1B4ZA

Oligo-peptide binding protein (oppa) complexed with kdk
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
total genus 187
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b4zA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b4zA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b4zA02
3Q28A 4R73A 3I5OA 1QUJA 4NF5A 4BDOA 5ITPA 4JWYA 1LAGE 2AIXA 2F6GA 3C35A 1QUKA 2DOJA 3FJ7A 4R72A 4GWOA 4NTLA 3MVZA 5TPAA 2R71A 3OO9A 4X9TA 1VFDA 2OWSA 3LSWA 1IXCA 1MXXA 4P11A 3DM0A 4JDFA 4ZEDA 3DRJA 5HPQA 3RUMA 1B3GA 3LR1A 4U1ZA 2F36A 3E9XA 3FD3A 4UACA 5CMCA 2H9BA 3ONMA 3FZVA 3PUZE 1FQCA 4MF3A 4AB5A 1P1WA 4YKPA 4GD5A 3SETA 4K3FA 5B7DA 5CBSA 2WOLA 2I0CA 2I48A 3LSXA 1B7ZA 3A3UA 3OENA 4GXAA 3Q29A 1M5FA 2ZXTA 3SKPA 3U92A 3IJXB 4POWA 1B1XA 1DTZA 1MXYA 2YJPA 2ZYKA 1USYH 4ZEIA 1N3WA 2DWAA 1B46A 2GFEA 3B6WA 3EHSA 4F3GA 1Y9UA 4LA9A 1SI1A 1B5IA 2XXWA 3C9HA 2IA4A 5ISUA 1OQGA 2RCBA 1B3FA 3QUJA 4XKPA 1CE2A 1H45A 4ZEKA 4IB2A 3AXFA 1B7UA 1UTHB 1MS7A 3PV0E 2D5WA 4RXLA 2F6PA 3PUYE 4IO5A 3IJOB 4H67A 3IB0A 4BDMA 1GV8A 3F11A 4LZ8A 5DT6A 2O51A 5ICTA 4Q30B 4HW8A 2XXXA 5DVFA 2VGQA 2OJTA 4RK9A 4ZS9A 1SW5A 3VLWA 1PBQA 1R6ZA 3H6UA 3FXRA 1Y4TA 1B7HA 5FHMA 3N6UA 3KEIA 4F1YA 4IGTA 3MBPA 3FJMA 3PUVE 5HBCA 1M5CA 1MXUA 3VXBA 4I8CA 1A8FA 3HO7A 1VR5A 3S2VA 4GOTA 3CHGA 2Q8JA 3TEPA 3UP9A 1OMPA 4NF5B 1ZTYA 4Q0CA 4RYAA 4QFLA 4O3CA 1I6BA 2QMWA 3VE1B 2IEEA 4ONYA 3TCFA 2ABHA 3IX1A 4ZZAA 3MAMA 5EYFA 2OZZA 2DVCA 4Q8RA 1MDP1 4OMBA 2Y7KA 3FJGA 4HCYA 4QF9A 4YICA 1NKXA 4IGRA 5AA3A 3RLFE 2I3VA 4PP0A 5DEXA 1Z7ME 1WVJA 3L6GA 2V93A 3O29A 1MRPA 3FV1A 3LUYA 1A99A 1UQWA 2CMOA 3RYBA 1A55A 2V3TA 1JEVA 1Y3NA 1SW4A 2XXYA 2XXPA 3K2DA 3MP1A 4GLIA 2NXOA 4O3BA 2D21A 2DE3A 3OO7A 3FVOA 1DPEA 2VHAA 3A3CA 4GVOA 5K2YA 4MH5A 4KYDA 2DXYA 2QS4A 3H7MA 2A5SA 2CZLA 1QUIA 2VD3A 2ZNSA 2RF1A 4O3AA 4P0IA 1PBPA 1F9BA 4LATA 3KN7A 5I2NB 4DLDA 1VSOA 2V84A 3HPIA 3LBSA 2G93A 4F19A 1EZ9A 4NMYA 3MVXA 3ODBA 5JTYA 5AA2A 3KSXA 1P1NA 3O97A 1N7WA 1UTBA 3MZ1A 1NH8A 1NNKA 5AA4A 3EN3A 3H6TA 4RY1A 2H4IA 2RCAA 4ZZEA 3G3IA 5I56B 3CI8A 5KDTA 1Q1KA 2DE2A 3O66A 2A5TB 4NWDA 2PVUA 3KZGA 1GTKA 5I58B 2Z23A 1IEJA 1LSTA 5L8DA 2REGA 2QJEA 1LFHA 1QKAA 1LLSA 1R9QA 1MY3A 1FTMA 2DWHA 2F7BA 3KSJA 1IITA 4GIZA 4Z0IA 1LFGA 3TMGA 3U94A 3H6WA 2OWTA 1SYHA 1D9YA 3C32A 1HSLA 1P1OA 2XX7A 2O1LA 1SDXA 3CG1A 5TP9B 3G3JA 5CMKA 4NF8B 2I6EA 5JEIA 3RT8A 5I59B 1EZPA 4OQOA 1JEUA 3VFJA 2REJA 4POXA 1DPPA 4H8JA 4OEVA 3CFXA 3C33A 3GZGA 3THIA 1WODA 2V3QA 3K01A 4NF6B 2PX1A 4IO3A 3CVGA 5JTYB 2DVZA 4QHQA 3TTRA 3VVFA 5KZTA 4KYSA 3KBRA 1EU8A 2F34A 2HAUA 3HV1A 1GGGA 4N07A 3WAEA 2Z22A 5AA4B 5I2KA 1T0KA 1MQGA 1XS5A 1P1UA 4G68A 4TQUQ 3MW0A 1MH4A 4YMAA 1XVYA 3FASA 3K6VA 1QVSA 5F7VA 1YCJA 4QFNA 1MY4A 2UVIA 4G77A 3SEXA 5I57B 4H1XA 1US5A 1OLCA 4JSDA 2KLFA 2QS2A 4YKIA 1JETA 1SQYA 3H6VA 4U22A 4NF8A 3TAJA 3PUWE 4KI0E 4WXJA 2RKMA 3FVGA 5KDTB 4OTEA 2HCAA 4LQ2A 1B4ZA 2PT1A 4HCWA 2ONKE 3SDFA 3RQTA 5DYHA 2XXUA 2NVUB 3USDA 4BDQA 5I57A 1A40A 4R75A 3TKDA 1XT8A 5L9MA 5I2NA 4FECA 1OQHA 2GH9A 2GHBA 3JV9A 3PUXE 4L17A 1P99A 1FQEA 2ZYMA 5IKBA 3PMXA 4U2RA 2UYEA 5A5XA 2R9JA 1AH5A 2F7AA 2HZLA 4H0WA 2O6AA 4YMBA 1FTOA 2RC7A 4DZ1A 3B6QA 5CM6A 5IAIA 2H5YA 3QSLA 2Q2AA 3O9PA 1II5A 3T96B 2OBGA 4DXCA 3IK6B 1MXZA 4OERA 5H8SA 2ZYOA 5DVJA 4YZZA 3UA8A 2BJJX 3FGSA 2Z8EA 3D4GA 3IOUA 3PU5A 4YB5A 4G8MA 5CMBA 3K00A 1POY1 5CC2A 4F22A 4PFWA 3CR9A 1A7LA 1PB8A 2I4CA 1OIBA 2PBWA 3B6TA 3BFTA 3T9VA 2HAVA 3FXQA 3R7XA 3QIMA 1TT1A 2QS1A 3K6WA 3M3FA 4M1VA 5H8NA 1I6AA 2R6GE 2F35A 2HZKA 2B4LA 1N7XA 4MFIA 4OXVA 3W15C 2ZMBA 1N84A 3IL1B 3T9HB 3TODA 3U1OA 4ZDMA 3CG3A 5AA1A 3TELA 3ECRA 3M8UA 2DWIA 4ZECA 4PQJA 1UIUA 5F1QA 3DP8A 3HCQA 5CRYA 3KJ7A 4H5FA 4YKKA 4EQ9A 5I2KB 1LGBC 2V3UA 4C1UA 3QYTA 2DP8A 4H8IA 3DP6A 5HM4B 3IB1A 4FIMA 2F8DA 3K1MA 1ZU0A 4I62A 1ZLQA 1NNFA 2XXVA 1SVXB 2F7CA 3JZJA 4KCDA 5M2VA 2WOKA 3TUSA 1FCKA 5FHOA 1TFAA 1VFEA 2ANJA 2O1MA 3DP4A 1LFIA 4Q5TA 2F5XA 1JVXA 3OO8A 2V25A 2DXRA 3KGCA 4G8HA 3RT6B 2DQVA 4XKQA 1QULA 2NOOA 4P0GA 3DRIA 1DTGA 1UTBB 4H6DA 3O6PA 1ZJLA 5FTIA 3TZAA 2QL3A 4NF6A 4E0XA 4OHNA 3V5AA 5ICQA 3OXNA 1I6QA 1SW2A 5H8NB 1R9LA 1UTHA 2NWJA 4XKRA 1AOVA 1IXGA 1WDNA 4G68C 3JYRA 5EHMA 3VLVA 1M5BA 3OEKA 4IO6A 3RN8A 3HSTA 4ND9A 1HSJA 2M8CA 4F39A 1S50A 1I69A 1B2HA 1Y4CA 3S9MC 2ESNA 2Z8FA 1BTJA 1DOTA 1MY1A 3MPLA 2B4MA 1D3KA 4G8NA 4MLVA 3IO6A 3U72A 3FVKA 3RGYA 4OFLA 3TQWA 3UGWA 1B51A 1ZBMA 3W9WA 5ELVA 2ZNTA 3O6IA 3VV5A 2XXQA 4TLMB 2I49A 4RJZA 3C31A 1H3DA 4QRZA 5TU0A 4C0RA 1B0LA 1J1NA 1NL5A 1XHYA 1B0HA 4OFOA 2Y84A 1LCTA 3IOTA 4GL0A 4TLLB 3HN0A 5FHNA 5H8QB 4F1UA 1JVYA 2PMSA 1LBCA 1M5EA 4NF4A 4EQ7A 1GVCA 3OO6A 4DDDA 5H8QA 2O7IA 3GBAA 5H8HB 1JNFA 3R6UA 2PYYA 3QXMA 1NNPA 4KD5A 5I58A 3PPPA 3S9NC 1H43A 2XXHA 4LZ5A 3G7WA 3TTLA 1NH7A 3A09A 2NUVA 3QUFA 2XX8A 4HS7A 5DEXB 5AA2D 2HFBA 2XXTA 2QS3A 4ESXA 2B65A 4R6YA 3IAZA 1B32A 4RNSA 3MZ9A 3U93A 1R1NA 3GLBA 4R74A 4YB7A 2Y7RA 5H8FB 1GR2A 4ZE9A 2AL4A 3EF7A 4KPTA 3UORA 2G29A 3OOAA 2DSFA 3PPRA 4NE4A 3ZSFA 5J1DA 4OZ9A 1RKMA 1DMBA 4X48A 1N04A 3OSQA 2QPQA 2X7QA 3LVUA 1HSEA 1AIVA 4F2OA 3M3KA 3CRBA 1B58A 5EHSA 3KN3A 4LP2B 3VLUA 4DIGA 4ECFA 5AA2B 3I6VA 1B5JA 2H99A 3TYHA 3MC2A 1YPNA 4X1BA 5L9OA 4JB7A 3TQLA 4DXBA 3OELA 4QFKA 3Q26A 3CSGA 4FAJA 2OK2A 3FATA 4GF8A 2I58A 3BFUA 1TFDA 3HHFA 3ILUB 1URSA 1B9JA 1B4HA 1Y20A 1LAXA 1MQHA 3P7IA 4QSEA 4JWXA 4U23A 5CBRA 2GRVA 3E13X 2F78A 3G3HA 2HQ0A 1EH3A 3G3KA 3DRGA 4FEBA 4U21A 1LBBA 4F3SA 2O84X 5A5XB 1B3HA 1N3XA 4WKMA 5KCJA 1QW0A 2I0BA 3Q25A 2QSXA 4GRKA 2I4BA 2UXAA 4PE5B 1MPCA 2THIA 3H06B 3VXCA 5KCJB 4IO7A 1IUDA 3BBRA 1BKAA 3FV2A 3KFMA 4OYVA 1JQFA 1Y3QA 1ANFA 2I3WA 3CFLA 3MUQA 3O6GA 4YKJA 3PD8A 4QSCA 2HXWA 2QRYA 4HTGA 4ISUA 3CSBA 1MPBA 3KG2A 4H5GA 3RPWA 2UVHA 3H4ZA 2B3FA 2FNCA 3IORA 2XX9A 4FJPA 1A54A 1VE4A 4GQOA 2X7PA 1PC3A 1MPDA 3PPNA 3SEVA 2XHDA 2O68A 4PETA 3UK4A 1MQIA 2PT2A 3DELB 1MQJA 3MP8A 3UIFA 4F1VA 1IXIA 1O63A 1RYXA 2Z8DA 3GBBA 4XXUA 4KCCA 5CI5A 4AB6A 3PAMA 2RC9A 4R9FA 1B3EA 4QFOA 3FTOA 2YPNA 4I9DA 1USYE 1MXWA 3RY3A 2DE4A 2VOZA 3IR1A 4LUBA 3VVEA 4EF2A 5CMMA 3K1NA 3H03A 1NNTA 1LB9A 1IXHA 3LC8A 3MPKA 1JW4A 1US4A 4F2QA 3MWBA 3T9XB 1M5DA 3HHGA 3OSRA 1Y3PA 4Z7EA 4BDNA 4EQBA 5FTHA 1FTKA 3FXUA 4LONB 4QFPA 5I84A 4YB6A 4GL8A 4EXKA 1XC1A 1SD3A 3PD9A 3KJTA 5AE4A 3ZS6A 3UN6A 4MBPA 4OVJA 4C1TA 1Z7NE 3K02A 3E3KA 3TFLA 3TTMA 1LAHE 2Y7PA 4E0WA 2DS9A 3TPAA 4X1DA 4TOZA 4R2FA 2QMXA 1FQDA 2H98A 4XTCQ 1ZMGA 3VDFA 3K4UA 1N76A 1SI0A 5ITOA 4N6PA 2DWJA 1JW5A 3LSLA 4U4XA 4DE8A 3C4MA 3FUZA 3O2AA 4JBZA 1BIYA 1TXFA 3QK6A 1B1HA 1KWHA 1PEBA 4F18A 4FORA 2LAOA 3ZKLA 4RPOA 4OEUA 2F97A 4RK2A 5H8HA 4IY5A 2Y7WA 3TTNA 3D4CA 3Q27A 3T9UA 1NFTA 1B3LA 4DCXA 4PFTA 1ATGA 2E1SA 3MVYA 2FYIA 2XXIA 3K1PA 4N13A 4U1OA 3RNNA 2XD3A 2AL5A 4BLAA 1URGA 3IOVA 3ZKKA 4PFUA 1MG1A 4KHZE 3FIRA 1Y1ZA 4LVQA 4H65A 3C34A 4ESWA 1JW1A 1EZOA 4GFRA 2HEUA 3TCHA 3R26A 1SBPA 3WAFA 1RYOA 1FTLA 3OEMA 1AL3A 1IQ7A 3MQ9A 4FE8A 3N6TA 1BP5A 4R9GA 1H44A 4ELQA 5L9SA 1MXVA 1Y1MA 3K0VA 1S9TA 4WEPA 5BWJA 4OWDA 1O64A 2Q88A 2YLNA 2E0SA 1IZ1A 3TTKA 4F29A 4DCYA 3FVNA 4R2BA 4XIGQ 1NMUA 4PFYA 1LB8A 1PB9A 2Q2CA 1MY0A 2ONSA 3E4RA 1POTA 3GXAA 4FATA 2DYXA 1L5TA 3MZBA 2Y7IA 1H76A 1B52A 1ELJA 3KOSA 3OMBA 1B5HA 1MY2A 1YAEA 3TDJA 1O7TA 3T93B 3EHTA 3MJNA 3W9VA 4YU0A 3RYAA 1FQBA 1UIVA 2H25A 3G3GA 4ELOA 3SEYA 4OETA 3ILTB 3S4UA 1YTVA 4ZE8A 3T66A 1ZIUA 4LZ7A 4NWCA 2XXRA 3PPOA 4KYEA 4JXIA 4R6KA 2P2AA 1MM7A 5DTBA 5TP9A 3T22A 4XKNA 3PGFA 3RTFB 4QSDA 4BDRA 4ELRA 1P1QA 3PPQA 5H8FA 5LOMA 4WEDA 1FQAA 3M3LA 4MLQA 4M4GA 1S7YA 5TPAB 1MH3A 4KR5A 3N94A 3DRKA 3DLNA 4UA8A 1XOCA 2WKYA 3DRFA 1D9VA 2B3BA 2ZYNA 2UVGA 3PMVA 3U8QA 4G2ZA 1PDAA 2P0SA 3PMWA 4EDPA 3L6HA 2P1SA 4YAHX 3EPEA 4U4SA 4OENA 1SYIA 3KN8A 2UYFA 3O6HA 4ZEBA 1SW1A 3N26A 4G4PA 4JWOA 3SERA 5JK4A 1Q35A 1IIWA 3SESA 1MM6A 2A5TA 4RPNA 5DVIA 4F3BA 4OESA 3VVDA 5I56A 4IO4A 3DRHA 4KFQA 3EHUA 1AMFA 4AQ4A 1MDQA 2W7YA 4EXLA 4JSOA 3C36A 3H3GA 3K6XA 2ZNUA 3EQ1A 1XVXA 5K2XA 4I1DA 3S9LC 2RINA 3N5LA 2D3IA 2Q9TA 2RC8A 3IOWA 4ZEFA 3CIJA 1OVTA 1A8EA 4GXSB 4F31B 1FTJA 5B70A 3V83A 3KOTA 4LQ5A 1ZKBA 1OLAA 2ALUA 2Q89A 2VD2A 2XD2A 3O28A 1QKBA 4NEDA 4THIA 3TCGA 3V89B 2X26A 3S9EA 4IO2A 4IY6A 4F3PA 1DSNA 1N0TA 3K6UA 2UVJA 3RTWB 5I59A 2GHAA 1B05A 2OCUA 3OD7A 3QAXA 3V8XB 1LCFA 4OFJA 1QJMA 4EF1A 4RA1A 3IB2A 4NF4B 4BDLA 2O7UA 2AYSA 3SEUA 4KQPA 2VP1A 1BLFA 1URDA 3CFZA 3MVWA 3BKIB 3G3FA 4FEDA 1PB7A 1MQDA 4R6HA 5BUUA 1CB6A 1FW0A 2WOPA 2ONRA 3I3VA 3IO4A 1B6HA 1D4NA 1TWYA 2OLBA 2O69A 3SEWA 4DXUA 4ELPA 3B7DA 2FA7A 4G68B 4EUOA 1LAFE 1B40A 3MP6A 3LSFB 1FQFA 1OVBA
chains in the Genus database with same CATH superfamily
1LAGE 3C35A 1QUKA 1FPKA 1IMDA 5TPAA 2F3DA 3LR1A 2F36A 4UACA 1EYJA 3FZVA 1FQCA 4MF3A 4AB5A 3A3UA 1M5FA 3U92A 4POWA 1MXYA 4ZEIA 1N3WA 2DWAA 4F3GA 2GFEA 2XXWA 1B3FA 4XKPA 1YZ0A 1FBPA 3AXFA 3PV0E 1UTHB 2D5WA 4BDMA 5DT6A 4Q30B 4HW8A 1Y4TA 1B7HA 2XA5A 3N6UA 4IGTA 3MBPA 3FJMA 1M5CA 3MYUA 1A8FA 3HO7A 1VR5A 4GOTA 1FBCA 1OMPA 1ZTYA 3VE1B 2OZZA 4OMBA 2Y7KA 4HCYA 3RLFE 2I3VA 3PTYA 1Z7ME 4HXVA 1UQWA 4N15A 2V3TA 1Y3NA 1SW4A 3K2DA 3MP1A 2NXOA 4NN3A 2VHAA 4GVOA 2DXYA 4AS4A 2A5SA 1QUIA 2RF1A 4P0IA 1PBPA 1F9BA 5I2NB 4OVRA 4DLDA 2G93A 1EZ9A 4PC9A 3MVXA 3ODBA 1INPA 1N7WA 3H6TA 4NWDA 4NX1A 3KZGA 2ZZWA 1IEJA 1LSTA 5L8DA 2WYKA 1LFHA 1QKAA 4Z7EA 1MY3A 2F7BA 3KSJA 4Z0IA 5BUUA 2OWTA 1D9YA 3C32A 1SDXA 4NF8B 2I6EA 3RT8A 1EZPA 1JEUA 1RDYA 4OEVA 3GZGA 2V3QA 2PX1A 3CVGA 2DVZA 1BK4A 3TTRA 3VVFA 4KYSA 4MEVA 2HAUA 5I2KA 4N07A 4I40A 2Z22A 3T0JA 1P1UA 2QVUA 4G68A 1MH4A 1XVYA 3K6VA 1MY4A 4G77A 4H1XA 1US5A 4YKIA 1JETA 4WXJA 3FVGA 3BIHA 4OTEA 2ONKE 2XXUA 3USDA 5L9MA 2F7AA 4H46A 1FTOA 5IAIA 2H5YA 2Q2AA 4DXCA 3IK6B 4YZZA 4GWWA 3PU5A 3IOUA 4YB5A 4G8MA 4F22A 4PFWA 2I4CA 1D9QA 1OIBA 3BFTA 4NF0A 3QIMA 3K6WA 3M3FA 2R6GE 2F35A 3W15C 3IL1B 2ZZVA 2DWIA 4PQJA 4ZECA 3HCQA 4H5FA 4EQ9A 5I2KB 1LGBC 4C1UA 4H8IA 4FIMA 3IB1A 3K1MA 1NNFA 5M2VA 2WOKA 1VFEA 4Q5TA 4N81A 2F5XA 3KGCA 4G8HA 2DQVA 4XKQA 1QULA 1UTBB 1ZJLA 2QL3A 5H8NB 5EHMA 4P47A 1S50A 1Y4CA 4LN5A 3S9MC 3FVKA 4OFLA 3UGWA 1ZBMA 2ZNTA 2XXQA 2I49A 3C31A 1H3DA 5EQ8A 5TU0A 4NF6A 1XHYA 4TLLB 1L5TA 5I2NA 5H8QB 1M5EA 1FRPA 5I58A 3QUFA 2NUVA 1FPLA 2QS3A 4RNSA 3T1BA 3EF7A 4DI4B 4GX4A 3OOAA 5J1DA 4X48A 1RDXA 3CRBA 3VLUA 5AA2B 1KZ8A 5ET6A 4N6DA 3A29A 4G61A 3U65A 4DXBA 3BFUA 3ILUB 4QSEA 3E13X 2F78A 3G3HA 2HQ0A 4FEBA 3DRGA 5A5XB 2O84X 5KCJA 2QSXA 2UXAA 4PE5B 1MPCA 3VXCA 5KCJB 3KFMA 2CEYA 1Y3QA 2I3WA 3O6GA 3CFLA 2HXWA 3MSTA 2QRYA 4ISUA 3CSBA 3H4ZA 5EYHA 3SEVA 1MPDA 2XHDA 3DELB 3UIFA 3MP8A 1RYXA 1K9ZA 4XXUA 4KCCA 1G0HA 4LUBA 3VVEA 2DE4A 1LB9A 3LC8A 1JW4A 3HHGA 5ET7A 4N8GA 5I84A 4GL8A 3PD9A 3ZS6A 5IZ1A 3E3KA 3TTMA 3TPAA 2QMXA 2H98A 4XTCQ 1ZMGA 4GBVA 5ITOA 4N6PA 4PGNA 4U4XA 2Q74A 2LAOA 2F97A 2Y5LA 1LBYA 3KBZA 4DCXA 2E1SA 3SEXA 3MVYA 5I57B 2AL5A 1IMBA 4ESWA 1RYOA 1NV4A 3OEMA 4R9GA 1IQ7A 1BP5A 1H44A 4ELQA 3K0VA 5BWJA 5ET8A 3TTKA 4F29A 4DCYA 1PB9A 2Y5KA 4FATA 1B52A 1YAEA 3T93B 3S4UA 1YTVA 4LZ7A 2XXRA 4QSDA 5H8FA 4WEDA 3M3LA 1S7YA 2WKYA 1D9VA 2B3BA 2UVGA 3U8QA 4G2ZA 4JWOA 1SW1A 5JK4A 4RPNA 4F3BA 4IO4A 3DRHA 4JSOA 3EQ1A 3S9LC 2D3IA 2RC8A 2MKZA 1ZKBA 3O28A 3V89B 3S9EA 4IY6A 4F3PA 5I59A 1LCFA 3IB2A 2VPOA 2PFZA 1PB7A 1MQDA 2ONRA 3IO4A 1B6HA 1LAFE 5LDZA 4RK2A 3LSFB 4QHQA 1OVBA 4R73A 4NF5A 4BDOA 4JWYA 3FJ7A 3MVZA 4X9TA 1VFDA 2KQZA 2OWSA 2Q8MA 3DRJA 5HPQA 3RUMA 1B3GA 3FD3A 4PAKA 1P1WA 4GD5A 3LSXA 1B7ZA 1AWBA 4N6KA 2YJPA 3EHSA 1USYH 5EQAA 4P56A 1Y9UA 4LA9A 1SI1A 1B5IA 4I3EA 1NUZA 1FJ9A 1CE2A 4ZEKA 3PUYE 2FBPA 3F11A 4LZ8A 1KA0A 2XXXA 4RK9A 3H6UA 1FSAA 4GWSA 2DDKA 4JVIA 4I8CA 4MNIA 4Q0CA 4NF5B 1IMEA 4YICA 4IGRA 5DEXA 4XF5A 3LUYA 1A99A 3R7XA 4M1VA 4PGPA 1A55A 4O3BA 2D21A 3OO7A 3A3CA 5K2YA 4MH5A 4PAIA 5F24A 2QS4A 2ZNSA 4O3AA 1VSOA 2V84A 3LBSA 4F19A 4NMYA 3MZ1A 1UTBA 1NNKA 3IFAA 4MNPA 3EN3A 5AA4A 4RY1A 2H4IA 4ZZEA 3G3IA 3CI8A 2DE2A 3KC0A 1LLSA 1FTMA 4GIZA 1SYHA 2XX7A 3RPLB 2O1LA 1FPIA 3CG1A 4P3LA 5TP9B 5JEIA 5I59B 2JJKA 4H8JA 1WODA 5JTYB 4N4UA 1SPIA 1EU8A 2F34A 5AA4B 3WAEA 1MQGA 1IMCA 4PDHA 3MW0A 5F7VA 1QVSA 2UVIA 2QS2A 1SQYA 4PFBA 3H6VA 3TAJA 3PUWE 4QBAA 4FBPA 4LQ2A 1B4ZA 3TKDA 4MAGA 3NOHA 2GH9A 3JV9A 4L17A 1P99A 2ZYMA 5EQ9A 3PMXA 5I7IA 2R9JA 1AH5A 2RC7A 4DZ1A 3QSLA 3O9PA 3T96B 5H8SA 3UA8A 3D4GA 5CMBA 1POY1 4MHFA 2PBWA 3T9VA 4PF6A 1TT1A 5H8NA 3LV0A 2B4LA 3T9HB 1DK4A 5AA1A 3ECRA 1UIUA 3DP8A 2P3NA 3QYTA 4I62A 2DP8A 2WBBA 2F7CA 3TUSA 2O1MA 2CZIA 1JVXA 3RT6B 2DXRA 3O6PA 4E0XA 3V5AA 1SW2A 1UTHA 2NWJA 1WDNA 4G68C 2M8CA 4JVDA 1I69A 2Z8FA 3MPLA 4G8NA 3U72A 1DCUA 4X04A 3VV5A 1B0LA 2Y84A 1B0HA 3IOTA 4GL0A 4GWXA 2PMSA 4NF4A 4EQ7A 3GBAA 3TTLA 4HS7A 4ESXA 2XXTA 4MNCA 1R1NA 3GLBA 4R74A 1GR2A 4ZE9A 2AL4A 3UORA 2G29A 4NE4A 2DSFA 3ZSFA 1RKMA 3OSQA 4F2OA 1B58A 1NV3A 3KN3A 4LP2B 4O94A 3I6VA 1B5JA 2H99A 3TYHA 1YPNA 1B40A 5L9OA 4GWUA 3CSGA 2OK2A 4GF8A 1B9JA 1B4HA 4U23A 1MQHA 5CBRA 4JWXA 2GRVA 1FBDA 1N3XA 2THIA 2OX3A 4IO7A 4QSCA 3RPWA 4NGUA 2B3FA 3IORA 4FJPA 4GQOA 2X7PA 4GX6A 1MQJA 3GBBA 1JP4A 3PAMA 4I9DA 3FBPA 1USYE 1MXWA 4EF2A 5CMMA 1NNTA 3MPKA 4P8BA 5FTHA 1FTKA 4EXKA 1SD3A 5AE4A 3KJTA 4C1TA 3K02A 1LAHE 2Y7PA 4E0WA 4TOZA 3GYYA 4R2FA 3KC1A 3K4UA 1N76A 2F3BA 4DE8A 4PBHA 3O2AA 1KWHA 5ET5A 4OEUA 4O7IA 4IY5A 2Y7WA 3TTNA 3T9UA 4PFTA 1ATGA 4BLAA 2XD3A 4PFUA 1MG1A 2R8TA 4H65A 4P1LA 2HEUA 4O7MA 1FTLA 4NHBA 3B50A 2YLNA 1IZ1A 3FVNA 4PFYA 1LB8A 2Q2CA 1MY0A 3E4RA 4HE0A 1ELJA 3OMBA 1NV6A 3MJNA 1UIVA 1DBZA 4OETA 3ILTB 4ZE8A 3T66A 5TP9A 4KYEA 4R6KA 3T22A 4ELRA 5TPAB 1MH3A 4KR5A 3DLNA 4PFIA 1XOCA 3DRFA 3PMVA 1NV2A 2P0SA 4OVTA 4YAHX 5J16A 4U4SA 4OENA 3KN8A 3SERA 4AQ4A 2W7YA 4EXLA 5K2XA 4I1DA 2RINA 3N5LA 4ZEFA 4F31B 1FTJA 5B70A 5IM2A 4THIA 3TCGA 1DSNA 2GHAA 3OD7A 4OFJA 4NF4B 4BDLA 2O7UA 2AYSA 1EYKA 3SEUA 4KQPA 2VP1A 3WAFA 3G3FA 3MVWA 1FW0A 3I3VA 2PFYA 1D4NA 2OLBA 4DXUA 1FTAA 2FA7A 4G68B 3MP6A 2DE3A 3I5OA 1QUJA 1K9YA 2AIXA 2F6GA 2QFLA 5T3JA 4R72A 2L5VA 2R71A 3OO9A 3LSWA 1IXCA 1MXXA 3DM0A 4ZEDA 2CEXA 3E9XA 5CMCA 2H9BA 5B7DA 4K3FA 2WOLA 2I0CA 3D1RA 1Q9DA 4GXAA 3Q29A 2ZXTA 3SKPA 1LEVA 3IJXB 2ZYKA 4H45A 1NV1A 1NV7A 3C9HA 1OQGA 2RCBA 1H45A 3E79A 3IJOB 3IB0A 2VGQA 4ZS9A 1SW5A 3VLWA 1PBQA 1R6ZA 3FXRA 3KEIA 1RDZA 3CHGA 3UP9A 4RYAA 3IFCA 4O3CA 1I6BA 4ONYA 3TCFA 3IX1A 3MAMA 4MJOA 4Q8RA 3FJGA 4QF9A 1NKXA 4PP0A 3O29A 1FBHA 5DW8A 2XXYA 2XXPA 1DPEA 2HXRA 3SESA 3TELA 5JTYA 1P1NA 3O97A 4PCDA 5I56B 5KDTA 1Q1KA 3O66A 2A5TB 5EYGA 5I58B 2REGA 3RPLA 2QJEA 2DWHA 3TMGA 1IITA 1NV5A 3H6WA 1HSLA 1P1OA 3G3JA 5CMKA 4OQOA 3VFJA 4POXA 4HE1A 3K01A 4IO3A 2P3VA 5KZTA 1LBZA 1T0KA 1NUXA 4X8RA 3FASA 2WEFA 1OLCA 4U22A 4NF8A 1QGXA 2RKMA 3LUZA 2HCAA 5DYHA 4BDQA 5I57A 1A40A 1XT8A 4OVPA 3PUXE 5IKBA 4U2RA 2UYEA 4H0WA 2O6AA 5CM6A 1II5A 2OBGA 1MXZA 4OERA 3ROJA 5DVJA 2BJJX 2Z8EA 4GWZA 5CC2A 3CR9A 1A7LA 1PB8A 2HAVA 3FXQA 2QS1A 4PE3A 1I6AA 2HZKA 4MFIA 1N7XA 3U1OA 3CG3A 5CRYA 5HM4B 1ZU0A 2XXVA 1SVXB 3JZJA 4KCDA 1TFAA 2ANJA 1LFIA 5ICTA 2NOOA 1DTGA 4H6DA 3TZAA 4OHNA 5ICQA 3OXNA 4XKRA 3JYRA 4IO6A 3HSTA 1B2HA 1YYZA 1BTJA 1DOTA 1D3KA 3IO6A 3W9WA 3TQWA 2XXKA 5ELVA 3O6IA 4TLMB 4RJZA 4QRZA 1NL5A 1EYIA 1LCTA 2XWKA 3HN0A 1LBCA 1GVCA 3OO6A 4DDDA 5H8QA 5H8HB 1JNFA 3R6UA 2PYYA 3QXMA 1NNPA 4KD5A 3PPPA 3G7WA 1NH7A 2XX8A 5AA2D 2HFBA 4R6YA 3IAZA 3B8BA 4YB7A 2Y7RA 5H8FB 4NG7A 4KPTA 1DMBA 2QVVA 2X7QA 1HSEA 2CZKA 1NV0A 3M3KA 5EHSA 4DIGA 2FHYA 4JB7A 3OELA 4QFKA 5IZ3B 3BIGA 3P7IA 1EH3A 2CZHA 4U21A 3Q25A 2I0BA 4DI3D 1IUDA 4OYVA 3BBRA 4HE2A 1BKAA 3MUQA 4QXDA 4YKJA 1NUWA 3KG2A 2UVHA 2FNCA 4LVQA 4F1VA 2PCRA 1A54A 1PC3A 3PPNA 4PETA 2O68A 1MQIA 5CI5A 3FTOA 2VOZA 3IR1A 1US4A 4F2QA 3MWBA 3T9XB 1M5DA 1Y3PA 3FXUA 4LONB 1XC1A 4MBPA 1Z7NE 3TFLA 4X1DA 3VDFA 1SI0A 2DWJA 4OVQA 3FUZA 4JBZA 1G0IA 1BIYA 3QK6A 4PTKA 1B1HA 4FORA 3ZKLA 5H8HA 1NFTA 3K1PA 2XXIA 3RNNA 1URGA 5I3SA 4KHZE 1Y1ZA 3C34A 1JW1A 1AL3A 5L9SA 1Y1MA 1S9TA 1O64A 4R2BA 1NMUA 4OANA 2ONSA 1POTA 2ZZXA 3GXAA 2DYXA 3MZBA 3ISPA 3TDJA 1O7TA 3W9VA 3RYAA 1ZIUA 1MM7A 5DTBA 4XKNA 3PGFA 3RTFB 4BDRA 5LOMA 1P1QA 4MLQA 1FQAA 4M4GA 4UA8A 2ZYNA 1PDAA 4EDPA 3EPEA 1SYIA 3O6HA 4ZEBA 3N26A 1FPBA 1IIWA 4OESA 3VVDA 4KFQA 1AMFA 2FIXA 2XWOA 3EKIA 1XVXA 2Q9TA 1LBXA 1A8EA 3V83A 1NUYA 3KOTA 4LQ5A 1OLAA 2ALUA 4NEDA 2KR0A 2X26A 4NQ8A 1FBFA 3QAXA 3V8XB 4PAFA 1QJMA 4RA1A 4GWYA 1URDA 3BKIB 4R6HA 1CB6A 2WOPA 1TWYA 3B7DA 4EUOA 4LATA 1FQFA 3Q28A 5ITPA 4MX6A 2DOJA 4I3YA 4GWOA 4NTLA 4P11A 1FPJA 4JDFA 4P9KA 4U1ZA 1KA1A 3ONMA 3PUZE 4XEQA 4YKPA 3SETA 5CBSA 2I48A 3RYDA 4N8YA 4GX3A 3OENA 1B1XA 1DTZA 1B46A 3B6WA 4PFRA 2IA4A 5ISUA 3QUJA 4N91A 4IB2A 1B7UA 4MCOA 1MS7A 4RXLA 2F6PA 4IO5A 4H67A 1GV8A 2O51A 4P1EA 5DVFA 2OJTA 5FHMA 4F1YA 3PUVE 5HBCA 1MXUA 3VXBA 3S2VA 2Q8JA 3TEPA 4QFLA 2QMWA 2IEEA 2ABHA 2QVRA 4ZZAA 5EYFA 2DVCA 1MDP1 5AA3A 1WVJA 3L6GA 2V93A 1MRPA 3FV1A 2CMOA 3RYBA 1JEVA 4KXPA 4GLIA 2HPGA 3FVOA 4KYDA 3H7MA 2CZLA 2VD3A 2XWVA 3KN7A 3HPIA 1LBWA 5AA2A 3KSXA 1CNQA 3E78A 1NH8A 1FBEA 2RCAA 3HFUA 4MIJA 2PVUA 1GTKA 4NAPA 2Z23A 1R9QA 1LFGA 3U94A 4JVCA 2REJA 1DPPA 3CFXA 3C33A 5IGAA 1IMAA 3THIA 4NF6B 3KBRA 3HV1A 1GGGA 1XS5A 1FBGA 4TQUQ 4YMAA 1YCJA 4QFNA 4JSDA 2KLFA 4KI0E 4PBQA 3SDFA 2PT1A 4HCWA 3RQTA 2NVUB 2HHMA 4R75A 4FECA 1OQHA 2GHBA 1FQEA 3QMFA 2HZLA 1FPEA 4YMBA 3B6QA 3SZPA 5EQ7A 1VDWA 2ZYOA 3FGSA 3K00A 3B6TA 4OXVA 2ZMBA 1N84A 3TODA 4ZDMA 3M8UA 5F1QA 3KJ7A 4YKKA 2V3UA 3DP6A 2F8DA 1ZLQA 1FCKA 5FHOA 3DP4A 3OO8A 2V25A 4P0GA 3DRIA 5FTIA 5ESYA 1I6QA 1R9LA 1AOVA 1IXGA 3VLVA 1FJ6A 1M5BA 3OEKA 3RN8A 4ND9A 1HSJA 4F39A 2ESNA 1MY1A 4MLVA 2B4MA 4OVSA 2BJIA 1AIVA 3RGYA 1B51A 4C0RA 1J1NA 5FHNA 4OFOA 4UABA 4F1UA 1JVYA 1IMFA 2O7IA 2FIEA 3S9NC 1H43A 2XXHA 4LZ5A 3A09A 5DEXB 2B65A 5A5LA 1B32A 5IZZA 3MZ9A 3U93A 3PPRA 2GQ1A 4OZ9A 2WYPA 1N04A 2QPQA 3LVUA 2VT5A 4ECFA 5IZ3A 3MC2A 1NI9A 4X1BA 3TQLA 3Q26A 4FAJA 3FATA 2I58A 1TFDA 3HHFA 1URSA 1Y20A 1LAXA 3G3KA 4PF8A 4F3SA 1LBBA 1B3HA 4WKMA 2WX9A 1QW0A 4GRKA 2I4BA 3H06B 3FV2A 4XFEA 1JQFA 1ANFA 3PD8A 4HTGA 1MPBA 4H5GA 1YXIA 2XX9A 5KDTB 1VE4A 3UK4A 5FBPA 2PT2A 2VPNA 1IXIA 1O63A 2Z8DA 4AS5A 2V4CA 4AB6A 2RC9A 4R9FA 1B3EA 4QFOA 2YPNA 3RY3A 5A5XA 3K1NA 3H03A 1IXHA 3OSRA 4BDNA 4EQBA 4QFPA 4YB6A 4PDDA 3UN6A 4OVJA 4O8MA 2DS9A 2OWZA 1FQDA 1JW5A 3LSLA 3C4MA 4F18A 1TXFA 1PEBA 4RPOA 1LBVA 5I5PA 3D4CA 3Q27A 1B3LA 2FYIA 4N13A 2XWIA 4U1OA 3ZKKA 3IOVA 2WBDA 3FIRA 1FPFA 1EZOA 4GFRA 3TCHA 3R26A 1SBPA 4FE8A 3MQ9A 3N6TA 1MXVA 4WEPA 4OWDA 2Q88A 2E0SA 4XIGQ 2Y7IA 1H76A 3KOSA 1B5HA 1MY2A 3EHTA 4GBWA 4YU0A 4ELOA 1FQBA 2H25A 3G3GA 2FVZA 3SEYA 4NWCA 3PPOA 4JXIA 2P2AA 4IR8A 5LTCA 3PPQA 3N94A 3DRKA 3PMWA 3L6HA 2P1SA 3FXBA 2UYFA 4G4PA 1Q35A 1MM6A 2A5TA 4MMPA 5DVIA 5I56A 3EHUA 1MDQA 3C36A 3H3GA 3K6XA 2ZNUA 3IOWA 3CIJA 1OVTA 4GXSB 4OA4A 2Q89A 2VD2A 2XD2A 1QKBA 4IO2A 1N0TA 3K6UA 2UVJA 3RTWB 1B05A 2OCUA 4EF1A 1FPGA 4N17A 1BLFA 3CFZA 4FEDA 2O69A 3SEWA 4ELPA 1FPDA 1XI6A
chains in the Genus database with same CATH topology
3Q28A 4R73A 3I5OA 1QUJA 4NF5A 4BDOA 5ITPA 4JWYA 1LAGE 2AIXA 2F6GA 3C35A 1QUKA 2DOJA 3FJ7A 4R72A 4GWOA 4NTLA 3MVZA 5TPAA 2R71A 3OO9A 4X9TA 1VFDA 2OWSA 3LSWA 1IXCA 1MXXA 4P11A 3DM0A 4JDFA 4ZEDA 3DRJA 5HPQA 3RUMA 1B3GA 3LR1A 4U1ZA 2F36A 3E9XA 3FD3A 4UACA 5CMCA 2H9BA 3ONMA 3FZVA 3PUZE 1FQCA 4MF3A 4AB5A 1P1WA 4YKPA 4GD5A 3SETA 4K3FA 5B7DA 5CBSA 2WOLA 2I0CA 2I48A 3LSXA 1B7ZA 3A3UA 3OENA 4GXAA 3Q29A 1M5FA 2ZXTA 3SKPA 3U92A 3IJXB 4POWA 1B1XA 1DTZA 1MXYA 2YJPA 2ZYKA 1USYH 4ZEIA 1N3WA 2DWAA 1B46A 2GFEA 3B6WA 3EHSA 4F3GA 1Y9UA 4LA9A 1SI1A 1B5IA 2XXWA 3C9HA 2IA4A 5ISUA 1OQGA 2RCBA 1B3FA 3QUJA 4XKPA 1CE2A 1H45A 4ZEKA 4IB2A 3AXFA 1B7UA 1UTHB 1MS7A 3PV0E 2D5WA 4RXLA 2F6PA 3PUYE 4IO5A 3IJOB 4H67A 3IB0A 4BDMA 1GV8A 3F11A 4LZ8A 5DT6A 2O51A 5ICTA 4Q30B 4HW8A 2XXXA 5DVFA 2VGQA 2OJTA 4RK9A 4ZS9A 1SW5A 3VLWA 1PBQA 1R6ZA 3H6UA 3FXRA 1Y4TA 1B7HA 5FHMA 3N6UA 3KEIA 4F1YA 4IGTA 3MBPA 3FJMA 3PUVE 5HBCA 1M5CA 1MXUA 3VXBA 4I8CA 1A8FA 3HO7A 1VR5A 3S2VA 4GOTA 3CHGA 2Q8JA 3TEPA 3UP9A 1OMPA 4NF5B 1ZTYA 4Q0CA 4RYAA 4QFLA 4O3CA 1I6BA 2QMWA 3VE1B 2IEEA 4ONYA 3TCFA 2ABHA 3IX1A 4ZZAA 3MAMA 5EYFA 2OZZA 2DVCA 4Q8RA 1MDP1 4OMBA 2Y7KA 3FJGA 4HCYA 4QF9A 4YICA 1NKXA 4IGRA 5AA3A 3RLFE 2I3VA 4PP0A 5DEXA 1Z7ME 1WVJA 3L6GA 2V93A 3O29A 1MRPA 3FV1A 3LUYA 1A99A 1UQWA 2CMOA 3RYBA 1A55A 2V3TA 1JEVA 1Y3NA 1SW4A 2XXYA 2XXPA 3K2DA 3MP1A 4GLIA 2NXOA 4O3BA 2D21A 2DE3A 3OO7A 3FVOA 1DPEA 2VHAA 3A3CA 4GVOA 5K2YA 4MH5A 4KYDA 2DXYA 2QS4A 3H7MA 2A5SA 2CZLA 1QUIA 2VD3A 2ZNSA 2RF1A 4O3AA 4P0IA 1PBPA 1F9BA 4LATA 3KN7A 5I2NB 4DLDA 1VSOA 2V84A 3HPIA 3LBSA 2G93A 4F19A 1EZ9A 4NMYA 3MVXA 3ODBA 5JTYA 5AA2A 3KSXA 1P1NA 3O97A 1N7WA 1UTBA 3MZ1A 1NH8A 1NNKA 5AA4A 3EN3A 3H6TA 4RY1A 2H4IA 2RCAA 4ZZEA 3G3IA 5I56B 3CI8A 5KDTA 1Q1KA 2DE2A 3O66A 2A5TB 4NWDA 2PVUA 3KZGA 1GTKA 5I58B 2Z23A 1IEJA 1LSTA 5L8DA 2REGA 2QJEA 1LFHA 1QKAA 1LLSA 1R9QA 1MY3A 1FTMA 2DWHA 2F7BA 3KSJA 1IITA 4GIZA 4Z0IA 1LFGA 3TMGA 3U94A 3H6WA 2OWTA 1SYHA 1D9YA 3C32A 1HSLA 1P1OA 2XX7A 2O1LA 1SDXA 3CG1A 5TP9B 3G3JA 5CMKA 4NF8B 2I6EA 5JEIA 3RT8A 5I59B 1EZPA 4OQOA 1JEUA 3VFJA 2REJA 4POXA 1DPPA 4H8JA 4OEVA 3CFXA 3C33A 3GZGA 3THIA 1WODA 2V3QA 3K01A 4NF6B 2PX1A 4IO3A 3CVGA 5JTYB 2DVZA 4QHQA 3TTRA 3VVFA 5KZTA 4KYSA 3KBRA 1EU8A 2F34A 2HAUA 3HV1A 1GGGA 4N07A 3WAEA 2Z22A 5AA4B 5I2KA 1T0KA 1MQGA 1XS5A 1P1UA 4G68A 4TQUQ 3MW0A 1MH4A 4YMAA 1XVYA 3FASA 3K6VA 1QVSA 5F7VA 1YCJA 4QFNA 1MY4A 2UVIA 4G77A 3SEXA 5I57B 4H1XA 1US5A 1OLCA 4JSDA 2KLFA 2QS2A 4YKIA 1JETA 1SQYA 3H6VA 4U22A 4NF8A 3TAJA 3PUWE 4KI0E 4WXJA 2RKMA 3FVGA 5KDTB 4OTEA 2HCAA 4LQ2A 1B4ZA 2PT1A 4HCWA 2ONKE 3SDFA 3RQTA 5DYHA 2XXUA 2NVUB 3USDA 4BDQA 5I57A 1A40A 4R75A 3TKDA 1XT8A 5L9MA 5I2NA 4FECA 1OQHA 2GH9A 2GHBA 3JV9A 3PUXE 4L17A 1P99A 1FQEA 2ZYMA 5IKBA 3PMXA 4U2RA 2UYEA 5A5XA 2R9JA 1AH5A 2F7AA 2HZLA 4H0WA 2O6AA 4YMBA 1FTOA 2RC7A 4DZ1A 3B6QA 5CM6A 5IAIA 2H5YA 3QSLA 2Q2AA 3O9PA 1II5A 3T96B 2OBGA 4DXCA 3IK6B 1MXZA 4OERA 5H8SA 2ZYOA 5DVJA 4YZZA 3UA8A 2BJJX 3FGSA 2Z8EA 3D4GA 3IOUA 3PU5A 4YB5A 4G8MA 5CMBA 3K00A 1POY1 5CC2A 4F22A 4PFWA 3CR9A 1A7LA 1PB8A 2I4CA 1OIBA 2PBWA 3B6TA 3BFTA 3T9VA 2HAVA 3FXQA 3R7XA 3QIMA 1TT1A 2QS1A 3K6WA 3M3FA 4M1VA 5H8NA 1I6AA 2R6GE 2F35A 2HZKA 2B4LA 1N7XA 4MFIA 4OXVA 3W15C 2ZMBA 1N84A 3IL1B 3T9HB 3TODA 3U1OA 4ZDMA 3CG3A 5AA1A 3TELA 3ECRA 3M8UA 2DWIA 4ZECA 4PQJA 1UIUA 5F1QA 3DP8A 3HCQA 5CRYA 3KJ7A 4H5FA 4YKKA 4EQ9A 5I2KB 1LGBC 2V3UA 4C1UA 3QYTA 2DP8A 4H8IA 3DP6A 5HM4B 3IB1A 4FIMA 2F8DA 3K1MA 1ZU0A 4I62A 1ZLQA 1NNFA 2XXVA 1SVXB 2F7CA 3JZJA 4KCDA 5M2VA 2WOKA 3TUSA 1FCKA 5FHOA 1TFAA 1VFEA 2ANJA 2O1MA 3DP4A 1LFIA 4Q5TA 2F5XA 1JVXA 3OO8A 2V25A 2DXRA 3KGCA 4G8HA 3RT6B 2DQVA 4XKQA 1QULA 2NOOA 4P0GA 3DRIA 1DTGA 1UTBB 4H6DA 3O6PA 1ZJLA 5FTIA 3TZAA 2QL3A 4NF6A 4E0XA 4OHNA 3V5AA 5ICQA 3OXNA 1I6QA 1SW2A 5H8NB 1R9LA 1UTHA 2NWJA 4XKRA 1AOVA 1IXGA 1WDNA 4G68C 3JYRA 5EHMA 3VLVA 1M5BA 3OEKA 4IO6A 3RN8A 3HSTA 4ND9A 1HSJA 2M8CA 4F39A 1S50A 1I69A 1B2HA 1Y4CA 3S9MC 2ESNA 2Z8FA 1BTJA 1DOTA 1MY1A 3MPLA 2B4MA 1D3KA 4G8NA 4MLVA 3IO6A 3U72A 3FVKA 3RGYA 4OFLA 3TQWA 3UGWA 1B51A 1ZBMA 3W9WA 5ELVA 2ZNTA 3O6IA 3VV5A 2XXQA 4TLMB 2I49A 4RJZA 3C31A 1H3DA 4QRZA 5TU0A 4C0RA 1B0LA 1J1NA 1NL5A 1XHYA 1B0HA 4OFOA 2Y84A 1LCTA 3IOTA 4GL0A 4TLLB 3HN0A 5FHNA 5H8QB 4F1UA 1JVYA 2PMSA 1LBCA 1M5EA 4NF4A 4EQ7A 1GVCA 3OO6A 4DDDA 5H8QA 2O7IA 3GBAA 5H8HB 1JNFA 3R6UA 2PYYA 3QXMA 1NNPA 4KD5A 5I58A 3PPPA 3S9NC 1H43A 2XXHA 4LZ5A 3G7WA 3TTLA 1NH7A 3A09A 2NUVA 3QUFA 2XX8A 4HS7A 5DEXB 5AA2D 2HFBA 2XXTA 2QS3A 4ESXA 2B65A 4R6YA 3IAZA 1B32A 4RNSA 3MZ9A 3U93A 1R1NA 3GLBA 4R74A 4YB7A 2Y7RA 5H8FB 1GR2A 4ZE9A 2AL4A 3EF7A 4KPTA 3UORA 2G29A 3OOAA 2DSFA 3PPRA 4NE4A 3ZSFA 5J1DA 4OZ9A 1RKMA 1DMBA 4X48A 1N04A 3OSQA 2QPQA 2X7QA 3LVUA 1HSEA 1AIVA 4F2OA 3M3KA 3CRBA 1B58A 5EHSA 3KN3A 4LP2B 3VLUA 4DIGA 4ECFA 5AA2B 3I6VA 1B5JA 2H99A 3TYHA 3MC2A 1YPNA 4X1BA 5L9OA 4JB7A 3TQLA 4DXBA 3OELA 4QFKA 3Q26A 3CSGA 4FAJA 2OK2A 3FATA 4GF8A 2I58A 3BFUA 1TFDA 3HHFA 3ILUB 1URSA 1B9JA 1B4HA 1Y20A 1LAXA 1MQHA 3P7IA 4QSEA 4JWXA 4U23A 5CBRA 2GRVA 3E13X 2F78A 3G3HA 2HQ0A 1EH3A 3G3KA 3DRGA 4FEBA 4U21A 1LBBA 4F3SA 2O84X 5A5XB 1B3HA 1N3XA 4WKMA 5KCJA 1QW0A 2I0BA 3Q25A 2QSXA 4GRKA 2I4BA 2UXAA 4PE5B 1MPCA 2THIA 3H06B 3VXCA 5KCJB 4IO7A 1IUDA 3BBRA 1BKAA 3FV2A 3KFMA 4OYVA 1JQFA 1Y3QA 1ANFA 2I3WA 3CFLA 3MUQA 3O6GA 4YKJA 3PD8A 4QSCA 2HXWA 2QRYA 4HTGA 4ISUA 3CSBA 1MPBA 3KG2A 4H5GA 3RPWA 2UVHA 3H4ZA 2B3FA 2FNCA 3IORA 2XX9A 4FJPA 1A54A 1VE4A 4GQOA 2X7PA 1PC3A 1MPDA 3PPNA 3SEVA 2XHDA 2O68A 4PETA 3UK4A 1MQIA 2PT2A 3DELB 1MQJA 3MP8A 3UIFA 4F1VA 1IXIA 1O63A 1RYXA 2Z8DA 3GBBA 4XXUA 4KCCA 5CI5A 4AB6A 3PAMA 2RC9A 4R9FA 1B3EA 4QFOA 3FTOA 2YPNA 4I9DA 1USYE 1MXWA 3RY3A 2DE4A 2VOZA 3IR1A 4LUBA 3VVEA 4EF2A 5CMMA 3K1NA 3H03A 1NNTA 1LB9A 1IXHA 3LC8A 3MPKA 1JW4A 1US4A 4F2QA 3MWBA 3T9XB 1M5DA 3HHGA 3OSRA 1Y3PA 4Z7EA 4BDNA 4EQBA 5FTHA 1FTKA 3FXUA 4LONB 4QFPA 5I84A 4YB6A 4GL8A 4EXKA 1XC1A 1SD3A 3PD9A 3KJTA 5AE4A 3ZS6A 3UN6A 4MBPA 4OVJA 4C1TA 1Z7NE 3K02A 3E3KA 3TFLA 3TTMA 1LAHE 2Y7PA 4E0WA 2DS9A 3TPAA 4X1DA 4TOZA 4R2FA 2QMXA 1FQDA 2H98A 4XTCQ 1ZMGA 3VDFA 3K4UA 1N76A 1SI0A 5ITOA 4N6PA 2DWJA 1JW5A 3LSLA 4U4XA 4DE8A 3C4MA 3FUZA 3O2AA 4JBZA 1BIYA 1TXFA 3QK6A 1B1HA 1KWHA 1PEBA 4F18A 4FORA 2LAOA 3ZKLA 4RPOA 4OEUA 2F97A 4RK2A 5H8HA 4IY5A 2Y7WA 3TTNA 3D4CA 3Q27A 3T9UA 1NFTA 1B3LA 4DCXA 4PFTA 1ATGA 2E1SA 3MVYA 2FYIA 2XXIA 3K1PA 4N13A 4U1OA 3RNNA 2XD3A 2AL5A 4BLAA 1URGA 3IOVA 3ZKKA 4PFUA 1MG1A 4KHZE 3FIRA 1Y1ZA 4LVQA 4H65A 3C34A 4ESWA 1JW1A 1EZOA 4GFRA 2HEUA 3TCHA 3R26A 1SBPA 3WAFA 1RYOA 1FTLA 3OEMA 1AL3A 1IQ7A 3MQ9A 4FE8A 3N6TA 1BP5A 4R9GA 1H44A 4ELQA 5L9SA 1MXVA 1Y1MA 3K0VA 1S9TA 4WEPA 5BWJA 4OWDA 1O64A 2Q88A 2YLNA 2E0SA 1IZ1A 3TTKA 4F29A 4DCYA 3FVNA 4R2BA 4XIGQ 1NMUA 4PFYA 1LB8A 1PB9A 2Q2CA 1MY0A 2ONSA 3E4RA 1POTA 3GXAA 4FATA 2DYXA 1L5TA 3MZBA 2Y7IA 1H76A 1B52A 1ELJA 3KOSA 3OMBA 1B5HA 1MY2A 1YAEA 3TDJA 1O7TA 3T93B 3EHTA 3MJNA 3W9VA 4YU0A 3RYAA 1FQBA 1UIVA 2H25A 3G3GA 4ELOA 3SEYA 4OETA 3ILTB 3S4UA 1YTVA 4ZE8A 3T66A 1ZIUA 4LZ7A 4NWCA 2XXRA 3PPOA 4KYEA 4JXIA 4R6KA 2P2AA 1MM7A 5DTBA 5TP9A 3T22A 4XKNA 3PGFA 3RTFB 4QSDA 4BDRA 4ELRA 1P1QA 3PPQA 5H8FA 5LOMA 4WEDA 1FQAA 3M3LA 4MLQA 4M4GA 1S7YA 5TPAB 1MH3A 4KR5A 3N94A 3DRKA 3DLNA 4UA8A 1XOCA 2WKYA 3DRFA 1D9VA 2B3BA 2ZYNA 2UVGA 3PMVA 3U8QA 4G2ZA 1PDAA 2P0SA 3PMWA 4EDPA 3L6HA 2P1SA 4YAHX 3EPEA 4U4SA 4OENA 1SYIA 3KN8A 2UYFA 3O6HA 4ZEBA 1SW1A 3N26A 4G4PA 4JWOA 3SERA 5JK4A 1Q35A 1IIWA 3SESA 1MM6A 2A5TA 4RPNA 5DVIA 4F3BA 4OESA 3VVDA 5I56A 4IO4A 3DRHA 4KFQA 3EHUA 1AMFA 4AQ4A 1MDQA 2W7YA 4EXLA 4JSOA 3C36A 3H3GA 3K6XA 2ZNUA 3EQ1A 1XVXA 5K2XA 4I1DA 3S9LC 2RINA 3N5LA 2D3IA 2Q9TA 2RC8A 3IOWA 4ZEFA 3CIJA 1OVTA 1A8EA 4GXSB 4F31B 1FTJA 5B70A 3V83A 3KOTA 4LQ5A 1ZKBA 1OLAA 2ALUA 2Q89A 2VD2A 2XD2A 3O28A 1QKBA 4NEDA 4THIA 3TCGA 3V89B 2X26A 3S9EA 4IO2A 4IY6A 4F3PA 1DSNA 1N0TA 3K6UA 2UVJA 3RTWB 5I59A 2GHAA 1B05A 2OCUA 3OD7A 3QAXA 3V8XB 1LCFA 4OFJA 1QJMA 4EF1A 4RA1A 3IB2A 4NF4B 4BDLA 2O7UA 2AYSA 3SEUA 4KQPA 2VP1A 1BLFA 1URDA 3CFZA 3MVWA 3BKIB 3G3FA 4FEDA 1PB7A 1MQDA 4R6HA 5BUUA 1CB6A 1FW0A 2WOPA 2ONRA 3I3VA 3IO4A 1B6HA 1D4NA 1TWYA 2OLBA 2O69A 3SEWA 4DXUA 4ELPA 3B7DA 2FA7A 4G68B 4EUOA 1LAFE 1B40A 3MP6A 3LSFB 1FQFA 1OVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q28 A;  4R73 A;  3I5O A;  1QUJ A;  4NF5 A;  4BDO A;  5ITP A;  4JWY A;  1LAG E;  2AIX A;  2F6G A;  3C35 A;  1QUK A;  2DOJ A;  3FJ7 A;  4R72 A;  4GWO A;  4NTL A;  3MVZ A;  5TPA A;  2R71 A;  3OO9 A;  4X9T A;  1VFD A;  2OWS A;  3LSW A;  1IXC A;  1MXX A;  4P11 A;  3DM0 A;  4JDF A;  4ZED A;  3DRJ A;  5HPQ A;  3RUM A;  1B3G A;  3LR1 A;  4U1Z A;  2F36 A;  3E9X A;  3FD3 A;  4UAC A;  5CMC A;  2H9B A;  3ONM A;  3FZV A;  3PUZ E;  1FQC A;  4MF3 A;  4AB5 A;  1P1W A;  4YKP A;  4GD5 A;  3SET A;  4K3F A;  5B7D A;  5CBS A;  2WOL A;  2I0C A;  2I48 A;  3LSX A;  1B7Z A;  3A3U A;  3OEN A;  4GXA A;  3Q29 A;  1M5F A;  2ZXT A;  3SKP A;  3U92 A;  3IJX B;  4POW A;  1B1X A;  1DTZ A;  1MXY A;  2YJP A;  2ZYK A;  1USY H;  4ZEI A;  1N3W A;  2DWA A;  1B46 A;  2GFE A;  3B6W A;  3EHS A;  4F3G A;  1Y9U A;  4LA9 A;  1SI1 A;  1B5I A;  2XXW A;  3C9H A;  2IA4 A;  5ISU A;  1OQG A;  2RCB A;  1B3F A;  3QUJ A;  4XKP A;  1CE2 A;  1H45 A;  4ZEK A;  4IB2 A;  3AXF A;  1B7U A;  1UTH B;  1MS7 A;  3PV0 E;  2D5W A;  4RXL A;  2F6P A;  3PUY E;  4IO5 A;  3IJO B;  4H67 A;  3IB0 A;  4BDM A;  1GV8 A;  3F11 A;  4LZ8 A;  5DT6 A;  2O51 A;  5ICT A;  4Q30 B;  4HW8 A;  2XXX A;  5DVF A;  2VGQ A;  2OJT A;  4RK9 A;  4ZS9 A;  1SW5 A;  3VLW A;  1PBQ A;  1R6Z A;  3H6U A;  3FXR A;  1Y4T A;  1B7H A;  5FHM A;  3N6U A;  3KEI A;  4F1Y A;  4IGT A;  3MBP A;  3FJM A;  3PUV E;  5HBC A;  1M5C A;  1MXU A;  3VXB A;  4I8C A;  1A8F A;  3HO7 A;  1VR5 A;  3S2V A;  4GOT A;  3CHG A;  2Q8J A;  3TEP A;  3UP9 A;  1OMP A;  4NF5 B;  1ZTY A;  4Q0C A;  4RYA A;  4QFL A;  4O3C A;  1I6B A;  2QMW A;  3VE1 B;  2IEE A;  4ONY A;  3TCF A;  2ABH A;  3IX1 A;  4ZZA A;  3MAM A;  5EYF A;  2OZZ A;  2DVC A;  4Q8R A;  1MDP 1;  4OMB A;  2Y7K A;  3FJG A;  4HCY A;  4QF9 A;  4YIC A;  1NKX A;  4IGR A;  5AA3 A;  3RLF E;  2I3V A;  4PP0 A;  5DEX A;  1Z7M E;  1WVJ A;  3L6G A;  2V93 A;  3O29 A;  1MRP A;  3FV1 A;  3LUY A;  1A99 A;  1UQW A;  2CMO A;  3RYB A;  1A55 A;  2V3T A;  1JEV A;  1Y3N A;  1SW4 A;  2XXY A;  2XXP A;  3K2D A;  3MP1 A;  4GLI A;  2NXO A;  4O3B A;  2D21 A;  2DE3 A;  3OO7 A;  3FVO A;  1DPE A;  2VHA A;  3A3C A;  4GVO A;  5K2Y A;  4MH5 A;  4KYD A;  2DXY A;  2QS4 A;  3H7M A;  2A5S A;  2CZL A;  1QUI A;  2VD3 A;  2ZNS A;  2RF1 A;  4O3A A;  4P0I A;  1PBP A;  1F9B A;  4LAT A;  3KN7 A;  5I2N B;  4DLD A;  1VSO A;  2V84 A;  3HPI A;  3LBS A;  2G93 A;  4F19 A;  1EZ9 A;  4NMY A;  3MVX A;  3ODB A;  5JTY A;  5AA2 A;  3KSX A;  1P1N A;  3O97 A;  1N7W A;  1UTB A;  3MZ1 A;  1NH8 A;  1NNK A;  5AA4 A;  3EN3 A;  3H6T A;  4RY1 A;  2H4I A;  2RCA A;  4ZZE A;  3G3I A;  5I56 B;  3CI8 A;  5KDT A;  1Q1K A;  2DE2 A;  3O66 A;  2A5T B;  4NWD A;  2PVU A;  3KZG A;  1GTK A;  5I58 B;  2Z23 A;  1IEJ A;  1LST A;  5L8D A;  2REG A;  2QJE A;  1LFH A;  1QKA A;  1LLS A;  1R9Q A;  1MY3 A;  1FTM A;  2DWH A;  2F7B A;  3KSJ A;  1IIT A;  4GIZ A;  4Z0I A;  1LFG A;  3TMG A;  3U94 A;  3H6W A;  2OWT A;  1SYH A;  1D9Y A;  3C32 A;  1HSL A;  1P1O A;  2XX7 A;  2O1L A;  1SDX A;  3CG1 A;  5TP9 B;  3G3J A;  5CMK A;  4NF8 B;  2I6E A;  5JEI A;  3RT8 A;  5I59 B;  1EZP A;  4OQO A;  1JEU A;  3VFJ A;  2REJ A;  4POX A;  1DPP A;  4H8J A;  4OEV A;  3CFX A;  3C33 A;  3GZG A;  3THI A;  1WOD A;  2V3Q A;  3K01 A;  4NF6 B;  2PX1 A;  4IO3 A;  3CVG A;  5JTY B;  2DVZ A;  4QHQ A;  3TTR A;  3VVF A;  5KZT A;  4KYS A;  3KBR A;  1EU8 A;  2F34 A;  2HAU A;  3HV1 A;  1GGG A;  4N07 A;  3WAE A;  2Z22 A;  5AA4 B;  5I2K A;  1T0K A;  1MQG A;  1XS5 A;  1P1U A;  4G68 A;  4TQU Q;  3MW0 A;  1MH4 A;  4YMA A;  1XVY A;  3FAS A;  3K6V A;  1QVS A;  5F7V A;  1YCJ A;  4QFN A;  1MY4 A;  2UVI A;  4G77 A;  3SEX A;  5I57 B;  4H1X A;  1US5 A;  1OLC A;  4JSD A;  2KLF A;  2QS2 A;  4YKI A;  1JET A;  1SQY A;  3H6V A;  4U22 A;  4NF8 A;  3TAJ A;  3PUW E;  4KI0 E;  4WXJ A;  2RKM A;  3FVG A;  5KDT B;  4OTE A;  2HCA A;  4LQ2 A;  1B4Z A;  2PT1 A;  4HCW A;  2ONK E;  3SDF A;  3RQT A;  5DYH A;  2XXU A;  2NVU B;  3USD A;  4BDQ A;  5I57 A;  1A40 A;  4R75 A;  3TKD A;  1XT8 A;  5L9M A;  5I2N A;  4FEC A;  1OQH A;  2GH9 A;  2GHB A;  3JV9 A;  3PUX E;  4L17 A;  1P99 A;  1FQE A;  2ZYM A;  5IKB A;  3PMX A;  4U2R A;  2UYE A;  5A5X A;  2R9J A;  1AH5 A;  2F7A A;  2HZL A;  4H0W A;  2O6A A;  4YMB A;  1FTO A;  2RC7 A;  4DZ1 A;  3B6Q A;  5CM6 A;  5IAI A;  2H5Y A;  3QSL A;  2Q2A A;  3O9P A;  1II5 A;  3T96 B;  2OBG A;  4DXC A;  3IK6 B;  1MXZ A;  4OER A;  5H8S A;  2ZYO A;  5DVJ A;  4YZZ A;  3UA8 A;  2BJJ X;  3FGS A;  2Z8E A;  3D4G A;  3IOU A;  3PU5 A;  4YB5 A;  4G8M A;  5CMB A;  3K00 A;  1POY 1;  5CC2 A;  4F22 A;  4PFW A;  3CR9 A;  1A7L A;  1PB8 A;  2I4C A;  1OIB A;  2PBW A;  3B6T A;  3BFT A;  3T9V A;  2HAV A;  3FXQ A;  3R7X A;  3QIM A;  1TT1 A;  2QS1 A;  3K6W A;  3M3F A;  4M1V A;  5H8N A;  1I6A A;  2R6G E;  2F35 A;  2HZK A;  2B4L A;  1N7X A;  4MFI A;  4OXV A;  3W15 C;  2ZMB A;  1N84 A;  3IL1 B;  3T9H B;  3TOD A;  3U1O A;  4ZDM A;  3CG3 A;  5AA1 A;  3TEL A;  3ECR A;  3M8U A;  2DWI A;  4ZEC A;  4PQJ A;  1UIU A;  5F1Q A;  3DP8 A;  3HCQ A;  5CRY A;  3KJ7 A;  4H5F A;  4YKK A;  4EQ9 A;  5I2K B;  1LGB C;  2V3U A;  4C1U A;  3QYT A;  2DP8 A;  4H8I A;  3DP6 A;  5HM4 B;  3IB1 A;  4FIM A;  2F8D A;  3K1M A;  1ZU0 A;  4I62 A;  1ZLQ A;  1NNF A;  2XXV A;  1SVX B;  2F7C A;  3JZJ A;  4KCD A;  5M2V A;  2WOK A;  3TUS A;  1FCK A;  5FHO A;  1TFA A;  1VFE A;  2ANJ A;  2O1M A;  3DP4 A;  1LFI A;  4Q5T A;  2F5X A;  1JVX A;  3OO8 A;  2V25 A;  2DXR A;  3KGC A;  4G8H A;  3RT6 B;  2DQV A;  4XKQ A;  1QUL A;  2NOO A;  4P0G A;  3DRI A;  1DTG A;  1UTB B;  4H6D A;  3O6P A;  1ZJL A;  5FTI A;  3TZA A;  2QL3 A;  4NF6 A;  4E0X A;  4OHN A;  3V5A A;  5ICQ A;  3OXN A;  1I6Q A;  1SW2 A;  5H8N B;  1R9L A;  1UTH A;  2NWJ A;  4XKR A;  1AOV A;  1IXG A;  1WDN A;  4G68 C;  3JYR A;  5EHM A;  3VLV A;  1M5B A;  3OEK A;  4IO6 A;  3RN8 A;  3HST A;  4ND9 A;  1HSJ A;  2M8C A;  4F39 A;  1S50 A;  1I69 A;  1B2H A;  1Y4C A;  3S9M C;  2ESN A;  2Z8F A;  1BTJ A;  1DOT A;  1MY1 A;  3MPL A;  2B4M A;  1D3K A;  4G8N A;  4MLV A;  3IO6 A;  3U72 A;  3FVK A;  3RGY A;  4OFL A;  3TQW A;  3UGW A;  1B51 A;  1ZBM A;  3W9W A;  5ELV A;  2ZNT A;  3O6I A;  3VV5 A;  2XXQ A;  4TLM B;  2I49 A;  4RJZ A;  3C31 A;  1H3D A;  4QRZ A;  5TU0 A;  4C0R A;  1B0L A;  1J1N A;  1NL5 A;  1XHY A;  1B0H A;  4OFO A;  2Y84 A;  1LCT A;  3IOT A;  4GL0 A;  4TLL B;  3HN0 A;  5FHN A;  5H8Q B;  4F1U A;  1JVY A;  2PMS A;  1LBC A;  1M5E A;  4NF4 A;  4EQ7 A;  1GVC A;  3OO6 A;  4DDD A;  5H8Q A;  2O7I A;  3GBA A;  5H8H B;  1JNF A;  3R6U A;  2PYY A;  3QXM A;  1NNP A;  4KD5 A;  5I58 A;  3PPP A;  3S9N C;  1H43 A;  2XXH A;  4LZ5 A;  3G7W A;  3TTL A;  1NH7 A;  3A09 A;  2NUV A;  3QUF A;  2XX8 A;  4HS7 A;  5DEX B;  5AA2 D;  2HFB A;  2XXT A;  2QS3 A;  4ESX A;  2B65 A;  4R6Y A;  3IAZ A;  1B32 A;  4RNS A;  3MZ9 A;  3U93 A;  1R1N A;  3GLB A;  4R74 A;  4YB7 A;  2Y7R A;  5H8F B;  1GR2 A;  4ZE9 A;  2AL4 A;  3EF7 A;  4KPT A;  3UOR A;  2G29 A;  3OOA A;  2DSF A;  3PPR A;  4NE4 A;  3ZSF A;  5J1D A;  4OZ9 A;  1RKM A;  1DMB A;  4X48 A;  1N04 A;  3OSQ A;  2QPQ A;  2X7Q A;  3LVU A;  1HSE A;  1AIV A;  4F2O A;  3M3K A;  3CRB A;  1B58 A;  5EHS A;  3KN3 A;  4LP2 B;  3VLU A;  4DIG A;  4ECF A;  5AA2 B;  3I6V A;  1B5J A;  2H99 A;  3TYH A;  3MC2 A;  1YPN A;  4X1B A;  5L9O A;  4JB7 A;  3TQL A;  4DXB A;  3OEL A;  4QFK A;  3Q26 A;  3CSG A;  4FAJ A;  2OK2 A;  3FAT A;  4GF8 A;  2I58 A;  3BFU A;  1TFD A;  3HHF A;  3ILU B;  1URS A;  1B9J A;  1B4H A;  1Y20 A;  1LAX A;  1MQH A;  3P7I A;  4QSE A;  4JWX A;  4U23 A;  5CBR A;  2GRV A;  3E13 X;  2F78 A;  3G3H A;  2HQ0 A;  1EH3 A;  3G3K A;  3DRG A;  4FEB A;  4U21 A;  1LBB A;  4F3S A;  2O84 X;  5A5X B;  1B3H A;  1N3X A;  4WKM A;  5KCJ A;  1QW0 A;  2I0B A;  3Q25 A;  2QSX A;  4GRK A;  2I4B A;  2UXA A;  4PE5 B;  1MPC A;  2THI A;  3H06 B;  3VXC A;  5KCJ B;  4IO7 A;  1IUD A;  3BBR A;  1BKA A;  3FV2 A;  3KFM A;  4OYV A;  1JQF A;  1Y3Q A;  1ANF A;  2I3W A;  3CFL A;  3MUQ A;  3O6G A;  4YKJ A;  3PD8 A;  4QSC A;  2HXW A;  2QRY A;  4HTG A;  4ISU A;  3CSB A;  1MPB A;  3KG2 A;  4H5G A;  3RPW A;  2UVH A;  3H4Z A;  2B3F A;  2FNC A;  3IOR A;  2XX9 A;  4FJP A;  1A54 A;  1VE4 A;  4GQO A;  2X7P A;  1PC3 A;  1MPD A;  3PPN A;  3SEV A;  2XHD A;  2O68 A;  4PET A;  3UK4 A;  1MQI A;  2PT2 A;  3DEL B;  1MQJ A;  3MP8 A;  3UIF A;  4F1V A;  1IXI A;  1O63 A;  1RYX A;  2Z8D A;  3GBB A;  4XXU A;  4KCC A;  5CI5 A;  4AB6 A;  3PAM A;  2RC9 A;  4R9F A;  1B3E A;  4QFO A;  3FTO A;  2YPN A;  4I9D A;  1USY E;  1MXW A;  3RY3 A;  2DE4 A;  2VOZ A;  3IR1 A;  4LUB A;  3VVE A;  4EF2 A;  5CMM A;  3K1N A;  3H03 A;  1NNT A;  1LB9 A;  1IXH A;  3LC8 A;  3MPK A;  1JW4 A;  1US4 A;  4F2Q A;  3MWB A;  3T9X B;  1M5D A;  3HHG A;  3OSR A;  1Y3P A;  4Z7E A;  4BDN A;  4EQB A;  5FTH A;  1FTK A;  3FXU A;  4LON B;  4QFP A;  5I84 A;  4YB6 A;  4GL8 A;  4EXK A;  1XC1 A;  1SD3 A;  3PD9 A;  3KJT A;  5AE4 A;  3ZS6 A;  3UN6 A;  4MBP A;  4OVJ A;  4C1T A;  1Z7N E;  3K02 A;  3E3K A;  3TFL A;  3TTM A;  1LAH E;  2Y7P A;  4E0W A;  2DS9 A;  3TPA A;  4X1D A;  4TOZ A;  4R2F A;  2QMX A;  1FQD A;  2H98 A;  4XTC Q;  1ZMG A;  3VDF A;  3K4U A;  1N76 A;  1SI0 A;  5ITO A;  4N6P A;  2DWJ A;  1JW5 A;  3LSL A;  4U4X A;  4DE8 A;  3C4M A;  3FUZ A;  3O2A A;  4JBZ A;  1BIY A;  1TXF A;  3QK6 A;  1B1H A;  1KWH A;  1PEB A;  4F18 A;  4FOR A;  2LAO A;  3ZKL A;  4RPO A;  4OEU A;  2F97 A;  4RK2 A;  5H8H A;  4IY5 A;  2Y7W A;  3TTN A;  3D4C A;  3Q27 A;  3T9U A;  1NFT A;  1B3L A;  4DCX A;  4PFT A;  1ATG A;  2E1S A;  3MVY A;  2FYI A;  2XXI A;  3K1P A;  4N13 A;  4U1O A;  3RNN A;  2XD3 A;  2AL5 A;  4BLA A;  1URG A;  3IOV A;  3ZKK A;  4PFU A;  1MG1 A;  4KHZ E;  3FIR A;  1Y1Z A;  4LVQ A;  4H65 A;  3C34 A;  4ESW A;  1JW1 A;  1EZO A;  4GFR A;  2HEU A;  3TCH A;  3R26 A;  1SBP A;  3WAF A;  1RYO A;  1FTL A;  3OEM A;  1AL3 A;  1IQ7 A;  3MQ9 A;  4FE8 A;  3N6T A;  1BP5 A;  4R9G A;  1H44 A;  4ELQ A;  5L9S A;  1MXV A;  1Y1M A;  3K0V A;  1S9T A;  4WEP A;  5BWJ A;  4OWD A;  1O64 A;  2Q88 A;  2YLN A;  2E0S A;  1IZ1 A;  3TTK A;  4F29 A;  4DCY A;  3FVN A;  4R2B A;  4XIG Q;  1NMU A;  4PFY A;  1LB8 A;  1PB9 A;  2Q2C A;  1MY0 A;  2ONS A;  3E4R A;  1POT A;  3GXA A;  4FAT A;  2DYX A;  1L5T A;  3MZB A;  2Y7I A;  1H76 A;  1B52 A;  1ELJ A;  3KOS A;  3OMB A;  1B5H A;  1MY2 A;  1YAE A;  3TDJ A;  1O7T A;  3T93 B;  3EHT A;  3MJN A;  3W9V A;  4YU0 A;  3RYA A;  1FQB A;  1UIV A;  2H25 A;  3G3G A;  4ELO A;  3SEY A;  4OET A;  3ILT B;  3S4U A;  1YTV A;  4ZE8 A;  3T66 A;  1ZIU A;  4LZ7 A;  4NWC A;  2XXR A;  3PPO A;  4KYE A;  4JXI A;  4R6K A;  2P2A A;  1MM7 A;  5DTB A;  5TP9 A;  3T22 A;  4XKN A;  3PGF A;  3RTF B;  4QSD A;  4BDR A;  4ELR A;  1P1Q A;  3PPQ A;  5H8F A;  5LOM A;  4WED A;  1FQA A;  3M3L A;  4MLQ A;  4M4G A;  1S7Y A;  5TPA B;  1MH3 A;  4KR5 A;  3N94 A;  3DRK A;  3DLN A;  4UA8 A;  1XOC A;  2WKY A;  3DRF A;  1D9V A;  2B3B A;  2ZYN A;  2UVG A;  3PMV A;  3U8Q A;  4G2Z A;  1PDA A;  2P0S A;  3PMW A;  4EDP A;  3L6H A;  2P1S A;  4YAH X;  3EPE A;  4U4S A;  4OEN A;  1SYI A;  3KN8 A;  2UYF A;  3O6H A;  4ZEB A;  1SW1 A;  3N26 A;  4G4P A;  4JWO A;  3SER A;  5JK4 A;  1Q35 A;  1IIW A;  3SES A;  1MM6 A;  2A5T A;  4RPN A;  5DVI A;  4F3B A;  4OES A;  3VVD A;  5I56 A;  4IO4 A;  3DRH A;  4KFQ A;  3EHU A;  1AMF A;  4AQ4 A;  1MDQ A;  2W7Y A;  4EXL A;  4JSO A;  3C36 A;  3H3G A;  3K6X A;  2ZNU A;  3EQ1 A;  1XVX A;  5K2X A;  4I1D A;  3S9L C;  2RIN A;  3N5L A;  2D3I A;  2Q9T A;  2RC8 A;  3IOW A;  4ZEF A;  3CIJ A;  1OVT A;  1A8E A;  4GXS B;  4F31 B;  1FTJ A;  5B70 A;  3V83 A;  3KOT A;  4LQ5 A;  1ZKB A;  1OLA A;  2ALU A;  2Q89 A;  2VD2 A;  2XD2 A;  3O28 A;  1QKB A;  4NED A;  4THI A;  3TCG A;  3V89 B;  2X26 A;  3S9E A;  4IO2 A;  4IY6 A;  4F3P A;  1DSN A;  1N0T A;  3K6U A;  2UVJ A;  3RTW B;  5I59 A;  2GHA A;  1B05 A;  2OCU A;  3OD7 A;  3QAX A;  3V8X B;  1LCF A;  4OFJ A;  1QJM A;  4EF1 A;  4RA1 A;  3IB2 A;  4NF4 B;  4BDL A;  2O7U A;  2AYS A;  3SEU A;  4KQP A;  2VP1 A;  1BLF A;  1URD A;  3CFZ A;  3MVW A;  3BKI B;  3G3F A;  4FED A;  1PB7 A;  1MQD A;  4R6H A;  5BUU A;  1CB6 A;  1FW0 A;  2WOP A;  2ONR A;  3I3V A;  3IO4 A;  1B6H A;  1D4N A;  1TWY A;  2OLB A;  2O69 A;  3SEW A;  4DXU A;  4ELP A;  3B7D A;  2FA7 A;  4G68 B;  4EUO A;  1LAF E;  1B40 A;  3MP6 A;  3LSF B;  1FQF A;  1OVB A; 
#chains in the Genus database with same CATH topology
 1LAG E;  3C35 A;  1QUK A;  1FPK A;  1IMD A;  5TPA A;  2F3D A;  3LR1 A;  2F36 A;  4UAC A;  1EYJ A;  3FZV A;  1FQC A;  4MF3 A;  4AB5 A;  3A3U A;  1M5F A;  3U92 A;  4POW A;  1MXY A;  4ZEI A;  1N3W A;  2DWA A;  4F3G A;  2GFE A;  2XXW A;  1B3F A;  4XKP A;  1YZ0 A;  1FBP A;  3AXF A;  3PV0 E;  1UTH B;  2D5W A;  4BDM A;  5DT6 A;  4Q30 B;  4HW8 A;  1Y4T A;  1B7H A;  2XA5 A;  3N6U A;  4IGT A;  3MBP A;  3FJM A;  1M5C A;  3MYU A;  1A8F A;  3HO7 A;  1VR5 A;  4GOT A;  1FBC A;  1OMP A;  1ZTY A;  3VE1 B;  2OZZ A;  4OMB A;  2Y7K A;  4HCY A;  3RLF E;  2I3V A;  3PTY A;  1Z7M E;  4HXV A;  1UQW A;  4N15 A;  2V3T A;  1Y3N A;  1SW4 A;  3K2D A;  3MP1 A;  2NXO A;  4NN3 A;  2VHA A;  4GVO A;  2DXY A;  4AS4 A;  2A5S A;  1QUI A;  2RF1 A;  4P0I A;  1PBP A;  1F9B A;  5I2N B;  4OVR A;  4DLD A;  2G93 A;  1EZ9 A;  4PC9 A;  3MVX A;  3ODB A;  1INP A;  1N7W A;  3H6T A;  4NWD A;  4NX1 A;  3KZG A;  2ZZW A;  1IEJ A;  1LST A;  5L8D A;  2WYK A;  1LFH A;  1QKA A;  4Z7E A;  1MY3 A;  2F7B A;  3KSJ A;  4Z0I A;  5BUU A;  2OWT A;  1D9Y A;  3C32 A;  1SDX A;  4NF8 B;  2I6E A;  3RT8 A;  1EZP A;  1JEU A;  1RDY A;  4OEV A;  3GZG A;  2V3Q A;  2PX1 A;  3CVG A;  2DVZ A;  1BK4 A;  3TTR A;  3VVF A;  4KYS A;  4MEV A;  2HAU A;  5I2K A;  4N07 A;  4I40 A;  2Z22 A;  3T0J A;  1P1U A;  2QVU A;  4G68 A;  1MH4 A;  1XVY A;  3K6V A;  1MY4 A;  4G77 A;  4H1X A;  1US5 A;  4YKI A;  1JET A;  4WXJ A;  3FVG A;  3BIH A;  4OTE A;  2ONK E;  2XXU A;  3USD A;  5L9M A;  2F7A A;  4H46 A;  1FTO A;  5IAI A;  2H5Y A;  2Q2A A;  4DXC A;  3IK6 B;  4YZZ A;  4GWW A;  3PU5 A;  3IOU A;  4YB5 A;  4G8M A;  4F22 A;  4PFW A;  2I4C A;  1D9Q A;  1OIB A;  3BFT A;  4NF0 A;  3QIM A;  3K6W A;  3M3F A;  2R6G E;  2F35 A;  3W15 C;  3IL1 B;  2ZZV A;  2DWI A;  4PQJ A;  4ZEC A;  3HCQ A;  4H5F A;  4EQ9 A;  5I2K B;  1LGB C;  4C1U A;  4H8I A;  4FIM A;  3IB1 A;  3K1M A;  1NNF A;  5M2V A;  2WOK A;  1VFE A;  4Q5T A;  4N81 A;  2F5X A;  3KGC A;  4G8H A;  2DQV A;  4XKQ A;  1QUL A;  1UTB B;  1ZJL A;  2QL3 A;  5H8N B;  5EHM A;  4P47 A;  1S50 A;  1Y4C A;  4LN5 A;  3S9M C;  3FVK A;  4OFL A;  3UGW A;  1ZBM A;  2ZNT A;  2XXQ A;  2I49 A;  3C31 A;  1H3D A;  5EQ8 A;  5TU0 A;  4NF6 A;  1XHY A;  4TLL B;  1L5T A;  5I2N A;  5H8Q B;  1M5E A;  1FRP A;  5I58 A;  3QUF A;  2NUV A;  1FPL A;  2QS3 A;  4RNS A;  3T1B A;  3EF7 A;  4DI4 B;  4GX4 A;  3OOA A;  5J1D A;  4X48 A;  1RDX A;  3CRB A;  3VLU A;  5AA2 B;  1KZ8 A;  5ET6 A;  4N6D A;  3A29 A;  4G61 A;  3U65 A;  4DXB A;  3BFU A;  3ILU B;  4QSE A;  3E13 X;  2F78 A;  3G3H A;  2HQ0 A;  4FEB A;  3DRG A;  5A5X B;  2O84 X;  5KCJ A;  2QSX A;  2UXA A;  4PE5 B;  1MPC A;  3VXC A;  5KCJ B;  3KFM A;  2CEY A;  1Y3Q A;  2I3W A;  3O6G A;  3CFL A;  2HXW A;  3MST A;  2QRY A;  4ISU A;  3CSB A;  3H4Z A;  5EYH A;  3SEV A;  1MPD A;  2XHD A;  3DEL B;  3UIF A;  3MP8 A;  1RYX A;  1K9Z A;  4XXU A;  4KCC A;  1G0H A;  4LUB A;  3VVE A;  2DE4 A;  1LB9 A;  3LC8 A;  1JW4 A;  3HHG A;  5ET7 A;  4N8G A;  5I84 A;  4GL8 A;  3PD9 A;  3ZS6 A;  5IZ1 A;  3E3K A;  3TTM A;  3TPA A;  2QMX A;  2H98 A;  4XTC Q;  1ZMG A;  4GBV A;  5ITO A;  4N6P A;  4PGN A;  4U4X A;  2Q74 A;  2LAO A;  2F97 A;  2Y5L A;  1LBY A;  3KBZ A;  4DCX A;  2E1S A;  3SEX A;  3MVY A;  5I57 B;  2AL5 A;  1IMB A;  4ESW A;  1RYO A;  1NV4 A;  3OEM A;  4R9G A;  1IQ7 A;  1BP5 A;  1H44 A;  4ELQ A;  3K0V A;  5BWJ A;  5ET8 A;  3TTK A;  4F29 A;  4DCY A;  1PB9 A;  2Y5K A;  4FAT A;  1B52 A;  1YAE A;  3T93 B;  3S4U A;  1YTV A;  4LZ7 A;  2XXR A;  4QSD A;  5H8F A;  4WED A;  3M3L A;  1S7Y A;  2WKY A;  1D9V A;  2B3B A;  2UVG A;  3U8Q A;  4G2Z A;  4JWO A;  1SW1 A;  5JK4 A;  4RPN A;  4F3B A;  4IO4 A;  3DRH A;  4JSO A;  3EQ1 A;  3S9L C;  2D3I A;  2RC8 A;  2MKZ A;  1ZKB A;  3O28 A;  3V89 B;  3S9E A;  4IY6 A;  4F3P A;  5I59 A;  1LCF A;  3IB2 A;  2VPO A;  2PFZ A;  1PB7 A;  1MQD A;  2ONR A;  3IO4 A;  1B6H A;  1LAF E;  5LDZ A;  4RK2 A;  3LSF B;  4QHQ A;  1OVB A;  4R73 A;  4NF5 A;  4BDO A;  4JWY A;  3FJ7 A;  3MVZ A;  4X9T A;  1VFD A;  2KQZ A;  2OWS A;  2Q8M A;  3DRJ A;  5HPQ A;  3RUM A;  1B3G A;  3FD3 A;  4PAK A;  1P1W A;  4GD5 A;  3LSX A;  1B7Z A;  1AWB A;  4N6K A;  2YJP A;  3EHS A;  1USY H;  5EQA A;  4P56 A;  1Y9U A;  4LA9 A;  1SI1 A;  1B5I A;  4I3E A;  1NUZ A;  1FJ9 A;  1CE2 A;  4ZEK A;  3PUY E;  2FBP A;  3F11 A;  4LZ8 A;  1KA0 A;  2XXX A;  4RK9 A;  3H6U A;  1FSA A;  4GWS A;  2DDK A;  4JVI A;  4I8C A;  4MNI A;  4Q0C A;  4NF5 B;  1IME A;  4YIC A;  4IGR A;  5DEX A;  4XF5 A;  3LUY A;  1A99 A;  3R7X A;  4M1V A;  4PGP A;  1A55 A;  4O3B A;  2D21 A;  3OO7 A;  3A3C A;  5K2Y A;  4MH5 A;  4PAI A;  5F24 A;  2QS4 A;  2ZNS A;  4O3A A;  1VSO A;  2V84 A;  3LBS A;  4F19 A;  4NMY A;  3MZ1 A;  1UTB A;  1NNK A;  3IFA A;  4MNP A;  3EN3 A;  5AA4 A;  4RY1 A;  2H4I A;  4ZZE A;  3G3I A;  3CI8 A;  2DE2 A;  3KC0 A;  1LLS A;  1FTM A;  4GIZ A;  1SYH A;  2XX7 A;  3RPL B;  2O1L A;  1FPI A;  3CG1 A;  4P3L A;  5TP9 B;  5JEI A;  5I59 B;  2JJK A;  4H8J A;  1WOD A;  5JTY B;  4N4U A;  1SPI A;  1EU8 A;  2F34 A;  5AA4 B;  3WAE A;  1MQG A;  1IMC A;  4PDH A;  3MW0 A;  5F7V A;  1QVS A;  2UVI A;  2QS2 A;  1SQY A;  4PFB A;  3H6V A;  3TAJ A;  3PUW E;  4QBA A;  4FBP A;  4LQ2 A;  1B4Z A;  3TKD A;  4MAG A;  3NOH A;  2GH9 A;  3JV9 A;  4L17 A;  1P99 A;  2ZYM A;  5EQ9 A;  3PMX A;  5I7I A;  2R9J A;  1AH5 A;  2RC7 A;  4DZ1 A;  3QSL A;  3O9P A;  3T96 B;  5H8S A;  3UA8 A;  3D4G A;  5CMB A;  1POY 1;  4MHF A;  2PBW A;  3T9V A;  4PF6 A;  1TT1 A;  5H8N A;  3LV0 A;  2B4L A;  3T9H B;  1DK4 A;  5AA1 A;  3ECR A;  1UIU A;  3DP8 A;  2P3N A;  3QYT A;  4I62 A;  2DP8 A;  2WBB A;  2F7C A;  3TUS A;  2O1M A;  2CZI A;  1JVX A;  3RT6 B;  2DXR A;  3O6P A;  4E0X A;  3V5A A;  1SW2 A;  1UTH A;  2NWJ A;  1WDN A;  4G68 C;  2M8C A;  4JVD A;  1I69 A;  2Z8F A;  3MPL A;  4G8N A;  3U72 A;  1DCU A;  4X04 A;  3VV5 A;  1B0L A;  2Y84 A;  1B0H A;  3IOT A;  4GL0 A;  4GWX A;  2PMS A;  4NF4 A;  4EQ7 A;  3GBA A;  3TTL A;  4HS7 A;  4ESX A;  2XXT A;  4MNC A;  1R1N A;  3GLB A;  4R74 A;  1GR2 A;  4ZE9 A;  2AL4 A;  3UOR A;  2G29 A;  4NE4 A;  2DSF A;  3ZSF A;  1RKM A;  3OSQ A;  4F2O A;  1B58 A;  1NV3 A;  3KN3 A;  4LP2 B;  4O94 A;  3I6V A;  1B5J A;  2H99 A;  3TYH A;  1YPN A;  1B40 A;  5L9O A;  4GWU A;  3CSG A;  2OK2 A;  4GF8 A;  1B9J A;  1B4H A;  4U23 A;  1MQH A;  5CBR A;  4JWX A;  2GRV A;  1FBD A;  1N3X A;  2THI A;  2OX3 A;  4IO7 A;  4QSC A;  3RPW A;  4NGU A;  2B3F A;  3IOR A;  4FJP A;  4GQO A;  2X7P A;  4GX6 A;  1MQJ A;  3GBB A;  1JP4 A;  3PAM A;  4I9D A;  3FBP A;  1USY E;  1MXW A;  4EF2 A;  5CMM A;  1NNT A;  3MPK A;  4P8B A;  5FTH A;  1FTK A;  4EXK A;  1SD3 A;  5AE4 A;  3KJT A;  4C1T A;  3K02 A;  1LAH E;  2Y7P A;  4E0W A;  4TOZ A;  3GYY A;  4R2F A;  3KC1 A;  3K4U A;  1N76 A;  2F3B A;  4DE8 A;  4PBH A;  3O2A A;  1KWH A;  5ET5 A;  4OEU A;  4O7I A;  4IY5 A;  2Y7W A;  3TTN A;  3T9U A;  4PFT A;  1ATG A;  4BLA A;  2XD3 A;  4PFU A;  1MG1 A;  2R8T A;  4H65 A;  4P1L A;  2HEU A;  4O7M A;  1FTL A;  4NHB A;  3B50 A;  2YLN A;  1IZ1 A;  3FVN A;  4PFY A;  1LB8 A;  2Q2C A;  1MY0 A;  3E4R A;  4HE0 A;  1ELJ A;  3OMB A;  1NV6 A;  3MJN A;  1UIV A;  1DBZ A;  4OET A;  3ILT B;  4ZE8 A;  3T66 A;  5TP9 A;  4KYE A;  4R6K A;  3T22 A;  4ELR A;  5TPA B;  1MH3 A;  4KR5 A;  3DLN A;  4PFI A;  1XOC A;  3DRF A;  3PMV A;  1NV2 A;  2P0S A;  4OVT A;  4YAH X;  5J16 A;  4U4S A;  4OEN A;  3KN8 A;  3SER A;  4AQ4 A;  2W7Y A;  4EXL A;  5K2X A;  4I1D A;  2RIN A;  3N5L A;  4ZEF A;  4F31 B;  1FTJ A;  5B70 A;  5IM2 A;  4THI A;  3TCG A;  1DSN A;  2GHA A;  3OD7 A;  4OFJ A;  4NF4 B;  4BDL A;  2O7U A;  2AYS A;  1EYK A;  3SEU A;  4KQP A;  2VP1 A;  3WAF A;  3G3F A;  3MVW A;  1FW0 A;  3I3V A;  2PFY A;  1D4N A;  2OLB A;  4DXU A;  1FTA A;  2FA7 A;  4G68 B;  3MP6 A;  2DE3 A;  3I5O A;  1QUJ A;  1K9Y A;  2AIX A;  2F6G A;  2QFL A;  5T3J A;  4R72 A;  2L5V A;  2R71 A;  3OO9 A;  3LSW A;  1IXC A;  1MXX A;  3DM0 A;  4ZED A;  2CEX A;  3E9X A;  5CMC A;  2H9B A;  5B7D A;  4K3F A;  2WOL A;  2I0C A;  3D1R A;  1Q9D A;  4GXA A;  3Q29 A;  2ZXT A;  3SKP A;  1LEV A;  3IJX B;  2ZYK A;  4H45 A;  1NV1 A;  1NV7 A;  3C9H A;  1OQG A;  2RCB A;  1H45 A;  3E79 A;  3IJO B;  3IB0 A;  2VGQ A;  4ZS9 A;  1SW5 A;  3VLW A;  1PBQ A;  1R6Z A;  3FXR A;  3KEI A;  1RDZ A;  3CHG A;  3UP9 A;  4RYA A;  3IFC A;  4O3C A;  1I6B A;  4ONY A;  3TCF A;  3IX1 A;  3MAM A;  4MJO A;  4Q8R A;  3FJG A;  4QF9 A;  1NKX A;  4PP0 A;  3O29 A;  1FBH A;  5DW8 A;  2XXY A;  2XXP A;  1DPE A;  2HXR A;  3SES A;  3TEL A;  5JTY A;  1P1N A;  3O97 A;  4PCD A;  5I56 B;  5KDT A;  1Q1K A;  3O66 A;  2A5T B;  5EYG A;  5I58 B;  2REG A;  3RPL A;  2QJE A;  2DWH A;  3TMG A;  1IIT A;  1NV5 A;  3H6W A;  1HSL A;  1P1O A;  3G3J A;  5CMK A;  4OQO A;  3VFJ A;  4POX A;  4HE1 A;  3K01 A;  4IO3 A;  2P3V A;  5KZT A;  1LBZ A;  1T0K A;  1NUX A;  4X8R A;  3FAS A;  2WEF A;  1OLC A;  4U22 A;  4NF8 A;  1QGX A;  2RKM A;  3LUZ A;  2HCA A;  5DYH A;  4BDQ A;  5I57 A;  1A40 A;  1XT8 A;  4OVP A;  3PUX E;  5IKB A;  4U2R A;  2UYE A;  4H0W A;  2O6A A;  5CM6 A;  1II5 A;  2OBG A;  1MXZ A;  4OER A;  3ROJ A;  5DVJ A;  2BJJ X;  2Z8E A;  4GWZ A;  5CC2 A;  3CR9 A;  1A7L A;  1PB8 A;  2HAV A;  3FXQ A;  2QS1 A;  4PE3 A;  1I6A A;  2HZK A;  4MFI A;  1N7X A;  3U1O A;  3CG3 A;  5CRY A;  5HM4 B;  1ZU0 A;  2XXV A;  1SVX B;  3JZJ A;  4KCD A;  1TFA A;  2ANJ A;  1LFI A;  5ICT A;  2NOO A;  1DTG A;  4H6D A;  3TZA A;  4OHN A;  5ICQ A;  3OXN A;  4XKR A;  3JYR A;  4IO6 A;  3HST A;  1B2H A;  1YYZ A;  1BTJ A;  1DOT A;  1D3K A;  3IO6 A;  3W9W A;  3TQW A;  2XXK A;  5ELV A;  3O6I A;  4TLM B;  4RJZ A;  4QRZ A;  1NL5 A;  1EYI A;  1LCT A;  2XWK A;  3HN0 A;  1LBC A;  1GVC A;  3OO6 A;  4DDD A;  5H8Q A;  5H8H B;  1JNF A;  3R6U A;  2PYY A;  3QXM A;  1NNP A;  4KD5 A;  3PPP A;  3G7W A;  1NH7 A;  2XX8 A;  5AA2 D;  2HFB A;  4R6Y A;  3IAZ A;  3B8B A;  4YB7 A;  2Y7R A;  5H8F B;  4NG7 A;  4KPT A;  1DMB A;  2QVV A;  2X7Q A;  1HSE A;  2CZK A;  1NV0 A;  3M3K A;  5EHS A;  4DIG A;  2FHY A;  4JB7 A;  3OEL A;  4QFK A;  5IZ3 B;  3BIG A;  3P7I A;  1EH3 A;  2CZH A;  4U21 A;  3Q25 A;  2I0B A;  4DI3 D;  1IUD A;  4OYV A;  3BBR A;  4HE2 A;  1BKA A;  3MUQ A;  4QXD A;  4YKJ A;  1NUW A;  3KG2 A;  2UVH A;  2FNC A;  4LVQ A;  4F1V A;  2PCR A;  1A54 A;  1PC3 A;  3PPN A;  4PET A;  2O68 A;  1MQI A;  5CI5 A;  3FTO A;  2VOZ A;  3IR1 A;  1US4 A;  4F2Q A;  3MWB A;  3T9X B;  1M5D A;  1Y3P A;  3FXU A;  4LON B;  1XC1 A;  4MBP A;  1Z7N E;  3TFL A;  4X1D A;  3VDF A;  1SI0 A;  2DWJ A;  4OVQ A;  3FUZ A;  4JBZ A;  1G0I A;  1BIY A;  3QK6 A;  4PTK A;  1B1H A;  4FOR A;  3ZKL A;  5H8H A;  1NFT A;  3K1P A;  2XXI A;  3RNN A;  1URG A;  5I3S A;  4KHZ E;  1Y1Z A;  3C34 A;  1JW1 A;  1AL3 A;  5L9S A;  1Y1M A;  1S9T A;  1O64 A;  4R2B A;  1NMU A;  4OAN A;  2ONS A;  1POT A;  2ZZX A;  3GXA A;  2DYX A;  3MZB A;  3ISP A;  3TDJ A;  1O7T A;  3W9V A;  3RYA A;  1ZIU A;  1MM7 A;  5DTB A;  4XKN A;  3PGF A;  3RTF B;  4BDR A;  5LOM A;  1P1Q A;  4MLQ A;  1FQA A;  4M4G A;  4UA8 A;  2ZYN A;  1PDA A;  4EDP A;  3EPE A;  1SYI A;  3O6H A;  4ZEB A;  3N26 A;  1FPB A;  1IIW A;  4OES A;  3VVD A;  4KFQ A;  1AMF A;  2FIX A;  2XWO A;  3EKI A;  1XVX A;  2Q9T A;  1LBX A;  1A8E A;  3V83 A;  1NUY A;  3KOT A;  4LQ5 A;  1OLA A;  2ALU A;  4NED A;  2KR0 A;  2X26 A;  4NQ8 A;  1FBF A;  3QAX A;  3V8X B;  4PAF A;  1QJM A;  4RA1 A;  4GWY A;  1URD A;  3BKI B;  4R6H A;  1CB6 A;  2WOP A;  1TWY A;  3B7D A;  4EUO A;  4LAT A;  1FQF A;  3Q28 A;  5ITP A;  4MX6 A;  2DOJ A;  4I3Y A;  4GWO A;  4NTL A;  4P11 A;  1FPJ A;  4JDF A;  4P9K A;  4U1Z A;  1KA1 A;  3ONM A;  3PUZ E;  4XEQ A;  4YKP A;  3SET A;  5CBS A;  2I48 A;  3RYD A;  4N8Y A;  4GX3 A;  3OEN A;  1B1X A;  1DTZ A;  1B46 A;  3B6W A;  4PFR A;  2IA4 A;  5ISU A;  3QUJ A;  4N91 A;  4IB2 A;  1B7U A;  4MCO A;  1MS7 A;  4RXL A;  2F6P A;  4IO5 A;  4H67 A;  1GV8 A;  2O51 A;  4P1E A;  5DVF A;  2OJT A;  5FHM A;  4F1Y A;  3PUV E;  5HBC A;  1MXU A;  3VXB A;  3S2V A;  2Q8J A;  3TEP A;  4QFL A;  2QMW A;  2IEE A;  2ABH A;  2QVR A;  4ZZA A;  5EYF A;  2DVC A;  1MDP 1;  5AA3 A;  1WVJ A;  3L6G A;  2V93 A;  1MRP A;  3FV1 A;  2CMO A;  3RYB A;  1JEV A;  4KXP A;  4GLI A;  2HPG A;  3FVO A;  4KYD A;  3H7M A;  2CZL A;  2VD3 A;  2XWV A;  3KN7 A;  3HPI A;  1LBW A;  5AA2 A;  3KSX A;  1CNQ A;  3E78 A;  1NH8 A;  1FBE A;  2RCA A;  3HFU A;  4MIJ A;  2PVU A;  1GTK A;  4NAP A;  2Z23 A;  1R9Q A;  1LFG A;  3U94 A;  4JVC A;  2REJ A;  1DPP A;  3CFX A;  3C33 A;  5IGA A;  1IMA A;  3THI A;  4NF6 B;  3KBR A;  3HV1 A;  1GGG A;  1XS5 A;  1FBG A;  4TQU Q;  4YMA A;  1YCJ A;  4QFN A;  4JSD A;  2KLF A;  4KI0 E;  4PBQ A;  3SDF A;  2PT1 A;  4HCW A;  3RQT A;  2NVU B;  2HHM A;  4R75 A;  4FEC A;  1OQH A;  2GHB A;  1FQE A;  3QMF A;  2HZL A;  1FPE A;  4YMB A;  3B6Q A;  3SZP A;  5EQ7 A;  1VDW A;  2ZYO A;  3FGS A;  3K00 A;  3B6T A;  4OXV A;  2ZMB A;  1N84 A;  3TOD A;  4ZDM A;  3M8U A;  5F1Q A;  3KJ7 A;  4YKK A;  2V3U A;  3DP6 A;  2F8D A;  1ZLQ A;  1FCK A;  5FHO A;  3DP4 A;  3OO8 A;  2V25 A;  4P0G A;  3DRI A;  5FTI A;  5ESY A;  1I6Q A;  1R9L A;  1AOV A;  1IXG A;  3VLV A;  1FJ6 A;  1M5B A;  3OEK A;  3RN8 A;  4ND9 A;  1HSJ A;  4F39 A;  2ESN A;  1MY1 A;  4MLV A;  2B4M A;  4OVS A;  2BJI A;  1AIV A;  3RGY A;  1B51 A;  4C0R A;  1J1N A;  5FHN A;  4OFO A;  4UAB A;  4F1U A;  1JVY A;  1IMF A;  2O7I A;  2FIE A;  3S9N C;  1H43 A;  2XXH A;  4LZ5 A;  3A09 A;  5DEX B;  2B65 A;  5A5L A;  1B32 A;  5IZZ A;  3MZ9 A;  3U93 A;  3PPR A;  2GQ1 A;  4OZ9 A;  2WYP A;  1N04 A;  2QPQ A;  3LVU A;  2VT5 A;  4ECF A;  5IZ3 A;  3MC2 A;  1NI9 A;  4X1B A;  3TQL A;  3Q26 A;  4FAJ A;  3FAT A;  2I58 A;  1TFD A;  3HHF A;  1URS A;  1Y20 A;  1LAX A;  3G3K A;  4PF8 A;  4F3S A;  1LBB A;  1B3H A;  4WKM A;  2WX9 A;  1QW0 A;  4GRK A;  2I4B A;  3H06 B;  3FV2 A;  4XFE A;  1JQF A;  1ANF A;  3PD8 A;  4HTG A;  1MPB A;  4H5G A;  1YXI A;  2XX9 A;  5KDT B;  1VE4 A;  3UK4 A;  5FBP A;  2PT2 A;  2VPN A;  1IXI A;  1O63 A;  2Z8D A;  4AS5 A;  2V4C A;  4AB6 A;  2RC9 A;  4R9F A;  1B3E A;  4QFO A;  2YPN A;  3RY3 A;  5A5X A;  3K1N A;  3H03 A;  1IXH A;  3OSR A;  4BDN A;  4EQB A;  4QFP A;  4YB6 A;  4PDD A;  3UN6 A;  4OVJ A;  4O8M A;  2DS9 A;  2OWZ A;  1FQD A;  1JW5 A;  3LSL A;  3C4M A;  4F18 A;  1TXF A;  1PEB A;  4RPO A;  1LBV A;  5I5P A;  3D4C A;  3Q27 A;  1B3L A;  2FYI A;  4N13 A;  2XWI A;  4U1O A;  3ZKK A;  3IOV A;  2WBD A;  3FIR A;  1FPF A;  1EZO A;  4GFR A;  3TCH A;  3R26 A;  1SBP A;  4FE8 A;  3MQ9 A;  3N6T A;  1MXV A;  4WEP A;  4OWD A;  2Q88 A;  2E0S A;  4XIG Q;  2Y7I A;  1H76 A;  3KOS A;  1B5H A;  1MY2 A;  3EHT A;  4GBW A;  4YU0 A;  4ELO A;  1FQB A;  2H25 A;  3G3G A;  2FVZ A;  3SEY A;  4NWC A;  3PPO A;  4JXI A;  2P2A A;  4IR8 A;  5LTC A;  3PPQ A;  3N94 A;  3DRK A;  3PMW A;  3L6H A;  2P1S A;  3FXB A;  2UYF A;  4G4P A;  1Q35 A;  1MM6 A;  2A5T A;  4MMP A;  5DVI A;  5I56 A;  3EHU A;  1MDQ A;  3C36 A;  3H3G A;  3K6X A;  2ZNU A;  3IOW A;  3CIJ A;  1OVT A;  4GXS B;  4OA4 A;  2Q89 A;  2VD2 A;  2XD2 A;  1QKB A;  4IO2 A;  1N0T A;  3K6U A;  2UVJ A;  3RTW B;  1B05 A;  2OCU A;  4EF1 A;  1FPG A;  4N17 A;  1BLF A;  3CFZ A;  4FED A;  2O69 A;  3SEW A;  4ELP A;  1FPD A;  1XI6 A; 
#chains in the Genus database with same CATH homology
 3Q28 A;  4R73 A;  3I5O A;  1QUJ A;  4NF5 A;  4BDO A;  5ITP A;  4JWY A;  1LAG E;  2AIX A;  2F6G A;  3C35 A;  1QUK A;  2DOJ A;  3FJ7 A;  4R72 A;  4GWO A;  4NTL A;  3MVZ A;  5TPA A;  2R71 A;  3OO9 A;  4X9T A;  1VFD A;  2OWS A;  3LSW A;  1IXC A;  1MXX A;  4P11 A;  3DM0 A;  4JDF A;  4ZED A;  3DRJ A;  5HPQ A;  3RUM A;  1B3G A;  3LR1 A;  4U1Z A;  2F36 A;  3E9X A;  3FD3 A;  4UAC A;  5CMC A;  2H9B A;  3ONM A;  3FZV A;  3PUZ E;  1FQC A;  4MF3 A;  4AB5 A;  1P1W A;  4YKP A;  4GD5 A;  3SET A;  4K3F A;  5B7D A;  5CBS A;  2WOL A;  2I0C A;  2I48 A;  3LSX A;  1B7Z A;  3A3U A;  3OEN A;  4GXA A;  3Q29 A;  1M5F A;  2ZXT A;  3SKP A;  3U92 A;  3IJX B;  4POW A;  1B1X A;  1DTZ A;  1MXY A;  2YJP A;  2ZYK A;  1USY H;  4ZEI A;  1N3W A;  2DWA A;  1B46 A;  2GFE A;  3B6W A;  3EHS A;  4F3G A;  1Y9U A;  4LA9 A;  1SI1 A;  1B5I A;  2XXW A;  3C9H A;  2IA4 A;  5ISU A;  1OQG A;  2RCB A;  1B3F A;  3QUJ A;  4XKP A;  1CE2 A;  1H45 A;  4ZEK A;  4IB2 A;  3AXF A;  1B7U A;  1UTH B;  1MS7 A;  3PV0 E;  2D5W A;  4RXL A;  2F6P A;  3PUY E;  4IO5 A;  3IJO B;  4H67 A;  3IB0 A;  4BDM A;  1GV8 A;  3F11 A;  4LZ8 A;  5DT6 A;  2O51 A;  5ICT A;  4Q30 B;  4HW8 A;  2XXX A;  5DVF A;  2VGQ A;  2OJT A;  4RK9 A;  4ZS9 A;  1SW5 A;  3VLW A;  1PBQ A;  1R6Z A;  3H6U A;  3FXR A;  1Y4T A;  1B7H A;  5FHM A;  3N6U A;  3KEI A;  4F1Y A;  4IGT A;  3MBP A;  3FJM A;  3PUV E;  5HBC A;  1M5C A;  1MXU A;  3VXB A;  4I8C A;  1A8F A;  3HO7 A;  1VR5 A;  3S2V A;  4GOT A;  3CHG A;  2Q8J A;  3TEP A;  3UP9 A;  1OMP A;  4NF5 B;  1ZTY A;  4Q0C A;  4RYA A;  4QFL A;  4O3C A;  1I6B A;  2QMW A;  3VE1 B;  2IEE A;  4ONY A;  3TCF A;  2ABH A;  3IX1 A;  4ZZA A;  3MAM A;  5EYF A;  2OZZ A;  2DVC A;  4Q8R A;  1MDP 1;  4OMB A;  2Y7K A;  3FJG A;  4HCY A;  4QF9 A;  4YIC A;  1NKX A;  4IGR A;  5AA3 A;  3RLF E;  2I3V A;  4PP0 A;  5DEX A;  1Z7M E;  1WVJ A;  3L6G A;  2V93 A;  3O29 A;  1MRP A;  3FV1 A;  3LUY A;  1A99 A;  1UQW A;  2CMO A;  3RYB A;  1A55 A;  2V3T A;  1JEV A;  1Y3N A;  1SW4 A;  2XXY A;  2XXP A;  3K2D A;  3MP1 A;  4GLI A;  2NXO A;  4O3B A;  2D21 A;  2DE3 A;  3OO7 A;  3FVO A;  1DPE A;  2VHA A;  3A3C A;  4GVO A;  5K2Y A;  4MH5 A;  4KYD A;  2DXY A;  2QS4 A;  3H7M A;  2A5S A;  2CZL A;  1QUI A;  2VD3 A;  2ZNS A;  2RF1 A;  4O3A A;  4P0I A;  1PBP A;  1F9B A;  4LAT A;  3KN7 A;  5I2N B;  4DLD A;  1VSO A;  2V84 A;  3HPI A;  3LBS A;  2G93 A;  4F19 A;  1EZ9 A;  4NMY A;  3MVX A;  3ODB A;  5JTY A;  5AA2 A;  3KSX A;  1P1N A;  3O97 A;  1N7W A;  1UTB A;  3MZ1 A;  1NH8 A;  1NNK A;  5AA4 A;  3EN3 A;  3H6T A;  4RY1 A;  2H4I A;  2RCA A;  4ZZE A;  3G3I A;  5I56 B;  3CI8 A;  5KDT A;  1Q1K A;  2DE2 A;  3O66 A;  2A5T B;  4NWD A;  2PVU A;  3KZG A;  1GTK A;  5I58 B;  2Z23 A;  1IEJ A;  1LST A;  5L8D A;  2REG A;  2QJE A;  1LFH A;  1QKA A;  1LLS A;  1R9Q A;  1MY3 A;  1FTM A;  2DWH A;  2F7B A;  3KSJ A;  1IIT A;  4GIZ A;  4Z0I A;  1LFG A;  3TMG A;  3U94 A;  3H6W A;  2OWT A;  1SYH A;  1D9Y A;  3C32 A;  1HSL A;  1P1O A;  2XX7 A;  2O1L A;  1SDX A;  3CG1 A;  5TP9 B;  3G3J A;  5CMK A;  4NF8 B;  2I6E A;  5JEI A;  3RT8 A;  5I59 B;  1EZP A;  4OQO A;  1JEU A;  3VFJ A;  2REJ A;  4POX A;  1DPP A;  4H8J A;  4OEV A;  3CFX A;  3C33 A;  3GZG A;  3THI A;  1WOD A;  2V3Q A;  3K01 A;  4NF6 B;  2PX1 A;  4IO3 A;  3CVG A;  5JTY B;  2DVZ A;  4QHQ A;  3TTR A;  3VVF A;  5KZT A;  4KYS A;  3KBR A;  1EU8 A;  2F34 A;  2HAU A;  3HV1 A;  1GGG A;  4N07 A;  3WAE A;  2Z22 A;  5AA4 B;  5I2K A;  1T0K A;  1MQG A;  1XS5 A;  1P1U A;  4G68 A;  4TQU Q;  3MW0 A;  1MH4 A;  4YMA A;  1XVY A;  3FAS A;  3K6V A;  1QVS A;  5F7V A;  1YCJ A;  4QFN A;  1MY4 A;  2UVI A;  4G77 A;  3SEX A;  5I57 B;  4H1X A;  1US5 A;  1OLC A;  4JSD A;  2KLF A;  2QS2 A;  4YKI A;  1JET A;  1SQY A;  3H6V A;  4U22 A;  4NF8 A;  3TAJ A;  3PUW E;  4KI0 E;  4WXJ A;  2RKM A;  3FVG A;  5KDT B;  4OTE A;  2HCA A;  4LQ2 A;  1B4Z A;  2PT1 A;  4HCW A;  2ONK E;  3SDF A;  3RQT A;  5DYH A;  2XXU A;  2NVU B;  3USD A;  4BDQ A;  5I57 A;  1A40 A;  4R75 A;  3TKD A;  1XT8 A;  5L9M A;  5I2N A;  4FEC A;  1OQH A;  2GH9 A;  2GHB A;  3JV9 A;  3PUX E;  4L17 A;  1P99 A;  1FQE A;  2ZYM A;  5IKB A;  3PMX A;  4U2R A;  2UYE A;  5A5X A;  2R9J A;  1AH5 A;  2F7A A;  2HZL A;  4H0W A;  2O6A A;  4YMB A;  1FTO A;  2RC7 A;  4DZ1 A;  3B6Q A;  5CM6 A;  5IAI A;  2H5Y A;  3QSL A;  2Q2A A;  3O9P A;  1II5 A;  3T96 B;  2OBG A;  4DXC A;  3IK6 B;  1MXZ A;  4OER A;  5H8S A;  2ZYO A;  5DVJ A;  4YZZ A;  3UA8 A;  2BJJ X;  3FGS A;  2Z8E A;  3D4G A;  3IOU A;  3PU5 A;  4YB5 A;  4G8M A;  5CMB A;  3K00 A;  1POY 1;  5CC2 A;  4F22 A;  4PFW A;  3CR9 A;  1A7L A;  1PB8 A;  2I4C A;  1OIB A;  2PBW A;  3B6T A;  3BFT A;  3T9V A;  2HAV A;  3FXQ A;  3R7X A;  3QIM A;  1TT1 A;  2QS1 A;  3K6W A;  3M3F A;  4M1V A;  5H8N A;  1I6A A;  2R6G E;  2F35 A;  2HZK A;  2B4L A;  1N7X A;  4MFI A;  4OXV A;  3W15 C;  2ZMB A;  1N84 A;  3IL1 B;  3T9H B;  3TOD A;  3U1O A;  4ZDM A;  3CG3 A;  5AA1 A;  3TEL A;  3ECR A;  3M8U A;  2DWI A;  4ZEC A;  4PQJ A;  1UIU A;  5F1Q A;  3DP8 A;  3HCQ A;  5CRY A;  3KJ7 A;  4H5F A;  4YKK A;  4EQ9 A;  5I2K B;  1LGB C;  2V3U A;  4C1U A;  3QYT A;  2DP8 A;  4H8I A;  3DP6 A;  5HM4 B;  3IB1 A;  4FIM A;  2F8D A;  3K1M A;  1ZU0 A;  4I62 A;  1ZLQ A;  1NNF A;  2XXV A;  1SVX B;  2F7C A;  3JZJ A;  4KCD A;  5M2V A;  2WOK A;  3TUS A;  1FCK A;  5FHO A;  1TFA A;  1VFE A;  2ANJ A;  2O1M A;  3DP4 A;  1LFI A;  4Q5T A;  2F5X A;  1JVX A;  3OO8 A;  2V25 A;  2DXR A;  3KGC A;  4G8H A;  3RT6 B;  2DQV A;  4XKQ A;  1QUL A;  2NOO A;  4P0G A;  3DRI A;  1DTG A;  1UTB B;  4H6D A;  3O6P A;  1ZJL A;  5FTI A;  3TZA A;  2QL3 A;  4NF6 A;  4E0X A;  4OHN A;  3V5A A;  5ICQ A;  3OXN A;  1I6Q A;  1SW2 A;  5H8N B;  1R9L A;  1UTH A;  2NWJ A;  4XKR A;  1AOV A;  1IXG A;  1WDN A;  4G68 C;  3JYR A;  5EHM A;  3VLV A;  1M5B A;  3OEK A;  4IO6 A;  3RN8 A;  3HST A;  4ND9 A;  1HSJ A;  2M8C A;  4F39 A;  1S50 A;  1I69 A;  1B2H A;  1Y4C A;  3S9M C;  2ESN A;  2Z8F A;  1BTJ A;  1DOT A;  1MY1 A;  3MPL A;  2B4M A;  1D3K A;  4G8N A;  4MLV A;  3IO6 A;  3U72 A;  3FVK A;  3RGY A;  4OFL A;  3TQW A;  3UGW A;  1B51 A;  1ZBM A;  3W9W A;  5ELV A;  2ZNT A;  3O6I A;  3VV5 A;  2XXQ A;  4TLM B;  2I49 A;  4RJZ A;  3C31 A;  1H3D A;  4QRZ A;  5TU0 A;  4C0R A;  1B0L A;  1J1N A;  1NL5 A;  1XHY A;  1B0H A;  4OFO A;  2Y84 A;  1LCT A;  3IOT A;  4GL0 A;  4TLL B;  3HN0 A;  5FHN A;  5H8Q B;  4F1U A;  1JVY A;  2PMS A;  1LBC A;  1M5E A;  4NF4 A;  4EQ7 A;  1GVC A;  3OO6 A;  4DDD A;  5H8Q A;  2O7I A;  3GBA A;  5H8H B;  1JNF A;  3R6U A;  2PYY A;  3QXM A;  1NNP A;  4KD5 A;  5I58 A;  3PPP A;  3S9N C;  1H43 A;  2XXH A;  4LZ5 A;  3G7W A;  3TTL A;  1NH7 A;  3A09 A;  2NUV A;  3QUF A;  2XX8 A;  4HS7 A;  5DEX B;  5AA2 D;  2HFB A;  2XXT A;  2QS3 A;  4ESX A;  2B65 A;  4R6Y A;  3IAZ A;  1B32 A;  4RNS A;  3MZ9 A;  3U93 A;  1R1N A;  3GLB A;  4R74 A;  4YB7 A;  2Y7R A;  5H8F B;  1GR2 A;  4ZE9 A;  2AL4 A;  3EF7 A;  4KPT A;  3UOR A;  2G29 A;  3OOA A;  2DSF A;  3PPR A;  4NE4 A;  3ZSF A;  5J1D A;  4OZ9 A;  1RKM A;  1DMB A;  4X48 A;  1N04 A;  3OSQ A;  2QPQ A;  2X7Q A;  3LVU A;  1HSE A;  1AIV A;  4F2O A;  3M3K A;  3CRB A;  1B58 A;  5EHS A;  3KN3 A;  4LP2 B;  3VLU A;  4DIG A;  4ECF A;  5AA2 B;  3I6V A;  1B5J A;  2H99 A;  3TYH A;  3MC2 A;  1YPN A;  4X1B A;  5L9O A;  4JB7 A;  3TQL A;  4DXB A;  3OEL A;  4QFK A;  3Q26 A;  3CSG A;  4FAJ A;  2OK2 A;  3FAT A;  4GF8 A;  2I58 A;  3BFU A;  1TFD A;  3HHF A;  3ILU B;  1URS A;  1B9J A;  1B4H A;  1Y20 A;  1LAX A;  1MQH A;  3P7I A;  4QSE A;  4JWX A;  4U23 A;  5CBR A;  2GRV A;  3E13 X;  2F78 A;  3G3H A;  2HQ0 A;  1EH3 A;  3G3K A;  3DRG A;  4FEB A;  4U21 A;  1LBB A;  4F3S A;  2O84 X;  5A5X B;  1B3H A;  1N3X A;  4WKM A;  5KCJ A;  1QW0 A;  2I0B A;  3Q25 A;  2QSX A;  4GRK A;  2I4B A;  2UXA A;  4PE5 B;  1MPC A;  2THI A;  3H06 B;  3VXC A;  5KCJ B;  4IO7 A;  1IUD A;  3BBR A;  1BKA A;  3FV2 A;  3KFM A;  4OYV A;  1JQF A;  1Y3Q A;  1ANF A;  2I3W A;  3CFL A;  3MUQ A;  3O6G A;  4YKJ A;  3PD8 A;  4QSC A;  2HXW A;  2QRY A;  4HTG A;  4ISU A;  3CSB A;  1MPB A;  3KG2 A;  4H5G A;  3RPW A;  2UVH A;  3H4Z A;  2B3F A;  2FNC A;  3IOR A;  2XX9 A;  4FJP A;  1A54 A;  1VE4 A;  4GQO A;  2X7P A;  1PC3 A;  1MPD A;  3PPN A;  3SEV A;  2XHD A;  2O68 A;  4PET A;  3UK4 A;  1MQI A;  2PT2 A;  3DEL B;  1MQJ A;  3MP8 A;  3UIF A;  4F1V A;  1IXI A;  1O63 A;  1RYX A;  2Z8D A;  3GBB A;  4XXU A;  4KCC A;  5CI5 A;  4AB6 A;  3PAM A;  2RC9 A;  4R9F A;  1B3E A;  4QFO A;  3FTO A;  2YPN A;  4I9D A;  1USY E;  1MXW A;  3RY3 A;  2DE4 A;  2VOZ A;  3IR1 A;  4LUB A;  3VVE A;  4EF2 A;  5CMM A;  3K1N A;  3H03 A;  1NNT A;  1LB9 A;  1IXH A;  3LC8 A;  3MPK A;  1JW4 A;  1US4 A;  4F2Q A;  3MWB A;  3T9X B;  1M5D A;  3HHG A;  3OSR A;  1Y3P A;  4Z7E A;  4BDN A;  4EQB A;  5FTH A;  1FTK A;  3FXU A;  4LON B;  4QFP A;  5I84 A;  4YB6 A;  4GL8 A;  4EXK A;  1XC1 A;  1SD3 A;  3PD9 A;  3KJT A;  5AE4 A;  3ZS6 A;  3UN6 A;  4MBP A;  4OVJ A;  4C1T A;  1Z7N E;  3K02 A;  3E3K A;  3TFL A;  3TTM A;  1LAH E;  2Y7P A;  4E0W A;  2DS9 A;  3TPA A;  4X1D A;  4TOZ A;  4R2F A;  2QMX A;  1FQD A;  2H98 A;  4XTC Q;  1ZMG A;  3VDF A;  3K4U A;  1N76 A;  1SI0 A;  5ITO A;  4N6P A;  2DWJ A;  1JW5 A;  3LSL A;  4U4X A;  4DE8 A;  3C4M A;  3FUZ A;  3O2A A;  4JBZ A;  1BIY A;  1TXF A;  3QK6 A;  1B1H A;  1KWH A;  1PEB A;  4F18 A;  4FOR A;  2LAO A;  3ZKL A;  4RPO A;  4OEU A;  2F97 A;  4RK2 A;  5H8H A;  4IY5 A;  2Y7W A;  3TTN A;  3D4C A;  3Q27 A;  3T9U A;  1NFT A;  1B3L A;  4DCX A;  4PFT A;  1ATG A;  2E1S A;  3MVY A;  2FYI A;  2XXI A;  3K1P A;  4N13 A;  4U1O A;  3RNN A;  2XD3 A;  2AL5 A;  4BLA A;  1URG A;  3IOV A;  3ZKK A;  4PFU A;  1MG1 A;  4KHZ E;  3FIR A;  1Y1Z A;  4LVQ A;  4H65 A;  3C34 A;  4ESW A;  1JW1 A;  1EZO A;  4GFR A;  2HEU A;  3TCH A;  3R26 A;  1SBP A;  3WAF A;  1RYO A;  1FTL A;  3OEM A;  1AL3 A;  1IQ7 A;  3MQ9 A;  4FE8 A;  3N6T A;  1BP5 A;  4R9G A;  1H44 A;  4ELQ A;  5L9S A;  1MXV A;  1Y1M A;  3K0V A;  1S9T A;  4WEP A;  5BWJ A;  4OWD A;  1O64 A;  2Q88 A;  2YLN A;  2E0S A;  1IZ1 A;  3TTK A;  4F29 A;  4DCY A;  3FVN A;  4R2B A;  4XIG Q;  1NMU A;  4PFY A;  1LB8 A;  1PB9 A;  2Q2C A;  1MY0 A;  2ONS A;  3E4R A;  1POT A;  3GXA A;  4FAT A;  2DYX A;  1L5T A;  3MZB A;  2Y7I A;  1H76 A;  1B52 A;  1ELJ A;  3KOS A;  3OMB A;  1B5H A;  1MY2 A;  1YAE A;  3TDJ A;  1O7T A;  3T93 B;  3EHT A;  3MJN A;  3W9V A;  4YU0 A;  3RYA A;  1FQB A;  1UIV A;  2H25 A;  3G3G A;  4ELO A;  3SEY A;  4OET A;  3ILT B;  3S4U A;  1YTV A;  4ZE8 A;  3T66 A;  1ZIU A;  4LZ7 A;  4NWC A;  2XXR A;  3PPO A;  4KYE A;  4JXI A;  4R6K A;  2P2A A;  1MM7 A;  5DTB A;  5TP9 A;  3T22 A;  4XKN A;  3PGF A;  3RTF B;  4QSD A;  4BDR A;  4ELR A;  1P1Q A;  3PPQ A;  5H8F A;  5LOM A;  4WED A;  1FQA A;  3M3L A;  4MLQ A;  4M4G A;  1S7Y A;  5TPA B;  1MH3 A;  4KR5 A;  3N94 A;  3DRK A;  3DLN A;  4UA8 A;  1XOC A;  2WKY A;  3DRF A;  1D9V A;  2B3B A;  2ZYN A;  2UVG A;  3PMV A;  3U8Q A;  4G2Z A;  1PDA A;  2P0S A;  3PMW A;  4EDP A;  3L6H A;  2P1S A;  4YAH X;  3EPE A;  4U4S A;  4OEN A;  1SYI A;  3KN8 A;  2UYF A;  3O6H A;  4ZEB A;  1SW1 A;  3N26 A;  4G4P A;  4JWO A;  3SER A;  5JK4 A;  1Q35 A;  1IIW A;  3SES A;  1MM6 A;  2A5T A;  4RPN A;  5DVI A;  4F3B A;  4OES A;  3VVD A;  5I56 A;  4IO4 A;  3DRH A;  4KFQ A;  3EHU A;  1AMF A;  4AQ4 A;  1MDQ A;  2W7Y A;  4EXL A;  4JSO A;  3C36 A;  3H3G A;  3K6X A;  2ZNU A;  3EQ1 A;  1XVX A;  5K2X A;  4I1D A;  3S9L C;  2RIN A;  3N5L A;  2D3I A;  2Q9T A;  2RC8 A;  3IOW A;  4ZEF A;  3CIJ A;  1OVT A;  1A8E A;  4GXS B;  4F31 B;  1FTJ A;  5B70 A;  3V83 A;  3KOT A;  4LQ5 A;  1ZKB A;  1OLA A;  2ALU A;  2Q89 A;  2VD2 A;  2XD2 A;  3O28 A;  1QKB A;  4NED A;  4THI A;  3TCG A;  3V89 B;  2X26 A;  3S9E A;  4IO2 A;  4IY6 A;  4F3P A;  1DSN A;  1N0T A;  3K6U A;  2UVJ A;  3RTW B;  5I59 A;  2GHA A;  1B05 A;  2OCU A;  3OD7 A;  3QAX A;  3V8X B;  1LCF A;  4OFJ A;  1QJM A;  4EF1 A;  4RA1 A;  3IB2 A;  4NF4 B;  4BDL A;  2O7U A;  2AYS A;  3SEU A;  4KQP A;  2VP1 A;  1BLF A;  1URD A;  3CFZ A;  3MVW A;  3BKI B;  3G3F A;  4FED A;  1PB7 A;  1MQD A;  4R6H A;  5BUU A;  1CB6 A;  1FW0 A;  2WOP A;  2ONR A;  3I3V A;  3IO4 A;  1B6H A;  1D4N A;  1TWY A;  2OLB A;  2O69 A;  3SEW A;  4DXU A;  4ELP A;  3B7D A;  2FA7 A;  4G68 B;  4EUO A;  1LAF E;  1B40 A;  3MP6 A;  3LSF B;  1FQF A;  1OVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...