1B5IA

Oligo-peptide binding protein (oppa) complexed with knk
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 190
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b5iA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b5iA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b5iA02
1CB6A 4PFYA 3QXMA 2PT1A 3TYHA 1IUDA 1WVJA 1LGBC 5I2NA 5F7VA 1II5A 1EZOA 2HZLA 3KBRA 1ZTYA 3PMVA 4BDLA 5TP9A 2OCUA 3FZVA 1J1NA 1FQBA 2UVJA 3MAMA 3PD9A 1Z7NE 1MXXA 1B3EA 1R9LA 4XKNA 5I58A 2ONSA 1IQ7A 2HZKA 4NF8A 4P11A 4DIGA 1WODA 3ZS6A 3MC2A 1YPNA 4JWYA 3A3UA 4H67A 4NF4A 5H8QA 2UVHA 5DVIA 4UA8A 5JTYB 3O2AA 1UTHA 2ONKE 4YKKA 1JVYA 1IXHA 4EF2A 2RCAA 2Z8FA 1FTJA 4N6PA 1FCKA 2H25A 2O68A 1N7WA 4IGRA 4BDNA 2HXWA 4R2FA 2O7IA 5CM6A 2VD3A 1OLAA 2F6GA 1VSOA 2V84A 3G3KA 3MUQA 1OLCA 2F34A 2Y7RA 4F3SA 2PVUA 3A3CA 1NH8A 5DTBA 2O69A 3N5LA 3UN6A 4F31B 3K6WA 3SEVA 4OERA 3LSFB 2IA4A 4E0XA 3PUWE 3C36A 1B0HA 1P99A 3RY3A 1A54A 3LSWA 2DVCA 5KCJA 4Q30B 2XXTA 1PB9A 4RYAA 4PETA 3JYRA 4WXJA 3RTFB 3Q25A 3HPIA 1AMFA 1L5TA 5L9SA 3KZGA 4RK9A 3KEIA 4GLIA 4JXIA 1WDNA 4C1UA 2DE4A 1MDP1 3K6VA 4QFNA 1SDXA 3RNNA 4RNSA 5LOMA 4K3FA 1ZBMA 2RINA 3DP8A 2RC8A 4NMYA 1B1HA 4BDOA 3G3GA 2QRYA 1FQFA 5H8SA 5H8HA 2Q2CA 3RN8A 4QFPA 1JVXA 3UORA 3T96B 1NFTA 4R73A 1B4ZA 1NNFA 5CI5A 2WOPA 2Q88A 1FTOA 4OXVA 1VR5A 3KFMA 3CFLA 1I6AA 4MF3A 2XHDA 1FQAA 1IZ1A 1QUKA 2XXPA 5BUUA 1B5HA 2DOJA 3G3HA 4ECFA 3OENA 1Q35A 1XHYA 3ZSFA 3W9VA 1M5FA 2ZYNA 3W9WA 1P1UA 5CBRA 2GH9A 1P1NA 4F3GA 4DCXA 3R26A 1B6HA 4IO5A 3MPLA 1XOCA 5F1QA 1M5CA 5FTHA 3H6TA 5H8NB 2I3VA 4OTEA 3QIMA 3PPOA 3O6GA 1LAFE 1SYIA 4GQOA 4EQ9A 2FA7A 2I4BA 2B4MA 5AA4B 1A8FA 4YICA 3IO6A 1LFIA 2QSXA 4KQPA 2RKMA 1H43A 1I6BA 4F18A 4G8MA 4F39A 1VFEA 1JW4A 4GIZA 4I1DA 3CG1A 4ELRA 5AA1A 4U1OA 5KDTB 2RC7A 1ATGA 2DQVA 1USYE 2OWSA 2I48A 2HAUA 4X9TA 2X7PA 1NNTA 3FVKA 5JTYA 4G68B 3FVNA 3H03A 2G29A 2REJA 3FXRA 5BWJA 4I62A 3THIA 3RT8A 3VVFA 4BDQA 3DM0A 4H8JA 3G7WA 4IO3A 2NVUB 1UIVA 2F36A 1LCTA 2Q89A 5L8DA 1D9VA 1IXIA 3QUFA 2VGQA 4F2QA 1MDQA 4R6KA 4X1DA 3QUJA 1P1OA 1CE2A 3B6QA 1LCFA 2RCBA 2CZLA 3HCQA 4OHNA 3D4GA 5I2NB 2ZXTA 2ZNTA 1URGA 3CRBA 5FHMA 4P0IA 1SW4A 1MQHA 1A40A 1SD3A 2R9JA 2XXVA 3PAMA 3SERA 5I58B 3OEMA 3PPQA 4NF5B 4KI0E 4OFOA 3KOTA 4NF8B 1H76A 1DPEA 2CMOA 3CVGA 1N3XA 1B3GA 3RYBA 1JQFA 3L6GA 1MPBA 3O29A 4NF4B 3K02A 4XKPA 1US5A 3QSLA 3H4ZA 3AXFA 2QMWA 3IJXB 1MM7A 2OZZA 3TTLA 3GZGA 1XVXA 1O64A 4NF6B 1PDAA 1JETA 3N94A 4NE4A 3B7DA 1TFDA 2NWJA 4FIMA 4I9DA 2O7UA 3FJMA 2B3BA 4EDPA 4OETA 4L17A 2THIA 4QSEA 1MY3A 3U1OA 4LVQA 1POTA 2DWJA 3IK6B 4DLDA 3T9HB 3IOVA 1QKBA 3MZ1A 4F22A 1LAHE 4G4PA 3PUVE 2WOKA 1Y1MA 3R7XA 3OSQA 3EPEA 2H4IA 5H8NA 4LZ7A 3IB0A 1M5BA 4RXLA 2Z8DA 3BKIB 2F7AA 5KCJB 3CSGA 1MQIA 5AA4A 3IOWA 1N76A 1B3FA 2HAVA 1FW0A 4RJZA 3ODBA 4HW8A 5KDTA 1PBPA 4AB6A 3SEWA 4KHZE 3N6UA 2HFBA 1LAXA 3WAFA 3VXCA 2AL5A 3T9VA 4G68A 1BIYA 3DP4A 3FJGA 1MXWA 4G68C 1RYOA 3UK4A 2XD2A 1XVYA 1B40A 4KR5A 5FHOA 1MRPA 1SI1A 1Y9UA 3T93B 2DWAA 2I4CA 3IB1A 4UACA 3ZKKA 4DE8A 1LB8A 3FV2A 2ONRA 4RY1A 4TLLB 4ZE8A 2BJJX 4P0GA 1SBPA 4LATA 1R1NA 2V93A 4EQ7A 5IKBA 1BLFA 3A09A 1OVBA 1MQDA 1SW2A 3OMBA 3CIJA 1HSEA 2OK2A 5AA2D 2B4LA 3PD8A 5AE4A 1R6ZA 1QJMA 3RUMA 3K6UA 3CFZA 4OFLA 3ECRA 3G3FA 2I58A 4XIGQ 3JZJA 1LFHA 3Q28A 1N3WA 1D9YA 1FQCA 3GXAA 4NF5A 3S9MC 2RF1A 4ZECA 1YTVA 3MVWA 4ELQA 3EN3A 1T0KA 1IXGA 2PT2A 5KZTA 5ICTA 2O51A 4PFTA 2XXHA 3KJTA 4R6YA 1LLSA 2PX1A 4NEDA 1Q1KA 2DVZA 4GXAA 3VVEA 4FEBA 1NNKA 1Y20A 3V8XB 1FTKA 1US4A 5I59B 5ISUA 2Y7PA 4N07A 4NF6A 3VVDA 3MPKA 1KWHA 1POY1 4RPNA 3H6WA 3FUZA 2E1SA 2Y84A 4JSDA 3V83A 3E4RA 3U72A 1QUIA 3I3VA 2I6EA 3O66A 3C9HA 4KCCA 1MXZA 2NUVA 3K01A 4F1UA 4H0WA 3S2VA 1TWYA 5I56B 3N26A 4BDMA 4OYVA 3BFUA 1GR2A 4GF8A 4YKJA 5EHMA 3DLNA 4G77A 3DRFA 3TEPA 4H1XA 4H5GA 4FORA 4U22A 3KSJA 4XXUA 5M2VA 3S4UA 1PB7A 5A5XB 3L6HA 4KCDA 4GVOA 3PUYE 2V3TA 1VE4A 3TKDA 1LAGE 3B6WA 4G2ZA 1B5IA 5CMBA 2E0SA 2DE3A 2Y7WA 4OQOA 2UYFA 1LSTA 3E9XA 1YAEA 1MY2A 3RPWA 2UVGA 3KN3A 4WKMA 1VFDA 2DXYA 1RKMA 1DMBA 3H6VA 4MFIA 1TFAA 4OZ9A 1NMUA 3VV5A 3FJ7A 5HBCA 5EYFA 3IX1A 1S9TA 1Y3PA 3TQWA 2B65A 3RQTA 4RPOA 1LFGA 4XKRA 2GHAA 3TTKA 1XT8A 1YCJA 1O7TA 2A5SA 3KN8A 1GVCA 4DDDA 1FQEA 2FNCA 1USYH 1DTZA 1ZMGA 4QFOA 4NTLA 5DT6A 1MXYA 1H45A 2HCAA 3PPRA 1AOVA 2O1LA 2O84X 4Q8RA 1PBQA 3O97A 3H3GA 3MP8A 4MH5A 4TOZA 1Y1ZA 3MW0A 3MVZA 2QS2A 1B32A 4OFJA 3FASA 3RLFE 4JB7A 5L9OA 2ABHA 3VDFA 3ZKLA 3OEKA 2XXUA 3ILUB 4IY5A 3MVXA 4RA1A 2F7BA 4C1TA 1EZPA 1IITA 1B5JA 1SW5A 1TXFA 4THIA 1P1WA 4DXUA 3C33A 2AYSA 3U94A 4Q0CA 1I69A 4YB5A 4YKPA 3G3IA 3PPNA 4E0WA 4ESXA 4R72A 3SEUA 1MM6A 3VLVA 4U4SA 3TAJA 3LUYA 1DOTA 3IJOB 3IL1B 4PP0A 1DSNA 4ZE9A 5I59A 1NNPA 4QHQA 4ESWA 3CG3A 3O6HA 5JEIA 2DP8A 1OIBA 3S9EA 4LQ2A 1JW5A 2UVIA 1OMPA 1B2HA 2XXXA 3OO8A 3BBRA 3CR9A 4O3CA 4MLVA 1Y4CA 2P2AA 3K1MA 4JSOA 2ALUA 1JW1A 4OVJA 4YB7A 4DZ1A 5TPAA 2P1SA 3B6TA 5I56A 4QFLA 4H5FA 5K2YA 2VP1A 4QRZA 2XXWA 3TZAA 3FVOA 1ZLQA 5ELVA 2I3WA 3DRIA 2DWHA 1Y3NA 4F2OA 3LBSA 5A5XA 4JBZA 4GFRA 3KN7A 1PC3A 4XTCQ 3M8UA 5B70A 5TU0A 3H7MA 2DSFA 1AL3A 4TQUQ 4DXCA 5B7DA 3V89B 3UIFA 1N84A 3MWBA 5DVFA 3MBPA 4G8HA 2QL3A 4GWOA 3PU5A 3FV1A 1MXVA 4IO2A 4F1VA 1ANFA 4POXA 3VE1B 5FHNA 1B7HA 3W15C 4LA9A 4EXLA 3KGCA 4WEDA 2D5WA 3N6TA 4O3AA 2NOOA 3PUXE 5H8FA 4GRKA 1Y4TA 1XS5A 2QPQA 3KJ7A 2PMSA 3UGWA 4LUBA 3K4UA 4IO6A 4ONYA 1PEBA 1JEVA 3KG2A 3RGYA 2XX7A 3QK6A 4POWA 4ELPA 2LAOA 5AA3A 3TQLA 1ZIUA 4KPTA 1N04A 3PMWA 1ELJA 4IB2A 3IR1A 1HSJA 4F1YA 4X1BA 5IAIA 1H44A 1I6QA 3K1NA 3M3LA 3U93A 2F5XA 3P7IA 3E13X 3IOTA 4H6DA 1MY1A 1JNFA 1HSLA 4ZEIA 2QS1A 2Y7IA 2HEUA 3T9UA 3OO6A 4O3BA 3KOSA 3K1PA 3K00A 5CMKA 4HCYA 3SETA 4MBPA 2Y7KA 2DXRA 1OQHA 3LSXA 2HQ0A 3SESA 3K0VA 5DEXB 3EF7A 3TCGA 3QYTA 4OWDA 1B3HA 1B46A 2V25A 2X7QA 2AL4A 3TTNA 4IY6A 4OMBA 3K2DA 1UQWA 4KD5A 4IO4A 3O6IA 1SI0A 2OLBA 3K6XA 2OWTA 3TPAA 3M3FA 2B3FA 2IEEA 4I8CA 3JV9A 3ONMA 3VFJA 1B58A 2I0BA 2H99A 4AQ4A 1NKXA 4DCYA 1MG1A 5HM4B 1B3LA 1A99A 2XXIA 2Q9TA 3WAEA 1H3DA 2OJTA 1PB8A 1GV8A 1GTKA 1SW1A 2F8DA 3OO9A 5AA2A 4ZS9A 3SEXA 3BFTA 4FE8A 2XXQA 3USDA 4R74A 3RYAA 4ZEKA 5CBSA 4PFUA 4WEPA 1UTBB 1Y3QA 1MH4A 3HV1A 3HN0A 2I0CA 3I6VA 4QF9A 2G93A 3EHTA 1QULA 1B52A 1LB9A 3GLBA 5I2KB 3FD3A 3TDJA 3D4CA 5ITPA 3HSTA 4HCWA 5DVJA 4EUOA 4M1VA 2P0SA 3LSLA 3PV0E 1FTLA 5TPAB 4U2RA 3MQ9A 5CMMA 3V5AA 5K2XA 4KYEA 4XKQA 1B7ZA 1GGGA 2AIXA 3ILTB 2ZYKA 2PBWA 4RK2A 1MH3A 3O9PA 4BLAA 2UYEA 4JWOA 4U4XA 1SYHA 4YKIA 1AIVA 1MY4A 2GHBA 3PPPA 2VHAA 1D4NA 2Z22A 2F78A 2Z23A 2XX8A 2VD2A 3F11A 3UP9A 2RC9A 4QFKA 2QJEA 2ZYMA 4H8IA 1B51A 3VLUA 1B4HA 3C32A 2A5TB 3SEYA 1BTJA 1LBBA 4LQ5A 3TODA 2ZNSA 1SQYA 4DXBA 4LP2B 4ZDMA 3EHUA 5CRYA 4F3BA 5JK4A 3DP6A 2W7YA 3DRHA 1P1QA 1DTGA 2ZNUA 1OQGA 3DRKA 4YB6A 5DEXA 4GOTA 4JDFA 4YAHX 4EF1A 1URSA 2DE2A 3PUZE 5H8FB 2V3QA 3OSRA 4U23A 4FJPA 4PE5B 4ELOA 3CI8A 2XX9A 1NH7A 2OBGA 4C0RA 1D3KA 4TLMB 4OENA 4AB5A 3S9LC 3FVGA 1SVXB 3TTRA 3E3KA 1DPPA 3IOUA 3FIRA 1FQDA 1OVTA 2Q2AA 3FXQA 2X26A 1AH5A 2M8CA 3MZBA 3DRJA 4OEVA 1XC1A 2XD3A 1BP5A 5HPQA 1B0LA 4ZZEA 3OOAA 3TFLA 4QSDA 2O1MA 1A55A 2REGA 1EH3A 4LZ5A 4PFWA 1EZ9A 4OEUA 4GL0A 2PYYA 4R75A 3CSBA 3U8QA 3C34A 2GRVA 3PMXA 4YMAA 4G8NA 1UTBA 3O6PA 1M5EA 2GFEA 2DYXA 3DELB 4ZEFA 3H6UA 4M4GA 4FECA 2ANJA 1BKAA 3PGFA 1QUJA 3MP6A 4NWCA 2FYIA 3HHGA 5I2KA 3H06B 4KFQA 1N0TA 3MZ9A 2F6PA 3M3KA 3T22A 2XXRA 1MQGA 1NL5A 4N13A 2KLFA 4LZ8A 4ZEBA 5J1DA 3DRGA 1R9QA 5I57B 3LR1A 3TUSA 4GXSB 4FEDA 2DS9A 5CMCA 3CHGA 1TT1A 5I84A 4F19A 3T9XB 1A7LA 2YLNA 2VOZA 4KYSA 3FXUA 4X48A 4YMBA 5TP9B 3RT6B 3EQ1A 4Z0IA 4R2BA 4GD5A 5EHSA 3IB2A 4PQJA 1MQJA 4ZEDA 1MS7A 1JEUA 3HO7A 3Q27A 4R9FA 3TCHA 2H5YA 5AA2B 3LC8A 3OELA 4KYDA 3QAXA 1F9BA 3FATA 2F35A 2YPNA 2A5TA 4ISUA 3OXNA 3TMGA 2O6AA 4Q5TA 5H8QB 2XXYA 2R6GE 3VLWA 1B9JA 3C31A 4YZZA 3MJNA 4IO7A 3Q26A 5CC2A 4IGTA 4MLQA 3OD7A 3CFXA 4EQBA 5ICQA 1IEJA 3MVYA 1UTHB 3EHSA 4FAJA 3TCFA 1Z7ME 4EXKA 1B05A 1ZKBA 3TTMA 1B7UA 2D3IA 2H98A 1MPCA 4HS7A 5DYHA 2F97A 3OO7A 4HTGA 4OESA 3IORA 1QVSA 2YJPA 5ITOA 2R71A 3RTWB 4NWDA 1ZU0A 1M5DA 1RYXA 1MY0A 1N7XA 1O63A 1QKAA 3TELA 2ESNA 3SKPA 2WKYA 3C4MA 4LONB 2WOLA 4F29A 1LBCA 3R6UA 2NXOA 4ND9A 1IXCA 3G3JA 2ZMBA 4R6HA 4ZZAA 4U21A 1IIWA 4F3PA 3IAZA 2V3UA 3IO4A 1A8EA 1UIUA 3O28A 4R9GA 2DWIA 1B1XA 1MXUA 4H65A 1ZJLA 3I5OA 4GL8A 3FTOA 1FTMA 3U92A 2I49A 4YU0A 4FATA 4Z7EA 3SDFA 2D21A 3GBAA 3HHFA 2QMXA 5FTIA 2H9BA 1S7YA 2QS4A 4QSCA 1QW0A 2Z8EA 4BDRA 1EU8A 1S50A 3C35A 3MP1A 5H8HB 1MPDA 4JWXA 3Q29A 4U1ZA 2UXAA 2ZYOA 3LVUA 3T66A 1URDA 3VXBA 3GBBA 2Q8JA 3KSXA 2QS3A 5L9MA 3UA8A 2F7CA 3FGSA 3S9NC 5I57A
chains in the Genus database with same CATH superfamily
1CB6A 4PFYA 3QXMA 2PT1A 4KXPA 3TYHA 1IUDA 1WVJA 1LGBC 5I2NA 5F7VA 1II5A 2Q8MA 1EZOA 2HZLA 3KBRA 3T1BA 1ZTYA 3PMVA 4MNCA 4BDLA 5TP9A 2OCUA 3FZVA 1J1NA 1FQBA 2UVJA 3MAMA 3PD9A 1Z7NE 1MXXA 1B3EA 1R9LA 4XKNA 5I58A 2ONSA 1IQ7A 2HZKA 4NF8A 2Q74A 4P11A 4DIGA 2WEFA 1WODA 3ZS6A 3RPLB 3MC2A 3FBPA 1YPNA 4JWYA 3A3UA 4H67A 4NF4A 5H8QA 2UVHA 5DVIA 2CEXA 4UA8A 5JTYB 4O8MA 3O2AA 1UTHA 2ONKE 1FBDA 4YKKA 1JVYA 1IXHA 4EF2A 2RCAA 2Z8FA 1FTJA 4N6PA 1FCKA 2H25A 2O68A 1N7WA 4IGRA 4BDNA 2HXWA 4R2FA 2O7IA 5CM6A 2VD3A 1LBVA 1OLAA 2F6GA 1VSOA 4I3YA 2V84A 3G3KA 4GWUA 3MUQA 1OLCA 2F34A 2Y7RA 4F3SA 2PVUA 1NV4A 3A3CA 1NH8A 5DTBA 2O69A 3N5LA 1FPDA 1RDXA 3UN6A 5I7IA 4MNPA 4F31B 3K6WA 3SEVA 4OERA 3GYYA 3LSFB 2IA4A 4E0XA 3PUWE 3C36A 2XWIA 1JP4A 1B0HA 1FBHA 1P99A 3RY3A 5ET6A 1A54A 3LSWA 1FBGA 2DVCA 5KCJA 4Q30B 1G0HA 2XXTA 1DK4A 1PB9A 4RYAA 4PETA 3JYRA 4WXJA 3RTFB 3Q25A 3HPIA 1AMFA 1L5TA 5L9SA 3KZGA 1LBXA 4RK9A 3KEIA 1LEVA 4GLIA 4JXIA 1WDNA 4C1UA 2DE4A 1MDP1 3HFUA 4QFNA 1SDXA 3K6VA 3RNNA 4RNSA 5LOMA 4K3FA 1ZBMA 2RINA 3DP8A 2RC8A 4NMYA 1B1HA 4BDOA 1FRPA 4PGPA 2KQZA 3G3GA 2QRYA 1FQFA 4MIJA 5H8SA 5H8HA 4O7MA 2Q2CA 2XXKA 4QFPA 3RN8A 1JVXA 3UORA 3T96B 1NFTA 4R73A 1B4ZA 1NNFA 5CI5A 2WOPA 2Q88A 1FTOA 4OXVA 1VR5A 3KFMA 3CFLA 1I6AA 4MF3A 1IMEA 2XHDA 3KC1A 5EQ9A 1FQAA 1IZ1A 1QUKA 2XXPA 5BUUA 1B5HA 2DOJA 3G3HA 4ECFA 3OENA 1Q35A 1XHYA 3ZSFA 3W9VA 1M5FA 2ZYNA 3W9WA 1P1UA 5J16A 2XA5A 5CBRA 2GH9A 1P1NA 4F3GA 4DCXA 3R26A 1B6HA 4AS4A 4IO5A 3MPLA 1XOCA 5F1QA 1M5CA 3FXBA 5FTHA 3H6TA 5H8NB 2I3VA 4OTEA 4MEVA 3QIMA 3PPOA 3O6GA 1LAFE 1SYIA 4GQOA 4EQ9A 2FA7A 2I4BA 2B4MA 5AA4B 1A8FA 4YICA 3IO6A 1LFIA 2QSXA 4KQPA 2RKMA 1H43A 1I6BA 4F18A 4G8MA 4F39A 1VFEA 1JW4A 4GIZA 4I1DA 4N17A 3CG1A 4ELRA 5AA1A 4U1OA 4OVQA 5KDTB 2RC7A 1ATGA 2DQVA 1USYE 2OWSA 2I48A 5IZ3A 3RYDA 2HAUA 4X9TA 2X7PA 1NNTA 3FVKA 5JTYA 4G68B 3FVNA 3H03A 2KR0A 2G29A 2REJA 3FXRA 4MHFA 5BWJA 4I62A 3THIA 4GX6A 3RT8A 3VVFA 4PCDA 4BDQA 2QVVA 3DM0A 4H8JA 3G7WA 4IO3A 2NVUB 1UIVA 2F36A 1LCTA 4GBVA 2Q89A 2HHMA 5L8DA 1D9VA 1IXIA 3QUFA 2VGQA 4F2QA 1MDQA 4R6KA 4X1DA 3QUJA 1P1OA 1CE2A 3B6QA 1LCFA 2RCBA 2CZLA 3HCQA 4OHNA 3D4GA 5I2NB 2ZXTA 1IMFA 2BJIA 2ZNTA 1URGA 3CRBA 5FHMA 4P3LA 4P0IA 1SW4A 1MQHA 1A40A 1SD3A 1FBCA 2R9JA 4N6DA 4GWZA 2XXVA 3PAMA 3SERA 1IMAA 1FPGA 3OEMA 5I58B 3PPQA 4NF5B 3EKIA 3SZPA 4KI0E 4OFOA 3KOTA 4NF8B 1H76A 4PAFA 1DPEA 2CMOA 3CVGA 1N3XA 1B3GA 3RYBA 1JQFA 3L6GA 1MPBA 4G61A 3O29A 2F3BA 4NF4B 3K02A 1Q9DA 4HE0A 5LDZA 4XKPA 1US5A 5ESYA 3QSLA 3H4ZA 3AXFA 4PFIA 2QMWA 3IJXB 1MM7A 2OZZA 3TTLA 3GZGA 1XVXA 1O64A 2CZHA 4NF6B 1PDAA 1JETA 3N94A 4NE4A 3B7DA 1TFDA 2NWJA 4FIMA 3B50A 4I9DA 2O7UA 3FJMA 4HXVA 2B3BA 2ZZWA 2R8TA 4EDPA 4OETA 4L17A 2THIA 4QSEA 1MY3A 3U1OA 4LVQA 1POTA 2DWJA 4PF8A 3IK6B 4DLDA 3T9HB 3IOVA 1QKBA 3MZ1A 4F22A 1LAHE 4G4PA 3PUVE 2WOKA 1FSAA 1Y1MA 4LN5A 3R7XA 3OSQA 3EPEA 1FPKA 2H4IA 5H8NA 4LZ7A 4PDDA 3IB0A 1M5BA 4RXLA 2Z8DA 3BKIB 2F7AA 5KCJB 3CSGA 1MQIA 5AA4A 2ZZVA 3IOWA 1N76A 1B3FA 4GBWA 2HAVA 1FW0A 4NQ8A 3IFCA 4RJZA 3ODBA 4HW8A 1INPA 5KDTA 1PBPA 4AB6A 3SEWA 4KHZE 3N6UA 2CEYA 2HFBA 1LAXA 3WAFA 3VXCA 2AL5A 3T9VA 4G68A 4OVSA 4P1EA 1BIYA 3DP4A 3FJGA 1MXWA 4G68C 1RYOA 3UK4A 2XD2A 1XVYA 1B40A 4KR5A 5FHOA 1MRPA 4NX1A 4PC9A 1SI1A 1Y9UA 3T93B 1EYIA 2DWAA 2I4CA 3IB1A 4UACA 3ZKKA 4DE8A 1LB8A 3FV2A 2ONRA 4RY1A 4TLLB 4ZE8A 4P1LA 2BJJX 4P0GA 1SBPA 4LATA 1R1NA 2V93A 4EQ7A 5IKBA 1BLFA 3A09A 3MYUA 4FBPA 1OVBA 2ZZXA 4JVIA 1MQDA 1SW2A 1YXIA 3OMBA 2QFLA 3CIJA 1HSEA 2OK2A 5AA2D 2B4LA 2DDKA 3PD8A 1NUWA 5AE4A 1R6ZA 1QJMA 3RUMA 1NV5A 3K6UA 2GQ1A 3CFZA 4OFLA 3ECRA 3G3FA 2I58A 4XIGQ 3JZJA 1LFHA 3Q28A 1N3WA 1D9YA 1FQCA 3GXAA 4NF5A 3S9MC 2RF1A 4ZECA 1YTVA 3MVWA 3MSTA 4ELQA 3EN3A 1T0KA 1IXGA 2PT2A 5KZTA 5ICTA 2O51A 4PFTA 2XXHA 3KJTA 4R6YA 1LLSA 2PX1A 4NEDA 5IZ3B 1Q1KA 2DVZA 4GXAA 3VVEA 4FEBA 1NNKA 2VPOA 3LV0A 1FPBA 4N6KA 1Y20A 3V8XB 4N81A 1FTKA 1US4A 5I59B 5ISUA 2Y7PA 4N07A 1SPIA 1NV1A 4NF6A 3VVDA 3MPKA 1KWHA 1POY1 4RPNA 3H6WA 2FIEA 3FUZA 2E1SA 2Y84A 4JSDA 5EYGA 4UABA 3V83A 1FBFA 3U65A 3E4RA 3U72A 1QUIA 3I3VA 2I6EA 3O66A 3C9HA 4KCCA 4XFEA 1MXZA 2NUVA 3K01A 4F1UA 4H0WA 3S2VA 1TWYA 5I56B 3N26A 4BDMA 4OYVA 3BFUA 1GR2A 4GF8A 1NI9A 4N91A 1VDWA 4YKJA 5EHMA 3DLNA 4G77A 3DRFA 3TEPA 4H1XA 5EQ8A 4H5GA 4GWYA 4FORA 4U22A 3KSJA 4XXUA 5M2VA 3S4UA 1PB7A 5A5XB 1EYKA 3L6HA 4KCDA 4GVOA 5I3SA 3PUYE 2V3TA 1VE4A 3TKDA 1LAGE 3B6WA 4G2ZA 1B5IA 5CMBA 2E0SA 2DE3A 2Y7WA 4OQOA 2UYFA 1LSTA 1KA0A 3E9XA 1YAEA 1MY2A 4P47A 3RPWA 2UVGA 3KN3A 4WKMA 1VFDA 4QXDA 2VT5A 1K9YA 2DXYA 1RKMA 1DMBA 3H6VA 4MFIA 1TFAA 4OZ9A 1NMUA 3VV5A 3FJ7A 5HBCA 2PCRA 5EYFA 3IX1A 1S9TA 1KA1A 1Y3PA 3TQWA 2B65A 2MKZA 3RQTA 4RPOA 1LFGA 4XKRA 2GHAA 3TTKA 1XT8A 1YCJA 1O7TA 2A5SA 4PDHA 3KN8A 1GVCA 4DDDA 1FQEA 2FNCA 1USYH 5IZ1A 1DTZA 1ZMGA 4QFOA 4NTLA 5DT6A 5LTCA 1MXYA 1H45A 2HCAA 3PPRA 4GX3A 1AOVA 1NV2A 2O1LA 2PFYA 2O84X 3KBZA 4Q8RA 1PBQA 3O97A 3H3GA 3MP8A 4MH5A 4TOZA 3ROJA 1Y1ZA 4I3EA 3MW0A 3MVZA 2QS2A 1B32A 4OFJA 3FASA 3RLFE 4JB7A 2JJKA 5L9OA 2ABHA 2OX3A 3VDFA 1BK4A 3ZKLA 3KC0A 3OEKA 2XWKA 2XXUA 3ILUB 4IY5A 3MVXA 4RA1A 2F7BA 4C1TA 1EZPA 4DI4B 1IITA 4GWXA 1B5JA 1SW5A 1TXFA 4NG7A 3A29A 4P9KA 1P1WA 4THIA 4DXUA 3C33A 1LBYA 2AYSA 3U94A 4Q0CA 1I69A 2QVRA 4N8YA 4YB5A 4YKPA 3G3IA 4MX6A 3PPNA 4E0WA 1NUYA 4ESXA 4R72A 3SEUA 5ET8A 1MM6A 3VLVA 4U4SA 3TAJA 3LUYA 1DOTA 3IJOB 3IL1B 4PP0A 1DSNA 4ZE9A 5I59A 1NNPA 2P3VA 4QHQA 4ESWA 1RDYA 3CG3A 3O6HA 5JEIA 2DP8A 1OIBA 3S9EA 4LQ2A 1JW5A 2UVIA 4OVRA 1OMPA 4DI3D 1B2HA 2XXXA 1FPJA 3OO8A 3BBRA 3CR9A 4O3CA 4MLVA 1Y4CA 2P2AA 3K1MA 4JSOA 2ALUA 1JW1A 4OVJA 4YB7A 4DZ1A 5TPAA 2P1SA 3B6TA 5I56A 4QFLA 4H5FA 5K2YA 2VP1A 4QRZA 2XXWA 3TZAA 1RDZA 3FVOA 5EQAA 1ZLQA 5ELVA 5I5PA 1YYZA 2I3WA 3DRIA 2DWHA 1Y3NA 4F2OA 3LBSA 2F3DA 5A5XA 4JBZA 4GFRA 3KN7A 1PC3A 5DW8A 4XTCQ 3M8UA 5B70A 1FPLA 3H7MA 2DSFA 5TU0A 1AL3A 4TQUQ 4DXCA 5B7DA 4O7IA 2L5VA 5IZZA 4MCOA 3V89B 3UIFA 1N84A 3MWBA 1IMCA 3MBPA 5DVFA 4G8HA 2QL3A 4GWOA 3PU5A 3FV1A 2XWVA 4XEQA 1MXVA 4IO2A 4F1VA 4OVPA 1ANFA 4POXA 4AS5A 3VE1B 5FHNA 1B7HA 3W15C 4LA9A 4NN3A 4EXLA 3KGCA 4WEDA 2D5WA 3N6TA 4O3AA 2NOOA 3PUXE 5H8FA 4GRKA 1Y4TA 1XS5A 2QPQA 3KJ7A 2PMSA 4H45A 3UGWA 4LUBA 3K4UA 4IO6A 2HXRA 4ONYA 1PEBA 1JEVA 2VPNA 3KG2A 4NGUA 4IR8A 3RGYA 2XX7A 3QK6A 4POWA 4ELPA 2LAOA 5AA3A 3TQLA 1ZIUA 4KPTA 1N04A 3PMWA 1ELJA 4IB2A 3IR1A 1HSJA 3ISPA 4F1YA 4MAGA 4X1BA 5IAIA 1H44A 5EYHA 1I6QA 1FJ6A 3K1NA 3M3LA 3U93A 2F5XA 3P7IA 3E13X 3IOTA 4H6DA 1MY1A 1JNFA 1HSLA 4MNIA 4ZEIA 2QS1A 2Y7IA 2HEUA 2CZKA 3T9UA 3E79A 3OO6A 4O3BA 3KOSA 3K1PA 3K00A 5CMKA 4HCYA 3SETA 4MBPA 2Y7KA 2DXRA 1OQHA 3LSXA 2HQ0A 3SESA 3K0VA 5DEXB 3EF7A 1YZ0A 3TCGA 1NV6A 4OWDA 3QYTA 1B3HA 1B46A 1G0IA 2V25A 2X7QA 1FPFA 5IGAA 2AL4A 3TTNA 4IY6A 4OMBA 3K2DA 4KD5A 1UQWA 4IO4A 3O6IA 1SI0A 2OLBA 3K6XA 2OWTA 3TPAA 3M3FA 2B3FA 2IEEA 4I8CA 3JV9A 3ONMA 3VFJA 1B58A 2P3NA 2I0BA 2H99A 4AQ4A 1NKXA 1KZ8A 4DCYA 1MG1A 5HM4B 4I40A 1B3LA 1A99A 2XXIA 2Q9TA 3WAEA 1H3DA 4OVTA 2OJTA 1PB8A 1GV8A 1NUZA 5IM2A 1GTKA 1SW1A 2F8DA 3OO9A 5AA2A 4ZS9A 2CZIA 3SEXA 4GWWA 3BFTA 4FE8A 2XXQA 3USDA 3T0JA 4R74A 3RYAA 4ZEKA 5CBSA 4PFUA 4WEPA 1UTBB 1Y3QA 1MH4A 4MMPA 3HV1A 3HN0A 2I0CA 2WX9A 3I6VA 4QF9A 2G93A 3EHTA 4H46A 1QULA 1B52A 1LB9A 3GLBA 5I2KB 3FD3A 3TDJA 1NUXA 1FBPA 4PFBA 3D4CA 3LUZA 5ITPA 3HSTA 4X8RA 4P56A 4HCWA 5DVJA 4EUOA 4M1VA 2P0SA 3LSLA 3PV0E 1FTLA 3QMFA 5TPAB 4U2RA 3MQ9A 5CMMA 3V5AA 5K2XA 4KYEA 4XKQA 1B7ZA 1GGGA 2AIXA 3ILTB 2ZYKA 1EYJA 2PBWA 4RK2A 1MH3A 3O9PA 4NHBA 4BLAA 2UYEA 4JWOA 4U4XA 1SYHA 4YKIA 1AIVA 1MY4A 2GHBA 3PPPA 2VHAA 1D4NA 2Z22A 2F78A 2Z23A 2XX8A 2VD2A 3F11A 3UP9A 5EQ7A 2RC9A 4QFKA 2QJEA 2ZYMA 1DBZA 4H8IA 1B51A 1K9ZA 3VLUA 1B4HA 3C32A 2A5TB 3SEYA 1BTJA 1LBBA 4LQ5A 3TODA 1NV0A 2ZNSA 4JVCA 1SQYA 4DXBA 4LP2B 4ZDMA 3EHUA 1CNQA 5CRYA 4F3BA 5JK4A 3DP6A 5ET5A 3D1RA 2W7YA 3DRHA 2FVZA 1P1QA 1DTGA 4PE3A 2ZNUA 1OQGA 3DRKA 4YB6A 2FIXA 5DEXA 4GOTA 4JDFA 5ET7A 4YAHX 4EF1A 2HPGA 1URSA 2DE2A 5FBPA 3PUZE 5H8FB 2V3QA 3OSRA 4U23A 2FHYA 4FJPA 4PE5B 4ELOA 3CI8A 2XX9A 1NH7A 2OBGA 1LBZA 4C0RA 1D3KA 4TLMB 1IMDA 4OENA 4AB5A 4PFRA 3S9LC 3FVGA 1SVXB 3TTRA 3E3KA 1DPPA 3IOUA 3FIRA 1FQDA 1OVTA 2Q2AA 3FXQA 2X26A 1AH5A 2M8CA 3MZBA 3DRJA 4OEVA 1XC1A 2XD3A 2Y5LA 1BP5A 5HPQA 2Y5KA 1B0LA 4ZZEA 3OOAA 3TFLA 4QSDA 2O1MA 1A55A 2REGA 1FTAA 1EH3A 2WYKA 4LZ5A 4PFWA 1EZ9A 3BIGA 4OEUA 3B8BA 4GL0A 3RPLA 2PYYA 4R75A 3CSBA 3U8QA 3C34A 2GRVA 3PMXA 4YMAA 4G8NA 1UTBA 3O6PA 1M5EA 2GFEA 2DYXA 3DELB 4ZEFA 4PTKA 3H6UA 3NOHA 2FBPA 4M4GA 4FECA 2ANJA 4XF5A 1BKAA 2WBBA 1QUJA 3MP6A 3PGFA 4NWCA 2FYIA 3HHGA 4GWSA 5I2KA 3H06B 4KFQA 1N0TA 3MZ9A 2F6PA 3M3KA 3T22A 2XXRA 1MQGA 1NL5A 4N13A 1QGXA 2KLFA 4LZ8A 4NAPA 4ZEBA 5J1DA 3DRGA 2WYPA 1R9QA 5I57B 5T3JA 3LR1A 3TUSA 4GXSB 4PF6A 4FEDA 2DS9A 5CMCA 3CHGA 1TT1A 4O94A 5I84A 4F19A 3T9XB 1A7LA 2YLNA 2VOZA 4KYSA 3FXUA 4X48A 4YMBA 5TP9B 3RT6B 3EQ1A 4Z0IA 4R2BA 4GD5A 5EHSA 3IB2A 4PQJA 1MQJA 4ZEDA 1MS7A 1JEUA 3HO7A 3Q27A 2PFZA 4R9FA 1FPIA 3TCHA 2H5YA 4OANA 5AA2B 3LC8A 3OELA 4KYDA 3QAXA 1F9BA 3FATA 2F35A 2YPNA 1XI6A 2OWZA 2A5TA 4ISUA 3OXNA 3TMGA 2O6AA 4Q5TA 5H8QB 1NV7A 2XXYA 2R6GE 3VLWA 1B9JA 3C31A 4YZZA 3MJNA 4IO7A 3Q26A 5CC2A 4IGTA 4MLQA 3OD7A 2WBDA 3CFXA 4EQBA 5ICQA 1IEJA 3MVYA 1UTHB 3EHSA 4FAJA 3TCFA 1Z7ME 3PTYA 2QVUA 4EXKA 1B05A 1ZKBA 3TTMA 1B7UA 1DCUA 2V4CA 5A5LA 2D3IA 2H98A 1MPCA 4HS7A 5DYHA 2F97A 4X04A 3OO7A 4HTGA 1NV3A 4OESA 3IORA 1FPEA 1QVSA 2YJPA 5ITOA 2R71A 3RTWB 4NWDA 1ZU0A 1M5DA 4GX4A 4MJOA 1RYXA 3E78A 1MY0A 1N7XA 1O63A 4QBAA 1QKAA 3TELA 2ESNA 2WKYA 3SKPA 3C4MA 4PBQA 4PBHA 4PAKA 4LONB 3BIHA 2WOLA 4F29A 4N4UA 1LBCA 3R6UA 2NXOA 4ND9A 1FJ9A 1IXCA 4P8BA 3G3JA 4HE2A 2ZMBA 4R6HA 4N8GA 4NF0A 4ZZAA 4U21A 1FBEA 1IIWA 4PAIA 4F3PA 3IAZA 2V3UA 3IO4A 1A8EA 1UIUA 3O28A 4R9GA 2DWIA 1B1XA 1MXUA 4H65A 1IMBA 1ZJLA 3I5OA 4OA4A 4GL8A 3FTOA 1FTMA 3U92A 2I49A 4YU0A 4FATA 4N15A 4Z7EA 3SDFA 2D21A 3GBAA 5F24A 3HHFA 2QMXA 5FTIA 2H9BA 1S7YA 2QS4A 4QSCA 1QW0A 2Z8EA 4BDRA 1EU8A 1S50A 4JVDA 1D9QA 3C35A 3MP1A 5H8HB 1MPDA 4JWXA 3Q29A 1LBWA 4U1ZA 4HE1A 2UXAA 2ZYOA 3LVUA 3T66A 1URDA 3VXBA 3GBBA 1AWBA 2Q8JA 3KSXA 2QS3A 5L9MA 3IFAA 3UA8A 2F7CA 3FGSA 3S9NC 4PGNA 5I57A 2XWOA
chains in the Genus database with same CATH topology
1CB6A 4PFYA 3QXMA 2PT1A 3TYHA 1IUDA 1WVJA 1LGBC 5I2NA 5F7VA 1II5A 1EZOA 2HZLA 3KBRA 1ZTYA 3PMVA 4BDLA 5TP9A 2OCUA 3FZVA 1J1NA 1FQBA 2UVJA 3MAMA 3PD9A 1Z7NE 1MXXA 1B3EA 1R9LA 4XKNA 5I58A 2ONSA 1IQ7A 2HZKA 4NF8A 4P11A 4DIGA 1WODA 3ZS6A 3MC2A 1YPNA 4JWYA 3A3UA 4H67A 4NF4A 5H8QA 2UVHA 5DVIA 4UA8A 5JTYB 3O2AA 1UTHA 2ONKE 4YKKA 1JVYA 1IXHA 4EF2A 2RCAA 2Z8FA 1FTJA 4N6PA 1FCKA 2H25A 2O68A 1N7WA 4IGRA 4BDNA 2HXWA 4R2FA 2O7IA 5CM6A 2VD3A 1OLAA 2F6GA 1VSOA 2V84A 3G3KA 3MUQA 1OLCA 2F34A 2Y7RA 4F3SA 2PVUA 3A3CA 1NH8A 5DTBA 2O69A 3N5LA 3UN6A 4F31B 3K6WA 3SEVA 4OERA 3LSFB 2IA4A 4E0XA 3PUWE 3C36A 1B0HA 1P99A 3RY3A 1A54A 3LSWA 2DVCA 5KCJA 4Q30B 2XXTA 1PB9A 4RYAA 4PETA 3JYRA 4WXJA 3RTFB 3Q25A 3HPIA 1AMFA 1L5TA 5L9SA 3KZGA 4RK9A 3KEIA 4GLIA 4JXIA 1WDNA 4C1UA 2DE4A 1MDP1 3K6VA 4QFNA 1SDXA 3RNNA 4RNSA 5LOMA 4K3FA 1ZBMA 2RINA 3DP8A 2RC8A 4NMYA 1B1HA 4BDOA 3G3GA 2QRYA 1FQFA 5H8SA 5H8HA 2Q2CA 3RN8A 4QFPA 1JVXA 3UORA 3T96B 1NFTA 4R73A 1B4ZA 1NNFA 5CI5A 2WOPA 2Q88A 1FTOA 4OXVA 1VR5A 3KFMA 3CFLA 1I6AA 4MF3A 2XHDA 1FQAA 1IZ1A 1QUKA 2XXPA 5BUUA 1B5HA 2DOJA 3G3HA 4ECFA 3OENA 1Q35A 1XHYA 3ZSFA 3W9VA 1M5FA 2ZYNA 3W9WA 1P1UA 5CBRA 2GH9A 1P1NA 4F3GA 4DCXA 3R26A 1B6HA 4IO5A 3MPLA 1XOCA 5F1QA 1M5CA 5FTHA 3H6TA 5H8NB 2I3VA 4OTEA 3QIMA 3PPOA 3O6GA 1LAFE 1SYIA 4GQOA 4EQ9A 2FA7A 2I4BA 2B4MA 5AA4B 1A8FA 4YICA 3IO6A 1LFIA 2QSXA 4KQPA 2RKMA 1H43A 1I6BA 4F18A 4G8MA 4F39A 1VFEA 1JW4A 4GIZA 4I1DA 3CG1A 4ELRA 5AA1A 4U1OA 5KDTB 2RC7A 1ATGA 2DQVA 1USYE 2OWSA 2I48A 2HAUA 4X9TA 2X7PA 1NNTA 3FVKA 5JTYA 4G68B 3FVNA 3H03A 2G29A 2REJA 3FXRA 5BWJA 4I62A 3THIA 3RT8A 3VVFA 4BDQA 3DM0A 4H8JA 3G7WA 4IO3A 2NVUB 1UIVA 2F36A 1LCTA 2Q89A 5L8DA 1D9VA 1IXIA 3QUFA 2VGQA 4F2QA 1MDQA 4R6KA 4X1DA 3QUJA 1P1OA 1CE2A 3B6QA 1LCFA 2RCBA 2CZLA 3HCQA 4OHNA 3D4GA 5I2NB 2ZXTA 2ZNTA 1URGA 3CRBA 5FHMA 4P0IA 1SW4A 1MQHA 1A40A 1SD3A 2R9JA 2XXVA 3PAMA 3SERA 5I58B 3OEMA 3PPQA 4NF5B 4KI0E 4OFOA 3KOTA 4NF8B 1H76A 1DPEA 2CMOA 3CVGA 1N3XA 1B3GA 3RYBA 1JQFA 3L6GA 1MPBA 3O29A 4NF4B 3K02A 4XKPA 1US5A 3QSLA 3H4ZA 3AXFA 2QMWA 3IJXB 1MM7A 2OZZA 3TTLA 3GZGA 1XVXA 1O64A 4NF6B 1PDAA 1JETA 3N94A 4NE4A 3B7DA 1TFDA 2NWJA 4FIMA 4I9DA 2O7UA 3FJMA 2B3BA 4EDPA 4OETA 4L17A 2THIA 4QSEA 1MY3A 3U1OA 4LVQA 1POTA 2DWJA 3IK6B 4DLDA 3T9HB 3IOVA 1QKBA 3MZ1A 4F22A 1LAHE 4G4PA 3PUVE 2WOKA 1Y1MA 3R7XA 3OSQA 3EPEA 2H4IA 5H8NA 4LZ7A 3IB0A 1M5BA 4RXLA 2Z8DA 3BKIB 2F7AA 5KCJB 3CSGA 1MQIA 5AA4A 3IOWA 1N76A 1B3FA 2HAVA 1FW0A 4RJZA 3ODBA 4HW8A 5KDTA 1PBPA 4AB6A 3SEWA 4KHZE 3N6UA 2HFBA 1LAXA 3WAFA 3VXCA 2AL5A 3T9VA 4G68A 1BIYA 3DP4A 3FJGA 1MXWA 4G68C 1RYOA 3UK4A 2XD2A 1XVYA 1B40A 4KR5A 5FHOA 1MRPA 1SI1A 1Y9UA 3T93B 2DWAA 2I4CA 3IB1A 4UACA 3ZKKA 4DE8A 1LB8A 3FV2A 2ONRA 4RY1A 4TLLB 4ZE8A 2BJJX 4P0GA 1SBPA 4LATA 1R1NA 2V93A 4EQ7A 5IKBA 1BLFA 3A09A 1OVBA 1MQDA 1SW2A 3OMBA 3CIJA 1HSEA 2OK2A 5AA2D 2B4LA 3PD8A 5AE4A 1R6ZA 1QJMA 3RUMA 3K6UA 3CFZA 4OFLA 3ECRA 3G3FA 2I58A 4XIGQ 3JZJA 1LFHA 3Q28A 1N3WA 1D9YA 1FQCA 3GXAA 4NF5A 3S9MC 2RF1A 4ZECA 1YTVA 3MVWA 4ELQA 3EN3A 1T0KA 1IXGA 2PT2A 5KZTA 5ICTA 2O51A 4PFTA 2XXHA 3KJTA 4R6YA 1LLSA 2PX1A 4NEDA 1Q1KA 2DVZA 4GXAA 3VVEA 4FEBA 1NNKA 1Y20A 3V8XB 1FTKA 1US4A 5I59B 5ISUA 2Y7PA 4N07A 4NF6A 3VVDA 3MPKA 1KWHA 1POY1 4RPNA 3H6WA 3FUZA 2E1SA 2Y84A 4JSDA 3V83A 3E4RA 3U72A 1QUIA 3I3VA 2I6EA 3O66A 3C9HA 4KCCA 1MXZA 2NUVA 3K01A 4F1UA 4H0WA 3S2VA 1TWYA 5I56B 3N26A 4BDMA 4OYVA 3BFUA 1GR2A 4GF8A 4YKJA 5EHMA 3DLNA 4G77A 3DRFA 3TEPA 4H1XA 4H5GA 4FORA 4U22A 3KSJA 4XXUA 5M2VA 3S4UA 1PB7A 5A5XB 3L6HA 4KCDA 4GVOA 3PUYE 2V3TA 1VE4A 3TKDA 1LAGE 3B6WA 4G2ZA 1B5IA 5CMBA 2E0SA 2DE3A 2Y7WA 4OQOA 2UYFA 1LSTA 3E9XA 1YAEA 1MY2A 3RPWA 2UVGA 3KN3A 4WKMA 1VFDA 2DXYA 1RKMA 1DMBA 3H6VA 4MFIA 1TFAA 4OZ9A 1NMUA 3VV5A 3FJ7A 5HBCA 5EYFA 3IX1A 1S9TA 1Y3PA 3TQWA 2B65A 3RQTA 4RPOA 1LFGA 4XKRA 2GHAA 3TTKA 1XT8A 1YCJA 1O7TA 2A5SA 3KN8A 1GVCA 4DDDA 1FQEA 2FNCA 1USYH 1DTZA 1ZMGA 4QFOA 4NTLA 5DT6A 1MXYA 1H45A 2HCAA 3PPRA 1AOVA 2O1LA 2O84X 4Q8RA 1PBQA 3O97A 3H3GA 3MP8A 4MH5A 4TOZA 1Y1ZA 3MW0A 3MVZA 2QS2A 1B32A 4OFJA 3FASA 3RLFE 4JB7A 5L9OA 2ABHA 3VDFA 3ZKLA 3OEKA 2XXUA 3ILUB 4IY5A 3MVXA 4RA1A 2F7BA 4C1TA 1EZPA 1IITA 1B5JA 1SW5A 1TXFA 4THIA 1P1WA 4DXUA 3C33A 2AYSA 3U94A 4Q0CA 1I69A 4YB5A 4YKPA 3G3IA 3PPNA 4E0WA 4ESXA 4R72A 3SEUA 1MM6A 3VLVA 4U4SA 3TAJA 3LUYA 1DOTA 3IJOB 3IL1B 4PP0A 1DSNA 4ZE9A 5I59A 1NNPA 4QHQA 4ESWA 3CG3A 3O6HA 5JEIA 2DP8A 1OIBA 3S9EA 4LQ2A 1JW5A 2UVIA 1OMPA 1B2HA 2XXXA 3OO8A 3BBRA 3CR9A 4O3CA 4MLVA 1Y4CA 2P2AA 3K1MA 4JSOA 2ALUA 1JW1A 4OVJA 4YB7A 4DZ1A 5TPAA 2P1SA 3B6TA 5I56A 4QFLA 4H5FA 5K2YA 2VP1A 4QRZA 2XXWA 3TZAA 3FVOA 1ZLQA 5ELVA 2I3WA 3DRIA 2DWHA 1Y3NA 4F2OA 3LBSA 5A5XA 4JBZA 4GFRA 3KN7A 1PC3A 4XTCQ 3M8UA 5B70A 5TU0A 3H7MA 2DSFA 1AL3A 4TQUQ 4DXCA 5B7DA 3V89B 3UIFA 1N84A 3MWBA 5DVFA 3MBPA 4G8HA 2QL3A 4GWOA 3PU5A 3FV1A 1MXVA 4IO2A 4F1VA 1ANFA 4POXA 3VE1B 5FHNA 1B7HA 3W15C 4LA9A 4EXLA 3KGCA 4WEDA 2D5WA 3N6TA 4O3AA 2NOOA 3PUXE 5H8FA 4GRKA 1Y4TA 1XS5A 2QPQA 3KJ7A 2PMSA 3UGWA 4LUBA 3K4UA 4IO6A 4ONYA 1PEBA 1JEVA 3KG2A 3RGYA 2XX7A 3QK6A 4POWA 4ELPA 2LAOA 5AA3A 3TQLA 1ZIUA 4KPTA 1N04A 3PMWA 1ELJA 4IB2A 3IR1A 1HSJA 4F1YA 4X1BA 5IAIA 1H44A 1I6QA 3K1NA 3M3LA 3U93A 2F5XA 3P7IA 3E13X 3IOTA 4H6DA 1MY1A 1JNFA 1HSLA 4ZEIA 2QS1A 2Y7IA 2HEUA 3T9UA 3OO6A 4O3BA 3KOSA 3K1PA 3K00A 5CMKA 4HCYA 3SETA 4MBPA 2Y7KA 2DXRA 1OQHA 3LSXA 2HQ0A 3SESA 3K0VA 5DEXB 3EF7A 3TCGA 3QYTA 4OWDA 1B3HA 1B46A 2V25A 2X7QA 2AL4A 3TTNA 4IY6A 4OMBA 3K2DA 1UQWA 4KD5A 4IO4A 3O6IA 1SI0A 2OLBA 3K6XA 2OWTA 3TPAA 3M3FA 2B3FA 2IEEA 4I8CA 3JV9A 3ONMA 3VFJA 1B58A 2I0BA 2H99A 4AQ4A 1NKXA 4DCYA 1MG1A 5HM4B 1B3LA 1A99A 2XXIA 2Q9TA 3WAEA 1H3DA 2OJTA 1PB8A 1GV8A 1GTKA 1SW1A 2F8DA 3OO9A 5AA2A 4ZS9A 3SEXA 3BFTA 4FE8A 2XXQA 3USDA 4R74A 3RYAA 4ZEKA 5CBSA 4PFUA 4WEPA 1UTBB 1Y3QA 1MH4A 3HV1A 3HN0A 2I0CA 3I6VA 4QF9A 2G93A 3EHTA 1QULA 1B52A 1LB9A 3GLBA 5I2KB 3FD3A 3TDJA 3D4CA 5ITPA 3HSTA 4HCWA 5DVJA 4EUOA 4M1VA 2P0SA 3LSLA 3PV0E 1FTLA 5TPAB 4U2RA 3MQ9A 5CMMA 3V5AA 5K2XA 4KYEA 4XKQA 1B7ZA 1GGGA 2AIXA 3ILTB 2ZYKA 2PBWA 4RK2A 1MH3A 3O9PA 4BLAA 2UYEA 4JWOA 4U4XA 1SYHA 4YKIA 1AIVA 1MY4A 2GHBA 3PPPA 2VHAA 1D4NA 2Z22A 2F78A 2Z23A 2XX8A 2VD2A 3F11A 3UP9A 2RC9A 4QFKA 2QJEA 2ZYMA 4H8IA 1B51A 3VLUA 1B4HA 3C32A 2A5TB 3SEYA 1BTJA 1LBBA 4LQ5A 3TODA 2ZNSA 1SQYA 4DXBA 4LP2B 4ZDMA 3EHUA 5CRYA 4F3BA 5JK4A 3DP6A 2W7YA 3DRHA 1P1QA 1DTGA 2ZNUA 1OQGA 3DRKA 4YB6A 5DEXA 4GOTA 4JDFA 4YAHX 4EF1A 1URSA 2DE2A 3PUZE 5H8FB 2V3QA 3OSRA 4U23A 4FJPA 4PE5B 4ELOA 3CI8A 2XX9A 1NH7A 2OBGA 4C0RA 1D3KA 4TLMB 4OENA 4AB5A 3S9LC 3FVGA 1SVXB 3TTRA 3E3KA 1DPPA 3IOUA 3FIRA 1FQDA 1OVTA 2Q2AA 3FXQA 2X26A 1AH5A 2M8CA 3MZBA 3DRJA 4OEVA 1XC1A 2XD3A 1BP5A 5HPQA 1B0LA 4ZZEA 3OOAA 3TFLA 4QSDA 2O1MA 1A55A 2REGA 1EH3A 4LZ5A 4PFWA 1EZ9A 4OEUA 4GL0A 2PYYA 4R75A 3CSBA 3U8QA 3C34A 2GRVA 3PMXA 4YMAA 4G8NA 1UTBA 3O6PA 1M5EA 2GFEA 2DYXA 3DELB 4ZEFA 3H6UA 4M4GA 4FECA 2ANJA 1BKAA 3PGFA 1QUJA 3MP6A 4NWCA 2FYIA 3HHGA 5I2KA 3H06B 4KFQA 1N0TA 3MZ9A 2F6PA 3M3KA 3T22A 2XXRA 1MQGA 1NL5A 4N13A 2KLFA 4LZ8A 4ZEBA 5J1DA 3DRGA 1R9QA 5I57B 3LR1A 3TUSA 4GXSB 4FEDA 2DS9A 5CMCA 3CHGA 1TT1A 5I84A 4F19A 3T9XB 1A7LA 2YLNA 2VOZA 4KYSA 3FXUA 4X48A 4YMBA 5TP9B 3RT6B 3EQ1A 4Z0IA 4R2BA 4GD5A 5EHSA 3IB2A 4PQJA 1MQJA 4ZEDA 1MS7A 1JEUA 3HO7A 3Q27A 4R9FA 3TCHA 2H5YA 5AA2B 3LC8A 3OELA 4KYDA 3QAXA 1F9BA 3FATA 2F35A 2YPNA 2A5TA 4ISUA 3OXNA 3TMGA 2O6AA 4Q5TA 5H8QB 2XXYA 2R6GE 3VLWA 1B9JA 3C31A 4YZZA 3MJNA 4IO7A 3Q26A 5CC2A 4IGTA 4MLQA 3OD7A 3CFXA 4EQBA 5ICQA 1IEJA 3MVYA 1UTHB 3EHSA 4FAJA 3TCFA 1Z7ME 4EXKA 1B05A 1ZKBA 3TTMA 1B7UA 2D3IA 2H98A 1MPCA 4HS7A 5DYHA 2F97A 3OO7A 4HTGA 4OESA 3IORA 1QVSA 2YJPA 5ITOA 2R71A 3RTWB 4NWDA 1ZU0A 1M5DA 1RYXA 1MY0A 1N7XA 1O63A 1QKAA 3TELA 2ESNA 3SKPA 2WKYA 3C4MA 4LONB 2WOLA 4F29A 1LBCA 3R6UA 2NXOA 4ND9A 1IXCA 3G3JA 2ZMBA 4R6HA 4ZZAA 4U21A 1IIWA 4F3PA 3IAZA 2V3UA 3IO4A 1A8EA 1UIUA 3O28A 4R9GA 2DWIA 1B1XA 1MXUA 4H65A 1ZJLA 3I5OA 4GL8A 3FTOA 1FTMA 3U92A 2I49A 4YU0A 4FATA 4Z7EA 3SDFA 2D21A 3GBAA 3HHFA 2QMXA 5FTIA 2H9BA 1S7YA 2QS4A 4QSCA 1QW0A 2Z8EA 4BDRA 1EU8A 1S50A 3C35A 3MP1A 5H8HB 1MPDA 4JWXA 3Q29A 4U1ZA 2UXAA 2ZYOA 3LVUA 3T66A 1URDA 3VXBA 3GBBA 2Q8JA 3KSXA 2QS3A 5L9MA 3UA8A 2F7CA 3FGSA 3S9NC 5I57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CB6 A;  4PFY A;  3QXM A;  2PT1 A;  3TYH A;  1IUD A;  1WVJ A;  1LGB C;  5I2N A;  5F7V A;  1II5 A;  1EZO A;  2HZL A;  3KBR A;  1ZTY A;  3PMV A;  4BDL A;  5TP9 A;  2OCU A;  3FZV A;  1J1N A;  1FQB A;  2UVJ A;  3MAM A;  3PD9 A;  1Z7N E;  1MXX A;  1B3E A;  1R9L A;  4XKN A;  5I58 A;  2ONS A;  1IQ7 A;  2HZK A;  4NF8 A;  4P11 A;  4DIG A;  1WOD A;  3ZS6 A;  3MC2 A;  1YPN A;  4JWY A;  3A3U A;  4H67 A;  4NF4 A;  5H8Q A;  2UVH A;  5DVI A;  4UA8 A;  5JTY B;  3O2A A;  1UTH A;  2ONK E;  4YKK A;  1JVY A;  1IXH A;  4EF2 A;  2RCA A;  2Z8F A;  1FTJ A;  4N6P A;  1FCK A;  2H25 A;  2O68 A;  1N7W A;  4IGR A;  4BDN A;  2HXW A;  4R2F A;  2O7I A;  5CM6 A;  2VD3 A;  1OLA A;  2F6G A;  1VSO A;  2V84 A;  3G3K A;  3MUQ A;  1OLC A;  2F34 A;  2Y7R A;  4F3S A;  2PVU A;  3A3C A;  1NH8 A;  5DTB A;  2O69 A;  3N5L A;  3UN6 A;  4F31 B;  3K6W A;  3SEV A;  4OER A;  3LSF B;  2IA4 A;  4E0X A;  3PUW E;  3C36 A;  1B0H A;  1P99 A;  3RY3 A;  1A54 A;  3LSW A;  2DVC A;  5KCJ A;  4Q30 B;  2XXT A;  1PB9 A;  4RYA A;  4PET A;  3JYR A;  4WXJ A;  3RTF B;  3Q25 A;  3HPI A;  1AMF A;  1L5T A;  5L9S A;  3KZG A;  4RK9 A;  3KEI A;  4GLI A;  4JXI A;  1WDN A;  4C1U A;  2DE4 A;  1MDP 1;  3K6V A;  4QFN A;  1SDX A;  3RNN A;  4RNS A;  5LOM A;  4K3F A;  1ZBM A;  2RIN A;  3DP8 A;  2RC8 A;  4NMY A;  1B1H A;  4BDO A;  3G3G A;  2QRY A;  1FQF A;  5H8S A;  5H8H A;  2Q2C A;  3RN8 A;  4QFP A;  1JVX A;  3UOR A;  3T96 B;  1NFT A;  4R73 A;  1B4Z A;  1NNF A;  5CI5 A;  2WOP A;  2Q88 A;  1FTO A;  4OXV A;  1VR5 A;  3KFM A;  3CFL A;  1I6A A;  4MF3 A;  2XHD A;  1FQA A;  1IZ1 A;  1QUK A;  2XXP A;  5BUU A;  1B5H A;  2DOJ A;  3G3H A;  4ECF A;  3OEN A;  1Q35 A;  1XHY A;  3ZSF A;  3W9V A;  1M5F A;  2ZYN A;  3W9W A;  1P1U A;  5CBR A;  2GH9 A;  1P1N A;  4F3G A;  4DCX A;  3R26 A;  1B6H A;  4IO5 A;  3MPL A;  1XOC A;  5F1Q A;  1M5C A;  5FTH A;  3H6T A;  5H8N B;  2I3V A;  4OTE A;  3QIM A;  3PPO A;  3O6G A;  1LAF E;  1SYI A;  4GQO A;  4EQ9 A;  2FA7 A;  2I4B A;  2B4M A;  5AA4 B;  1A8F A;  4YIC A;  3IO6 A;  1LFI A;  2QSX A;  4KQP A;  2RKM A;  1H43 A;  1I6B A;  4F18 A;  4G8M A;  4F39 A;  1VFE A;  1JW4 A;  4GIZ A;  4I1D A;  3CG1 A;  4ELR A;  5AA1 A;  4U1O A;  5KDT B;  2RC7 A;  1ATG A;  2DQV A;  1USY E;  2OWS A;  2I48 A;  2HAU A;  4X9T A;  2X7P A;  1NNT A;  3FVK A;  5JTY A;  4G68 B;  3FVN A;  3H03 A;  2G29 A;  2REJ A;  3FXR A;  5BWJ A;  4I62 A;  3THI A;  3RT8 A;  3VVF A;  4BDQ A;  3DM0 A;  4H8J A;  3G7W A;  4IO3 A;  2NVU B;  1UIV A;  2F36 A;  1LCT A;  2Q89 A;  5L8D A;  1D9V A;  1IXI A;  3QUF A;  2VGQ A;  4F2Q A;  1MDQ A;  4R6K A;  4X1D A;  3QUJ A;  1P1O A;  1CE2 A;  3B6Q A;  1LCF A;  2RCB A;  2CZL A;  3HCQ A;  4OHN A;  3D4G A;  5I2N B;  2ZXT A;  2ZNT A;  1URG A;  3CRB A;  5FHM A;  4P0I A;  1SW4 A;  1MQH A;  1A40 A;  1SD3 A;  2R9J A;  2XXV A;  3PAM A;  3SER A;  5I58 B;  3OEM A;  3PPQ A;  4NF5 B;  4KI0 E;  4OFO A;  3KOT A;  4NF8 B;  1H76 A;  1DPE A;  2CMO A;  3CVG A;  1N3X A;  1B3G A;  3RYB A;  1JQF A;  3L6G A;  1MPB A;  3O29 A;  4NF4 B;  3K02 A;  4XKP A;  1US5 A;  3QSL A;  3H4Z A;  3AXF A;  2QMW A;  3IJX B;  1MM7 A;  2OZZ A;  3TTL A;  3GZG A;  1XVX A;  1O64 A;  4NF6 B;  1PDA A;  1JET A;  3N94 A;  4NE4 A;  3B7D A;  1TFD A;  2NWJ A;  4FIM A;  4I9D A;  2O7U A;  3FJM A;  2B3B A;  4EDP A;  4OET A;  4L17 A;  2THI A;  4QSE A;  1MY3 A;  3U1O A;  4LVQ A;  1POT A;  2DWJ A;  3IK6 B;  4DLD A;  3T9H B;  3IOV A;  1QKB A;  3MZ1 A;  4F22 A;  1LAH E;  4G4P A;  3PUV E;  2WOK A;  1Y1M A;  3R7X A;  3OSQ A;  3EPE A;  2H4I A;  5H8N A;  4LZ7 A;  3IB0 A;  1M5B A;  4RXL A;  2Z8D A;  3BKI B;  2F7A A;  5KCJ B;  3CSG A;  1MQI A;  5AA4 A;  3IOW A;  1N76 A;  1B3F A;  2HAV A;  1FW0 A;  4RJZ A;  3ODB A;  4HW8 A;  5KDT A;  1PBP A;  4AB6 A;  3SEW A;  4KHZ E;  3N6U A;  2HFB A;  1LAX A;  3WAF A;  3VXC A;  2AL5 A;  3T9V A;  4G68 A;  1BIY A;  3DP4 A;  3FJG A;  1MXW A;  4G68 C;  1RYO A;  3UK4 A;  2XD2 A;  1XVY A;  1B40 A;  4KR5 A;  5FHO A;  1MRP A;  1SI1 A;  1Y9U A;  3T93 B;  2DWA A;  2I4C A;  3IB1 A;  4UAC A;  3ZKK A;  4DE8 A;  1LB8 A;  3FV2 A;  2ONR A;  4RY1 A;  4TLL B;  4ZE8 A;  2BJJ X;  4P0G A;  1SBP A;  4LAT A;  1R1N A;  2V93 A;  4EQ7 A;  5IKB A;  1BLF A;  3A09 A;  1OVB A;  1MQD A;  1SW2 A;  3OMB A;  3CIJ A;  1HSE A;  2OK2 A;  5AA2 D;  2B4L A;  3PD8 A;  5AE4 A;  1R6Z A;  1QJM A;  3RUM A;  3K6U A;  3CFZ A;  4OFL A;  3ECR A;  3G3F A;  2I58 A;  4XIG Q;  3JZJ A;  1LFH A;  3Q28 A;  1N3W A;  1D9Y A;  1FQC A;  3GXA A;  4NF5 A;  3S9M C;  2RF1 A;  4ZEC A;  1YTV A;  3MVW A;  4ELQ A;  3EN3 A;  1T0K A;  1IXG A;  2PT2 A;  5KZT A;  5ICT A;  2O51 A;  4PFT A;  2XXH A;  3KJT A;  4R6Y A;  1LLS A;  2PX1 A;  4NED A;  1Q1K A;  2DVZ A;  4GXA A;  3VVE A;  4FEB A;  1NNK A;  1Y20 A;  3V8X B;  1FTK A;  1US4 A;  5I59 B;  5ISU A;  2Y7P A;  4N07 A;  4NF6 A;  3VVD A;  3MPK A;  1KWH A;  1POY 1;  4RPN A;  3H6W A;  3FUZ A;  2E1S A;  2Y84 A;  4JSD A;  3V83 A;  3E4R A;  3U72 A;  1QUI A;  3I3V A;  2I6E A;  3O66 A;  3C9H A;  4KCC A;  1MXZ A;  2NUV A;  3K01 A;  4F1U A;  4H0W A;  3S2V A;  1TWY A;  5I56 B;  3N26 A;  4BDM A;  4OYV A;  3BFU A;  1GR2 A;  4GF8 A;  4YKJ A;  5EHM A;  3DLN A;  4G77 A;  3DRF A;  3TEP A;  4H1X A;  4H5G A;  4FOR A;  4U22 A;  3KSJ A;  4XXU A;  5M2V A;  3S4U A;  1PB7 A;  5A5X B;  3L6H A;  4KCD A;  4GVO A;  3PUY E;  2V3T A;  1VE4 A;  3TKD A;  1LAG E;  3B6W A;  4G2Z A;  1B5I A;  5CMB A;  2E0S A;  2DE3 A;  2Y7W A;  4OQO A;  2UYF A;  1LST A;  3E9X A;  1YAE A;  1MY2 A;  3RPW A;  2UVG A;  3KN3 A;  4WKM A;  1VFD A;  2DXY A;  1RKM A;  1DMB A;  3H6V A;  4MFI A;  1TFA A;  4OZ9 A;  1NMU A;  3VV5 A;  3FJ7 A;  5HBC A;  5EYF A;  3IX1 A;  1S9T A;  1Y3P A;  3TQW A;  2B65 A;  3RQT A;  4RPO A;  1LFG A;  4XKR A;  2GHA A;  3TTK A;  1XT8 A;  1YCJ A;  1O7T A;  2A5S A;  3KN8 A;  1GVC A;  4DDD A;  1FQE A;  2FNC A;  1USY H;  1DTZ A;  1ZMG A;  4QFO A;  4NTL A;  5DT6 A;  1MXY A;  1H45 A;  2HCA A;  3PPR A;  1AOV A;  2O1L A;  2O84 X;  4Q8R A;  1PBQ A;  3O97 A;  3H3G A;  3MP8 A;  4MH5 A;  4TOZ A;  1Y1Z A;  3MW0 A;  3MVZ A;  2QS2 A;  1B32 A;  4OFJ A;  3FAS A;  3RLF E;  4JB7 A;  5L9O A;  2ABH A;  3VDF A;  3ZKL A;  3OEK A;  2XXU A;  3ILU B;  4IY5 A;  3MVX A;  4RA1 A;  2F7B A;  4C1T A;  1EZP A;  1IIT A;  1B5J A;  1SW5 A;  1TXF A;  4THI A;  1P1W A;  4DXU A;  3C33 A;  2AYS A;  3U94 A;  4Q0C A;  1I69 A;  4YB5 A;  4YKP A;  3G3I A;  3PPN A;  4E0W A;  4ESX A;  4R72 A;  3SEU A;  1MM6 A;  3VLV A;  4U4S A;  3TAJ A;  3LUY A;  1DOT A;  3IJO B;  3IL1 B;  4PP0 A;  1DSN A;  4ZE9 A;  5I59 A;  1NNP A;  4QHQ A;  4ESW A;  3CG3 A;  3O6H A;  5JEI A;  2DP8 A;  1OIB A;  3S9E A;  4LQ2 A;  1JW5 A;  2UVI A;  1OMP A;  1B2H A;  2XXX A;  3OO8 A;  3BBR A;  3CR9 A;  4O3C A;  4MLV A;  1Y4C A;  2P2A A;  3K1M A;  4JSO A;  2ALU A;  1JW1 A;  4OVJ A;  4YB7 A;  4DZ1 A;  5TPA A;  2P1S A;  3B6T A;  5I56 A;  4QFL A;  4H5F A;  5K2Y A;  2VP1 A;  4QRZ A;  2XXW A;  3TZA A;  3FVO A;  1ZLQ A;  5ELV A;  2I3W A;  3DRI A;  2DWH A;  1Y3N A;  4F2O A;  3LBS A;  5A5X A;  4JBZ A;  4GFR A;  3KN7 A;  1PC3 A;  4XTC Q;  3M8U A;  5B70 A;  5TU0 A;  3H7M A;  2DSF A;  1AL3 A;  4TQU Q;  4DXC A;  5B7D A;  3V89 B;  3UIF A;  1N84 A;  3MWB A;  5DVF A;  3MBP A;  4G8H A;  2QL3 A;  4GWO A;  3PU5 A;  3FV1 A;  1MXV A;  4IO2 A;  4F1V A;  1ANF A;  4POX A;  3VE1 B;  5FHN A;  1B7H A;  3W15 C;  4LA9 A;  4EXL A;  3KGC A;  4WED A;  2D5W A;  3N6T A;  4O3A A;  2NOO A;  3PUX E;  5H8F A;  4GRK A;  1Y4T A;  1XS5 A;  2QPQ A;  3KJ7 A;  2PMS A;  3UGW A;  4LUB A;  3K4U A;  4IO6 A;  4ONY A;  1PEB A;  1JEV A;  3KG2 A;  3RGY A;  2XX7 A;  3QK6 A;  4POW A;  4ELP A;  2LAO A;  5AA3 A;  3TQL A;  1ZIU A;  4KPT A;  1N04 A;  3PMW A;  1ELJ A;  4IB2 A;  3IR1 A;  1HSJ A;  4F1Y A;  4X1B A;  5IAI A;  1H44 A;  1I6Q A;  3K1N A;  3M3L A;  3U93 A;  2F5X A;  3P7I A;  3E13 X;  3IOT A;  4H6D A;  1MY1 A;  1JNF A;  1HSL A;  4ZEI A;  2QS1 A;  2Y7I A;  2HEU A;  3T9U A;  3OO6 A;  4O3B A;  3KOS A;  3K1P A;  3K00 A;  5CMK A;  4HCY A;  3SET A;  4MBP A;  2Y7K A;  2DXR A;  1OQH A;  3LSX A;  2HQ0 A;  3SES A;  3K0V A;  5DEX B;  3EF7 A;  3TCG A;  3QYT A;  4OWD A;  1B3H A;  1B46 A;  2V25 A;  2X7Q A;  2AL4 A;  3TTN A;  4IY6 A;  4OMB A;  3K2D A;  1UQW A;  4KD5 A;  4IO4 A;  3O6I A;  1SI0 A;  2OLB A;  3K6X A;  2OWT A;  3TPA A;  3M3F A;  2B3F A;  2IEE A;  4I8C A;  3JV9 A;  3ONM A;  3VFJ A;  1B58 A;  2I0B A;  2H99 A;  4AQ4 A;  1NKX A;  4DCY A;  1MG1 A;  5HM4 B;  1B3L A;  1A99 A;  2XXI A;  2Q9T A;  3WAE A;  1H3D A;  2OJT A;  1PB8 A;  1GV8 A;  1GTK A;  1SW1 A;  2F8D A;  3OO9 A;  5AA2 A;  4ZS9 A;  3SEX A;  3BFT A;  4FE8 A;  2XXQ A;  3USD A;  4R74 A;  3RYA A;  4ZEK A;  5CBS A;  4PFU A;  4WEP A;  1UTB B;  1Y3Q A;  1MH4 A;  3HV1 A;  3HN0 A;  2I0C A;  3I6V A;  4QF9 A;  2G93 A;  3EHT A;  1QUL A;  1B52 A;  1LB9 A;  3GLB A;  5I2K B;  3FD3 A;  3TDJ A;  3D4C A;  5ITP A;  3HST A;  4HCW A;  5DVJ A;  4EUO A;  4M1V A;  2P0S A;  3LSL A;  3PV0 E;  1FTL A;  5TPA B;  4U2R A;  3MQ9 A;  5CMM A;  3V5A A;  5K2X A;  4KYE A;  4XKQ A;  1B7Z A;  1GGG A;  2AIX A;  3ILT B;  2ZYK A;  2PBW A;  4RK2 A;  1MH3 A;  3O9P A;  4BLA A;  2UYE A;  4JWO A;  4U4X A;  1SYH A;  4YKI A;  1AIV A;  1MY4 A;  2GHB A;  3PPP A;  2VHA A;  1D4N A;  2Z22 A;  2F78 A;  2Z23 A;  2XX8 A;  2VD2 A;  3F11 A;  3UP9 A;  2RC9 A;  4QFK A;  2QJE A;  2ZYM A;  4H8I A;  1B51 A;  3VLU A;  1B4H A;  3C32 A;  2A5T B;  3SEY A;  1BTJ A;  1LBB A;  4LQ5 A;  3TOD A;  2ZNS A;  1SQY A;  4DXB A;  4LP2 B;  4ZDM A;  3EHU A;  5CRY A;  4F3B A;  5JK4 A;  3DP6 A;  2W7Y A;  3DRH A;  1P1Q A;  1DTG A;  2ZNU A;  1OQG A;  3DRK A;  4YB6 A;  5DEX A;  4GOT A;  4JDF A;  4YAH X;  4EF1 A;  1URS A;  2DE2 A;  3PUZ E;  5H8F B;  2V3Q A;  3OSR A;  4U23 A;  4FJP A;  4PE5 B;  4ELO A;  3CI8 A;  2XX9 A;  1NH7 A;  2OBG A;  4C0R A;  1D3K A;  4TLM B;  4OEN A;  4AB5 A;  3S9L C;  3FVG A;  1SVX B;  3TTR A;  3E3K A;  1DPP A;  3IOU A;  3FIR A;  1FQD A;  1OVT A;  2Q2A A;  3FXQ A;  2X26 A;  1AH5 A;  2M8C A;  3MZB A;  3DRJ A;  4OEV A;  1XC1 A;  2XD3 A;  1BP5 A;  5HPQ A;  1B0L A;  4ZZE A;  3OOA A;  3TFL A;  4QSD A;  2O1M A;  1A55 A;  2REG A;  1EH3 A;  4LZ5 A;  4PFW A;  1EZ9 A;  4OEU A;  4GL0 A;  2PYY A;  4R75 A;  3CSB A;  3U8Q A;  3C34 A;  2GRV A;  3PMX A;  4YMA A;  4G8N A;  1UTB A;  3O6P A;  1M5E A;  2GFE A;  2DYX A;  3DEL B;  4ZEF A;  3H6U A;  4M4G A;  4FEC A;  2ANJ A;  1BKA A;  3PGF A;  1QUJ A;  3MP6 A;  4NWC A;  2FYI A;  3HHG A;  5I2K A;  3H06 B;  4KFQ A;  1N0T A;  3MZ9 A;  2F6P A;  3M3K A;  3T22 A;  2XXR A;  1MQG A;  1NL5 A;  4N13 A;  2KLF A;  4LZ8 A;  4ZEB A;  5J1D A;  3DRG A;  1R9Q A;  5I57 B;  3LR1 A;  3TUS A;  4GXS B;  4FED A;  2DS9 A;  5CMC A;  3CHG A;  1TT1 A;  5I84 A;  4F19 A;  3T9X B;  1A7L A;  2YLN A;  2VOZ A;  4KYS A;  3FXU A;  4X48 A;  4YMB A;  5TP9 B;  3RT6 B;  3EQ1 A;  4Z0I A;  4R2B A;  4GD5 A;  5EHS A;  3IB2 A;  4PQJ A;  1MQJ A;  4ZED A;  1MS7 A;  1JEU A;  3HO7 A;  3Q27 A;  4R9F A;  3TCH A;  2H5Y A;  5AA2 B;  3LC8 A;  3OEL A;  4KYD A;  3QAX A;  1F9B A;  3FAT A;  2F35 A;  2YPN A;  2A5T A;  4ISU A;  3OXN A;  3TMG A;  2O6A A;  4Q5T A;  5H8Q B;  2XXY A;  2R6G E;  3VLW A;  1B9J A;  3C31 A;  4YZZ A;  3MJN A;  4IO7 A;  3Q26 A;  5CC2 A;  4IGT A;  4MLQ A;  3OD7 A;  3CFX A;  4EQB A;  5ICQ A;  1IEJ A;  3MVY A;  1UTH B;  3EHS A;  4FAJ A;  3TCF A;  1Z7M E;  4EXK A;  1B05 A;  1ZKB A;  3TTM A;  1B7U A;  2D3I A;  2H98 A;  1MPC A;  4HS7 A;  5DYH A;  2F97 A;  3OO7 A;  4HTG A;  4OES A;  3IOR A;  1QVS A;  2YJP A;  5ITO A;  2R71 A;  3RTW B;  4NWD A;  1ZU0 A;  1M5D A;  1RYX A;  1MY0 A;  1N7X A;  1O63 A;  1QKA A;  3TEL A;  2ESN A;  3SKP A;  2WKY A;  3C4M A;  4LON B;  2WOL A;  4F29 A;  1LBC A;  3R6U A;  2NXO A;  4ND9 A;  1IXC A;  3G3J A;  2ZMB A;  4R6H A;  4ZZA A;  4U21 A;  1IIW A;  4F3P A;  3IAZ A;  2V3U A;  3IO4 A;  1A8E A;  1UIU A;  3O28 A;  4R9G A;  2DWI A;  1B1X A;  1MXU A;  4H65 A;  1ZJL A;  3I5O A;  4GL8 A;  3FTO A;  1FTM A;  3U92 A;  2I49 A;  4YU0 A;  4FAT A;  4Z7E A;  3SDF A;  2D21 A;  3GBA A;  3HHF A;  2QMX A;  5FTI A;  2H9B A;  1S7Y A;  2QS4 A;  4QSC A;  1QW0 A;  2Z8E A;  4BDR A;  1EU8 A;  1S50 A;  3C35 A;  3MP1 A;  5H8H B;  1MPD A;  4JWX A;  3Q29 A;  4U1Z A;  2UXA A;  2ZYO A;  3LVU A;  3T66 A;  1URD A;  3VXB A;  3GBB A;  2Q8J A;  3KSX A;  2QS3 A;  5L9M A;  3UA8 A;  2F7C A;  3FGS A;  3S9N C;  5I57 A; 
#chains in the Genus database with same CATH topology
 1CB6 A;  4PFY A;  3QXM A;  2PT1 A;  4KXP A;  3TYH A;  1IUD A;  1WVJ A;  1LGB C;  5I2N A;  5F7V A;  1II5 A;  2Q8M A;  1EZO A;  2HZL A;  3KBR A;  3T1B A;  1ZTY A;  3PMV A;  4MNC A;  4BDL A;  5TP9 A;  2OCU A;  3FZV A;  1J1N A;  1FQB A;  2UVJ A;  3MAM A;  3PD9 A;  1Z7N E;  1MXX A;  1B3E A;  1R9L A;  4XKN A;  5I58 A;  2ONS A;  1IQ7 A;  2HZK A;  4NF8 A;  2Q74 A;  4P11 A;  4DIG A;  2WEF A;  1WOD A;  3ZS6 A;  3RPL B;  3MC2 A;  3FBP A;  1YPN A;  4JWY A;  3A3U A;  4H67 A;  4NF4 A;  5H8Q A;  2UVH A;  5DVI A;  2CEX A;  4UA8 A;  5JTY B;  4O8M A;  3O2A A;  1UTH A;  2ONK E;  1FBD A;  4YKK A;  1JVY A;  1IXH A;  4EF2 A;  2RCA A;  2Z8F A;  1FTJ A;  4N6P A;  1FCK A;  2H25 A;  2O68 A;  1N7W A;  4IGR A;  4BDN A;  2HXW A;  4R2F A;  2O7I A;  5CM6 A;  2VD3 A;  1LBV A;  1OLA A;  2F6G A;  1VSO A;  4I3Y A;  2V84 A;  3G3K A;  4GWU A;  3MUQ A;  1OLC A;  2F34 A;  2Y7R A;  4F3S A;  2PVU A;  1NV4 A;  3A3C A;  1NH8 A;  5DTB A;  2O69 A;  3N5L A;  1FPD A;  1RDX A;  3UN6 A;  5I7I A;  4MNP A;  4F31 B;  3K6W A;  3SEV A;  4OER A;  3GYY A;  3LSF B;  2IA4 A;  4E0X A;  3PUW E;  3C36 A;  2XWI A;  1JP4 A;  1B0H A;  1FBH A;  1P99 A;  3RY3 A;  5ET6 A;  1A54 A;  3LSW A;  1FBG A;  2DVC A;  5KCJ A;  4Q30 B;  1G0H A;  2XXT A;  1DK4 A;  1PB9 A;  4RYA A;  4PET A;  3JYR A;  4WXJ A;  3RTF B;  3Q25 A;  3HPI A;  1AMF A;  1L5T A;  5L9S A;  3KZG A;  1LBX A;  4RK9 A;  3KEI A;  1LEV A;  4GLI A;  4JXI A;  1WDN A;  4C1U A;  2DE4 A;  1MDP 1;  3HFU A;  4QFN A;  1SDX A;  3K6V A;  3RNN A;  4RNS A;  5LOM A;  4K3F A;  1ZBM A;  2RIN A;  3DP8 A;  2RC8 A;  4NMY A;  1B1H A;  4BDO A;  1FRP A;  4PGP A;  2KQZ A;  3G3G A;  2QRY A;  1FQF A;  4MIJ A;  5H8S A;  5H8H A;  4O7M A;  2Q2C A;  2XXK A;  4QFP A;  3RN8 A;  1JVX A;  3UOR A;  3T96 B;  1NFT A;  4R73 A;  1B4Z A;  1NNF A;  5CI5 A;  2WOP A;  2Q88 A;  1FTO A;  4OXV A;  1VR5 A;  3KFM A;  3CFL A;  1I6A A;  4MF3 A;  1IME A;  2XHD A;  3KC1 A;  5EQ9 A;  1FQA A;  1IZ1 A;  1QUK A;  2XXP A;  5BUU A;  1B5H A;  2DOJ A;  3G3H A;  4ECF A;  3OEN A;  1Q35 A;  1XHY A;  3ZSF A;  3W9V A;  1M5F A;  2ZYN A;  3W9W A;  1P1U A;  5J16 A;  2XA5 A;  5CBR A;  2GH9 A;  1P1N A;  4F3G A;  4DCX A;  3R26 A;  1B6H A;  4AS4 A;  4IO5 A;  3MPL A;  1XOC A;  5F1Q A;  1M5C A;  3FXB A;  5FTH A;  3H6T A;  5H8N B;  2I3V A;  4OTE A;  4MEV A;  3QIM A;  3PPO A;  3O6G A;  1LAF E;  1SYI A;  4GQO A;  4EQ9 A;  2FA7 A;  2I4B A;  2B4M A;  5AA4 B;  1A8F A;  4YIC A;  3IO6 A;  1LFI A;  2QSX A;  4KQP A;  2RKM A;  1H43 A;  1I6B A;  4F18 A;  4G8M A;  4F39 A;  1VFE A;  1JW4 A;  4GIZ A;  4I1D A;  4N17 A;  3CG1 A;  4ELR A;  5AA1 A;  4U1O A;  4OVQ A;  5KDT B;  2RC7 A;  1ATG A;  2DQV A;  1USY E;  2OWS A;  2I48 A;  5IZ3 A;  3RYD A;  2HAU A;  4X9T A;  2X7P A;  1NNT A;  3FVK A;  5JTY A;  4G68 B;  3FVN A;  3H03 A;  2KR0 A;  2G29 A;  2REJ A;  3FXR A;  4MHF A;  5BWJ A;  4I62 A;  3THI A;  4GX6 A;  3RT8 A;  3VVF A;  4PCD A;  4BDQ A;  2QVV A;  3DM0 A;  4H8J A;  3G7W A;  4IO3 A;  2NVU B;  1UIV A;  2F36 A;  1LCT A;  4GBV A;  2Q89 A;  2HHM A;  5L8D A;  1D9V A;  1IXI A;  3QUF A;  2VGQ A;  4F2Q A;  1MDQ A;  4R6K A;  4X1D A;  3QUJ A;  1P1O A;  1CE2 A;  3B6Q A;  1LCF A;  2RCB A;  2CZL A;  3HCQ A;  4OHN A;  3D4G A;  5I2N B;  2ZXT A;  1IMF A;  2BJI A;  2ZNT A;  1URG A;  3CRB A;  5FHM A;  4P3L A;  4P0I A;  1SW4 A;  1MQH A;  1A40 A;  1SD3 A;  1FBC A;  2R9J A;  4N6D A;  4GWZ A;  2XXV A;  3PAM A;  3SER A;  1IMA A;  1FPG A;  3OEM A;  5I58 B;  3PPQ A;  4NF5 B;  3EKI A;  3SZP A;  4KI0 E;  4OFO A;  3KOT A;  4NF8 B;  1H76 A;  4PAF A;  1DPE A;  2CMO A;  3CVG A;  1N3X A;  1B3G A;  3RYB A;  1JQF A;  3L6G A;  1MPB A;  4G61 A;  3O29 A;  2F3B A;  4NF4 B;  3K02 A;  1Q9D A;  4HE0 A;  5LDZ A;  4XKP A;  1US5 A;  5ESY A;  3QSL A;  3H4Z A;  3AXF A;  4PFI A;  2QMW A;  3IJX B;  1MM7 A;  2OZZ A;  3TTL A;  3GZG A;  1XVX A;  1O64 A;  2CZH A;  4NF6 B;  1PDA A;  1JET A;  3N94 A;  4NE4 A;  3B7D A;  1TFD A;  2NWJ A;  4FIM A;  3B50 A;  4I9D A;  2O7U A;  3FJM A;  4HXV A;  2B3B A;  2ZZW A;  2R8T A;  4EDP A;  4OET A;  4L17 A;  2THI A;  4QSE A;  1MY3 A;  3U1O A;  4LVQ A;  1POT A;  2DWJ A;  4PF8 A;  3IK6 B;  4DLD A;  3T9H B;  3IOV A;  1QKB A;  3MZ1 A;  4F22 A;  1LAH E;  4G4P A;  3PUV E;  2WOK A;  1FSA A;  1Y1M A;  4LN5 A;  3R7X A;  3OSQ A;  3EPE A;  1FPK A;  2H4I A;  5H8N A;  4LZ7 A;  4PDD A;  3IB0 A;  1M5B A;  4RXL A;  2Z8D A;  3BKI B;  2F7A A;  5KCJ B;  3CSG A;  1MQI A;  5AA4 A;  2ZZV A;  3IOW A;  1N76 A;  1B3F A;  4GBW A;  2HAV A;  1FW0 A;  4NQ8 A;  3IFC A;  4RJZ A;  3ODB A;  4HW8 A;  1INP A;  5KDT A;  1PBP A;  4AB6 A;  3SEW A;  4KHZ E;  3N6U A;  2CEY A;  2HFB A;  1LAX A;  3WAF A;  3VXC A;  2AL5 A;  3T9V A;  4G68 A;  4OVS A;  4P1E A;  1BIY A;  3DP4 A;  3FJG A;  1MXW A;  4G68 C;  1RYO A;  3UK4 A;  2XD2 A;  1XVY A;  1B40 A;  4KR5 A;  5FHO A;  1MRP A;  4NX1 A;  4PC9 A;  1SI1 A;  1Y9U A;  3T93 B;  1EYI A;  2DWA A;  2I4C A;  3IB1 A;  4UAC A;  3ZKK A;  4DE8 A;  1LB8 A;  3FV2 A;  2ONR A;  4RY1 A;  4TLL B;  4ZE8 A;  4P1L A;  2BJJ X;  4P0G A;  1SBP A;  4LAT A;  1R1N A;  2V93 A;  4EQ7 A;  5IKB A;  1BLF A;  3A09 A;  3MYU A;  4FBP A;  1OVB A;  2ZZX A;  4JVI A;  1MQD A;  1SW2 A;  1YXI A;  3OMB A;  2QFL A;  3CIJ A;  1HSE A;  2OK2 A;  5AA2 D;  2B4L A;  2DDK A;  3PD8 A;  1NUW A;  5AE4 A;  1R6Z A;  1QJM A;  3RUM A;  1NV5 A;  3K6U A;  2GQ1 A;  3CFZ A;  4OFL A;  3ECR A;  3G3F A;  2I58 A;  4XIG Q;  3JZJ A;  1LFH A;  3Q28 A;  1N3W A;  1D9Y A;  1FQC A;  3GXA A;  4NF5 A;  3S9M C;  2RF1 A;  4ZEC A;  1YTV A;  3MVW A;  3MST A;  4ELQ A;  3EN3 A;  1T0K A;  1IXG A;  2PT2 A;  5KZT A;  5ICT A;  2O51 A;  4PFT A;  2XXH A;  3KJT A;  4R6Y A;  1LLS A;  2PX1 A;  4NED A;  5IZ3 B;  1Q1K A;  2DVZ A;  4GXA A;  3VVE A;  4FEB A;  1NNK A;  2VPO A;  3LV0 A;  1FPB A;  4N6K A;  1Y20 A;  3V8X B;  4N81 A;  1FTK A;  1US4 A;  5I59 B;  5ISU A;  2Y7P A;  4N07 A;  1SPI A;  1NV1 A;  4NF6 A;  3VVD A;  3MPK A;  1KWH A;  1POY 1;  4RPN A;  3H6W A;  2FIE A;  3FUZ A;  2E1S A;  2Y84 A;  4JSD A;  5EYG A;  4UAB A;  3V83 A;  1FBF A;  3U65 A;  3E4R A;  3U72 A;  1QUI A;  3I3V A;  2I6E A;  3O66 A;  3C9H A;  4KCC A;  4XFE A;  1MXZ A;  2NUV A;  3K01 A;  4F1U A;  4H0W A;  3S2V A;  1TWY A;  5I56 B;  3N26 A;  4BDM A;  4OYV A;  3BFU A;  1GR2 A;  4GF8 A;  1NI9 A;  4N91 A;  1VDW A;  4YKJ A;  5EHM A;  3DLN A;  4G77 A;  3DRF A;  3TEP A;  4H1X A;  5EQ8 A;  4H5G A;  4GWY A;  4FOR A;  4U22 A;  3KSJ A;  4XXU A;  5M2V A;  3S4U A;  1PB7 A;  5A5X B;  1EYK A;  3L6H A;  4KCD A;  4GVO A;  5I3S A;  3PUY E;  2V3T A;  1VE4 A;  3TKD A;  1LAG E;  3B6W A;  4G2Z A;  1B5I A;  5CMB A;  2E0S A;  2DE3 A;  2Y7W A;  4OQO A;  2UYF A;  1LST A;  1KA0 A;  3E9X A;  1YAE A;  1MY2 A;  4P47 A;  3RPW A;  2UVG A;  3KN3 A;  4WKM A;  1VFD A;  4QXD A;  2VT5 A;  1K9Y A;  2DXY A;  1RKM A;  1DMB A;  3H6V A;  4MFI A;  1TFA A;  4OZ9 A;  1NMU A;  3VV5 A;  3FJ7 A;  5HBC A;  2PCR A;  5EYF A;  3IX1 A;  1S9T A;  1KA1 A;  1Y3P A;  3TQW A;  2B65 A;  2MKZ A;  3RQT A;  4RPO A;  1LFG A;  4XKR A;  2GHA A;  3TTK A;  1XT8 A;  1YCJ A;  1O7T A;  2A5S A;  4PDH A;  3KN8 A;  1GVC A;  4DDD A;  1FQE A;  2FNC A;  1USY H;  5IZ1 A;  1DTZ A;  1ZMG A;  4QFO A;  4NTL A;  5DT6 A;  5LTC A;  1MXY A;  1H45 A;  2HCA A;  3PPR A;  4GX3 A;  1AOV A;  1NV2 A;  2O1L A;  2PFY A;  2O84 X;  3KBZ A;  4Q8R A;  1PBQ A;  3O97 A;  3H3G A;  3MP8 A;  4MH5 A;  4TOZ A;  3ROJ A;  1Y1Z A;  4I3E A;  3MW0 A;  3MVZ A;  2QS2 A;  1B32 A;  4OFJ A;  3FAS A;  3RLF E;  4JB7 A;  2JJK A;  5L9O A;  2ABH A;  2OX3 A;  3VDF A;  1BK4 A;  3ZKL A;  3KC0 A;  3OEK A;  2XWK A;  2XXU A;  3ILU B;  4IY5 A;  3MVX A;  4RA1 A;  2F7B A;  4C1T A;  1EZP A;  4DI4 B;  1IIT A;  4GWX A;  1B5J A;  1SW5 A;  1TXF A;  4NG7 A;  3A29 A;  4P9K A;  1P1W A;  4THI A;  4DXU A;  3C33 A;  1LBY A;  2AYS A;  3U94 A;  4Q0C A;  1I69 A;  2QVR A;  4N8Y A;  4YB5 A;  4YKP A;  3G3I A;  4MX6 A;  3PPN A;  4E0W A;  1NUY A;  4ESX A;  4R72 A;  3SEU A;  5ET8 A;  1MM6 A;  3VLV A;  4U4S A;  3TAJ A;  3LUY A;  1DOT A;  3IJO B;  3IL1 B;  4PP0 A;  1DSN A;  4ZE9 A;  5I59 A;  1NNP A;  2P3V A;  4QHQ A;  4ESW A;  1RDY A;  3CG3 A;  3O6H A;  5JEI A;  2DP8 A;  1OIB A;  3S9E A;  4LQ2 A;  1JW5 A;  2UVI A;  4OVR A;  1OMP A;  4DI3 D;  1B2H A;  2XXX A;  1FPJ A;  3OO8 A;  3BBR A;  3CR9 A;  4O3C A;  4MLV A;  1Y4C A;  2P2A A;  3K1M A;  4JSO A;  2ALU A;  1JW1 A;  4OVJ A;  4YB7 A;  4DZ1 A;  5TPA A;  2P1S A;  3B6T A;  5I56 A;  4QFL A;  4H5F A;  5K2Y A;  2VP1 A;  4QRZ A;  2XXW A;  3TZA A;  1RDZ A;  3FVO A;  5EQA A;  1ZLQ A;  5ELV A;  5I5P A;  1YYZ A;  2I3W A;  3DRI A;  2DWH A;  1Y3N A;  4F2O A;  3LBS A;  2F3D A;  5A5X A;  4JBZ A;  4GFR A;  3KN7 A;  1PC3 A;  5DW8 A;  4XTC Q;  3M8U A;  5B70 A;  1FPL A;  3H7M A;  2DSF A;  5TU0 A;  1AL3 A;  4TQU Q;  4DXC A;  5B7D A;  4O7I A;  2L5V A;  5IZZ A;  4MCO A;  3V89 B;  3UIF A;  1N84 A;  3MWB A;  1IMC A;  3MBP A;  5DVF A;  4G8H A;  2QL3 A;  4GWO A;  3PU5 A;  3FV1 A;  2XWV A;  4XEQ A;  1MXV A;  4IO2 A;  4F1V A;  4OVP A;  1ANF A;  4POX A;  4AS5 A;  3VE1 B;  5FHN A;  1B7H A;  3W15 C;  4LA9 A;  4NN3 A;  4EXL A;  3KGC A;  4WED A;  2D5W A;  3N6T A;  4O3A A;  2NOO A;  3PUX E;  5H8F A;  4GRK A;  1Y4T A;  1XS5 A;  2QPQ A;  3KJ7 A;  2PMS A;  4H45 A;  3UGW A;  4LUB A;  3K4U A;  4IO6 A;  2HXR A;  4ONY A;  1PEB A;  1JEV A;  2VPN A;  3KG2 A;  4NGU A;  4IR8 A;  3RGY A;  2XX7 A;  3QK6 A;  4POW A;  4ELP A;  2LAO A;  5AA3 A;  3TQL A;  1ZIU A;  4KPT A;  1N04 A;  3PMW A;  1ELJ A;  4IB2 A;  3IR1 A;  1HSJ A;  3ISP A;  4F1Y A;  4MAG A;  4X1B A;  5IAI A;  1H44 A;  5EYH A;  1I6Q A;  1FJ6 A;  3K1N A;  3M3L A;  3U93 A;  2F5X A;  3P7I A;  3E13 X;  3IOT A;  4H6D A;  1MY1 A;  1JNF A;  1HSL A;  4MNI A;  4ZEI A;  2QS1 A;  2Y7I A;  2HEU A;  2CZK A;  3T9U A;  3E79 A;  3OO6 A;  4O3B A;  3KOS A;  3K1P A;  3K00 A;  5CMK A;  4HCY A;  3SET A;  4MBP A;  2Y7K A;  2DXR A;  1OQH A;  3LSX A;  2HQ0 A;  3SES A;  3K0V A;  5DEX B;  3EF7 A;  1YZ0 A;  3TCG A;  1NV6 A;  4OWD A;  3QYT A;  1B3H A;  1B46 A;  1G0I A;  2V25 A;  2X7Q A;  1FPF A;  5IGA A;  2AL4 A;  3TTN A;  4IY6 A;  4OMB A;  3K2D A;  4KD5 A;  1UQW A;  4IO4 A;  3O6I A;  1SI0 A;  2OLB A;  3K6X A;  2OWT A;  3TPA A;  3M3F A;  2B3F A;  2IEE A;  4I8C A;  3JV9 A;  3ONM A;  3VFJ A;  1B58 A;  2P3N A;  2I0B A;  2H99 A;  4AQ4 A;  1NKX A;  1KZ8 A;  4DCY A;  1MG1 A;  5HM4 B;  4I40 A;  1B3L A;  1A99 A;  2XXI A;  2Q9T A;  3WAE A;  1H3D A;  4OVT A;  2OJT A;  1PB8 A;  1GV8 A;  1NUZ A;  5IM2 A;  1GTK A;  1SW1 A;  2F8D A;  3OO9 A;  5AA2 A;  4ZS9 A;  2CZI A;  3SEX A;  4GWW A;  3BFT A;  4FE8 A;  2XXQ A;  3USD A;  3T0J A;  4R74 A;  3RYA A;  4ZEK A;  5CBS A;  4PFU A;  4WEP A;  1UTB B;  1Y3Q A;  1MH4 A;  4MMP A;  3HV1 A;  3HN0 A;  2I0C A;  2WX9 A;  3I6V A;  4QF9 A;  2G93 A;  3EHT A;  4H46 A;  1QUL A;  1B52 A;  1LB9 A;  3GLB A;  5I2K B;  3FD3 A;  3TDJ A;  1NUX A;  1FBP A;  4PFB A;  3D4C A;  3LUZ A;  5ITP A;  3HST A;  4X8R A;  4P56 A;  4HCW A;  5DVJ A;  4EUO A;  4M1V A;  2P0S A;  3LSL A;  3PV0 E;  1FTL A;  3QMF A;  5TPA B;  4U2R A;  3MQ9 A;  5CMM A;  3V5A A;  5K2X A;  4KYE A;  4XKQ A;  1B7Z A;  1GGG A;  2AIX A;  3ILT B;  2ZYK A;  1EYJ A;  2PBW A;  4RK2 A;  1MH3 A;  3O9P A;  4NHB A;  4BLA A;  2UYE A;  4JWO A;  4U4X A;  1SYH A;  4YKI A;  1AIV A;  1MY4 A;  2GHB A;  3PPP A;  2VHA A;  1D4N A;  2Z22 A;  2F78 A;  2Z23 A;  2XX8 A;  2VD2 A;  3F11 A;  3UP9 A;  5EQ7 A;  2RC9 A;  4QFK A;  2QJE A;  2ZYM A;  1DBZ A;  4H8I A;  1B51 A;  1K9Z A;  3VLU A;  1B4H A;  3C32 A;  2A5T B;  3SEY A;  1BTJ A;  1LBB A;  4LQ5 A;  3TOD A;  1NV0 A;  2ZNS A;  4JVC A;  1SQY A;  4DXB A;  4LP2 B;  4ZDM A;  3EHU A;  1CNQ A;  5CRY A;  4F3B A;  5JK4 A;  3DP6 A;  5ET5 A;  3D1R A;  2W7Y A;  3DRH A;  2FVZ A;  1P1Q A;  1DTG A;  4PE3 A;  2ZNU A;  1OQG A;  3DRK A;  4YB6 A;  2FIX A;  5DEX A;  4GOT A;  4JDF A;  5ET7 A;  4YAH X;  4EF1 A;  2HPG A;  1URS A;  2DE2 A;  5FBP A;  3PUZ E;  5H8F B;  2V3Q A;  3OSR A;  4U23 A;  2FHY A;  4FJP A;  4PE5 B;  4ELO A;  3CI8 A;  2XX9 A;  1NH7 A;  2OBG A;  1LBZ A;  4C0R A;  1D3K A;  4TLM B;  1IMD A;  4OEN A;  4AB5 A;  4PFR A;  3S9L C;  3FVG A;  1SVX B;  3TTR A;  3E3K A;  1DPP A;  3IOU A;  3FIR A;  1FQD A;  1OVT A;  2Q2A A;  3FXQ A;  2X26 A;  1AH5 A;  2M8C A;  3MZB A;  3DRJ A;  4OEV A;  1XC1 A;  2XD3 A;  2Y5L A;  1BP5 A;  5HPQ A;  2Y5K A;  1B0L A;  4ZZE A;  3OOA A;  3TFL A;  4QSD A;  2O1M A;  1A55 A;  2REG A;  1FTA A;  1EH3 A;  2WYK A;  4LZ5 A;  4PFW A;  1EZ9 A;  3BIG A;  4OEU A;  3B8B A;  4GL0 A;  3RPL A;  2PYY A;  4R75 A;  3CSB A;  3U8Q A;  3C34 A;  2GRV A;  3PMX A;  4YMA A;  4G8N A;  1UTB A;  3O6P A;  1M5E A;  2GFE A;  2DYX A;  3DEL B;  4ZEF A;  4PTK A;  3H6U A;  3NOH A;  2FBP A;  4M4G A;  4FEC A;  2ANJ A;  4XF5 A;  1BKA A;  2WBB A;  1QUJ A;  3MP6 A;  3PGF A;  4NWC A;  2FYI A;  3HHG A;  4GWS A;  5I2K A;  3H06 B;  4KFQ A;  1N0T A;  3MZ9 A;  2F6P A;  3M3K A;  3T22 A;  2XXR A;  1MQG A;  1NL5 A;  4N13 A;  1QGX A;  2KLF A;  4LZ8 A;  4NAP A;  4ZEB A;  5J1D A;  3DRG A;  2WYP A;  1R9Q A;  5I57 B;  5T3J A;  3LR1 A;  3TUS A;  4GXS B;  4PF6 A;  4FED A;  2DS9 A;  5CMC A;  3CHG A;  1TT1 A;  4O94 A;  5I84 A;  4F19 A;  3T9X B;  1A7L A;  2YLN A;  2VOZ A;  4KYS A;  3FXU A;  4X48 A;  4YMB A;  5TP9 B;  3RT6 B;  3EQ1 A;  4Z0I A;  4R2B A;  4GD5 A;  5EHS A;  3IB2 A;  4PQJ A;  1MQJ A;  4ZED A;  1MS7 A;  1JEU A;  3HO7 A;  3Q27 A;  2PFZ A;  4R9F A;  1FPI A;  3TCH A;  2H5Y A;  4OAN A;  5AA2 B;  3LC8 A;  3OEL A;  4KYD A;  3QAX A;  1F9B A;  3FAT A;  2F35 A;  2YPN A;  1XI6 A;  2OWZ A;  2A5T A;  4ISU A;  3OXN A;  3TMG A;  2O6A A;  4Q5T A;  5H8Q B;  1NV7 A;  2XXY A;  2R6G E;  3VLW A;  1B9J A;  3C31 A;  4YZZ A;  3MJN A;  4IO7 A;  3Q26 A;  5CC2 A;  4IGT A;  4MLQ A;  3OD7 A;  2WBD A;  3CFX A;  4EQB A;  5ICQ A;  1IEJ A;  3MVY A;  1UTH B;  3EHS A;  4FAJ A;  3TCF A;  1Z7M E;  3PTY A;  2QVU A;  4EXK A;  1B05 A;  1ZKB A;  3TTM A;  1B7U A;  1DCU A;  2V4C A;  5A5L A;  2D3I A;  2H98 A;  1MPC A;  4HS7 A;  5DYH A;  2F97 A;  4X04 A;  3OO7 A;  4HTG A;  1NV3 A;  4OES A;  3IOR A;  1FPE A;  1QVS A;  2YJP A;  5ITO A;  2R71 A;  3RTW B;  4NWD A;  1ZU0 A;  1M5D A;  4GX4 A;  4MJO A;  1RYX A;  3E78 A;  1MY0 A;  1N7X A;  1O63 A;  4QBA A;  1QKA A;  3TEL A;  2ESN A;  2WKY A;  3SKP A;  3C4M A;  4PBQ A;  4PBH A;  4PAK A;  4LON B;  3BIH A;  2WOL A;  4F29 A;  4N4U A;  1LBC A;  3R6U A;  2NXO A;  4ND9 A;  1FJ9 A;  1IXC A;  4P8B A;  3G3J A;  4HE2 A;  2ZMB A;  4R6H A;  4N8G A;  4NF0 A;  4ZZA A;  4U21 A;  1FBE A;  1IIW A;  4PAI A;  4F3P A;  3IAZ A;  2V3U A;  3IO4 A;  1A8E A;  1UIU A;  3O28 A;  4R9G A;  2DWI A;  1B1X A;  1MXU A;  4H65 A;  1IMB A;  1ZJL A;  3I5O A;  4OA4 A;  4GL8 A;  3FTO A;  1FTM A;  3U92 A;  2I49 A;  4YU0 A;  4FAT A;  4N15 A;  4Z7E A;  3SDF A;  2D21 A;  3GBA A;  5F24 A;  3HHF A;  2QMX A;  5FTI A;  2H9B A;  1S7Y A;  2QS4 A;  4QSC A;  1QW0 A;  2Z8E A;  4BDR A;  1EU8 A;  1S50 A;  4JVD A;  1D9Q A;  3C35 A;  3MP1 A;  5H8H B;  1MPD A;  4JWX A;  3Q29 A;  1LBW A;  4U1Z A;  4HE1 A;  2UXA A;  2ZYO A;  3LVU A;  3T66 A;  1URD A;  3VXB A;  3GBB A;  1AWB A;  2Q8J A;  3KSX A;  2QS3 A;  5L9M A;  3IFA A;  3UA8 A;  2F7C A;  3FGS A;  3S9N C;  4PGN A;  5I57 A;  2XWO A; 
#chains in the Genus database with same CATH homology
 1CB6 A;  4PFY A;  3QXM A;  2PT1 A;  3TYH A;  1IUD A;  1WVJ A;  1LGB C;  5I2N A;  5F7V A;  1II5 A;  1EZO A;  2HZL A;  3KBR A;  1ZTY A;  3PMV A;  4BDL A;  5TP9 A;  2OCU A;  3FZV A;  1J1N A;  1FQB A;  2UVJ A;  3MAM A;  3PD9 A;  1Z7N E;  1MXX A;  1B3E A;  1R9L A;  4XKN A;  5I58 A;  2ONS A;  1IQ7 A;  2HZK A;  4NF8 A;  4P11 A;  4DIG A;  1WOD A;  3ZS6 A;  3MC2 A;  1YPN A;  4JWY A;  3A3U A;  4H67 A;  4NF4 A;  5H8Q A;  2UVH A;  5DVI A;  4UA8 A;  5JTY B;  3O2A A;  1UTH A;  2ONK E;  4YKK A;  1JVY A;  1IXH A;  4EF2 A;  2RCA A;  2Z8F A;  1FTJ A;  4N6P A;  1FCK A;  2H25 A;  2O68 A;  1N7W A;  4IGR A;  4BDN A;  2HXW A;  4R2F A;  2O7I A;  5CM6 A;  2VD3 A;  1OLA A;  2F6G A;  1VSO A;  2V84 A;  3G3K A;  3MUQ A;  1OLC A;  2F34 A;  2Y7R A;  4F3S A;  2PVU A;  3A3C A;  1NH8 A;  5DTB A;  2O69 A;  3N5L A;  3UN6 A;  4F31 B;  3K6W A;  3SEV A;  4OER A;  3LSF B;  2IA4 A;  4E0X A;  3PUW E;  3C36 A;  1B0H A;  1P99 A;  3RY3 A;  1A54 A;  3LSW A;  2DVC A;  5KCJ A;  4Q30 B;  2XXT A;  1PB9 A;  4RYA A;  4PET A;  3JYR A;  4WXJ A;  3RTF B;  3Q25 A;  3HPI A;  1AMF A;  1L5T A;  5L9S A;  3KZG A;  4RK9 A;  3KEI A;  4GLI A;  4JXI A;  1WDN A;  4C1U A;  2DE4 A;  1MDP 1;  3K6V A;  4QFN A;  1SDX A;  3RNN A;  4RNS A;  5LOM A;  4K3F A;  1ZBM A;  2RIN A;  3DP8 A;  2RC8 A;  4NMY A;  1B1H A;  4BDO A;  3G3G A;  2QRY A;  1FQF A;  5H8S A;  5H8H A;  2Q2C A;  3RN8 A;  4QFP A;  1JVX A;  3UOR A;  3T96 B;  1NFT A;  4R73 A;  1B4Z A;  1NNF A;  5CI5 A;  2WOP A;  2Q88 A;  1FTO A;  4OXV A;  1VR5 A;  3KFM A;  3CFL A;  1I6A A;  4MF3 A;  2XHD A;  1FQA A;  1IZ1 A;  1QUK A;  2XXP A;  5BUU A;  1B5H A;  2DOJ A;  3G3H A;  4ECF A;  3OEN A;  1Q35 A;  1XHY A;  3ZSF A;  3W9V A;  1M5F A;  2ZYN A;  3W9W A;  1P1U A;  5CBR A;  2GH9 A;  1P1N A;  4F3G A;  4DCX A;  3R26 A;  1B6H A;  4IO5 A;  3MPL A;  1XOC A;  5F1Q A;  1M5C A;  5FTH A;  3H6T A;  5H8N B;  2I3V A;  4OTE A;  3QIM A;  3PPO A;  3O6G A;  1LAF E;  1SYI A;  4GQO A;  4EQ9 A;  2FA7 A;  2I4B A;  2B4M A;  5AA4 B;  1A8F A;  4YIC A;  3IO6 A;  1LFI A;  2QSX A;  4KQP A;  2RKM A;  1H43 A;  1I6B A;  4F18 A;  4G8M A;  4F39 A;  1VFE A;  1JW4 A;  4GIZ A;  4I1D A;  3CG1 A;  4ELR A;  5AA1 A;  4U1O A;  5KDT B;  2RC7 A;  1ATG A;  2DQV A;  1USY E;  2OWS A;  2I48 A;  2HAU A;  4X9T A;  2X7P A;  1NNT A;  3FVK A;  5JTY A;  4G68 B;  3FVN A;  3H03 A;  2G29 A;  2REJ A;  3FXR A;  5BWJ A;  4I62 A;  3THI A;  3RT8 A;  3VVF A;  4BDQ A;  3DM0 A;  4H8J A;  3G7W A;  4IO3 A;  2NVU B;  1UIV A;  2F36 A;  1LCT A;  2Q89 A;  5L8D A;  1D9V A;  1IXI A;  3QUF A;  2VGQ A;  4F2Q A;  1MDQ A;  4R6K A;  4X1D A;  3QUJ A;  1P1O A;  1CE2 A;  3B6Q A;  1LCF A;  2RCB A;  2CZL A;  3HCQ A;  4OHN A;  3D4G A;  5I2N B;  2ZXT A;  2ZNT A;  1URG A;  3CRB A;  5FHM A;  4P0I A;  1SW4 A;  1MQH A;  1A40 A;  1SD3 A;  2R9J A;  2XXV A;  3PAM A;  3SER A;  5I58 B;  3OEM A;  3PPQ A;  4NF5 B;  4KI0 E;  4OFO A;  3KOT A;  4NF8 B;  1H76 A;  1DPE A;  2CMO A;  3CVG A;  1N3X A;  1B3G A;  3RYB A;  1JQF A;  3L6G A;  1MPB A;  3O29 A;  4NF4 B;  3K02 A;  4XKP A;  1US5 A;  3QSL A;  3H4Z A;  3AXF A;  2QMW A;  3IJX B;  1MM7 A;  2OZZ A;  3TTL A;  3GZG A;  1XVX A;  1O64 A;  4NF6 B;  1PDA A;  1JET A;  3N94 A;  4NE4 A;  3B7D A;  1TFD A;  2NWJ A;  4FIM A;  4I9D A;  2O7U A;  3FJM A;  2B3B A;  4EDP A;  4OET A;  4L17 A;  2THI A;  4QSE A;  1MY3 A;  3U1O A;  4LVQ A;  1POT A;  2DWJ A;  3IK6 B;  4DLD A;  3T9H B;  3IOV A;  1QKB A;  3MZ1 A;  4F22 A;  1LAH E;  4G4P A;  3PUV E;  2WOK A;  1Y1M A;  3R7X A;  3OSQ A;  3EPE A;  2H4I A;  5H8N A;  4LZ7 A;  3IB0 A;  1M5B A;  4RXL A;  2Z8D A;  3BKI B;  2F7A A;  5KCJ B;  3CSG A;  1MQI A;  5AA4 A;  3IOW A;  1N76 A;  1B3F A;  2HAV A;  1FW0 A;  4RJZ A;  3ODB A;  4HW8 A;  5KDT A;  1PBP A;  4AB6 A;  3SEW A;  4KHZ E;  3N6U A;  2HFB A;  1LAX A;  3WAF A;  3VXC A;  2AL5 A;  3T9V A;  4G68 A;  1BIY A;  3DP4 A;  3FJG A;  1MXW A;  4G68 C;  1RYO A;  3UK4 A;  2XD2 A;  1XVY A;  1B40 A;  4KR5 A;  5FHO A;  1MRP A;  1SI1 A;  1Y9U A;  3T93 B;  2DWA A;  2I4C A;  3IB1 A;  4UAC A;  3ZKK A;  4DE8 A;  1LB8 A;  3FV2 A;  2ONR A;  4RY1 A;  4TLL B;  4ZE8 A;  2BJJ X;  4P0G A;  1SBP A;  4LAT A;  1R1N A;  2V93 A;  4EQ7 A;  5IKB A;  1BLF A;  3A09 A;  1OVB A;  1MQD A;  1SW2 A;  3OMB A;  3CIJ A;  1HSE A;  2OK2 A;  5AA2 D;  2B4L A;  3PD8 A;  5AE4 A;  1R6Z A;  1QJM A;  3RUM A;  3K6U A;  3CFZ A;  4OFL A;  3ECR A;  3G3F A;  2I58 A;  4XIG Q;  3JZJ A;  1LFH A;  3Q28 A;  1N3W A;  1D9Y A;  1FQC A;  3GXA A;  4NF5 A;  3S9M C;  2RF1 A;  4ZEC A;  1YTV A;  3MVW A;  4ELQ A;  3EN3 A;  1T0K A;  1IXG A;  2PT2 A;  5KZT A;  5ICT A;  2O51 A;  4PFT A;  2XXH A;  3KJT A;  4R6Y A;  1LLS A;  2PX1 A;  4NED A;  1Q1K A;  2DVZ A;  4GXA A;  3VVE A;  4FEB A;  1NNK A;  1Y20 A;  3V8X B;  1FTK A;  1US4 A;  5I59 B;  5ISU A;  2Y7P A;  4N07 A;  4NF6 A;  3VVD A;  3MPK A;  1KWH A;  1POY 1;  4RPN A;  3H6W A;  3FUZ A;  2E1S A;  2Y84 A;  4JSD A;  3V83 A;  3E4R A;  3U72 A;  1QUI A;  3I3V A;  2I6E A;  3O66 A;  3C9H A;  4KCC A;  1MXZ A;  2NUV A;  3K01 A;  4F1U A;  4H0W A;  3S2V A;  1TWY A;  5I56 B;  3N26 A;  4BDM A;  4OYV A;  3BFU A;  1GR2 A;  4GF8 A;  4YKJ A;  5EHM A;  3DLN A;  4G77 A;  3DRF A;  3TEP A;  4H1X A;  4H5G A;  4FOR A;  4U22 A;  3KSJ A;  4XXU A;  5M2V A;  3S4U A;  1PB7 A;  5A5X B;  3L6H A;  4KCD A;  4GVO A;  3PUY E;  2V3T A;  1VE4 A;  3TKD A;  1LAG E;  3B6W A;  4G2Z A;  1B5I A;  5CMB A;  2E0S A;  2DE3 A;  2Y7W A;  4OQO A;  2UYF A;  1LST A;  3E9X A;  1YAE A;  1MY2 A;  3RPW A;  2UVG A;  3KN3 A;  4WKM A;  1VFD A;  2DXY A;  1RKM A;  1DMB A;  3H6V A;  4MFI A;  1TFA A;  4OZ9 A;  1NMU A;  3VV5 A;  3FJ7 A;  5HBC A;  5EYF A;  3IX1 A;  1S9T A;  1Y3P A;  3TQW A;  2B65 A;  3RQT A;  4RPO A;  1LFG A;  4XKR A;  2GHA A;  3TTK A;  1XT8 A;  1YCJ A;  1O7T A;  2A5S A;  3KN8 A;  1GVC A;  4DDD A;  1FQE A;  2FNC A;  1USY H;  1DTZ A;  1ZMG A;  4QFO A;  4NTL A;  5DT6 A;  1MXY A;  1H45 A;  2HCA A;  3PPR A;  1AOV A;  2O1L A;  2O84 X;  4Q8R A;  1PBQ A;  3O97 A;  3H3G A;  3MP8 A;  4MH5 A;  4TOZ A;  1Y1Z A;  3MW0 A;  3MVZ A;  2QS2 A;  1B32 A;  4OFJ A;  3FAS A;  3RLF E;  4JB7 A;  5L9O A;  2ABH A;  3VDF A;  3ZKL A;  3OEK A;  2XXU A;  3ILU B;  4IY5 A;  3MVX A;  4RA1 A;  2F7B A;  4C1T A;  1EZP A;  1IIT A;  1B5J A;  1SW5 A;  1TXF A;  4THI A;  1P1W A;  4DXU A;  3C33 A;  2AYS A;  3U94 A;  4Q0C A;  1I69 A;  4YB5 A;  4YKP A;  3G3I A;  3PPN A;  4E0W A;  4ESX A;  4R72 A;  3SEU A;  1MM6 A;  3VLV A;  4U4S A;  3TAJ A;  3LUY A;  1DOT A;  3IJO B;  3IL1 B;  4PP0 A;  1DSN A;  4ZE9 A;  5I59 A;  1NNP A;  4QHQ A;  4ESW A;  3CG3 A;  3O6H A;  5JEI A;  2DP8 A;  1OIB A;  3S9E A;  4LQ2 A;  1JW5 A;  2UVI A;  1OMP A;  1B2H A;  2XXX A;  3OO8 A;  3BBR A;  3CR9 A;  4O3C A;  4MLV A;  1Y4C A;  2P2A A;  3K1M A;  4JSO A;  2ALU A;  1JW1 A;  4OVJ A;  4YB7 A;  4DZ1 A;  5TPA A;  2P1S A;  3B6T A;  5I56 A;  4QFL A;  4H5F A;  5K2Y A;  2VP1 A;  4QRZ A;  2XXW A;  3TZA A;  3FVO A;  1ZLQ A;  5ELV A;  2I3W A;  3DRI A;  2DWH A;  1Y3N A;  4F2O A;  3LBS A;  5A5X A;  4JBZ A;  4GFR A;  3KN7 A;  1PC3 A;  4XTC Q;  3M8U A;  5B70 A;  5TU0 A;  3H7M A;  2DSF A;  1AL3 A;  4TQU Q;  4DXC A;  5B7D A;  3V89 B;  3UIF A;  1N84 A;  3MWB A;  5DVF A;  3MBP A;  4G8H A;  2QL3 A;  4GWO A;  3PU5 A;  3FV1 A;  1MXV A;  4IO2 A;  4F1V A;  1ANF A;  4POX A;  3VE1 B;  5FHN A;  1B7H A;  3W15 C;  4LA9 A;  4EXL A;  3KGC A;  4WED A;  2D5W A;  3N6T A;  4O3A A;  2NOO A;  3PUX E;  5H8F A;  4GRK A;  1Y4T A;  1XS5 A;  2QPQ A;  3KJ7 A;  2PMS A;  3UGW A;  4LUB A;  3K4U A;  4IO6 A;  4ONY A;  1PEB A;  1JEV A;  3KG2 A;  3RGY A;  2XX7 A;  3QK6 A;  4POW A;  4ELP A;  2LAO A;  5AA3 A;  3TQL A;  1ZIU A;  4KPT A;  1N04 A;  3PMW A;  1ELJ A;  4IB2 A;  3IR1 A;  1HSJ A;  4F1Y A;  4X1B A;  5IAI A;  1H44 A;  1I6Q A;  3K1N A;  3M3L A;  3U93 A;  2F5X A;  3P7I A;  3E13 X;  3IOT A;  4H6D A;  1MY1 A;  1JNF A;  1HSL A;  4ZEI A;  2QS1 A;  2Y7I A;  2HEU A;  3T9U A;  3OO6 A;  4O3B A;  3KOS A;  3K1P A;  3K00 A;  5CMK A;  4HCY A;  3SET A;  4MBP A;  2Y7K A;  2DXR A;  1OQH A;  3LSX A;  2HQ0 A;  3SES A;  3K0V A;  5DEX B;  3EF7 A;  3TCG A;  3QYT A;  4OWD A;  1B3H A;  1B46 A;  2V25 A;  2X7Q A;  2AL4 A;  3TTN A;  4IY6 A;  4OMB A;  3K2D A;  1UQW A;  4KD5 A;  4IO4 A;  3O6I A;  1SI0 A;  2OLB A;  3K6X A;  2OWT A;  3TPA A;  3M3F A;  2B3F A;  2IEE A;  4I8C A;  3JV9 A;  3ONM A;  3VFJ A;  1B58 A;  2I0B A;  2H99 A;  4AQ4 A;  1NKX A;  4DCY A;  1MG1 A;  5HM4 B;  1B3L A;  1A99 A;  2XXI A;  2Q9T A;  3WAE A;  1H3D A;  2OJT A;  1PB8 A;  1GV8 A;  1GTK A;  1SW1 A;  2F8D A;  3OO9 A;  5AA2 A;  4ZS9 A;  3SEX A;  3BFT A;  4FE8 A;  2XXQ A;  3USD A;  4R74 A;  3RYA A;  4ZEK A;  5CBS A;  4PFU A;  4WEP A;  1UTB B;  1Y3Q A;  1MH4 A;  3HV1 A;  3HN0 A;  2I0C A;  3I6V A;  4QF9 A;  2G93 A;  3EHT A;  1QUL A;  1B52 A;  1LB9 A;  3GLB A;  5I2K B;  3FD3 A;  3TDJ A;  3D4C A;  5ITP A;  3HST A;  4HCW A;  5DVJ A;  4EUO A;  4M1V A;  2P0S A;  3LSL A;  3PV0 E;  1FTL A;  5TPA B;  4U2R A;  3MQ9 A;  5CMM A;  3V5A A;  5K2X A;  4KYE A;  4XKQ A;  1B7Z A;  1GGG A;  2AIX A;  3ILT B;  2ZYK A;  2PBW A;  4RK2 A;  1MH3 A;  3O9P A;  4BLA A;  2UYE A;  4JWO A;  4U4X A;  1SYH A;  4YKI A;  1AIV A;  1MY4 A;  2GHB A;  3PPP A;  2VHA A;  1D4N A;  2Z22 A;  2F78 A;  2Z23 A;  2XX8 A;  2VD2 A;  3F11 A;  3UP9 A;  2RC9 A;  4QFK A;  2QJE A;  2ZYM A;  4H8I A;  1B51 A;  3VLU A;  1B4H A;  3C32 A;  2A5T B;  3SEY A;  1BTJ A;  1LBB A;  4LQ5 A;  3TOD A;  2ZNS A;  1SQY A;  4DXB A;  4LP2 B;  4ZDM A;  3EHU A;  5CRY A;  4F3B A;  5JK4 A;  3DP6 A;  2W7Y A;  3DRH A;  1P1Q A;  1DTG A;  2ZNU A;  1OQG A;  3DRK A;  4YB6 A;  5DEX A;  4GOT A;  4JDF A;  4YAH X;  4EF1 A;  1URS A;  2DE2 A;  3PUZ E;  5H8F B;  2V3Q A;  3OSR A;  4U23 A;  4FJP A;  4PE5 B;  4ELO A;  3CI8 A;  2XX9 A;  1NH7 A;  2OBG A;  4C0R A;  1D3K A;  4TLM B;  4OEN A;  4AB5 A;  3S9L C;  3FVG A;  1SVX B;  3TTR A;  3E3K A;  1DPP A;  3IOU A;  3FIR A;  1FQD A;  1OVT A;  2Q2A A;  3FXQ A;  2X26 A;  1AH5 A;  2M8C A;  3MZB A;  3DRJ A;  4OEV A;  1XC1 A;  2XD3 A;  1BP5 A;  5HPQ A;  1B0L A;  4ZZE A;  3OOA A;  3TFL A;  4QSD A;  2O1M A;  1A55 A;  2REG A;  1EH3 A;  4LZ5 A;  4PFW A;  1EZ9 A;  4OEU A;  4GL0 A;  2PYY A;  4R75 A;  3CSB A;  3U8Q A;  3C34 A;  2GRV A;  3PMX A;  4YMA A;  4G8N A;  1UTB A;  3O6P A;  1M5E A;  2GFE A;  2DYX A;  3DEL B;  4ZEF A;  3H6U A;  4M4G A;  4FEC A;  2ANJ A;  1BKA A;  3PGF A;  1QUJ A;  3MP6 A;  4NWC A;  2FYI A;  3HHG A;  5I2K A;  3H06 B;  4KFQ A;  1N0T A;  3MZ9 A;  2F6P A;  3M3K A;  3T22 A;  2XXR A;  1MQG A;  1NL5 A;  4N13 A;  2KLF A;  4LZ8 A;  4ZEB A;  5J1D A;  3DRG A;  1R9Q A;  5I57 B;  3LR1 A;  3TUS A;  4GXS B;  4FED A;  2DS9 A;  5CMC A;  3CHG A;  1TT1 A;  5I84 A;  4F19 A;  3T9X B;  1A7L A;  2YLN A;  2VOZ A;  4KYS A;  3FXU A;  4X48 A;  4YMB A;  5TP9 B;  3RT6 B;  3EQ1 A;  4Z0I A;  4R2B A;  4GD5 A;  5EHS A;  3IB2 A;  4PQJ A;  1MQJ A;  4ZED A;  1MS7 A;  1JEU A;  3HO7 A;  3Q27 A;  4R9F A;  3TCH A;  2H5Y A;  5AA2 B;  3LC8 A;  3OEL A;  4KYD A;  3QAX A;  1F9B A;  3FAT A;  2F35 A;  2YPN A;  2A5T A;  4ISU A;  3OXN A;  3TMG A;  2O6A A;  4Q5T A;  5H8Q B;  2XXY A;  2R6G E;  3VLW A;  1B9J A;  3C31 A;  4YZZ A;  3MJN A;  4IO7 A;  3Q26 A;  5CC2 A;  4IGT A;  4MLQ A;  3OD7 A;  3CFX A;  4EQB A;  5ICQ A;  1IEJ A;  3MVY A;  1UTH B;  3EHS A;  4FAJ A;  3TCF A;  1Z7M E;  4EXK A;  1B05 A;  1ZKB A;  3TTM A;  1B7U A;  2D3I A;  2H98 A;  1MPC A;  4HS7 A;  5DYH A;  2F97 A;  3OO7 A;  4HTG A;  4OES A;  3IOR A;  1QVS A;  2YJP A;  5ITO A;  2R71 A;  3RTW B;  4NWD A;  1ZU0 A;  1M5D A;  1RYX A;  1MY0 A;  1N7X A;  1O63 A;  1QKA A;  3TEL A;  2ESN A;  3SKP A;  2WKY A;  3C4M A;  4LON B;  2WOL A;  4F29 A;  1LBC A;  3R6U A;  2NXO A;  4ND9 A;  1IXC A;  3G3J A;  2ZMB A;  4R6H A;  4ZZA A;  4U21 A;  1IIW A;  4F3P A;  3IAZ A;  2V3U A;  3IO4 A;  1A8E A;  1UIU A;  3O28 A;  4R9G A;  2DWI A;  1B1X A;  1MXU A;  4H65 A;  1ZJL A;  3I5O A;  4GL8 A;  3FTO A;  1FTM A;  3U92 A;  2I49 A;  4YU0 A;  4FAT A;  4Z7E A;  3SDF A;  2D21 A;  3GBA A;  3HHF A;  2QMX A;  5FTI A;  2H9B A;  1S7Y A;  2QS4 A;  4QSC A;  1QW0 A;  2Z8E A;  4BDR A;  1EU8 A;  1S50 A;  3C35 A;  3MP1 A;  5H8H B;  1MPD A;  4JWX A;  3Q29 A;  4U1Z A;  2UXA A;  2ZYO A;  3LVU A;  3T66 A;  1URD A;  3VXB A;  3GBB A;  2Q8J A;  3KSX A;  2QS3 A;  5L9M A;  3UA8 A;  2F7C A;  3FGS A;  3S9N C;  5I57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...