6A 3GXAA 3A3UA 4U2RA 1GVCA 4DE8A 3SZPA 5AA4A 3V8XB 1O64A 3USDA 2R6GE 3LBSA 2WOKA 1VFEA 4OZ9A 4ESWA 3MP6A 3Q29A 5AA4B 2ZZXA 2QVUA 4QFNA 3MSTA 3IR1A 5J16A 2A5SA 5KDTA 2WYPA 4ISUA 1N76A 2WBBA 3BFTA 5H8SA 4Q5TA 2Q8MA 4GFRA 1DPPA 1AWBA 4X1DA 3KN7A 1BTJA 5DT6A 3THIA 2JJKA 4DIGA 4LATA 1TT1A 4DI3D 4G8NA 4OMBA 1FPJA 1B58A 3FUZA 1P1WA 1R6ZA 3TCGA 2OZZA 4IO2A 3MP8A 2I4BA 2QL3A 1SW2A 3PUVE 3WAEA 1IMBA 4PETA 4KD5A 3MPLA 3MPKA 5I2NA 3CRBA 4OENA 3MVWA 1QUJA 3GLBA 3LV0A 1FTOA 1B4HA 4MNCA 2OWSA 1AIVA 1XC1A 3C32A 3KG2A 2ZNUA 1NV4A 3C9HA 4ZEBA 3C33A 1NUWA 3FXRA 3OEMA 2VHAA 3MC2A 4MAGA 1MPBA 2VPOA 5I2KA 1JVYA 3K1NA 4Z7EA 4HCYA 5EQ8A 2XX7A 1B7HA 2H99A 4N15A 3DP4A 2PT2A 4IR8A 4ELOA 2B65A 3OMBA 3RLFE 1FPKA 4I1DA 5EYHA 5IAIA 2I0BA 1LFIA 1UIUA 4LN5A 1IMEA 4Q0CA 5I5PA 5KZTA 2OBGA 1FPIA 4XFEA 3TCFA 4R6HA 5TP9A 1B3GA 2F6GA 3VFJA 3G3HA 4ZZEA 1POY1 1IIWA 2DXYA 3MZBA 3K0VA 1CE2A 2I3WA 5TP9B 3U94A 3KEIA 4GD5A 2HAVA 2F78A 1Y3PA 4PCDA 5DVFA 3VLVA 1SD3A 5F24A 2QFLA 2O68A 2RCAA 1D3KA 5ITPA 1GV8A 1IZ1A 2KQZA 1QKBA 2VD2A 4YZZA 4H5GA 1G0IA 2ONSA 3S9EA 3U65A 3S4UA 4C1UA 3DRJA 3PMVA 1J1NA 1OLAA 4EQBA 2DVCA 1Y1MA 5ICQA 1BK4A 3FXUA 3FXQA 2DS9A 1IITA 2NXOA 3IJXB 1B5HA 1QJMA 1OQHA 5L8DA 3EHTA 5I84A 5H8FB 3IFAA 2XXYA 5L9MA 2F36A 4WKMA 3ECRA 1EH3A 4U21A 5K2YA 3K2DA 3GBBA 4PE5B 1NUXA 2KLFA 3KOTA 4N6DA 4QFKA 4N81A 3TPAA 3MWBA 3LC8A 4GX6A 4JVCA 1SVXB 3PV0E 4IY6A 4RPOA 1O63A 2QVVA 4JVDA 5CBRA 1AOVA 4F3BA 1IXGA 2KR0A 1NV3A 4MF3A 3PUYE 4AB6A 3QUJA 3G7WA 4IY5A 2RC7A 4P3LA 3IO6A 1JNFA 4YU0A 1LBWA 3VVFA 1JETA 3T0JA 4GWUA 1G0HA 3TTRA 2AL5A 4LZ8A 1AMFA 4IO3A 1D9YA 2R9JA 3GZGA 4LONB 2GH9A 3TDJA 2XX8A 1ATGA 2HEUA 2H9BA 3VV5A 2WOPA 1DTZA 4PFBA 1LBYA 1KA0A 4RPNA 5I7IA 1NNTA 4F3PA 5AA2A 3M3LA 1ZMGA 3FV1A 1URDA 4IGRA 1AL3A 2H5YA 2UVIA 3IJOB 4MNPA 5AA2B 1MXYA 1US4A 2QVRA 2XA5A 2DVZA 5JTYB 3W9WA 5BUUA 3MJNA 4PDDA 3TTKA 3DP6A 2Q2AA 3VXCA 1NUZA 1POTA 4DXCA 4EXLA 4H0WA 3PGFA 3S9MC 3F11A 4ELPA 1FTJA 2ANJA 1MY4A 1YCJA 2M8CA 1FTAA 1LBVA 4AS4A 2XD3A 5ET6A 1LAXA 2O7IA 3TUSA 1YYZA 5F7VA 1USYH 1UTHA 2G29A 1ZKBA 5IKBA 4KYDA 3N26A 4PTKA 1XI6A 1MXXA 3FBPA 4R2FA 2RF1A 4N8YA 1B3EA 3LR1A 1UTHB 3E3KA 2O7UA 2CZKA 4JWYA 3H4ZA 4DXBA 3T93B 1ZLQA 1K9YA 1IMCA 3MVYA 4P9KA 4QXDA 1B9JA 2WOLA 2I49A 4OVJA 4MJOA 4EQ9A 1SW5A 4G8HA 4OXVA 3A3CA 3D4CA 4H8IA 1DOTA 1N3XA 2F3DA 1LAGE 3HN0A 1MXUA 3BIHA 3IFCA 2Z23A 2Q8JA 3SKPA 4FJPA 5EYFA 1MQGA 3OSQA 1PBPA 4N4UA 2VD3A 2UVJA 1JEUA 4GIZA 3U8QA 4X04A 1JW5A 3PTYA 1B4ZA 5IZZA 4ZECA 3ONMA 3O97A 4XKQA 4ELQA 3SDFA 4PFIA 1S50A 1FSAA 4NF0A 4RK9A 1FBGA 1IEJA 1I6QA 4LA9A 4ZDMA 2DE2A 4F3SA 4LQ2A 1MY0A 1TWYA 1M5FA 3K6VA 3TCHA 2OX3A 2HAUA 1YPNA 5I59B 3RTFB 1KWHA 2HXWA 3R6UA 2Q89A 2UVHA 1Y3NA 4YKIA 3T9VA 1FJ6A 2AL4A 1RYOA 1NV1A 4YB7A 1FBDA 3OEKA 1XVXA 3Q28A 5IZ1A 2ZYMA 1H76A 3TKDA 4IO6A 1VFDA 3LUZA 4H65A 1SDXA 1QULA 1JW4A 3PUXE 2HQ0A 3T66A 1D9QA 3CIJA 1K9ZA 4ZEFA 2WEFA 4K3FA 3FVNA 2ZYNA 3KBZA 4NF8A 4IO7A 1NFTA 3BKIB 4GXAA 4JVIA 4WXJA 5ET7A 5TPAA 2XXIA 2UYEA 3N5LA 1MQHA 1N7WA 4PF8A 5H8QA 5TU0A 1IXIA 4N8GA 4NF4A 4NF8B 3PMWA 5LTCA 4OYVA 5TPAB 1FTLA 5H8QB 2DWJA 4F22A 5B7DA 2OLBA 1FTKA 3RPLB 3OO9A 2CEYA 1MXWA 1PEBA 2FYIA 2P3NA 1UIVA 1B2HA 5I3SA 1LCTA 1SI1A 1EYJA 2O1LA 1JW1A 3C36A 4UA8A 1LBZA 5CI5A 2DWAA 1IXHA 1RYXA 2BJJX 5I56A 2B4LA 3TAJA 2O69A 4R9GA 1B40A 3ZSFA 3S9LC 4N6KA 5H8NA 3OENA 2Q9TA 5I56B 1B1XA 3FTOA 5H8NB 3PPPA 1SYHA 2QS3A 4WEDA 4P1LA 2MKZA 1AH5A 1WVJA 1R9QA 4P0GA 1OLCA 1QGXA 4X9TA 2XXXA 2W7YA 3G3JA 4QSEA 1DCUA 3IOWA 1YTVA 2RKMA 2GHAA 2PMSA 1CNQA 2X26A 5AA2D 2DQVA 4OFOA 2R8TA 1NH7A 1VE4A 3H6VA 4C1TA 2ZYKA 4KQPA 3VLWA 5IZ3B 3MZ9A 3I6VA 1A54A 1NV7A 2YPNA 1MM7A 1M5DA 2Y5KA 2BJIA 2HZKA 4POWA 4F31B 2CZHA 4TOZA 2THIA 3NOHA 4G68A 3PPRA 5CC2A 4DZ1A 4OVPA 3GYYA 3I5OA 2O51A 2P2AA 4ECFA 2XXQA 4OESA 1D4NA 4HE0A 4G68C 3H7MA 4MIJA 5CMCA 4MBPA 4G68B 2RC8A 4C0RA 2I0CA 3CFZA 1RDXA 4H5FA 2GFEA 2D21A 3CSGA 4IB2A 4PC9A 1Z7ME 4NF6B 5I58A 4R2BA 2PX1A 1B46A 4EQ7A 4FAJA 4TLMB 1ZBMA 5I58B 3B8BA 1NNKA 4G61A 1Q35A 1MS7A 3DLNA 3EHSA 3HPIA 1LAHE 3FJ7A 4YMAA 4KHZE 5M2VA 1VR5A 2O1MA 4BDLA 2R71A 3RYAA 3OXNA 4U23A 2XHDA 2ZXTA 1MM6A 3U93A 4I9DA 1P99A 2I58A 3CVGA 4MMPA 2Y7IA 4MFIA 2Q2CA 2Q74A 2XWIA 1MPDA 2XXUA 5I57B 4KYSA 2UXAA 2HCAA 3P7IA 1MH4A 4H6DA 2AYSA 3TELA 2OJTA 2F7AA 4IO5A 3OO7A 1UQWA 2Z8FA 1NH8A 1N84A 1ZU0A 4FBPA 2O6AA 3O9PA 4OEUA 3DRFA 4IO4A 3TFLA 3QMFA 4EDPA 3C34A 2FHYA 2F8DA 3OSRA 3JV9A 5AA1A 4NEDA 4P1EA 3TQWA 1XHYA 3N94A 2VT5A 4H8JA 1JP4A 3I3VA 3CR9A 1WODA 3IORA 1NV2A 4U22A 3T96B 4GWYA 4PF6A 4F39A 4OWDA 4G2ZA 4U1ZA 4F1YA 4MCOA 2FBPA 5H8FA 2ABHA 4H45A 3W15C 2DWIA 1SBPA 4PFTA 3ZKKA 4XTCQ 2PFYA 4R72A 2XXWA 1BP5A 4FEDA 5KCJA 3Q26A 4JB7A 4MLVA 3L6HA 3O6HA 2XXKA 2ZNTA 3DM0A 2PBWA 2H98A 1XS5A 4F2OA 2YJPA 5KCJB 1SW1A 4F29A 1LLSA 1ZTYA 1H45A 1SQYA 4DDDA 1URSA 3Q25A 2CZLA 3OD7A 4ELRA 4I62A 1RKMA 2I48A 3ILTB 4NAPA 1LB9A 2ALUA 1EYKA 1INPA 4OHNA 2B3FA 4PFUA 4KCCA 5CMKA 4GWZA 3V89B 4FATA 3R26A 3H3GA 3B50A 4AQ4A 4F2QA 4BDQA 3ZS6A 2I4CA 4LP2B 4OFLA 3CG1A 4JSDA 3K1MA 1JEVA 4XIGQ 4U4XA 2DP8A 2OK2A 3Q27A 1EZ9A 1B7ZA 1QW0A 5IGAA 4MLQA 3O6GA 3LVUA 3HCQA 4FECA 3KN3A 3ZKLA 1R1NA 2OWZA 4QFLA 4DCYA 4G8MA 3D1RA 5JTYA 4O8MA 1LFHA 4X1BA 4PAIA 3FGSA 3O6PA 1LEVA 1US5A 3EQ1A 2QSXA 4GWWA 1B7UA 4OA4A 1FJ9A 4IGTA 1FQFA 4OTEA 4M1VA 2E1SA 3FZVA 4FIMA 2NUVA 4ZEKA 4MNIA 2DYXA 3IK6B 3DRIA 1HSJA 3TQLA 4R74A 2F35A 3DRGA 3CI8A 4TQUQ 5L9OA 3ODBA 1QUIA 2DSFA 4U4SA 4GBVA 1BKAA 1Z7NE 4EF1A 3KOSA 3OOAA 3B6TA 2VGQA 2NVUB 3SEWA 5JK4A 2RC9A 3LSWA 3V83A 2D5WA 2P0SA 1Y9UA 3OO8A 2FIXA 3TTMA 4XXUA 1DPEA 5ISUA 1H3DA 2NOOA 2H4IA 1JQFA 4KFQA 2QRYA 3MVZA 1B32A 4LQ5A 4YMBA 1QVSA 1O7TA 1FBFA 2XXTA 2X7PA 3U1OA 2ZMBA 3C35A 2A5TA 4THIA 1XVYA 1URGA 3IB1A 4NGUA 1BIYA 4ONYA 1TFAA 2CEXA 2GQ1A 2Y5LA 4N6PA 5LDZA 2A5TB 2WKYA 3WAFA 1SW4A 4L17A 1B52A 2PVUA 3HO7A 3KFMA 3G3FA 4LUBA 4R9FA 1FW0A 4PFYA 1IXCA 3IB2A 3MBPA 5I59A 3PMXA 1GGGA 3O29A 4NHBA 1NNPA 1GTKA 2ZYOA 1OVBA 3FIRA 4HXVA 5DVIA 3KC0A 5CM6A 1FRPA 2Y7KA 3PD9A 5EQ7A 3IOTA 4M4GA 4GWOA 1RDYA 1B51A 5ESYA 3A29A 2REGA 4YICA 4RNSA 3FASA 1PB8A 3FJMA 3CFLA 3IOVA 2DXRA 4GL0A 1EU8A 1A40A 1F9BA 3PUWE 4R73A 1M5BA 3T9XB 5T3JA 1B0LA 1B1HA 1P1UA 3PPNA 2G93A 1FPFA 3TTLA 4H67A 2V3UA 2V84A 1LBBA 1MDP1 1MH3A 3R7XA 2XXRA 3TTNA 4GL8A 4QBAA 5EHMA 4XKPA 1ANFA 3TZAA 2QS2A 4OVQA 2V93A 4ND9A 4ZS9A 4O94A 2Q88A 2VP1A 3EN3A 4OANA 3RPLA 3VDFA 2QPQA 1EZOA 1IMAA 4NWCA 4G4PA 3CSBA
chains in the Genus database with same CATH topology
1MQJA 2DE3A 2PT1A 3MAMA 1PC3A 3LUYA 1L5TA 3EF7A 4QSDA 4LZ7A 2XXPA 4F19A 5JEIA 3W9VA 2P1SA 1H44A 5HPQA 4EF2A 2V25A 1ELJA 3RGYA 1A7LA 2I3VA 4WEPA 4YB5A 3MQ9A 4EXKA 1HSLA 3TODA 1JVXA 3DP8A 2V3TA 1OQGA 1A99A 1B05A 4OETA 2CMOA 4TLLB 2B4MA 3CHGA 3M8UA 3MUQA 1N3WA 2F5XA 1Y4TA 3SERA 4OFJA 3K6XA 5FHMA 4GF8A 2H25A 2YLNA 2Z8DA 3VXBA 5DVJA 1DTGA 4G77A 4H1XA 1QUKA 3KBRA 2D3IA 5CMMA 3H06B 3K02A 3O2AA 4POXA 1LB8A 5AA3A 3CFXA 4R6KA 1MPCA 3TYHA 4RYAA 1DMBA 3QXMA 4RXLA 1R9LA 3U72A 1LAFE 3SEUA 4RK2A 3QUFA 4Q8RA 5KDTB 4R6YA 1HSEA 4JDFA 3G3IA 5AE4A 3RT6B 3RT8A 3PU5A 1SYIA 2RCBA 3E4RA 5L9SA 4YKJA 1I6BA 3E13X 1Y1ZA 4NF6A 1MY1A 1A8FA 1YAEA 1CB6A 2RINA 1Q1KA 4RA1A 3HV1A 3H6UA 3ILUB 1B5JA 1USYE 3K00A 5I2NB 3LSXA 1PB9A 3FVOA 3VVEA 4JSOA 4HS7A 3UP9A 2F7CA 2F7BA 2XXHA 1M5EA 1B6HA 3UN6A 3EPEA 3H6TA 3FVGA 2LAOA 3DELB 5I57A 1LFGA 1S7YA 5I2KB 4YB6A 4PQJA 4ZE8A 3B6WA 3RY3A 4KR5A 1IQ7A 1PBQA 1Y20A 1MDQA 4JWXA 4RY1A 2I6EA 3KZGA 1FQEA 1FQDA 1P1NA 3IO4A 1OMPA 5DTBA 1UTBA 1B5IA 4JXIA 4DXUA 1N04A 2XX9A 4OERA 1XT8A 2ESNA 1SI0A 3DRKA 1VSOA 1N0TA 4F18A 4QFOA 2E0SA 1UTBB 3UA8A 3FD3A 3K6UA 2NWJA 4PP0A 1LBCA 3C31A 3O66A 4KYEA 3VVDA 2Z8EA 1A8EA 4OQOA 4GXSB 3PPQA 1FQCA 3RTWB 4BDOA 1II5A 4QHQA 2IA4A 5CBSA 4FORA 2DE4A 2IEEA 4KCDA 2QMXA 4ZEDA 3MVXA 3U92A 3FJGA 2QS4A 4YKPA 5LOMA 2VOZA 3LSLA 5A5XA 3D4GA 3FATA 4GQOA 4FE8A 1Y3QA 1MXVA 3G3KA 5A5XB 1FQBA 1MG1A 1MY2A 3M3KA 1MY3A 3HSTA 3S9NC 3TEPA 1BLFA 2F97A 5FHOA 4O3CA 4NMYA 2B3BA 4ZZAA 3V5AA 3HHFA 1NNFA 3LSFB 2V3QA 3QYTA 4F3GA 3OELA 4GRKA 1DSNA 3K1PA 4XKRA 2HZLA 3VE1B 2OCUA 3QAXA 1LCFA 3PPOA 2Z22A 3KN8A 4GLIA 2OWTA 2QJEA 4RJZA 1M5CA 3MP1A 2X7QA 2DOJA 3TMGA 4NE4A 3PAMA 4NTLA 3O28A 4AB5A 3E9XA 4P11A 4FEBA 3B6QA 4P0IA 3IOUA 4QSCA 1B3HA 1P1QA 1MXZA 2Y84A 3K01A 2Y7WA 4JWOA 4XKNA 1PB7A 2ZNSA 4GOTA 1MQDA 1GR2A 3A09A 1ZIUA 3C4MA 5ICTA 3SEXA 3IAZA 4KPTA 4Q30B 4F1VA 1I6AA 2XXVA 1FTMA 4YKKA 2Y7PA 3MW0A 1PDAA 4I8CA 3CG3A 3JZJA 2REJA 1S9TA 5F1QA 5ITOA 3T22A 1NL5A 1MRPA 3QK6A 3T9HB 1N7XA 3MZ1A 4HTGA 5H8HA 5FTIA 5HM4B 2Y7RA 4ZE9A 3RQTA 4QRZA 1LGBC 3KGCA 1QKAA 4GVOA 5H8HB 3HHGA 3QIMA 1NMUA 3GBAA 4YAHX 5J1DA 2HFBA 1T0KA 1Y4CA 1EZPA 4MH5A 2QMWA 5CMBA 3KJTA 4QF9A 2UVGA 3RNNA 5ELVA 3SEYA 2GRVA 3RN8A 4DCXA 3O6IA 5DYHA 4ESXA 2UYFA 2F6PA 3EHUA 4EUOA 4OEVA 4LVQA 1NKXA 2O84X 5B70A 4O3AA 3K4UA 1D9VA 4UACA 4ZEIA 1B3LA 3BFUA 4U1OA 2PYYA 5FTHA 3RUMA 1FQAA 3JYRA 1I69A 1XOCA 3IB0A 4BDMA 3S2VA 3KJ7A 4N13A 3SEVA 3BBRA 4QFPA 2GHBA 1ZJLA 1A55A 3K6WA 4JBZA 3L6GA 3VLUA 3N6TA 3IL1B 3T9UA 5CRYA 4DLDA 4R75A 4E0WA 2FA7A 2ONKE 2ONRA 3UIFA 3RPWA 3B7DA 3AXFA 3KSXA 2XD2A 3QSLA 3UGWA 4N07A 4X48A 5HBCA 3FVKA 1LSTA 3N6UA 3IX1A 1B3FA 5DEXA 4F1UA 2F34A 4KI0E 2FNCA 1TXFA 1OVTA 4NWDA 5DEXB 5BWJA 2AIXA 4BLAA 3KSJA 1H43A 4HCWA 1B0HA 4E0XA 5K2XA 1P1OA 5FHNA 3H03A 4NF5A 5EHSA 1OIBA 4BDRA 3PUZE 3H6WA 3FV2A 4PFWA 3PD8A 4BDNA 4NF5B 3G3GA 1FCKA 2QS1A 4HW8A 4NF4B 3RYBA 4Z0IA 4LZ5A 3UORA 3DRHA 3SETA 3SESA 2DWHA 3UK4A 1IUDA 4O3BA 1MQIA 1WDNA 3M3FA 1TFDA 3OO6A 3GXAA 3A3UA 4U2RA 1GVCA 4DE8A 5AA4A 3V8XB 1O64A 3USDA 2R6GE 3LBSA 2WOKA 1VFEA 4OZ9A 4ESWA 3MP6A 3Q29A 5AA4B 4QFNA 3IR1A 2A5SA 5KDTA 4ISUA 1N76A 3BFTA 5H8SA 4Q5TA 4GFRA 1DPPA 4X1DA 3KN7A 1BTJA 5DT6A 3THIA 4DIGA 4LATA 1TT1A 4G8NA 4OMBA 1B58A 3FUZA 1P1WA 1R6ZA 3TCGA 2OZZA 4IO2A 3MP8A 2I4BA 2QL3A 1SW2A 3PUVE 3WAEA 4PETA 4KD5A 3MPLA 3MPKA 5I2NA 3CRBA 4OENA 3MVWA 1QUJA 3GLBA 1FTOA 1B4HA 2OWSA 1AIVA 1XC1A 3C32A 3KG2A 2ZNUA 3C9HA 4ZEBA 3C33A 3FXRA 3OEMA 2VHAA 3MC2A 1MPBA 5I2KA 1JVYA 3K1NA 4Z7EA 4HCYA 2XX7A 1B7HA 2H99A 3DP4A 2PT2A 4ELOA 2B65A 3OMBA 3RLFE 4I1DA 5IAIA 2I0BA 1LFIA 1UIUA 4Q0CA 5KZTA 2OBGA 3TCFA 4R6HA 5TP9A 1B3GA 2F6GA 3VFJA 3G3HA 4ZZEA 1POY1 1IIWA 2DXYA 3MZBA 3K0VA 1CE2A 2I3WA 5TP9B 3U94A 3KEIA 4GD5A 2HAVA 2F78A 1Y3PA 5DVFA 3VLVA 1SD3A 2RCAA 2O68A 1D3KA 5ITPA 1GV8A 1IZ1A 1QKBA 2VD2A 4YZZA 4H5GA 2ONSA 3S9EA 3S4UA 4C1UA 3DRJA 3PMVA 1J1NA 1OLAA 4EQBA 2DVCA 1Y1MA 5ICQA 3FXUA 3FXQA 2DS9A 1IITA 2NXOA 3IJXB 1B5HA 1QJMA 1OQHA 5L8DA 3EHTA 5I84A 5H8FB 2XXYA 5L9MA 2F36A 4WKMA 3ECRA 1EH3A 4U21A 5K2YA 3K2DA 3GBBA 4PE5B 2KLFA 3KOTA 4QFKA 3TPAA 3MWBA 3LC8A 1SVXB 3PV0E 4IY6A 4RPOA 1O63A 5CBRA 1AOVA 4F3BA 1IXGA 4MF3A 3PUYE 4AB6A 3QUJA 3G7WA 4IY5A 2RC7A 3IO6A 1JNFA 4YU0A 3VVFA 1JETA 3TTRA 2AL5A 4LZ8A 1AMFA 4IO3A 1D9YA 2R9JA 3GZGA 4LONB 2GH9A 3TDJA 2XX8A 1ATGA 2HEUA 2H9BA 3VV5A 2WOPA 1DTZA 4RPNA 1NNTA 4F3PA 5AA2A 3M3LA 1ZMGA 3FV1A 1URDA 4IGRA 1AL3A 2H5YA 2UVIA 3IJOB 5AA2B 1MXYA 1US4A 2DVZA 5JTYB 3W9WA 5BUUA 3MJNA 3TTKA 3DP6A 2Q2AA 3VXCA 1POTA 4DXCA 4EXLA 4H0WA 3PGFA 3S9MC 3F11A 4ELPA 1FTJA 2ANJA 1MY4A 1YCJA 2M8CA 2XD3A 1LAXA 2O7IA 3TUSA 5F7VA 1USYH 1UTHA 2G29A 1ZKBA 5IKBA 4KYDA 3N26A 1MXXA 4R2FA 2RF1A 1B3EA 3LR1A 1UTHB 3E3KA 2O7UA 4JWYA 3H4ZA 4DXBA 3T93B 1ZLQA 3MVYA 1B9JA 2WOLA 2I49A 4OVJA 4EQ9A 1SW5A 4G8HA 4OXVA 3A3CA 3D4CA 4H8IA 1DOTA 1N3XA 1LAGE 3HN0A 1MXUA 2Z23A 2Q8JA 3SKPA 4FJPA 5EYFA 1MQGA 3OSQA 1PBPA 2VD3A 2UVJA 1JEUA 4GIZA 3U8QA 1JW5A 1B4ZA 4ZECA 3ONMA 3O97A 4XKQA 4ELQA 3SDFA 1S50A 4RK9A 1IEJA 1I6QA 4LA9A 4ZDMA 2DE2A 4F3SA 4LQ2A 1MY0A 1TWYA 1M5FA 3K6VA 3TCHA 2HAUA 1YPNA 5I59B 3RTFB 1KWHA 2HXWA 3R6UA 2Q89A 2UVHA 1Y3NA 4YKIA 3T9VA 2AL4A 1RYOA 4YB7A 3OEKA 1XVXA 3Q28A 2ZYMA 1H76A 3TKDA 4IO6A 1VFDA 4H65A 1SDXA 1QULA 1JW4A 3PUXE 2HQ0A 3T66A 3CIJA 4ZEFA 4K3FA 3FVNA 2ZYNA 4NF8A 4IO7A 1NFTA 3BKIB 4GXAA 4WXJA 5TPAA 2XXIA 2UYEA 3N5LA 1MQHA 1N7WA 5H8QA 5TU0A 1IXIA 4NF4A 4NF8B 3PMWA 4OYVA 5TPAB 1FTLA 5H8QB 2DWJA 4F22A 5B7DA 2OLBA 1FTKA 3OO9A 1MXWA 1PEBA 2FYIA 1UIVA 1B2HA 1LCTA 1SI1A 2O1LA 1JW1A 3C36A 4UA8A 5CI5A 2DWAA 1IXHA 1RYXA 2BJJX 5I56A 2B4LA 3TAJA 2O69A 4R9GA 1B40A 3ZSFA 3S9LC 5H8NA 3OENA 2Q9TA 5I56B 1B1XA 3FTOA 5H8NB 3PPPA 1SYHA 2QS3A 4WEDA 1AH5A 1WVJA 1R9QA 4P0GA 1OLCA 4X9TA 2XXXA 2W7YA 3G3JA 4QSEA 3IOWA 1YTVA 2RKMA 2GHAA 2PMSA 2X26A 5AA2D 2DQVA 4OFOA 1NH7A 1VE4A 3H6VA 4C1TA 2ZYKA 4KQPA 3VLWA 3MZ9A 3I6VA 1A54A 2YPNA 1MM7A 1M5DA 2HZKA 4POWA 4F31B 4TOZA 2THIA 4G68A 3PPRA 5CC2A 4DZ1A 3I5OA 2O51A 2P2AA 4ECFA 2XXQA 4OESA 1D4NA 4G68C 3H7MA 5CMCA 4MBPA 4G68B 2RC8A 4C0RA 2I0CA 3CFZA 3CSGA 2GFEA 2D21A 4H5FA 4IB2A 1Z7ME 4NF6B 5I58A 4R2BA 2PX1A 1B46A 4EQ7A 4FAJA 4TLMB 1ZBMA 5I58B 1NNKA 1Q35A 1MS7A 3DLNA 3EHSA 3HPIA 1LAHE 3FJ7A 4YMAA 4KHZE 5M2VA 1VR5A 2O1MA 4BDLA 2R71A 3RYAA 3OXNA 4U23A 2XHDA 2ZXTA 1MM6A 3U93A 4I9DA 1P99A 2I58A 3CVGA 2Y7IA 4MFIA 2Q2CA 1MPDA 2XXUA 5I57B 4KYSA 2UXAA 2HCAA 3P7IA 1MH4A 4H6DA 2AYSA 3TELA 2OJTA 2F7AA 4IO5A 3OO7A 1UQWA 2Z8FA 1NH8A 1N84A 1ZU0A 2O6AA 3O9PA 4OEUA 3DRFA 4IO4A 3TFLA 4EDPA 3C34A 2F8DA 3OSRA 3JV9A 5AA1A 4NEDA 3TQWA 1XHYA 3N94A 4H8JA 3I3VA 3CR9A 1WODA 3IORA 4U22A 3T96B 4F39A 4OWDA 4G2ZA 4U1ZA 4F1YA 5H8FA 2ABHA 3W15C 2DWIA 1SBPA 4PFTA 3ZKKA 4XTCQ 4R72A 2XXWA 1BP5A 4FEDA 5KCJA 3Q26A 4JB7A 4MLVA 3L6HA 3O6HA 2ZNTA 3DM0A 2PBWA 2H98A 1XS5A 4F2OA 2YJPA 5KCJB 1SW1A 4F29A 1LLSA 1ZTYA 1H45A 1SQYA 4DDDA 1URSA 3Q25A 2CZLA 3OD7A 4ELRA 4I62A 1RKMA 2I48A 3ILTB 1LB9A 2ALUA 4OHNA 2B3FA 4PFUA 4KCCA 5CMKA 3V89B 4FATA 3R26A 3H3GA 4AQ4A 4F2QA 4BDQA 3ZS6A 2I4CA 4LP2B 4OFLA 3CG1A 4JSDA 3K1MA 1JEVA 4XIGQ 4U4XA 2DP8A 2OK2A 3Q27A 1EZ9A 1B7ZA 1QW0A 4MLQA 3O6GA 3LVUA 3HCQA 4FECA 3KN3A 3ZKLA 1R1NA 4QFLA 4DCYA 4G8MA 5JTYA 1LFHA 4X1BA 3FGSA 3O6PA 1US5A 3EQ1A 2QSXA 1B7UA 4IGTA 1FQFA 4OTEA 4M1VA 2E1SA 3FZVA 4FIMA 2NUVA 4ZEKA 2DYXA 3IK6B 3DRIA 1HSJA 3TQLA 4R74A 2F35A 3DRGA 3CI8A 4TQUQ 5L9OA 3ODBA 1QUIA 2DSFA 4U4SA 1BKAA 1Z7NE 4EF1A 3KOSA 3OOAA 3B6TA 2VGQA 2NVUB 3SEWA 5JK4A 2RC9A 3LSWA 3V83A 2D5WA 2P0SA 1Y9UA 3OO8A 3TTMA 4XXUA 1DPEA 5ISUA 1H3DA 2NOOA 2H4IA 1JQFA 4KFQA 2QRYA 3MVZA 1B32A 4LQ5A 4YMBA 1QVSA 1O7TA 2XXTA 2X7PA 3U1OA 2ZMBA 3C35A 2A5TA 4THIA 1XVYA 1URGA 3IB1A 1BIYA 4ONYA 1TFAA 4N6PA 2A5TB 2WKYA 3WAFA 1SW4A 4L17A 1B52A 2PVUA 3HO7A 3KFMA 3G3FA 4LUBA 4R9FA 1FW0A 4PFYA 1IXCA 3IB2A 3MBPA 5I59A 3PMXA 1GGGA 3O29A 1NNPA 1GTKA 2ZYOA 1OVBA 3FIRA 5DVIA 5CM6A 2Y7KA 3PD9A 3IOTA 4M4GA 4GWOA 1B51A 2REGA 4YICA 4RNSA 3FASA 1PB8A 3FJMA 3CFLA 3IOVA 2DXRA 4GL0A 1EU8A 1A40A 1F9BA 3PUWE 4R73A 1M5BA 3T9XB 1B0LA 1B1HA 1P1UA 3PPNA 2G93A 3TTLA 4H67A 2V3UA 2V84A 1LBBA 1MDP1 1MH3A 3R7XA 2XXRA 3TTNA 4GL8A 5EHMA 4XKPA 1ANFA 3TZAA 2QS2A 4ZS9A 2V93A 4ND9A 2Q88A 2VP1A 3EN3A 3VDFA 2QPQA 1EZOA 4NWCA 4G4PA 3CSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQJ A;  2DE3 A;  2PT1 A;  3MAM A;  1PC3 A;  3LUY A;  1L5T A;  3EF7 A;  4QSD A;  4LZ7 A;  2XXP A;  4F19 A;  5JEI A;  3W9V A;  2P1S A;  1H44 A;  5HPQ A;  4EF2 A;  2V25 A;  1ELJ A;  3RGY A;  1A7L A;  2I3V A;  4WEP A;  4YB5 A;  3MQ9 A;  4EXK A;  1HSL A;  3TOD A;  1JVX A;  3DP8 A;  2V3T A;  1OQG A;  1A99 A;  1B05 A;  4OET A;  2CMO A;  4TLL B;  2B4M A;  3CHG A;  3M8U A;  3MUQ A;  1N3W A;  2F5X A;  1Y4T A;  3SER A;  4OFJ A;  3K6X A;  5FHM A;  4GF8 A;  2H25 A;  2YLN A;  2Z8D A;  3VXB A;  5DVJ A;  1DTG A;  4G77 A;  4H1X A;  1QUK A;  3KBR A;  2D3I A;  5CMM A;  3H06 B;  3K02 A;  3O2A A;  4POX A;  1LB8 A;  5AA3 A;  3CFX A;  4R6K A;  1MPC A;  3TYH A;  4RYA A;  1DMB A;  3QXM A;  4RXL A;  1R9L A;  3U72 A;  1LAF E;  3SEU A;  4RK2 A;  3QUF A;  4Q8R A;  5KDT B;  4R6Y A;  1HSE A;  4JDF A;  3G3I A;  5AE4 A;  3RT6 B;  3RT8 A;  3PU5 A;  1SYI A;  2RCB A;  3E4R A;  5L9S A;  4YKJ A;  1I6B A;  3E13 X;  1Y1Z A;  4NF6 A;  1MY1 A;  1A8F A;  1YAE A;  1CB6 A;  2RIN A;  1Q1K A;  4RA1 A;  3HV1 A;  3H6U A;  3ILU B;  1B5J A;  1USY E;  3K00 A;  5I2N B;  3LSX A;  1PB9 A;  3FVO A;  3VVE A;  4JSO A;  4HS7 A;  3UP9 A;  2F7C A;  2F7B A;  2XXH A;  1M5E A;  1B6H A;  3UN6 A;  3EPE A;  3H6T A;  3FVG A;  2LAO A;  3DEL B;  5I57 A;  1LFG A;  1S7Y A;  5I2K B;  4YB6 A;  4PQJ A;  4ZE8 A;  3B6W A;  3RY3 A;  4KR5 A;  1IQ7 A;  1PBQ A;  1Y20 A;  1MDQ A;  4JWX A;  4RY1 A;  2I6E A;  3KZG A;  1FQE A;  1FQD A;  1P1N A;  3IO4 A;  1OMP A;  5DTB A;  1UTB A;  1B5I A;  4JXI A;  4DXU A;  1N04 A;  2XX9 A;  4OER A;  1XT8 A;  2ESN A;  1SI0 A;  3DRK A;  1VSO A;  1N0T A;  4F18 A;  4QFO A;  2E0S A;  1UTB B;  3UA8 A;  3FD3 A;  3K6U A;  2NWJ A;  4PP0 A;  1LBC A;  3C31 A;  3O66 A;  4KYE A;  3VVD A;  2Z8E A;  1A8E A;  4OQO A;  4GXS B;  3PPQ A;  1FQC A;  3RTW B;  4BDO A;  1II5 A;  4QHQ A;  2IA4 A;  5CBS A;  4FOR A;  2DE4 A;  2IEE A;  4KCD A;  2QMX A;  4ZED A;  3MVX A;  3U92 A;  3FJG A;  2QS4 A;  4YKP A;  5LOM A;  2VOZ A;  3LSL A;  5A5X A;  3D4G A;  3FAT A;  4GQO A;  4FE8 A;  1Y3Q A;  1MXV A;  3G3K A;  5A5X B;  1FQB A;  1MG1 A;  1MY2 A;  3M3K A;  1MY3 A;  3HST A;  3S9N C;  3TEP A;  1BLF A;  2F97 A;  5FHO A;  4O3C A;  4NMY A;  2B3B A;  4ZZA A;  3V5A A;  3HHF A;  1NNF A;  3LSF B;  2V3Q A;  3QYT A;  4F3G A;  3OEL A;  4GRK A;  1DSN A;  3K1P A;  4XKR A;  2HZL A;  3VE1 B;  2OCU A;  3QAX A;  1LCF A;  3PPO A;  2Z22 A;  3KN8 A;  4GLI A;  2OWT A;  2QJE A;  4RJZ A;  1M5C A;  3MP1 A;  2X7Q A;  2DOJ A;  3TMG A;  4NE4 A;  3PAM A;  4NTL A;  3O28 A;  4AB5 A;  3E9X A;  4P11 A;  4FEB A;  3B6Q A;  4P0I A;  3IOU A;  4QSC A;  1B3H A;  1P1Q A;  1MXZ A;  2Y84 A;  3K01 A;  2Y7W A;  4JWO A;  4XKN A;  1PB7 A;  2ZNS A;  4GOT A;  1MQD A;  1GR2 A;  3A09 A;  1ZIU A;  3C4M A;  5ICT A;  3SEX A;  3IAZ A;  4KPT A;  4Q30 B;  4F1V A;  1I6A A;  2XXV A;  1FTM A;  4YKK A;  2Y7P A;  3MW0 A;  1PDA A;  4I8C A;  3CG3 A;  3JZJ A;  2REJ A;  1S9T A;  5F1Q A;  5ITO A;  3T22 A;  1NL5 A;  1MRP A;  3QK6 A;  3T9H B;  1N7X A;  3MZ1 A;  4HTG A;  5H8H A;  5FTI A;  5HM4 B;  2Y7R A;  4ZE9 A;  3RQT A;  4QRZ A;  1LGB C;  3KGC A;  1QKA A;  4GVO A;  5H8H B;  3HHG A;  3QIM A;  1NMU A;  3GBA A;  4YAH X;  5J1D A;  2HFB A;  1T0K A;  1Y4C A;  1EZP A;  4MH5 A;  2QMW A;  5CMB A;  3KJT A;  4QF9 A;  2UVG A;  3RNN A;  5ELV A;  3SEY A;  2GRV A;  3RN8 A;  4DCX A;  3O6I A;  5DYH A;  4ESX A;  2UYF A;  2F6P A;  3EHU A;  4EUO A;  4OEV A;  4LVQ A;  1NKX A;  2O84 X;  5B70 A;  4O3A A;  3K4U A;  1D9V A;  4UAC A;  4ZEI A;  1B3L A;  3BFU A;  4U1O A;  2PYY A;  5FTH A;  3RUM A;  1FQA A;  3JYR A;  1I69 A;  1XOC A;  3IB0 A;  4BDM A;  3S2V A;  3KJ7 A;  4N13 A;  3SEV A;  3BBR A;  4QFP A;  2GHB A;  1ZJL A;  1A55 A;  3K6W A;  4JBZ A;  3L6G A;  3VLU A;  3N6T A;  3IL1 B;  3T9U A;  5CRY A;  4DLD A;  4R75 A;  4E0W A;  2FA7 A;  2ONK E;  2ONR A;  3UIF A;  3RPW A;  3B7D A;  3AXF A;  3KSX A;  2XD2 A;  3QSL A;  3UGW A;  4N07 A;  4X48 A;  5HBC A;  3FVK A;  1LST A;  3N6U A;  3IX1 A;  1B3F A;  5DEX A;  4F1U A;  2F34 A;  4KI0 E;  2FNC A;  1TXF A;  1OVT A;  4NWD A;  5DEX B;  5BWJ A;  2AIX A;  4BLA A;  3KSJ A;  1H43 A;  4HCW A;  1B0H A;  4E0X A;  5K2X A;  1P1O A;  5FHN A;  3H03 A;  4NF5 A;  5EHS A;  1OIB A;  4BDR A;  3PUZ E;  3H6W A;  3FV2 A;  4PFW A;  3PD8 A;  4BDN A;  4NF5 B;  3G3G A;  1FCK A;  2QS1 A;  4HW8 A;  4NF4 B;  3RYB A;  4Z0I A;  4LZ5 A;  3UOR A;  3DRH A;  3SET A;  3SES A;  2DWH A;  3UK4 A;  1IUD A;  4O3B A;  1MQI A;  1WDN A;  3M3F A;  1TFD A;  3OO6 A;  3GXA A;  3A3U A;  4U2R A;  1GVC A;  4DE8 A;  5AA4 A;  3V8X B;  1O64 A;  3USD A;  2R6G E;  3LBS A;  2WOK A;  1VFE A;  4OZ9 A;  4ESW A;  3MP6 A;  3Q29 A;  5AA4 B;  4QFN A;  3IR1 A;  2A5S A;  5KDT A;  4ISU A;  1N76 A;  3BFT A;  5H8S A;  4Q5T A;  4GFR A;  1DPP A;  4X1D A;  3KN7 A;  1BTJ A;  5DT6 A;  3THI A;  4DIG A;  4LAT A;  1TT1 A;  4G8N A;  4OMB A;  1B58 A;  3FUZ A;  1P1W A;  1R6Z A;  3TCG A;  2OZZ A;  4IO2 A;  3MP8 A;  2I4B A;  2QL3 A;  1SW2 A;  3PUV E;  3WAE A;  4PET A;  4KD5 A;  3MPL A;  3MPK A;  5I2N A;  3CRB A;  4OEN A;  3MVW A;  1QUJ A;  3GLB A;  1FTO A;  1B4H A;  2OWS A;  1AIV A;  1XC1 A;  3C32 A;  3KG2 A;  2ZNU A;  3C9H A;  4ZEB A;  3C33 A;  3FXR A;  3OEM A;  2VHA A;  3MC2 A;  1MPB A;  5I2K A;  1JVY A;  3K1N A;  4Z7E A;  4HCY A;  2XX7 A;  1B7H A;  2H99 A;  3DP4 A;  2PT2 A;  4ELO A;  2B65 A;  3OMB A;  3RLF E;  4I1D A;  5IAI A;  2I0B A;  1LFI A;  1UIU A;  4Q0C A;  5KZT A;  2OBG A;  3TCF A;  4R6H A;  5TP9 A;  1B3G A;  2F6G A;  3VFJ A;  3G3H A;  4ZZE A;  1POY 1;  1IIW A;  2DXY A;  3MZB A;  3K0V A;  1CE2 A;  2I3W A;  5TP9 B;  3U94 A;  3KEI A;  4GD5 A;  2HAV A;  2F78 A;  1Y3P A;  5DVF A;  3VLV A;  1SD3 A;  2RCA A;  2O68 A;  1D3K A;  5ITP A;  1GV8 A;  1IZ1 A;  1QKB A;  2VD2 A;  4YZZ A;  4H5G A;  2ONS A;  3S9E A;  3S4U A;  4C1U A;  3DRJ A;  3PMV A;  1J1N A;  1OLA A;  4EQB A;  2DVC A;  1Y1M A;  5ICQ A;  3FXU A;  3FXQ A;  2DS9 A;  1IIT A;  2NXO A;  3IJX B;  1B5H A;  1QJM A;  1OQH A;  5L8D A;  3EHT A;  5I84 A;  5H8F B;  2XXY A;  5L9M A;  2F36 A;  4WKM A;  3ECR A;  1EH3 A;  4U21 A;  5K2Y A;  3K2D A;  3GBB A;  4PE5 B;  2KLF A;  3KOT A;  4QFK A;  3TPA A;  3MWB A;  3LC8 A;  1SVX B;  3PV0 E;  4IY6 A;  4RPO A;  1O63 A;  5CBR A;  1AOV A;  4F3B A;  1IXG A;  4MF3 A;  3PUY E;  4AB6 A;  3QUJ A;  3G7W A;  4IY5 A;  2RC7 A;  3IO6 A;  1JNF A;  4YU0 A;  3VVF A;  1JET A;  3TTR A;  2AL5 A;  4LZ8 A;  1AMF A;  4IO3 A;  1D9Y A;  2R9J A;  3GZG A;  4LON B;  2GH9 A;  3TDJ A;  2XX8 A;  1ATG A;  2HEU A;  2H9B A;  3VV5 A;  2WOP A;  1DTZ A;  4RPN A;  1NNT A;  4F3P A;  5AA2 A;  3M3L A;  1ZMG A;  3FV1 A;  1URD A;  4IGR A;  1AL3 A;  2H5Y A;  2UVI A;  3IJO B;  5AA2 B;  1MXY A;  1US4 A;  2DVZ A;  5JTY B;  3W9W A;  5BUU A;  3MJN A;  3TTK A;  3DP6 A;  2Q2A A;  3VXC A;  1POT A;  4DXC A;  4EXL A;  4H0W A;  3PGF A;  3S9M C;  3F11 A;  4ELP A;  1FTJ A;  2ANJ A;  1MY4 A;  1YCJ A;  2M8C A;  2XD3 A;  1LAX A;  2O7I A;  3TUS A;  5F7V A;  1USY H;  1UTH A;  2G29 A;  1ZKB A;  5IKB A;  4KYD A;  3N26 A;  1MXX A;  4R2F A;  2RF1 A;  1B3E A;  3LR1 A;  1UTH B;  3E3K A;  2O7U A;  4JWY A;  3H4Z A;  4DXB A;  3T93 B;  1ZLQ A;  3MVY A;  1B9J A;  2WOL A;  2I49 A;  4OVJ A;  4EQ9 A;  1SW5 A;  4G8H A;  4OXV A;  3A3C A;  3D4C A;  4H8I A;  1DOT A;  1N3X A;  1LAG E;  3HN0 A;  1MXU A;  2Z23 A;  2Q8J A;  3SKP A;  4FJP A;  5EYF A;  1MQG A;  3OSQ A;  1PBP A;  2VD3 A;  2UVJ A;  1JEU A;  4GIZ A;  3U8Q A;  1JW5 A;  1B4Z A;  4ZEC A;  3ONM A;  3O97 A;  4XKQ A;  4ELQ A;  3SDF A;  1S50 A;  4RK9 A;  1IEJ A;  1I6Q A;  4LA9 A;  4ZDM A;  2DE2 A;  4F3S A;  4LQ2 A;  1MY0 A;  1TWY A;  1M5F A;  3K6V A;  3TCH A;  2HAU A;  1YPN A;  5I59 B;  3RTF B;  1KWH A;  2HXW A;  3R6U A;  2Q89 A;  2UVH A;  1Y3N A;  4YKI A;  3T9V A;  2AL4 A;  1RYO A;  4YB7 A;  3OEK A;  1XVX A;  3Q28 A;  2ZYM A;  1H76 A;  3TKD A;  4IO6 A;  1VFD A;  4H65 A;  1SDX A;  1QUL A;  1JW4 A;  3PUX E;  2HQ0 A;  3T66 A;  3CIJ A;  4ZEF A;  4K3F A;  3FVN A;  2ZYN A;  4NF8 A;  4IO7 A;  1NFT A;  3BKI B;  4GXA A;  4WXJ A;  5TPA A;  2XXI A;  2UYE A;  3N5L A;  1MQH A;  1N7W A;  5H8Q A;  5TU0 A;  1IXI A;  4NF4 A;  4NF8 B;  3PMW A;  4OYV A;  5TPA B;  1FTL A;  5H8Q B;  2DWJ A;  4F22 A;  5B7D A;  2OLB A;  1FTK A;  3OO9 A;  1MXW A;  1PEB A;  2FYI A;  1UIV A;  1B2H A;  1LCT A;  1SI1 A;  2O1L A;  1JW1 A;  3C36 A;  4UA8 A;  5CI5 A;  2DWA A;  1IXH A;  1RYX A;  2BJJ X;  5I56 A;  2B4L A;  3TAJ A;  2O69 A;  4R9G A;  1B40 A;  3ZSF A;  3S9L C;  5H8N A;  3OEN A;  2Q9T A;  5I56 B;  1B1X A;  3FTO A;  5H8N B;  3PPP A;  1SYH A;  2QS3 A;  4WED A;  1AH5 A;  1WVJ A;  1R9Q A;  4P0G A;  1OLC A;  4X9T A;  2XXX A;  2W7Y A;  3G3J A;  4QSE A;  3IOW A;  1YTV A;  2RKM A;  2GHA A;  2PMS A;  2X26 A;  5AA2 D;  2DQV A;  4OFO A;  1NH7 A;  1VE4 A;  3H6V A;  4C1T A;  2ZYK A;  4KQP A;  3VLW A;  3MZ9 A;  3I6V A;  1A54 A;  2YPN A;  1MM7 A;  1M5D A;  2HZK A;  4POW A;  4F31 B;  4TOZ A;  2THI A;  4G68 A;  3PPR A;  5CC2 A;  4DZ1 A;  3I5O A;  2O51 A;  2P2A A;  4ECF A;  2XXQ A;  4OES A;  1D4N A;  4G68 C;  3H7M A;  5CMC A;  4MBP A;  4G68 B;  2RC8 A;  4C0R A;  2I0C A;  3CFZ A;  3CSG A;  2GFE A;  2D21 A;  4H5F A;  4IB2 A;  1Z7M E;  4NF6 B;  5I58 A;  4R2B A;  2PX1 A;  1B46 A;  4EQ7 A;  4FAJ A;  4TLM B;  1ZBM A;  5I58 B;  1NNK A;  1Q35 A;  1MS7 A;  3DLN A;  3EHS A;  3HPI A;  1LAH E;  3FJ7 A;  4YMA A;  4KHZ E;  5M2V A;  1VR5 A;  2O1M A;  4BDL A;  2R71 A;  3RYA A;  3OXN A;  4U23 A;  2XHD A;  2ZXT A;  1MM6 A;  3U93 A;  4I9D A;  1P99 A;  2I58 A;  3CVG A;  2Y7I A;  4MFI A;  2Q2C A;  1MPD A;  2XXU A;  5I57 B;  4KYS A;  2UXA A;  2HCA A;  3P7I A;  1MH4 A;  4H6D A;  2AYS A;  3TEL A;  2OJT A;  2F7A A;  4IO5 A;  3OO7 A;  1UQW A;  2Z8F A;  1NH8 A;  1N84 A;  1ZU0 A;  2O6A A;  3O9P A;  4OEU A;  3DRF A;  4IO4 A;  3TFL A;  4EDP A;  3C34 A;  2F8D A;  3OSR A;  3JV9 A;  5AA1 A;  4NED A;  3TQW A;  1XHY A;  3N94 A;  4H8J A;  3I3V A;  3CR9 A;  1WOD A;  3IOR A;  4U22 A;  3T96 B;  4F39 A;  4OWD A;  4G2Z A;  4U1Z A;  4F1Y A;  5H8F A;  2ABH A;  3W15 C;  2DWI A;  1SBP A;  4PFT A;  3ZKK A;  4XTC Q;  4R72 A;  2XXW A;  1BP5 A;  4FED A;  5KCJ A;  3Q26 A;  4JB7 A;  4MLV A;  3L6H A;  3O6H A;  2ZNT A;  3DM0 A;  2PBW A;  2H98 A;  1XS5 A;  4F2O A;  2YJP A;  5KCJ B;  1SW1 A;  4F29 A;  1LLS A;  1ZTY A;  1H45 A;  1SQY A;  4DDD A;  1URS A;  3Q25 A;  2CZL A;  3OD7 A;  4ELR A;  4I62 A;  1RKM A;  2I48 A;  3ILT B;  1LB9 A;  2ALU A;  4OHN A;  2B3F A;  4PFU A;  4KCC A;  5CMK A;  3V89 B;  4FAT A;  3R26 A;  3H3G A;  4AQ4 A;  4F2Q A;  4BDQ A;  3ZS6 A;  2I4C A;  4LP2 B;  4OFL A;  3CG1 A;  4JSD A;  3K1M A;  1JEV A;  4XIG Q;  4U4X A;  2DP8 A;  2OK2 A;  3Q27 A;  1EZ9 A;  1B7Z A;  1QW0 A;  4MLQ A;  3O6G A;  3LVU A;  3HCQ A;  4FEC A;  3KN3 A;  3ZKL A;  1R1N A;  4QFL A;  4DCY A;  4G8M A;  5JTY A;  1LFH A;  4X1B A;  3FGS A;  3O6P A;  1US5 A;  3EQ1 A;  2QSX A;  1B7U A;  4IGT A;  1FQF A;  4OTE A;  4M1V A;  2E1S A;  3FZV A;  4FIM A;  2NUV A;  4ZEK A;  2DYX A;  3IK6 B;  3DRI A;  1HSJ A;  3TQL A;  4R74 A;  2F35 A;  3DRG A;  3CI8 A;  4TQU Q;  5L9O A;  3ODB A;  1QUI A;  2DSF A;  4U4S A;  1BKA A;  1Z7N E;  4EF1 A;  3KOS A;  3OOA A;  3B6T A;  2VGQ A;  2NVU B;  3SEW A;  5JK4 A;  2RC9 A;  3LSW A;  3V83 A;  2D5W A;  2P0S A;  1Y9U A;  3OO8 A;  3TTM A;  4XXU A;  1DPE A;  5ISU A;  1H3D A;  2NOO A;  2H4I A;  1JQF A;  4KFQ A;  2QRY A;  3MVZ A;  1B32 A;  4LQ5 A;  4YMB A;  1QVS A;  1O7T A;  2XXT A;  2X7P A;  3U1O A;  2ZMB A;  3C35 A;  2A5T A;  4THI A;  1XVY A;  1URG A;  3IB1 A;  1BIY A;  4ONY A;  1TFA A;  4N6P A;  2A5T B;  2WKY A;  3WAF A;  1SW4 A;  4L17 A;  1B52 A;  2PVU A;  3HO7 A;  3KFM A;  3G3F A;  4LUB A;  4R9F A;  1FW0 A;  4PFY A;  1IXC A;  3IB2 A;  3MBP A;  5I59 A;  3PMX A;  1GGG A;  3O29 A;  1NNP A;  1GTK A;  2ZYO A;  1OVB A;  3FIR A;  5DVI A;  5CM6 A;  2Y7K A;  3PD9 A;  3IOT A;  4M4G A;  4GWO A;  1B51 A;  2REG A;  4YIC A;  4RNS A;  3FAS A;  1PB8 A;  3FJM A;  3CFL A;  3IOV A;  2DXR A;  4GL0 A;  1EU8 A;  1A40 A;  1F9B A;  3PUW E;  4R73 A;  1M5B A;  3T9X B;  1B0L A;  1B1H A;  1P1U A;  3PPN A;  2G93 A;  3TTL A;  4H67 A;  2V3U A;  2V84 A;  1LBB A;  1MDP 1;  1MH3 A;  3R7X A;  2XXR A;  3TTN A;  4GL8 A;  5EHM A;  4XKP A;  1ANF A;  3TZA A;  2QS2 A;  4ZS9 A;  2V93 A;  4ND9 A;  2Q88 A;  2VP1 A;  3EN3 A;  3VDF A;  2QPQ A;  1EZO A;  4NWC A;  4G4P A;  3CSB A; 
#chains in the Genus database with same CATH topology
 1MQJ A;  4GX3 A;  2DE3 A;  2PT1 A;  3MAM A;  1PC3 A;  3LUY A;  1L5T A;  3EF7 A;  2XWO A;  4QSD A;  4LZ7 A;  2XXP A;  4F19 A;  5JEI A;  2HHM A;  3W9V A;  2P1S A;  1H44 A;  5HPQ A;  4EF2 A;  2V25 A;  1ELJ A;  4P8B A;  3RGY A;  1A7L A;  2I3V A;  4WEP A;  4YB5 A;  3MQ9 A;  4EXK A;  1HSL A;  4N17 A;  1JVX A;  3TOD A;  3DP8 A;  2V3T A;  1OQG A;  1A99 A;  1B05 A;  4OET A;  2CMO A;  1NV5 A;  4TLL B;  2B4M A;  3CHG A;  3M8U A;  1EYI A;  1N3W A;  3MUQ A;  2F5X A;  3T1B A;  1Y4T A;  3SER A;  4OFJ A;  3K6X A;  5FHM A;  4GF8 A;  2H25 A;  2YLN A;  2Z8D A;  3VXB A;  5DVJ A;  1DTG A;  4G77 A;  4H1X A;  1QUK A;  3KBR A;  2D3I A;  5CMM A;  3H06 B;  3K02 A;  3O2A A;  4POX A;  1LB8 A;  1DBZ A;  5AA3 A;  3CFX A;  4R6K A;  1MPC A;  3TYH A;  4RYA A;  1DMB A;  1VDW A;  3QXM A;  4RXL A;  4X8R A;  1R9L A;  5IZ3 A;  1LAF E;  3U72 A;  3SEU A;  1FBC A;  4RK2 A;  3QUF A;  4Q8R A;  5KDT B;  4R6Y A;  1FBH A;  1HSE A;  4JDF A;  1IMD A;  3G3I A;  5AE4 A;  3RT6 B;  3RT8 A;  3PU5 A;  5EQA A;  1SYI A;  2RCB A;  3E4R A;  1IMF A;  5L9S A;  1I6B A;  3E13 X;  4YKJ A;  2PCR A;  1Y1Z A;  4NF6 A;  1MY1 A;  1A8F A;  4OVS A;  1YAE A;  4PE3 A;  1CB6 A;  2RIN A;  1Q1K A;  4RA1 A;  3HV1 A;  3H6U A;  3ILU B;  1B5J A;  1USY E;  4PGP A;  3K00 A;  5I2N B;  3LSX A;  2P3V A;  1PB9 A;  3FVO A;  3VVE A;  4NQ8 A;  4JSO A;  4HS7 A;  3UP9 A;  1FPD A;  2F7C A;  2F7B A;  2XXH A;  1M5E A;  1B6H A;  3UN6 A;  3EPE A;  4HE2 A;  2XWK A;  3H6T A;  1FPL A;  1NI9 A;  4PAF A;  3MYU A;  3FVG A;  3ROJ A;  2LAO A;  3DEL B;  5I57 A;  1LFG A;  1S7Y A;  5I2K B;  5EYG A;  4PGN A;  2ZZV A;  4YB6 A;  4PQJ A;  4ZE8 A;  3B6W A;  3RY3 A;  4KR5 A;  1IQ7 A;  1PBQ A;  1Y20 A;  1MDQ A;  4AS5 A;  4JWX A;  4RY1 A;  2I6E A;  3KZG A;  1FQE A;  1FQD A;  1P1N A;  3IO4 A;  4XF5 A;  3BIG A;  1OMP A;  5DTB A;  1UTB A;  1B5I A;  4JXI A;  2FIE A;  4MEV A;  4DXU A;  1N04 A;  2XX9 A;  4OER A;  1XT8 A;  2ESN A;  1SI0 A;  3DRK A;  1VSO A;  1N0T A;  4F18 A;  4QFO A;  2E0S A;  1UTB B;  3UA8 A;  3FD3 A;  3K6U A;  3EKI A;  2NWJ A;  4PP0 A;  1LBC A;  3C31 A;  3O66 A;  4KYE A;  3VVD A;  2Z8E A;  1A8E A;  2HXR A;  4OQO A;  5A5L A;  4GXS B;  3PPQ A;  4GWX A;  4MHF A;  3E79 A;  1FQC A;  3RTW B;  4BDO A;  1II5 A;  4QHQ A;  2IA4 A;  5CBS A;  2ZZW A;  4FOR A;  2DE4 A;  2IEE A;  4KCD A;  2QMX A;  4ZED A;  3MVX A;  3U92 A;  3FJG A;  2QS4 A;  4YKP A;  5LOM A;  4PBQ A;  2VOZ A;  3LSL A;  4P47 A;  2L5V A;  5A5X A;  3D4G A;  3FAT A;  4GQO A;  4FE8 A;  2FVZ A;  1Y3Q A;  1MXV A;  2XWV A;  1FPB A;  3G3K A;  5A5X B;  1MG1 A;  1FQB A;  1MY2 A;  1YZ0 A;  3M3K A;  5ET8 A;  1MY3 A;  3HST A;  3S9N C;  3TEP A;  4P56 A;  1BLF A;  2F97 A;  5FHO A;  4O3C A;  4GBW A;  4NMY A;  2B3B A;  3ISP A;  4ZZA A;  3HHF A;  1NNF A;  3V5A A;  3LSF B;  2V3Q A;  3QYT A;  4F3G A;  1FBE A;  3OEL A;  4GRK A;  1DSN A;  3K1P A;  4XKR A;  3KC1 A;  1FPG A;  2HZL A;  3VE1 B;  4KXP A;  2OCU A;  3QAX A;  1LCF A;  3PPO A;  3RYD A;  2Z22 A;  3KN8 A;  4GLI A;  2OWT A;  4GX4 A;  2QJE A;  4RJZ A;  1M5C A;  3MP1 A;  1NUY A;  2DOJ A;  2X7Q A;  3TMG A;  4NE4 A;  3PAM A;  4NTL A;  3O28 A;  4AB5 A;  4XEQ A;  3E9X A;  4P11 A;  2WYK A;  4FEB A;  3B6Q A;  4P0I A;  3IOU A;  4QSC A;  1B3H A;  1P1Q A;  1MXZ A;  1YXI A;  4I3Y A;  2Y84 A;  3K01 A;  2Y7W A;  4JWO A;  4XKN A;  1PB7 A;  1RDZ A;  2ZNS A;  4OVR A;  4GOT A;  1MQD A;  2V4C A;  1GR2 A;  3A09 A;  1ZIU A;  3C4M A;  5ICT A;  3SEX A;  3IAZ A;  4KPT A;  4Q30 B;  4F1V A;  1I6A A;  2XXV A;  1FTM A;  4I40 A;  4YKK A;  2Y7P A;  3MW0 A;  1PDA A;  4I8C A;  3CG3 A;  3JZJ A;  2REJ A;  1S9T A;  5F1Q A;  2F3B A;  5ITO A;  3T22 A;  2HPG A;  4I3E A;  1FPE A;  1NL5 A;  1MRP A;  2CZI A;  3QK6 A;  1N7X A;  3T9H B;  2WBD A;  3MZ1 A;  4HTG A;  5H8H A;  5FTI A;  5HM4 B;  2Y7R A;  4ZE9 A;  4NN3 A;  3RQT A;  4QRZ A;  1LGB C;  3KGC A;  1QKA A;  4GVO A;  5H8H B;  2DDK A;  3HHG A;  4NG7 A;  3QIM A;  1NMU A;  3GBA A;  4YAH X;  5J1D A;  4MX6 A;  2HFB A;  1T0K A;  1Y4C A;  2PFZ A;  1EZP A;  4MH5 A;  2QMW A;  3KJT A;  5CMB A;  4QF9 A;  5ET5 A;  1Q9D A;  2UVG A;  3RNN A;  4OVT A;  5ELV A;  3SEY A;  1FBP A;  2GRV A;  3RN8 A;  4DCX A;  3O6I A;  5EQ9 A;  5DYH A;  4ESX A;  2UYF A;  2F6P A;  3EHU A;  4EUO A;  4OEV A;  4LVQ A;  1NV0 A;  1NKX A;  2O84 X;  5B70 A;  4O3A A;  5DW8 A;  3K4U A;  1D9V A;  4UAC A;  4ZEI A;  4PBH A;  1B3L A;  3BFU A;  4U1O A;  2PYY A;  5FTH A;  3RUM A;  1FQA A;  3JYR A;  1I69 A;  1XOC A;  3IB0 A;  4BDM A;  2WX9 A;  1KA1 A;  3S2V A;  1DK4 A;  3KJ7 A;  4N13 A;  3SEV A;  3BBR A;  4QFP A;  2GHB A;  1ZJL A;  1A55 A;  3FXB A;  3K6W A;  3L6G A;  4JBZ A;  4PAK A;  3VLU A;  3N6T A;  4PDH A;  3IL1 B;  3T9U A;  5CRY A;  4DLD A;  1KZ8 A;  4R75 A;  4E0W A;  4N91 A;  2FA7 A;  2ONK E;  2ONR A;  3UIF A;  4NX1 A;  3RPW A;  4DI4 B;  3B7D A;  1SPI A;  3AXF A;  3KSX A;  2XD2 A;  3QSL A;  3UGW A;  4N07 A;  4X48 A;  5HBC A;  4O7M A;  3FVK A;  1LST A;  3N6U A;  3IX1 A;  1B3F A;  5DEX A;  5FBP A;  4HE1 A;  4F1U A;  2F34 A;  4KI0 E;  2FNC A;  4O7I A;  1TXF A;  1OVT A;  4NWD A;  5DEX B;  5BWJ A;  3E78 A;  2AIX A;  4H46 A;  4BLA A;  3KSJ A;  3HFU A;  4UAB A;  1H43 A;  4HCW A;  1B0H A;  4E0X A;  5K2X A;  1P1O A;  5FHN A;  3H03 A;  4NF5 A;  5IM2 A;  5EHS A;  4PFR A;  1OIB A;  1NV6 A;  4BDR A;  4GWS A;  3PUZ E;  3H6W A;  3FV2 A;  4PFW A;  3PD8 A;  4BDN A;  4NF5 B;  3G3G A;  1FCK A;  2QS1 A;  4HW8 A;  4NF4 B;  3RYB A;  4Z0I A;  4LZ5 A;  3UOR A;  3DRH A;  3SET A;  2VPN A;  2DWH A;  3SES A;  3UK4 A;  1IUD A;  1LBX A;  4O3B A;  1MQI A;  1WDN A;  3M3F A;  1TFD A;  3OO6 A;  3GXA A;  3A3U A;  4U2R A;  1GVC A;  4DE8 A;  3SZP A;  5AA4 A;  3V8X B;  1O64 A;  3USD A;  2R6G E;  3LBS A;  2WOK A;  1VFE A;  4OZ9 A;  4ESW A;  3MP6 A;  3Q29 A;  5AA4 B;  2ZZX A;  2QVU A;  4QFN A;  3MST A;  3IR1 A;  5J16 A;  2A5S A;  5KDT A;  2WYP A;  4ISU A;  1N76 A;  2WBB A;  3BFT A;  5H8S A;  4Q5T A;  2Q8M A;  4GFR A;  1DPP A;  1AWB A;  4X1D A;  3KN7 A;  1BTJ A;  5DT6 A;  3THI A;  2JJK A;  4DIG A;  4LAT A;  1TT1 A;  4DI3 D;  4G8N A;  4OMB A;  1FPJ A;  1B58 A;  3FUZ A;  1P1W A;  1R6Z A;  3TCG A;  2OZZ A;  4IO2 A;  3MP8 A;  2I4B A;  2QL3 A;  1SW2 A;  3PUV E;  3WAE A;  1IMB A;  4PET A;  4KD5 A;  3MPL A;  3MPK A;  5I2N A;  3CRB A;  4OEN A;  3MVW A;  1QUJ A;  3GLB A;  3LV0 A;  1FTO A;  1B4H A;  4MNC A;  2OWS A;  1AIV A;  1XC1 A;  3C32 A;  3KG2 A;  2ZNU A;  1NV4 A;  3C9H A;  4ZEB A;  3C33 A;  1NUW A;  3FXR A;  3OEM A;  2VHA A;  3MC2 A;  4MAG A;  1MPB A;  2VPO A;  5I2K A;  1JVY A;  3K1N A;  4Z7E A;  4HCY A;  5EQ8 A;  2XX7 A;  1B7H A;  2H99 A;  4N15 A;  3DP4 A;  2PT2 A;  4IR8 A;  4ELO A;  2B65 A;  3OMB A;  3RLF E;  1FPK A;  4I1D A;  5EYH A;  5IAI A;  2I0B A;  1LFI A;  1UIU A;  4LN5 A;  1IME A;  4Q0C A;  5I5P A;  5KZT A;  2OBG A;  1FPI A;  4XFE A;  3TCF A;  4R6H A;  5TP9 A;  1B3G A;  2F6G A;  3VFJ A;  3G3H A;  4ZZE A;  1POY 1;  1IIW A;  2DXY A;  3MZB A;  3K0V A;  1CE2 A;  2I3W A;  5TP9 B;  3U94 A;  3KEI A;  4GD5 A;  2HAV A;  2F78 A;  1Y3P A;  4PCD A;  5DVF A;  3VLV A;  1SD3 A;  5F24 A;  2QFL A;  2O68 A;  2RCA A;  1D3K A;  5ITP A;  1GV8 A;  1IZ1 A;  2KQZ A;  1QKB A;  2VD2 A;  4YZZ A;  4H5G A;  1G0I A;  2ONS A;  3S9E A;  3U65 A;  3S4U A;  4C1U A;  3DRJ A;  3PMV A;  1J1N A;  1OLA A;  4EQB A;  2DVC A;  1Y1M A;  5ICQ A;  1BK4 A;  3FXU A;  3FXQ A;  2DS9 A;  1IIT A;  2NXO A;  3IJX B;  1B5H A;  1QJM A;  1OQH A;  5L8D A;  3EHT A;  5I84 A;  5H8F B;  3IFA A;  2XXY A;  5L9M A;  2F36 A;  4WKM A;  3ECR A;  1EH3 A;  4U21 A;  5K2Y A;  3K2D A;  3GBB A;  4PE5 B;  1NUX A;  2KLF A;  3KOT A;  4N6D A;  4QFK A;  4N81 A;  3TPA A;  3MWB A;  3LC8 A;  4GX6 A;  4JVC A;  1SVX B;  3PV0 E;  4IY6 A;  4RPO A;  1O63 A;  2QVV A;  4JVD A;  5CBR A;  1AOV A;  4F3B A;  1IXG A;  2KR0 A;  1NV3 A;  4MF3 A;  3PUY E;  4AB6 A;  3QUJ A;  3G7W A;  4IY5 A;  2RC7 A;  4P3L A;  3IO6 A;  1JNF A;  4YU0 A;  1LBW A;  3VVF A;  1JET A;  3T0J A;  4GWU A;  1G0H A;  3TTR A;  2AL5 A;  4LZ8 A;  1AMF A;  4IO3 A;  1D9Y A;  2R9J A;  3GZG A;  4LON B;  2GH9 A;  3TDJ A;  2XX8 A;  1ATG A;  2HEU A;  2H9B A;  3VV5 A;  2WOP A;  1DTZ A;  4PFB A;  1LBY A;  1KA0 A;  4RPN A;  5I7I A;  1NNT A;  4F3P A;  5AA2 A;  3M3L A;  1ZMG A;  3FV1 A;  1URD A;  4IGR A;  1AL3 A;  2H5Y A;  2UVI A;  3IJO B;  4MNP A;  5AA2 B;  1MXY A;  1US4 A;  2QVR A;  2XA5 A;  2DVZ A;  5JTY B;  3W9W A;  5BUU A;  3MJN A;  4PDD A;  3TTK A;  3DP6 A;  2Q2A A;  3VXC A;  1NUZ A;  1POT A;  4DXC A;  4EXL A;  4H0W A;  3PGF A;  3S9M C;  3F11 A;  4ELP A;  1FTJ A;  2ANJ A;  1MY4 A;  1YCJ A;  2M8C A;  1FTA A;  1LBV A;  4AS4 A;  2XD3 A;  5ET6 A;  1LAX A;  2O7I A;  3TUS A;  1YYZ A;  5F7V A;  1USY H;  1UTH A;  2G29 A;  1ZKB A;  5IKB A;  4KYD A;  3N26 A;  4PTK A;  1XI6 A;  1MXX A;  3FBP A;  4R2F A;  2RF1 A;  4N8Y A;  1B3E A;  3LR1 A;  1UTH B;  3E3K A;  2O7U A;  2CZK A;  4JWY A;  3H4Z A;  4DXB A;  3T93 B;  1ZLQ A;  1K9Y A;  1IMC A;  3MVY A;  4P9K A;  4QXD A;  1B9J A;  2WOL A;  2I49 A;  4OVJ A;  4MJO A;  4EQ9 A;  1SW5 A;  4G8H A;  4OXV A;  3A3C A;  3D4C A;  4H8I A;  1DOT A;  1N3X A;  2F3D A;  1LAG E;  3HN0 A;  1MXU A;  3BIH A;  3IFC A;  2Z23 A;  2Q8J A;  3SKP A;  4FJP A;  5EYF A;  1MQG A;  3OSQ A;  1PBP A;  4N4U A;  2VD3 A;  2UVJ A;  1JEU A;  4GIZ A;  3U8Q A;  4X04 A;  1JW5 A;  3PTY A;  1B4Z A;  5IZZ A;  4ZEC A;  3ONM A;  3O97 A;  4XKQ A;  4ELQ A;  3SDF A;  4PFI A;  1S50 A;  1FSA A;  4NF0 A;  4RK9 A;  1FBG A;  1IEJ A;  1I6Q A;  4LA9 A;  4ZDM A;  2DE2 A;  4F3S A;  4LQ2 A;  1MY0 A;  1TWY A;  1M5F A;  3K6V A;  3TCH A;  2OX3 A;  2HAU A;  1YPN A;  5I59 B;  3RTF B;  1KWH A;  2HXW A;  3R6U A;  2Q89 A;  2UVH A;  1Y3N A;  4YKI A;  3T9V A;  1FJ6 A;  2AL4 A;  1RYO A;  1NV1 A;  4YB7 A;  1FBD A;  3OEK A;  1XVX A;  3Q28 A;  5IZ1 A;  2ZYM A;  1H76 A;  3TKD A;  4IO6 A;  1VFD A;  3LUZ A;  4H65 A;  1SDX A;  1QUL A;  1JW4 A;  3PUX E;  2HQ0 A;  3T66 A;  1D9Q A;  3CIJ A;  1K9Z A;  4ZEF A;  2WEF A;  4K3F A;  3FVN A;  2ZYN A;  3KBZ A;  4NF8 A;  4IO7 A;  1NFT A;  3BKI B;  4GXA A;  4JVI A;  4WXJ A;  5ET7 A;  5TPA A;  2XXI A;  2UYE A;  3N5L A;  1MQH A;  1N7W A;  4PF8 A;  5H8Q A;  5TU0 A;  1IXI A;  4N8G A;  4NF4 A;  4NF8 B;  3PMW A;  5LTC A;  4OYV A;  5TPA B;  1FTL A;  5H8Q B;  2DWJ A;  4F22 A;  5B7D A;  2OLB A;  1FTK A;  3RPL B;  3OO9 A;  2CEY A;  1MXW A;  1PEB A;  2FYI A;  2P3N A;  1UIV A;  1B2H A;  5I3S A;  1LCT A;  1SI1 A;  1EYJ A;  2O1L A;  1JW1 A;  3C36 A;  4UA8 A;  1LBZ A;  5CI5 A;  2DWA A;  1IXH A;  1RYX A;  2BJJ X;  5I56 A;  2B4L A;  3TAJ A;  2O69 A;  4R9G A;  1B40 A;  3ZSF A;  3S9L C;  4N6K A;  5H8N A;  3OEN A;  2Q9T A;  5I56 B;  1B1X A;  3FTO A;  5H8N B;  3PPP A;  1SYH A;  2QS3 A;  4WED A;  4P1L A;  2MKZ A;  1AH5 A;  1WVJ A;  1R9Q A;  4P0G A;  1OLC A;  1QGX A;  4X9T A;  2XXX A;  2W7Y A;  3G3J A;  4QSE A;  1DCU A;  3IOW A;  1YTV A;  2RKM A;  2GHA A;  2PMS A;  1CNQ A;  2X26 A;  5AA2 D;  2DQV A;  4OFO A;  2R8T A;  1NH7 A;  1VE4 A;  3H6V A;  4C1T A;  2ZYK A;  4KQP A;  3VLW A;  5IZ3 B;  3MZ9 A;  3I6V A;  1A54 A;  1NV7 A;  2YPN A;  1MM7 A;  1M5D A;  2Y5K A;  2BJI A;  2HZK A;  4POW A;  4F31 B;  2CZH A;  4TOZ A;  2THI A;  3NOH A;  4G68 A;  3PPR A;  5CC2 A;  4DZ1 A;  4OVP A;  3GYY A;  3I5O A;  2O51 A;  2P2A A;  4ECF A;  2XXQ A;  4OES A;  1D4N A;  4HE0 A;  4G68 C;  3H7M A;  4MIJ A;  5CMC A;  4MBP A;  4G68 B;  2RC8 A;  4C0R A;  2I0C A;  3CFZ A;  1RDX A;  4H5F A;  2GFE A;  2D21 A;  3CSG A;  4IB2 A;  4PC9 A;  1Z7M E;  4NF6 B;  5I58 A;  4R2B A;  2PX1 A;  1B46 A;  4EQ7 A;  4FAJ A;  4TLM B;  1ZBM A;  5I58 B;  3B8B A;  1NNK A;  4G61 A;  1Q35 A;  1MS7 A;  3DLN A;  3EHS A;  3HPI A;  1LAH E;  3FJ7 A;  4YMA A;  4KHZ E;  5M2V A;  1VR5 A;  2O1M A;  4BDL A;  2R71 A;  3RYA A;  3OXN A;  4U23 A;  2XHD A;  2ZXT A;  1MM6 A;  3U93 A;  4I9D A;  1P99 A;  2I58 A;  3CVG A;  4MMP A;  2Y7I A;  4MFI A;  2Q2C A;  2Q74 A;  2XWI A;  1MPD A;  2XXU A;  5I57 B;  4KYS A;  2UXA A;  2HCA A;  3P7I A;  1MH4 A;  4H6D A;  2AYS A;  3TEL A;  2OJT A;  2F7A A;  4IO5 A;  3OO7 A;  1UQW A;  2Z8F A;  1NH8 A;  1N84 A;  1ZU0 A;  4FBP A;  2O6A A;  3O9P A;  4OEU A;  3DRF A;  4IO4 A;  3TFL A;  3QMF A;  4EDP A;  3C34 A;  2FHY A;  2F8D A;  3OSR A;  3JV9 A;  5AA1 A;  4NED A;  4P1E A;  3TQW A;  1XHY A;  3N94 A;  2VT5 A;  4H8J A;  1JP4 A;  3I3V A;  3CR9 A;  1WOD A;  3IOR A;  1NV2 A;  4U22 A;  3T96 B;  4GWY A;  4PF6 A;  4F39 A;  4OWD A;  4G2Z A;  4U1Z A;  4F1Y A;  4MCO A;  2FBP A;  5H8F A;  2ABH A;  4H45 A;  3W15 C;  2DWI A;  1SBP A;  4PFT A;  3ZKK A;  4XTC Q;  2PFY A;  4R72 A;  2XXW A;  1BP5 A;  4FED A;  5KCJ A;  3Q26 A;  4JB7 A;  4MLV A;  3L6H A;  3O6H A;  2XXK A;  2ZNT A;  3DM0 A;  2PBW A;  2H98 A;  1XS5 A;  4F2O A;  2YJP A;  5KCJ B;  1SW1 A;  4F29 A;  1LLS A;  1ZTY A;  1H45 A;  1SQY A;  4DDD A;  1URS A;  3Q25 A;  2CZL A;  3OD7 A;  4ELR A;  4I62 A;  1RKM A;  2I48 A;  3ILT B;  4NAP A;  1LB9 A;  2ALU A;  1EYK A;  1INP A;  4OHN A;  2B3F A;  4PFU A;  4KCC A;  5CMK A;  4GWZ A;  3V89 B;  4FAT A;  3R26 A;  3H3G A;  3B50 A;  4AQ4 A;  4F2Q A;  4BDQ A;  3ZS6 A;  2I4C A;  4LP2 B;  4OFL A;  3CG1 A;  4JSD A;  3K1M A;  1JEV A;  4XIG Q;  4U4X A;  2DP8 A;  2OK2 A;  3Q27 A;  1EZ9 A;  1B7Z A;  1QW0 A;  5IGA A;  4MLQ A;  3O6G A;  3LVU A;  3HCQ A;  4FEC A;  3KN3 A;  3ZKL A;  1R1N A;  2OWZ A;  4QFL A;  4DCY A;  4G8M A;  3D1R A;  5JTY A;  4O8M A;  1LFH A;  4X1B A;  4PAI A;  3FGS A;  3O6P A;  1LEV A;  1US5 A;  3EQ1 A;  2QSX A;  4GWW A;  1B7U A;  4OA4 A;  1FJ9 A;  4IGT A;  1FQF A;  4OTE A;  4M1V A;  2E1S A;  3FZV A;  4FIM A;  2NUV A;  4ZEK A;  4MNI A;  2DYX A;  3IK6 B;  3DRI A;  1HSJ A;  3TQL A;  4R74 A;  2F35 A;  3DRG A;  3CI8 A;  4TQU Q;  5L9O A;  3ODB A;  1QUI A;  2DSF A;  4U4S A;  4GBV A;  1BKA A;  1Z7N E;  4EF1 A;  3KOS A;  3OOA A;  3B6T A;  2VGQ A;  2NVU B;  3SEW A;  5JK4 A;  2RC9 A;  3LSW A;  3V83 A;  2D5W A;  2P0S A;  1Y9U A;  3OO8 A;  2FIX A;  3TTM A;  4XXU A;  1DPE A;  5ISU A;  1H3D A;  2NOO A;  2H4I A;  1JQF A;  4KFQ A;  2QRY A;  3MVZ A;  1B32 A;  4LQ5 A;  4YMB A;  1QVS A;  1O7T A;  1FBF A;  2XXT A;  2X7P A;  3U1O A;  2ZMB A;  3C35 A;  2A5T A;  4THI A;  1XVY A;  1URG A;  3IB1 A;  4NGU A;  1BIY A;  4ONY A;  1TFA A;  2CEX A;  2GQ1 A;  2Y5L A;  4N6P A;  5LDZ A;  2A5T B;  2WKY A;  3WAF A;  1SW4 A;  4L17 A;  1B52 A;  2PVU A;  3HO7 A;  3KFM A;  3G3F A;  4LUB A;  4R9F A;  1FW0 A;  4PFY A;  1IXC A;  3IB2 A;  3MBP A;  5I59 A;  3PMX A;  1GGG A;  3O29 A;  4NHB A;  1NNP A;  1GTK A;  2ZYO A;  1OVB A;  3FIR A;  4HXV A;  5DVI A;  3KC0 A;  5CM6 A;  1FRP A;  2Y7K A;  3PD9 A;  5EQ7 A;  3IOT A;  4M4G A;  4GWO A;  1RDY A;  1B51 A;  5ESY A;  3A29 A;  2REG A;  4YIC A;  4RNS A;  3FAS A;  1PB8 A;  3FJM A;  3CFL A;  3IOV A;  2DXR A;  4GL0 A;  1EU8 A;  1A40 A;  1F9B A;  3PUW E;  4R73 A;  1M5B A;  3T9X B;  5T3J A;  1B0L A;  1B1H A;  1P1U A;  3PPN A;  2G93 A;  1FPF A;  3TTL A;  4H67 A;  2V3U A;  2V84 A;  1LBB A;  1MDP 1;  1MH3 A;  3R7X A;  2XXR A;  3TTN A;  4GL8 A;  4QBA A;  5EHM A;  4XKP A;  1ANF A;  3TZA A;  2QS2 A;  4OVQ A;  2V93 A;  4ND9 A;  4ZS9 A;  4O94 A;  2Q88 A;  2VP1 A;  3EN3 A;  4OAN A;  3RPL A;  3VDF A;  2QPQ A;  1EZO A;  1IMA A;  4NWC A;  4G4P A;  3CSB A; 
#chains in the Genus database with same CATH homology
 1MQJ A;  2DE3 A;  2PT1 A;  3MAM A;  1PC3 A;  3LUY A;  1L5T A;  3EF7 A;  4QSD A;  4LZ7 A;  2XXP A;  4F19 A;  5JEI A;  3W9V A;  2P1S A;  1H44 A;  5HPQ A;  4EF2 A;  2V25 A;  1ELJ A;  3RGY A;  1A7L A;  2I3V A;  4WEP A;  4YB5 A;  3MQ9 A;  4EXK A;  1HSL A;  3TOD A;  1JVX A;  3DP8 A;  2V3T A;  1OQG A;  1A99 A;  1B05 A;  4OET A;  2CMO A;  4TLL B;  2B4M A;  3CHG A;  3M8U A;  3MUQ A;  1N3W A;  2F5X A;  1Y4T A;  3SER A;  4OFJ A;  3K6X A;  5FHM A;  4GF8 A;  2H25 A;  2YLN A;  2Z8D A;  3VXB A;  5DVJ A;  1DTG A;  4G77 A;  4H1X A;  1QUK A;  3KBR A;  2D3I A;  5CMM A;  3H06 B;  3K02 A;  3O2A A;  4POX A;  1LB8 A;  5AA3 A;  3CFX A;  4R6K A;  1MPC A;  3TYH A;  4RYA A;  1DMB A;  3QXM A;  4RXL A;  1R9L A;  3U72 A;  1LAF E;  3SEU A;  4RK2 A;  3QUF A;  4Q8R A;  5KDT B;  4R6Y A;  1HSE A;  4JDF A;  3G3I A;  5AE4 A;  3RT6 B;  3RT8 A;  3PU5 A;  1SYI A;  2RCB A;  3E4R A;  5L9S A;  4YKJ A;  1I6B A;  3E13 X;  1Y1Z A;  4NF6 A;  1MY1 A;  1A8F A;  1YAE A;  1CB6 A;  2RIN A;  1Q1K A;  4RA1 A;  3HV1 A;  3H6U A;  3ILU B;  1B5J A;  1USY E;  3K00 A;  5I2N B;  3LSX A;  1PB9 A;  3FVO A;  3VVE A;  4JSO A;  4HS7 A;  3UP9 A;  2F7C A;  2F7B A;  2XXH A;  1M5E A;  1B6H A;  3UN6 A;  3EPE A;  3H6T A;  3FVG A;  2LAO A;  3DEL B;  5I57 A;  1LFG A;  1S7Y A;  5I2K B;  4YB6 A;  4PQJ A;  4ZE8 A;  3B6W A;  3RY3 A;  4KR5 A;  1IQ7 A;  1PBQ A;  1Y20 A;  1MDQ A;  4JWX A;  4RY1 A;  2I6E A;  3KZG A;  1FQE A;  1FQD A;  1P1N A;  3IO4 A;  1OMP A;  5DTB A;  1UTB A;  1B5I A;  4JXI A;  4DXU A;  1N04 A;  2XX9 A;  4OER A;  1XT8 A;  2ESN A;  1SI0 A;  3DRK A;  1VSO A;  1N0T A;  4F18 A;  4QFO A;  2E0S A;  1UTB B;  3UA8 A;  3FD3 A;  3K6U A;  2NWJ A;  4PP0 A;  1LBC A;  3C31 A;  3O66 A;  4KYE A;  3VVD A;  2Z8E A;  1A8E A;  4OQO A;  4GXS B;  3PPQ A;  1FQC A;  3RTW B;  4BDO A;  1II5 A;  4QHQ A;  2IA4 A;  5CBS A;  4FOR A;  2DE4 A;  2IEE A;  4KCD A;  2QMX A;  4ZED A;  3MVX A;  3U92 A;  3FJG A;  2QS4 A;  4YKP A;  5LOM A;  2VOZ A;  3LSL A;  5A5X A;  3D4G A;  3FAT A;  4GQO A;  4FE8 A;  1Y3Q A;  1MXV A;  3G3K A;  5A5X B;  1FQB A;  1MG1 A;  1MY2 A;  3M3K A;  1MY3 A;  3HST A;  3S9N C;  3TEP A;  1BLF A;  2F97 A;  5FHO A;  4O3C A;  4NMY A;  2B3B A;  4ZZA A;  3V5A A;  3HHF A;  1NNF A;  3LSF B;  2V3Q A;  3QYT A;  4F3G A;  3OEL A;  4GRK A;  1DSN A;  3K1P A;  4XKR A;  2HZL A;  3VE1 B;  2OCU A;  3QAX A;  1LCF A;  3PPO A;  2Z22 A;  3KN8 A;  4GLI A;  2OWT A;  2QJE A;  4RJZ A;  1M5C A;  3MP1 A;  2X7Q A;  2DOJ A;  3TMG A;  4NE4 A;  3PAM A;  4NTL A;  3O28 A;  4AB5 A;  3E9X A;  4P11 A;  4FEB A;  3B6Q A;  4P0I A;  3IOU A;  4QSC A;  1B3H A;  1P1Q A;  1MXZ A;  2Y84 A;  3K01 A;  2Y7W A;  4JWO A;  4XKN A;  1PB7 A;  2ZNS A;  4GOT A;  1MQD A;  1GR2 A;  3A09 A;  1ZIU A;  3C4M A;  5ICT A;  3SEX A;  3IAZ A;  4KPT A;  4Q30 B;  4F1V A;  1I6A A;  2XXV A;  1FTM A;  4YKK A;  2Y7P A;  3MW0 A;  1PDA A;  4I8C A;  3CG3 A;  3JZJ A;  2REJ A;  1S9T A;  5F1Q A;  5ITO A;  3T22 A;  1NL5 A;  1MRP A;  3QK6 A;  3T9H B;  1N7X A;  3MZ1 A;  4HTG A;  5H8H A;  5FTI A;  5HM4 B;  2Y7R A;  4ZE9 A;  3RQT A;  4QRZ A;  1LGB C;  3KGC A;  1QKA A;  4GVO A;  5H8H B;  3HHG A;  3QIM A;  1NMU A;  3GBA A;  4YAH X;  5J1D A;  2HFB A;  1T0K A;  1Y4C A;  1EZP A;  4MH5 A;  2QMW A;  5CMB A;  3KJT A;  4QF9 A;  2UVG A;  3RNN A;  5ELV A;  3SEY A;  2GRV A;  3RN8 A;  4DCX A;  3O6I A;  5DYH A;  4ESX A;  2UYF A;  2F6P A;  3EHU A;  4EUO A;  4OEV A;  4LVQ A;  1NKX A;  2O84 X;  5B70 A;  4O3A A;  3K4U A;  1D9V A;  4UAC A;  4ZEI A;  1B3L A;  3BFU A;  4U1O A;  2PYY A;  5FTH A;  3RUM A;  1FQA A;  3JYR A;  1I69 A;  1XOC A;  3IB0 A;  4BDM A;  3S2V A;  3KJ7 A;  4N13 A;  3SEV A;  3BBR A;  4QFP A;  2GHB A;  1ZJL A;  1A55 A;  3K6W A;  4JBZ A;  3L6G A;  3VLU A;  3N6T A;  3IL1 B;  3T9U A;  5CRY A;  4DLD A;  4R75 A;  4E0W A;  2FA7 A;  2ONK E;  2ONR A;  3UIF A;  3RPW A;  3B7D A;  3AXF A;  3KSX A;  2XD2 A;  3QSL A;  3UGW A;  4N07 A;  4X48 A;  5HBC A;  3FVK A;  1LST A;  3N6U A;  3IX1 A;  1B3F A;  5DEX A;  4F1U A;  2F34 A;  4KI0 E;  2FNC A;  1TXF A;  1OVT A;  4NWD A;  5DEX B;  5BWJ A;  2AIX A;  4BLA A;  3KSJ A;  1H43 A;  4HCW A;  1B0H A;  4E0X A;  5K2X A;  1P1O A;  5FHN A;  3H03 A;  4NF5 A;  5EHS A;  1OIB A;  4BDR A;  3PUZ E;  3H6W A;  3FV2 A;  4PFW A;  3PD8 A;  4BDN A;  4NF5 B;  3G3G A;  1FCK A;  2QS1 A;  4HW8 A;  4NF4 B;  3RYB A;  4Z0I A;  4LZ5 A;  3UOR A;  3DRH A;  3SET A;  3SES A;  2DWH A;  3UK4 A;  1IUD A;  4O3B A;  1MQI A;  1WDN A;  3M3F A;  1TFD A;  3OO6 A;  3GXA A;  3A3U A;  4U2R A;  1GVC A;  4DE8 A;  5AA4 A;  3V8X B;  1O64 A;  3USD A;  2R6G E;  3LBS A;  2WOK A;  1VFE A;  4OZ9 A;  4ESW A;  3MP6 A;  3Q29 A;  5AA4 B;  4QFN A;  3IR1 A;  2A5S A;  5KDT A;  4ISU A;  1N76 A;  3BFT A;  5H8S A;  4Q5T A;  4GFR A;  1DPP A;  4X1D A;  3KN7 A;  1BTJ A;  5DT6 A;  3THI A;  4DIG A;  4LAT A;  1TT1 A;  4G8N A;  4OMB A;  1B58 A;  3FUZ A;  1P1W A;  1R6Z A;  3TCG A;  2OZZ A;  4IO2 A;  3MP8 A;  2I4B A;  2QL3 A;  1SW2 A;  3PUV E;  3WAE A;  4PET A;  4KD5 A;  3MPL A;  3MPK A;  5I2N A;  3CRB A;  4OEN A;  3MVW A;  1QUJ A;  3GLB A;  1FTO A;  1B4H A;  2OWS A;  1AIV A;  1XC1 A;  3C32 A;  3KG2 A;  2ZNU A;  3C9H A;  4ZEB A;  3C33 A;  3FXR A;  3OEM A;  2VHA A;  3MC2 A;  1MPB A;  5I2K A;  1JVY A;  3K1N A;  4Z7E A;  4HCY A;  2XX7 A;  1B7H A;  2H99 A;  3DP4 A;  2PT2 A;  4ELO A;  2B65 A;  3OMB A;  3RLF E;  4I1D A;  5IAI A;  2I0B A;  1LFI A;  1UIU A;  4Q0C A;  5KZT A;  2OBG A;  3TCF A;  4R6H A;  5TP9 A;  1B3G A;  2F6G A;  3VFJ A;  3G3H A;  4ZZE A;  1POY 1;  1IIW A;  2DXY A;  3MZB A;  3K0V A;  1CE2 A;  2I3W A;  5TP9 B;  3U94 A;  3KEI A;  4GD5 A;  2HAV A;  2F78 A;  1Y3P A;  5DVF A;  3VLV A;  1SD3 A;  2RCA A;  2O68 A;  1D3K A;  5ITP A;  1GV8 A;  1IZ1 A;  1QKB A;  2VD2 A;  4YZZ A;  4H5G A;  2ONS A;  3S9E A;  3S4U A;  4C1U A;  3DRJ A;  3PMV A;  1J1N A;  1OLA A;  4EQB A;  2DVC A;  1Y1M A;  5ICQ A;  3FXU A;  3FXQ A;  2DS9 A;  1IIT A;  2NXO A;  3IJX B;  1B5H A;  1QJM A;  1OQH A;  5L8D A;  3EHT A;  5I84 A;  5H8F B;  2XXY A;  5L9M A;  2F36 A;  4WKM A;  3ECR A;  1EH3 A;  4U21 A;  5K2Y A;  3K2D A;  3GBB A;  4PE5 B;  2KLF A;  3KOT A;  4QFK A;  3TPA A;  3MWB A;  3LC8 A;  1SVX B;  3PV0 E;  4IY6 A;  4RPO A;  1O63 A;  5CBR A;  1AOV A;  4F3B A;  1IXG A;  4MF3 A;  3PUY E;  4AB6 A;  3QUJ A;  3G7W A;  4IY5 A;  2RC7 A;  3IO6 A;  1JNF A;  4YU0 A;  3VVF A;  1JET A;  3TTR A;  2AL5 A;  4LZ8 A;  1AMF A;  4IO3 A;  1D9Y A;  2R9J A;  3GZG A;  4LON B;  2GH9 A;  3TDJ A;  2XX8 A;  1ATG A;  2HEU A;  2H9B A;  3VV5 A;  2WOP A;  1DTZ A;  4RPN A;  1NNT A;  4F3P A;  5AA2 A;  3M3L A;  1ZMG A;  3FV1 A;  1URD A;  4IGR A;  1AL3 A;  2H5Y A;  2UVI A;  3IJO B;  5AA2 B;  1MXY A;  1US4 A;  2DVZ A;  5JTY B;  3W9W A;  5BUU A;  3MJN A;  3TTK A;  3DP6 A;  2Q2A A;  3VXC A;  1POT A;  4DXC A;  4EXL A;  4H0W A;  3PGF A;  3S9M C;  3F11 A;  4ELP A;  1FTJ A;  2ANJ A;  1MY4 A;  1YCJ A;  2M8C A;  2XD3 A;  1LAX A;  2O7I A;  3TUS A;  5F7V A;  1USY H;  1UTH A;  2G29 A;  1ZKB A;  5IKB A;  4KYD A;  3N26 A;  1MXX A;  4R2F A;  2RF1 A;  1B3E A;  3LR1 A;  1UTH B;  3E3K A;  2O7U A;  4JWY A;  3H4Z A;  4DXB A;  3T93 B;  1ZLQ A;  3MVY A;  1B9J A;  2WOL A;  2I49 A;  4OVJ A;  4EQ9 A;  1SW5 A;  4G8H A;  4OXV A;  3A3C A;  3D4C A;  4H8I A;  1DOT A;  1N3X A;  1LAG E;  3HN0 A;  1MXU A;  2Z23 A;  2Q8J A;  3SKP A;  4FJP A;  5EYF A;  1MQG A;  3OSQ A;  1PBP A;  2VD3 A;  2UVJ A;  1JEU A;  4GIZ A;  3U8Q A;  1JW5 A;  1B4Z A;  4ZEC A;  3ONM A;  3O97 A;  4XKQ A;  4ELQ A;  3SDF A;  1S50 A;  4RK9 A;  1IEJ A;  1I6Q A;  4LA9 A;  4ZDM A;  2DE2 A;  4F3S A;  4LQ2 A;  1MY0 A;  1TWY A;  1M5F A;  3K6V A;  3TCH A;  2HAU A;  1YPN A;  5I59 B;  3RTF B;  1KWH A;  2HXW A;  3R6U A;  2Q89 A;  2UVH A;  1Y3N A;  4YKI A;  3T9V A;  2AL4 A;  1RYO A;  4YB7 A;  3OEK A;  1XVX A;  3Q28 A;  2ZYM A;  1H76 A;  3TKD A;  4IO6 A;  1VFD A;  4H65 A;  1SDX A;  1QUL A;  1JW4 A;  3PUX E;  2HQ0 A;  3T66 A;  3CIJ A;  4ZEF A;  4K3F A;  3FVN A;  2ZYN A;  4NF8 A;  4IO7 A;  1NFT A;  3BKI B;  4GXA A;  4WXJ A;  5TPA A;  2XXI A;  2UYE A;  3N5L A;  1MQH A;  1N7W A;  5H8Q A;  5TU0 A;  1IXI A;  4NF4 A;  4NF8 B;  3PMW A;  4OYV A;  5TPA B;  1FTL A;  5H8Q B;  2DWJ A;  4F22 A;  5B7D A;  2OLB A;  1FTK A;  3OO9 A;  1MXW A;  1PEB A;  2FYI A;  1UIV A;  1B2H A;  1LCT A;  1SI1 A;  2O1L A;  1JW1 A;  3C36 A;  4UA8 A;  5CI5 A;  2DWA A;  1IXH A;  1RYX A;  2BJJ X;  5I56 A;  2B4L A;  3TAJ A;  2O69 A;  4R9G A;  1B40 A;  3ZSF A;  3S9L C;  5H8N A;  3OEN A;  2Q9T A;  5I56 B;  1B1X A;  3FTO A;  5H8N B;  3PPP A;  1SYH A;  2QS3 A;  4WED A;  1AH5 A;  1WVJ A;  1R9Q A;  4P0G A;  1OLC A;  4X9T A;  2XXX A;  2W7Y A;  3G3J A;  4QSE A;  3IOW A;  1YTV A;  2RKM A;  2GHA A;  2PMS A;  2X26 A;  5AA2 D;  2DQV A;  4OFO A;  1NH7 A;  1VE4 A;  3H6V A;  4C1T A;  2ZYK A;  4KQP A;  3VLW A;  3MZ9 A;  3I6V A;  1A54 A;  2YPN A;  1MM7 A;  1M5D A;  2HZK A;  4POW A;  4F31 B;  4TOZ A;  2THI A;  4G68 A;  3PPR A;  5CC2 A;  4DZ1 A;  3I5O A;  2O51 A;  2P2A A;  4ECF A;  2XXQ A;  4OES A;  1D4N A;  4G68 C;  3H7M A;  5CMC A;  4MBP A;  4G68 B;  2RC8 A;  4C0R A;  2I0C A;  3CFZ A;  3CSG A;  2GFE A;  2D21 A;  4H5F A;  4IB2 A;  1Z7M E;  4NF6 B;  5I58 A;  4R2B A;  2PX1 A;  1B46 A;  4EQ7 A;  4FAJ A;  4TLM B;  1ZBM A;  5I58 B;  1NNK A;  1Q35 A;  1MS7 A;  3DLN A;  3EHS A;  3HPI A;  1LAH E;  3FJ7 A;  4YMA A;  4KHZ E;  5M2V A;  1VR5 A;  2O1M A;  4BDL A;  2R71 A;  3RYA A;  3OXN A;  4U23 A;  2XHD A;  2ZXT A;  1MM6 A;  3U93 A;  4I9D A;  1P99 A;  2I58 A;  3CVG A;  2Y7I A;  4MFI A;  2Q2C A;  1MPD A;  2XXU A;  5I57 B;  4KYS A;  2UXA A;  2HCA A;  3P7I A;  1MH4 A;  4H6D A;  2AYS A;  3TEL A;  2OJT A;  2F7A A;  4IO5 A;  3OO7 A;  1UQW A;  2Z8F A;  1NH8 A;  1N84 A;  1ZU0 A;  2O6A A;  3O9P A;  4OEU A;  3DRF A;  4IO4 A;  3TFL A;  4EDP A;  3C34 A;  2F8D A;  3OSR A;  3JV9 A;  5AA1 A;  4NED A;  3TQW A;  1XHY A;  3N94 A;  4H8J A;  3I3V A;  3CR9 A;  1WOD A;  3IOR A;  4U22 A;  3T96 B;  4F39 A;  4OWD A;  4G2Z A;  4U1Z A;  4F1Y A;  5H8F A;  2ABH A;  3W15 C;  2DWI A;  1SBP A;  4PFT A;  3ZKK A;  4XTC Q;  4R72 A;  2XXW A;  1BP5 A;  4FED A;  5KCJ A;  3Q26 A;  4JB7 A;  4MLV A;  3L6H A;  3O6H A;  2ZNT A;  3DM0 A;  2PBW A;  2H98 A;  1XS5 A;  4F2O A;  2YJP A;  5KCJ B;  1SW1 A;  4F29 A;  1LLS A;  1ZTY A;  1H45 A;  1SQY A;  4DDD A;  1URS A;  3Q25 A;  2CZL A;  3OD7 A;  4ELR A;  4I62 A;  1RKM A;  2I48 A;  3ILT B;  1LB9 A;  2ALU A;  4OHN A;  2B3F A;  4PFU A;  4KCC A;  5CMK A;  3V89 B;  4FAT A;  3R26 A;  3H3G A;  4AQ4 A;  4F2Q A;  4BDQ A;  3ZS6 A;  2I4C A;  4LP2 B;  4OFL A;  3CG1 A;  4JSD A;  3K1M A;  1JEV A;  4XIG Q;  4U4X A;  2DP8 A;  2OK2 A;  3Q27 A;  1EZ9 A;  1B7Z A;  1QW0 A;  4MLQ A;  3O6G A;  3LVU A;  3HCQ A;  4FEC A;  3KN3 A;  3ZKL A;  1R1N A;  4QFL A;  4DCY A;  4G8M A;  5JTY A;  1LFH A;  4X1B A;  3FGS A;  3O6P A;  1US5 A;  3EQ1 A;  2QSX A;  1B7U A;  4IGT A;  1FQF A;  4OTE A;  4M1V A;  2E1S A;  3FZV A;  4FIM A;  2NUV A;  4ZEK A;  2DYX A;  3IK6 B;  3DRI A;  1HSJ A;  3TQL A;  4R74 A;  2F35 A;  3DRG A;  3CI8 A;  4TQU Q;  5L9O A;  3ODB A;  1QUI A;  2DSF A;  4U4S A;  1BKA A;  1Z7N E;  4EF1 A;  3KOS A;  3OOA A;  3B6T A;  2VGQ A;  2NVU B;  3SEW A;  5JK4 A;  2RC9 A;  3LSW A;  3V83 A;  2D5W A;  2P0S A;  1Y9U A;  3OO8 A;  3TTM A;  4XXU A;  1DPE A;  5ISU A;  1H3D A;  2NOO A;  2H4I A;  1JQF A;  4KFQ A;  2QRY A;  3MVZ A;  1B32 A;  4LQ5 A;  4YMB A;  1QVS A;  1O7T A;  2XXT A;  2X7P A;  3U1O A;  2ZMB A;  3C35 A;  2A5T A;  4THI A;  1XVY A;  1URG A;  3IB1 A;  1BIY A;  4ONY A;  1TFA A;  4N6P A;  2A5T B;  2WKY A;  3WAF A;  1SW4 A;  4L17 A;  1B52 A;  2PVU A;  3HO7 A;  3KFM A;  3G3F A;  4LUB A;  4R9F A;  1FW0 A;  4PFY A;  1IXC A;  3IB2 A;  3MBP A;  5I59 A;  3PMX A;  1GGG A;  3O29 A;  1NNP A;  1GTK A;  2ZYO A;  1OVB A;  3FIR A;  5DVI A;  5CM6 A;  2Y7K A;  3PD9 A;  3IOT A;  4M4G A;  4GWO A;  1B51 A;  2REG A;  4YIC A;  4RNS A;  3FAS A;  1PB8 A;  3FJM A;  3CFL A;  3IOV A;  2DXR A;  4GL0 A;  1EU8 A;  1A40 A;  1F9B A;  3PUW E;  4R73 A;  1M5B A;  3T9X B;  1B0L A;  1B1H A;  1P1U A;  3PPN A;  2G93 A;  3TTL A;  4H67 A;  2V3U A;  2V84 A;  1LBB A;  1MDP 1;  1MH3 A;  3R7X A;  2XXR A;  3TTN A;  4GL8 A;  5EHM A;  4XKP A;  1ANF A;  3TZA A;  2QS2 A;  4ZS9 A;  2V93 A;  4ND9 A;  2Q88 A;  2VP1 A;  3EN3 A;  3VDF A;  2QPQ A;  1EZO A;  4NWC A;  4G4P A;  3CSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...