3TCHA

Crystal structure of e. coli oppa in an open conformation
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
517
structure length
517
Chain Sequence
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Periplasmic oligopeptide-binding protein
publication title Escherichia coli peptide binding protein OppA has a preference for positively charged peptides.
pubmed doi rcsb
source organism Escherichia coli
total genus 181
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3tchA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tchA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3tchA02
3CHGA 4XKQA 5JTYA 4R75A 3IJOB 4G4PA 3I5OA 3ILTB 3QUJA 2NXOA 2QRYA 1NNFA 3PPPA 3KJTA 1SVXB 4OHNA 3FXUA 3MC2A 2DWJA 3K6VA 3IO6A 1B40A 2Z8EA 1MXVA 1B0LA 4XXUA 4H6DA 1HSLA 5I2KA 1TWYA 4ZECA 3TTMA 2OJTA 3IO4A 2Y7IA 3RNNA 1A55A 3LBSA 1Y20A 4YKIA 1MDQA 3FVNA 4OFOA 3ZKLA 4FIMA 1B5JA 1IXGA 3TUSA 2THIA 4F3PA 3O29A 4QFKA 1UIVA 3FASA 3BKIB 3BFUA 1EZ9A 1MQJA 3G3GA 3K1NA 2E1SA 1Q1KA 1LFIA 3TQLA 4DE8A 1MDP1 1OVTA 3MUQA 4JXIA 3RY3A 3FIRA 1UIUA 2Z23A 1USYH 3MVZA 3PV0E 2B3BA 3OSRA 1WVJA 3TPAA 1I69A 4X9TA 5DT6A 4NF6B 4ELOA 3VFJA 3MPKA 1URGA 3R7XA 1AOVA 4F39A 4H1XA 3IOTA 1XHYA 1M5EA 4RPNA 2PT1A 4ZEIA 3IB2A 4PE5B 1MXZA 4F3SA 3N94A 3PAMA 5HM4B 3HPIA 5H8HB 4PFYA 2B4LA 3LUYA 3THIA 3L6GA 3U94A 4QHQA 5H8FA 1PB8A 1BIYA 2QL3A 4I1DA 2UXAA 5DYHA 5TP9B 1IZ1A 1GVCA 1H76A 5F7VA 5CMBA 1A7LA 2V25A 5H8SA 1QW0A 2YLNA 4RJZA 1IXIA 1NMUA 4DLDA 2Q88A 4GXAA 3TYHA 3E3KA 2Q8JA 1MM7A 4NE4A 2M8CA 5A5XA 4FEDA 5CM6A 2WOLA 4MH5A 4MFIA 4QF9A 2F6GA 3EPEA 3SEYA 1B05A 1MS7A 2X26A 4ZE9A 1B7ZA 4WXJA 4QFOA 3DRKA 2XXYA 4G68C 3UP9A 2LAOA 1AL3A 1F9BA 1B3GA 4PFUA 4NF5A 5JTYB 3SDFA 3TTRA 4KD5A 5CC2A 3PMWA 5FTHA 5KCJB 3S9NC 2ZYKA 3O9PA 4OEVA 2XXVA 3CI8A 4IB2A 4H8JA 4P0IA 4XTCQ 3QUFA 5I57A 3PMVA 3N26A 1D4NA 3EHSA 2DXRA 2RCAA 2NUVA 4KYDA 2UYEA 4OESA 1EH3A 3KBRA 3PUYE 4TLMB 1MG1A 2D21A 3Q25A 4GD5A 1JQFA 3PUVE 1EU8A 4JBZA 3IAZA 3PD8A 5HPQA 3CR9A 3S4UA 2AL5A 3GBBA 3O97A 2QMWA 2ALUA 2P2AA 3K00A 3QIMA 2QS4A 1MY4A 4GRKA 2RF1A 3IOWA 3IK6B 3KG2A 2H99A 1MH4A 3LVUA 3KFMA 3TDJA 3VVEA 3FXRA 4DCXA 2QJEA 1MRPA 1B2HA 2V3QA 1IITA 4DXBA 4LQ2A 2P1SA 4NF4B 1B4HA 1POTA 5L9OA 4YKPA 4MLVA 5ICQA 1BKAA 2O68A 4N13A 3H06B 1VSOA 1PB7A 1Y3QA 3O6GA 2V84A 4EXKA 3LR1A 3Q27A 3WAEA 3FGSA 4ELPA 3G3FA 3B6QA 1XC1A 4LATA 5I84A 4EDPA 4G68A 1LFGA 3I3VA 4GQOA 2VD2A 2DE4A 2YJPA 3T22A 3JV9A 1RKMA 2O6AA 5ICTA 3IX1A 4HCWA 5J1DA 5H8FB 4Q30B 2F6PA 3KEIA 2ESNA 3SETA 2HCAA 1B5IA 4KHZE 4Q8RA 3KSXA 3K4UA 4U23A 4MF3A 3MP8A 2ZYOA 4LZ5A 3TFLA 3FJGA 1N7XA 3V89B 1LB9A 3TELA 4LUBA 4R72A 2X7QA 3M8UA 3H6UA 1PBQA 1TFAA 3U8QA 3E13X 1FTLA 3PGFA 2DSFA 1YTVA 1NKXA 3G3IA 1QVSA 1US4A 4PFTA 5CBRA 4YMAA 3O2AA 1XS5A 1B51A 2Y7WA 4X1DA 2XXQA 2R9JA 1DMBA 1QUJA 3HCQA 2XXHA 3PPNA 4NF5B 1HSJA 4F1UA 1QJMA 3ZSFA 4F18A 5I58A 1O7TA 4PETA 2G29A 4RPOA 4FJPA 3CFZA 5I57B 2DS9A 3IL1B 3U1OA 3SEXA 1B58A 4E0XA 3OO8A 1FCKA 4U21A 3RTWB 3T93B 1IIWA 2HEUA 4YAHX 1USYE 2DE3A 1FTJA 5FHOA 2F78A 4R74A 4YB7A 2NVUB 3MVXA 2GRVA 3BFTA 2I4BA 4RXLA 1B5HA 2AYSA 3V5AA 4XIGQ 4ISUA 3OO7A 4RNSA 1US5A 4ZEDA 2HZKA 4NEDA 5BWJA 2PMSA 1MQHA 1Y3PA 3OD7A 2V3UA 2QPQA 1N3WA 4QFLA 1Y9UA 4Z0IA 5CMKA 3DELB 2XXPA 4DXUA 2D3IA 3V8XB 4DZ1A 2H5YA 4GFRA 3GXAA 1GR2A 1P1NA 1B3FA 2HAUA 1N04A 4F2QA 2F7CA 4G2ZA 4EQ9A 1II5A 2DXYA 2XX7A 4OFLA 2HXWA 3K02A 3OOAA 3DRIA 3DP6A 4KYEA 3W9WA 3CSGA 5H8QB 4EQBA 4GXSB 3H3GA 2DWIA 3PUXE 4HS7A 1IQ7A 4NF8B 5AE4A 3PU5A 3FD3A 1Q35A 4P0GA 4BDOA 3ODBA 3IR1A 3RT6B 2R6GE 2BJJX 3OMBA 4FORA 4G68B 1IXHA 4X48A 1JEUA 1O64A 4ONYA 1SW1A 4F29A 2P0SA 4X1BA 3KGCA 3OEMA 3G7WA 1LCFA 4F19A 3W9VA 1A54A 1OQHA 1LGBC 2HFBA 4YU0A 2OWSA 2OLBA 1QUIA 2A5TB 1JW5A 3G3KA 2ANJA 1LFHA 3N6UA 1OMPA 4XKPA 3RLFE 5FHNA 3OXNA 3KN8A 1DTZA 2ZNSA 2IEEA 2UYFA 3KSJA 3OENA 1Z7NE 3CFXA 1AIVA 1CE2A 2GHAA 4JWYA 5AA2B 5I2NA 3DRJA 1A40A 4G8NA 5KZTA 3FVOA 4F22A 2HQ0A 1BLFA 1QUKA 3KZGA 4EQ7A 3C36A 2RC8A 1N76A 1Y1MA 2ZYNA 5KDTA 1H44A 3V83A 3BBRA 5LOMA 3O6HA 2RINA 1UTBA 3KOTA 3DRFA 4HTGA 4IGRA 3T96B 4C1TA 4JDFA 1KWHA 2O1LA 3E9XA 3SERA 3SEUA 3RQTA 3LSXA 3FUZA 4C1UA 3S9MC 4OYVA 3MZ9A 1S50A 3C31A 3KN7A 1JW4A 3H6VA 3A3UA 4U1OA 2QSXA 4BDMA 1P1UA 2CZLA 4RK2A 1B1XA 1H45A 4O3BA 1H3DA 2OBGA 1NL5A 3CG3A 2YPNA 2D5WA 5H8NB 1H43A 1SQYA 5EHMA 4N6PA 3VXCA 1PDAA 5DEXB 1JNFA 4WEDA 1IUDA 2O7UA 3TMGA 4R6HA 3CIJA 3LSLA 1T0KA 3T9UA 4I62A 3PUWE 3KJ7A 3OSQA 5ISUA 2H25A 1LBBA 1PC3A 2ONKE 5IKBA 3VVDA 3A3CA 5M2VA 4H67A 4LZ8A 4EF1A 4KCDA 3MP1A 4QSDA 4JWOA 1Y1ZA 5K2XA 4IGTA 1I6BA 2Q2AA 1MH3A 4U4SA 2IA4A 1GV8A 4C0RA 2XXWA 3B7DA 5DTBA 4FAJA 5FTIA 1UTHA 3T66A 1URDA 1MXXA 1OLCA 3I6VA 1FQFA 3FV1A 1FTMA 3Q28A 2ZMBA 4U4XA 1NFTA 1R1NA 4H5GA 5AA1A 3O66A 5I2KB 3EN3A 4U2RA 1URSA 2I3VA 4R2FA 3GLBA 4Z7EA 3WAFA 3RN8A 1LAFE 3K1PA 4M4GA 1JETA 5I56A 3KOSA 4IO5A 3PPRA 1B6HA 2I48A 3QYTA 3ZS6A 5ITPA 2FYIA 4EXLA 3M3KA 3C4MA 3S9LC 1MPBA 5TU0A 1P1WA 2XXTA 1GTKA 1B9JA 3SKPA 4QFNA 1QKAA 2AIXA 1FTOA 3OO9A 2ZYMA 3P7IA 5EYFA 1HSEA 1R9QA 3U92A 3UN6A 2UVGA 1ZLQA 3OEKA 4NMYA 4YMBA 1FQDA 5JEIA 2QMXA 3FV2A 1SDXA 2UVHA 1DSNA 3U93A 3TKDA 1DPPA 4JB7A 3GBAA 1OLAA 2RCBA 4WEPA 3TAJA 1ZMGA 4TOZA 3N6TA 3DP8A 3Q29A 3RTFB 4WKMA 3MP6A 3TODA 3MAMA 3IB1A 3K0VA 4GWOA 3TZAA 2O84X 4OENA 1OQGA 5AA4A 1UTBB 2HZLA 1LSTA 2O51A 1B7UA 3S9EA 2B65A 2V93A 4LZ7A 3SEVA 2XX8A 4IY5A 1B52A 1NNKA 3G3JA 4BDLA 4AQ4A 1O63A 2DWHA 4TLLB 1NH7A 4FEBA 4IO6A 1S9TA 1S7YA 2ZNTA 1A8FA 2VHAA 4AB5A 3UORA 4JSOA 3UGWA 2B3FA 2ZXTA 1FW0A 4F3BA 5A5XB 1N84A 5I59A 4ZEBA 2PX1A 1Y4CA 2Y7PA 4DIGA 3MZBA 2XHDA 1SI0A 3IORA 4ND9A 1ZTYA 1LAXA 3DRHA 1J1NA 4EUOA 4EF2A 4G8MA 1XVYA 3VXBA 3FATA 4YB6A 1N3XA 4I8CA 3ONMA 1D9VA 4QRZA 2HAVA 3FZVA 3MJNA 1EZPA 1LBCA 4R9GA 1MPCA 1P99A 2X7PA 4QSEA 4YICA 4LVQA 4DDDA 2QS3A 4R2BA 3C9HA 1B3HA 3L6HA 4MLQA 4NWCA 1JVXA 2DOJA 3ECRA 2RKMA 2I58A 4Q0CA 4OQOA 4ESWA 3USDA 3B6WA 3HSTA 4HW8A 3T9XB 5TP9A 4RYAA 3AXFA 4O3AA 3K2DA 4BDNA 3T9HB 3MZ1A 4R6YA 4KR5A 3ILUB 2FNCA 3JZJA 1ZKBA 4IO7A 4KI0E 4UA8A 5FHMA 3RUMA 5I56B 1IEJA 2GFEA 1B32A 4ZS9A 4YB5A 4PQJA 2E0SA 4HCYA 1EZOA 1D9YA 4KFQA 4E0WA 1ANFA 3O28A 3VV5A 2KLFA 3QAXA 2NWJA 4KYSA 2G93A 2RC9A 1R9LA 3TCGA 2O7IA 1Z7ME 5L9MA 3MVWA 2F36A 4UACA 3C32A 4OFJA 3E4RA 4H65A 1MQDA 1BP5A 2UVIA 4ZDMA 3VE1B 2I3WA 4R6KA 4THIA 1MY3A 2DQVA 4NWDA 3RPWA 4BDRA 3DM0A 5KCJA 3MQ9A 1SYHA 3EHUA 1YAEA 4H5FA 1TFDA 3FTOA 3R26A 3FVGA 2UVJA 4OVJA 3IB0A 3A09A 4G8HA 3IOUA 3TTLA 1ZJLA 1M5DA 2F7AA 2REJA 4FECA 1B46A 3K01A 4OETA 5DVIA 3C35A 2GHBA 4MBPA 5AA4B 4XKRA 3TTNA 1VFEA 1N0TA 4AB6A 1LB8A 4OERA 3O6IA 4RY1A 1FQCA 2VP1A 4G77A 5F1QA 1RYXA 1A99A 1MQGA 3M3LA 3W15C 3H6TA 1QULA 1RYOA 1MY1A 3K6XA 3VLVA 4OZ9A 4F2OA 5CMCA 1UQWA 4QSCA 2I0CA 1A8EA 1ATGA 3UIFA 4POXA 1GGGA 2H9BA 1SW4A 5I59B 3T9VA 3TCFA 3U72A 2F8DA 2PT2A 3VLUA 2I6EA 4IO4A 4NF4A 1MM6A 4R9FA 4GIZA 1FQAA 4ZEKA 3PD9A 3PMXA 1PEBA 3CFLA 1JVYA 2Q89A 3DRGA 1I6QA 2ZNUA 3M3FA 1AH5A 1ELJA 3TEPA 3Q26A 2PYYA 4BLAA 1POY1 2PVUA 5B70A 5I58B 2F35A 4FE8A 3PPQA 3DLNA 4KCCA 5K2YA 4F3GA 5JK4A 1DTGA 4GOTA 2XD2A 3EHTA 3CG1A 3QSLA 1MXYA 1M5FA 4ESXA 3FXQA 1VFDA 1MY2A 2R71A 2QS1A 3H6WA 4NTLA 2V3TA 4M1VA 2DE2A 4YZZA 4Q5TA 3FVKA 1JW1A 2F5XA 4FATA 5CRYA 3KN3A 2XD3A 3SEWA 1M5BA 3O6PA 2H4IA 3LSFB 2OCUA 3ZKKA 3UK4A 2CMOA 2VD3A 4IY6A 2ABHA 4KPTA 3RT8A 4ZZEA 5CI5A 3GZGA 1B3LA 4I9DA 4RK9A 4PFWA 1M5CA 5CMMA 5L8DA 2QS2A 1D3KA 1B4ZA 3JYRA 3RYBA 4JWXA 1WODA 1LCTA 2XXUA 1Y3NA 4TQUQ 4IO2A 3FJMA 3F11A 3K6UA 5TPAA 4ZEFA 4P11A 2ONSA 1MXUA 3H4ZA 3HN0A 2Y84A 2DVCA 3TQWA 1Y4TA 1L5TA 2Q2CA 2O1MA 4PP0A 3QXMA 1MQIA 4KQPA 4H8IA 2O69A 2F7BA 1CB6A 1B1HA 1PBPA 1P1OA 1OVBA 1NNPA 5L9SA 3K1MA 3MBPA 4LA9A 3PPOA 5DVJA 3MW0A 4F1VA 3H7MA 4BDQA 1YCJA 2XXIA 4H0WA 5ITOA 2VOZA 1JEVA 5BUUA 3OELA 2VGQA 5AA3A 4LP2B 1B0HA 1PB9A 3N5LA 3VDFA 1VR5A 1IXCA 3UA8A 5ELVA 2OZZA 2I0BA 3RYAA 4OTEA 1BTJA 1MY0A 4ECFA 5I2NB 4O3CA 4ELRA 3TTKA 1NH8A 1TXFA 4R73A 1AMFA 1ZU0A 4QFPA 2Z8FA 5AA2D 4U1ZA 5B7DA 1P1QA 2F97A 3R6UA 4GVOA 2OK2A 2Z22A 4OWDA 3RGYA 2WOKA 4L17A 3MPLA 2NOOA 3MWBA 1TT1A 4XKNA 5KDTB 1ZIUA 1ZBMA 4OMBA 2DWAA 5H8QA 1SYIA 4NF8A 2H98A 2B4MA 1MXWA 3IJXB 3C34A 2FA7A 3CSBA 3HV1A 3LC8A 4GL0A 3HHFA 2I49A 1LLSA 2Y7RA 4LONB 3FJ7A 3LSWA 3EQ1A 3QK6A 1VE4A 1B3EA 1N7WA 2XXRA 3VLWA 2A5TA 1R6ZA 3EF7A 4F1YA 2REGA 2XX9A 4OEUA 1WDNA 2Q9TA 2WKYA 1B7HA 2I4CA 4U22A 1YPNA 3HHGA 4IO3A 4NF6A 5DVFA 2ONRA 3CVGA 5EHSA 4DXCA 5AA2A 1QKBA 3OO6A 1MPDA 3DP4A 4GLIA 1SD3A 3IOVA 4ZZAA 3C33A 1XVXA 1FTKA 2Y7KA 2F34A 3S2VA 5H8HA 4OXVA 5TPAB 4JSDA 4RA1A 2Z8DA 5HBCA 4ELQA 4ZE8A 1DPEA 1UTHB 4POWA 1FQEA 2GH9A 1XT8A 2DVZA 3K6WA 3TCHA 4LQ5A 1SW5A 2AL4A 2XXXA 3D4CA 2DYXA 4K3FA 1DOTA 4N07A 2RC7A 1LAHE 1I6AA 3VVFA 2DP8A 2OWTA 3G3HA 4YKJA 4F31B 1SBPA 2A5SA 4GL8A 3B6TA 1SW2A 5CBSA 2WOPA 3SESA 3HO7A 5H8NA 3H03A 1SI1A 4YKKA 1LAGE 4GF8A 4DCYA 1XOCA 5DEXA 5IAIA 1NNTA 1FQBA 1OIBA 2W7YA 3MVYA 3CRBA 3PUZE 2PBWA 3D4GA
chains in the Genus database with same CATH superfamily
3CHGA 4XKQA 5JTYA 4R75A 3IJOB 4G4PA 3I5OA 4MJOA 4PAFA 3ILTB 3QUJA 2NXOA 2QRYA 1NV3A 1NNFA 3PPPA 3KJTA 1SVXB 4OHNA 2Y5LA 3FXUA 3MC2A 2DWJA 1FPDA 3K6VA 3IO6A 4JVDA 1B40A 2Z8EA 1MXVA 1B0LA 5I7IA 4XXUA 1NV5A 4H6DA 1HSLA 5I2KA 1TWYA 5ET6A 4ZECA 2L5VA 3TTMA 2OJTA 3IO4A 2Y7IA 3RNNA 1A55A 3LBSA 1Y20A 4YKIA 1MDQA 3FVNA 4OFOA 3ZKLA 2QVRA 4FIMA 1B5JA 1IXGA 3TUSA 2THIA 4F3PA 3O29A 4QFKA 1UIVA 3FASA 3BKIB 3BFUA 1EZ9A 1MQJA 3MYUA 3G3GA 1RDZA 3K1NA 2E1SA 3IFCA 1Q1KA 1LFIA 3TQLA 4DE8A 1MDP1 1OVTA 3MUQA 4JXIA 3RY3A 3FIRA 2Q74A 1UIUA 2Z23A 1USYH 3MVZA 3PV0E 1FJ6A 2B3BA 4MNIA 1NV1A 3OSRA 1WVJA 3TPAA 1I69A 4X9TA 1DK4A 2FVZA 5DT6A 4NF6B 4ELOA 3VFJA 3MPKA 1URGA 3R7XA 1AOVA 4F39A 4H1XA 3IOTA 1LBWA 1XHYA 1M5EA 4RPNA 2PT1A 1DCUA 4ZEIA 3IB2A 4PE5B 1MXZA 4OVSA 4F3SA 3N94A 3PAMA 5HM4B 3HPIA 5H8HB 4PFYA 2B4LA 4O8MA 3LUYA 3THIA 3L6GA 3U94A 5FBPA 4QHQA 2XWKA 5H8FA 1PB8A 1BIYA 2QL3A 5IZ1A 4I1DA 2XA5A 2UXAA 5DYHA 5TP9B 1IZ1A 1D9QA 1GVCA 4I3EA 1H76A 4N91A 5F7VA 2OWZA 5CMBA 1A7LA 1NI9A 2V25A 5H8SA 4HE1A 1QW0A 5ESYA 2YLNA 4RJZA 1IXIA 1NMUA 4DLDA 2Q88A 4GXAA 3TYHA 3E3KA 2Q8JA 1MM7A 4NE4A 2M8CA 5A5XA 4FEDA 5CM6A 2WOLA 4MH5A 4MFIA 4QF9A 2F6GA 2ZZXA 3EPEA 3SEYA 2QFLA 1B05A 1MS7A 2X26A 4ZE9A 1B7ZA 4WXJA 4QFOA 3DRKA 2XXYA 4G68C 3UP9A 2LAOA 1AL3A 1F9BA 1B3GA 4PFUA 4NF5A 1JP4A 5JTYB 3SDFA 4KD5A 4XFEA 3TTRA 3PMWA 5FTHA 5CC2A 5KCJB 3S9NC 2ZYKA 3O9PA 4OEVA 2XXVA 3CI8A 4O7IA 4IB2A 2F3DA 3RPLB 1DBZA 4H8JA 4P0IA 4XTCQ 3QUFA 5I57A 1FPKA 3PMVA 3N26A 1D4NA 2FIEA 3EHSA 2DXRA 2RCAA 2NUVA 4KYDA 2UYEA 4OESA 1EH3A 3KBRA 3PUYE 4TLMB 2KQZA 1MG1A 2D21A 3Q25A 4GD5A 1JQFA 2XWIA 3PUVE 1EU8A 4JBZA 1NUXA 3IAZA 3PD8A 5HPQA 3T0JA 4P1LA 3CR9A 3S4UA 2AL5A 3GBBA 3O97A 2QMWA 4MNPA 2ALUA 2P2AA 3K00A 3QIMA 3BIHA 1KA0A 2QS4A 1MY4A 4GRKA 2MKZA 2RF1A 3IOWA 2BJIA 3IK6B 3KG2A 2H99A 1MH4A 3LVUA 3KFMA 4MNCA 3TDJA 3VVEA 3FXRA 4MIJA 4DCXA 2QJEA 1MRPA 1B2HA 2V3QA 1IITA 1AWBA 4DXBA 1BK4A 4LQ2A 2P1SA 4NF4B 1B4HA 1POTA 5L9OA 3E79A 4YKPA 1IMCA 4H45A 4LN5A 5ICQA 1BKAA 4MLVA 2O68A 4N13A 4HE2A 3H06B 1VSOA 1PB7A 1Y3QA 3O6GA 2V84A 2PFZA 2WX9A 4EXKA 4PGPA 3LR1A 3Q27A 3WAEA 3FGSA 4ELPA 3G3FA 4IR8A 3B6QA 4GBVA 4GBWA 1XC1A 4LATA 5I84A 4EDPA 2PFYA 4N17A 4MEVA 4G68A 1LFGA 3I3VA 4GQOA 2VD2A 2DE4A 2YJPA 3JV9A 3T22A 1RKMA 2O6AA 5ICTA 3IX1A 4HCWA 5J1DA 5H8FB 4Q30B 2F6PA 3KEIA 2ESNA 3SETA 2HCAA 1B5IA 4KHZE 5IM2A 4Q8RA 3KSXA 3K4UA 4KXPA 4U23A 4MF3A 3MP8A 2ZYOA 4LZ5A 3TFLA 3FJGA 1N7XA 3V89B 1LB9A 3TELA 4LUBA 4R72A 2X7QA 2WYKA 3M8UA 3H6UA 1PBQA 1TFAA 3U8QA 3E13X 1FTLA 3PGFA 3FXBA 2DSFA 1YTVA 1NKXA 3G3IA 4NN3A 1QVSA 1US4A 4PFTA 5CBRA 4YMAA 3O2AA 1XS5A 1B51A 2Y7WA 4X1DA 2XXQA 2R9JA 1DMBA 1QUJA 3HCQA 2FIXA 2XXHA 3PPNA 4NF5B 1HSJA 4F1UA 1QJMA 3ZSFA 4F18A 4N15A 5I58A 1O7TA 4PETA 2G29A 3HFUA 4RPOA 4HXVA 4FJPA 3CFZA 5I57B 4OA4A 2DS9A 3IL1B 3U1OA 3SEXA 2ZZVA 1B58A 4E0XA 4XEQA 1EYJA 3OO8A 1FCKA 4U21A 3RTWB 3T93B 1IIWA 2HEUA 4YAHX 5ET8A 1USYE 1FBCA 2DE3A 1FTJA 5F24A 5FHOA 2F78A 4R74A 4YB7A 2NVUB 1KZ8A 3MVXA 2GRVA 3BFTA 1FRPA 4PDDA 2I4BA 4RXLA 1B5HA 2AYSA 3V5AA 3PTYA 4P47A 3RYDA 4XIGQ 4ISUA 3OO7A 3GYYA 1US5A 4RNSA 4AS4A 4ZEDA 2HZKA 4NEDA 5BWJA 2PMSA 1MQHA 1Y3PA 3OD7A 4FBPA 2V3UA 2WEFA 2QPQA 1N3WA 4QFLA 1Y9UA 4Z0IA 1FBPA 5CMKA 3DELB 2XXPA 4H46A 4DXUA 2D3IA 5IZ3B 5DW8A 3V8XB 4DZ1A 5J16A 2H5YA 4GFRA 3GXAA 1GR2A 1P1NA 1B3FA 2HAUA 1N04A 4F2QA 2F7CA 1FBHA 4G2ZA 5EYGA 4N4UA 4EQ9A 1II5A 2DXYA 2XX7A 4OFLA 2HXWA 3K02A 3OOAA 3DRIA 3DP6A 4KYEA 3W9WA 3CSGA 5H8QB 1LBZA 4EQBA 4GXSB 3H3GA 2DWIA 3PUXE 4HS7A 1IQ7A 4NF8B 5AE4A 3PU5A 3FD3A 1Q35A 4P0GA 1FBGA 4BDOA 3ODBA 3IR1A 3RT6B 2R6GE 2BJJX 3OMBA 4FORA 4G68B 1NV4A 1IXHA 4O7MA 4X48A 1JEUA 1O64A 4ONYA 1SW1A 4NX1A 4F29A 2P0SA 4X1BA 3KGCA 3OEMA 4N8YA 3G7WA 1LCFA 4F19A 3W9VA 1A54A 1OQHA 1LGBC 3NOHA 2HFBA 4YU0A 2OWSA 2OLBA 4DI4B 1QUIA 2A5TB 1JW5A 3G3KA 2ANJA 1LFHA 3N6UA 1OMPA 4XKPA 3RLFE 5FHNA 3OXNA 4GX4A 3KN8A 1DTZA 2ZNSA 2IEEA 2UYFA 3KSJA 2Q8MA 3OENA 1Z7NE 3CFXA 1AIVA 1CE2A 2GHAA 2CZKA 4JWYA 5AA2B 5I2NA 5EQ8A 2XXKA 1VDWA 1NV6A 3DRJA 1A40A 4G8NA 5KZTA 3FVOA 4F22A 2HQ0A 1BLFA 1QUKA 3KZGA 4EQ7A 3C36A 2RC8A 3T1BA 1N76A 1Y1MA 2ZYNA 5KDTA 1H44A 3V83A 3BBRA 5LOMA 4P8BA 3O6HA 2RINA 1UTBA 3KOTA 3DRFA 4HTGA 5LDZA 3QMFA 3E78A 4IGRA 1LBVA 3T96B 4C1TA 4JDFA 1KWHA 2O1LA 3E9XA 3SERA 3SEUA 3RQTA 3LSXA 3FUZA 4C1UA 3ROJA 3S9MC 4OYVA 3MZ9A 1S50A 3C31A 3KN7A 1JW4A 3H6VA 3A3UA 4U1OA 4NF0A 2QSXA 4PTKA 4BDMA 1P1UA 4AS5A 2CZLA 4RK2A 1B1XA 1H45A 4O3BA 2P3NA 1H3DA 2OBGA 1NL5A 3CG3A 2YPNA 2D5WA 4GX3A 2VPNA 5H8NB 1H43A 1SQYA 5EHMA 4N6PA 3VXCA 4OVRA 1PDAA 5DEXB 1JNFA 1EYIA 2FBPA 4WEDA 1IUDA 2O7UA 3KBZA 3TMGA 4R6HA 3CIJA 3LSLA 1T0KA 3T9UA 4I62A 3PUWE 3KJ7A 3BIGA 3OSQA 3KC0A 5ISUA 1FPEA 2H25A 1LBBA 1PC3A 2ONKE 5IKBA 3VVDA 3A3CA 5M2VA 4H67A 4LZ8A 4EF1A 4KCDA 3MP1A 4QSDA 4JWOA 1Y1ZA 5K2XA 4IGTA 1I6BA 2Q2AA 1MH3A 4U4SA 2IA4A 1GV8A 5I3SA 4C0RA 2XXWA 3B7DA 5IGAA 1NUYA 5DTBA 4FAJA 5FTIA 1UTHA 3T66A 1URDA 5IZZA 1MXXA 1OLCA 3I6VA 1FQFA 4MHFA 3FV1A 1FTMA 3Q28A 2ZMBA 4U4XA 1NFTA 1R1NA 4H5GA 3O66A 5AA1A 5I2KB 3EN3A 4U2RA 1URSA 2I3VA 4R2FA 3GLBA 4Z7EA 4GWUA 3WAFA 3RN8A 1LAFE 3K1PA 4M4GA 4MMPA 1JETA 5I56A 3KOSA 4IO5A 3PPRA 1B6HA 2I48A 3QYTA 3ZS6A 5ITPA 2FYIA 4PFRA 4QBAA 4EXLA 3B50A 4PF6A 2PCRA 3M3KA 3C4MA 3S9LC 1MPBA 5TU0A 1P1WA 2XXTA 1GTKA 1B9JA 3SKPA 1FSAA 4QFNA 1QKAA 2AIXA 1FTOA 3OO9A 3U65A 2ZYMA 3P7IA 5EYFA 1HSEA 1R9QA 3U92A 3UN6A 4PDHA 2UVGA 5EQ9A 1IMDA 1ZLQA 3OEKA 2HXRA 4NMYA 4YMBA 1FQDA 2JJKA 5I5PA 1K9YA 5JEIA 2QMXA 3FV2A 1SDXA 2UVHA 1LEVA 1DSNA 3U93A 3TKDA 1DPPA 4JB7A 3GBAA 1OLAA 2RCBA 4WEPA 3TAJA 1ZMGA 4OVQA 1CNQA 4TOZA 3N6TA 3DP8A 3Q29A 3EKIA 3RTFB 4WKMA 3MP6A 4I40A 3TODA 4JVIA 3MAMA 3IB1A 3K0VA 4GWOA 3TZAA 2O84X 4OENA 1OQGA 5AA4A 1UTBB 2HZLA 1G0HA 1LSTA 2O51A 1B7UA 3S9EA 2B65A 2V93A 4LZ7A 1QGXA 4PGNA 3SEVA 2XX8A 4IY5A 1B52A 1NNKA 3G3JA 5A5LA 4BDLA 2QVVA 4AQ4A 1O63A 2DWHA 4TLLB 1NH7A 4FEBA 4IO6A 1S9TA 1S7YA 1NUWA 2ZNTA 1A8FA 2VHAA 4AB5A 4GWSA 3UORA 2HPGA 4JSOA 3UGWA 2B3FA 2ZXTA 3ISPA 1FW0A 4F3BA 5A5XB 1N84A 5I59A 4ZEBA 2PX1A 1Y4CA 2Y7PA 4DIGA 3MZBA 2XHDA 1SI0A 3IORA 4ND9A 1ZTYA 1LAXA 3DRHA 1J1NA 4N8GA 4EF2A 4EUOA 4G8MA 1XVYA 3VXBA 3FATA 4YB6A 1N3XA 4I8CA 3A29A 3ONMA 1D9VA 4QRZA 4QXDA 2HAVA 3FZVA 4GWZA 3MJNA 1EZPA 1FBEA 1LBCA 4R9GA 4N81A 1MPCA 5EQAA 1P99A 2X7PA 4QSEA 4YICA 4LVQA 4DDDA 4P1EA 4PC9A 2QS3A 4NQ8A 4R2BA 3C9HA 1B3HA 3L6HA 4MLQA 4NWCA 1JVXA 4GWYA 2DOJA 3ECRA 2RKMA 2I58A 4Q0CA 4OQOA 4ESWA 3USDA 3B6WA 3FBPA 2CEYA 3HSTA 2VT5A 4HW8A 1FPBA 3T9XB 5TP9A 4RYAA 3AXFA 4O3AA 3K2DA 4BDNA 3T9HB 3MZ1A 4R6YA 4KR5A 3ILUB 2FNCA 3JZJA 1ZKBA 4IO7A 4KI0E 4PBHA 1RDYA 1FPFA 4UA8A 5FHMA 2F3BA 3RUMA 5I56B 1IEJA 2CZIA 2GFEA 1B32A 4ZS9A 4YB5A 4PQJA 2E0SA 4HCYA 1EZOA 1D9YA 4KFQA 4E0WA 1ANFA 3O28A 3VV5A 1KA1A 2KLFA 3QAXA 4DI3D 2NWJA 4PAKA 1YZ0A 4KYSA 2G93A 2RC9A 1R9LA 3TCGA 2O7IA 1Z7ME 5L9MA 3MVWA 2F36A 4UACA 3C32A 4OFJA 3E4RA 4H65A 4P56A 1MQDA 2XWOA 1BP5A 2UVIA 4ZDMA 3VE1B 2I3WA 4PE3A 4R6KA 4THIA 1MY3A 2DQVA 4NWDA 3RPWA 4BDRA 3DM0A 5KCJA 3MQ9A 1SYHA 3RPLA 3EHUA 4PF8A 1YAEA 4H5FA 1TFDA 3FTOA 2WBBA 5EQ7A 3R26A 3FVGA 2UVJA 4OVJA 1IMAA 3IB0A 4N6KA 1IMEA 2Y5KA 3A09A 4G8HA 3IOUA 3TTLA 1ZJLA 1M5DA 4NHBA 2F7AA 2REJA 4FECA 1B46A 3K01A 4OETA 5DVIA 3C35A 2GHBA 4MBPA 5AA4B 4XKRA 3TTNA 1VFEA 1N0TA 4AB6A 1LB8A 4OERA 1NUZA 3O6IA 1NV7A 2WYPA 4RY1A 1FQCA 2VP1A 1RDXA 4G77A 5F1QA 1RYXA 1A99A 1MQGA 3M3LA 3W15C 3H6TA 1QULA 1RYOA 1MY1A 3K6XA 3VLVA 4OZ9A 4F2OA 5CMCA 4OVTA 1UQWA 4QSCA 2I0CA 1A8EA 4I3YA 2CZHA 1ATGA 1FJ9A 3UIFA 3LV0A 2DDKA 4POXA 1GGGA 2H9BA 1SW4A 5I59B 3T9VA 3TCFA 3U72A 4N6DA 2F8DA 1FBFA 2PT2A 3VLUA 2I6EA 4IO4A 4NF4A 1MM6A 3LUZA 4MX6A 1FPIA 4GIZA 4R9FA 1FQAA 4ZEKA 3PD9A 3PMXA 1PEBA 3CFLA 4P9KA 1JVYA 2Q89A 3DRGA 1I6QA 2ZNUA 3M3FA 1AH5A 1ELJA 3TEPA 1FTAA 3Q26A 2PYYA 4BLAA 1POY1 4OVPA 2PVUA 3MSTA 3KC1A 5B70A 5I58B 2F35A 4FE8A 3PPQA 3DLNA 1Q9DA 4KCCA 5K2YA 4G61A 4F3GA 5JK4A 1DTGA 1G0IA 5T3JA 1INPA 4GX6A 4GOTA 4O94A 2XD2A 2VPOA 3EHTA 3CG1A 3QSLA 1MXYA 1M5FA 4ESXA 3FXQA 1VFDA 1MY2A 2V4CA 2R71A 2QS1A 3H6WA 4GWXA 4NTLA 5EYHA 2V3TA 4M1VA 2DE2A 4YZZA 4Q5TA 3FVKA 1JW1A 4NAPA 2F5XA 4FATA 5ET5A 5CRYA 3KN3A 2XD3A 1YXIA 3SEWA 1IMBA 1M5BA 3O6PA 2H4IA 3LSFB 2OCUA 3ZKKA 2QVUA 3UK4A 2CMOA 2VD3A 4IY6A 2ABHA 4KPTA 3RT8A 4ZZEA 5CI5A 3GZGA 1B3LA 4I9DA 2XWVA 4RK9A 4PFWA 1M5CA 5CMMA 1K9ZA 5L8DA 2QS2A 1EYKA 1D3KA 1B4ZA 3JYRA 3RYBA 4JWXA 4MCOA 1WODA 1LCTA 2XXUA 1Y3NA 4TQUQ 4IO2A 3FJMA 3F11A 3K6UA 5TPAA 4ZEFA 1SPIA 2ONSA 4P11A 1MXUA 3H4ZA 3HN0A 2Y84A 2DVCA 3TQWA 1Y4TA 1L5TA 2Q2CA 1NV2A 2O1MA 4PP0A 3QXMA 1MQIA 4KQPA 2HHMA 4H8IA 4PFBA 2O69A 2F7BA 1CB6A 4MAGA 5LTCA 1B1HA 1PBPA 5ET7A 1P1OA 1OVBA 1NNPA 5L9SA 3K1MA 3MBPA 1XI6A 4LA9A 3PPOA 5DVJA 3MW0A 4F1VA 3H7MA 4NGUA 4BDQA 1YCJA 2XXIA 4H0WA 5ITOA 2VOZA 1JEVA 5BUUA 3OELA 2VGQA 4GWWA 5AA3A 4LP2B 1B0HA 1PB9A 2WBDA 1YYZA 3N5LA 3VDFA 1VR5A 1IXCA 3UA8A 5ELVA 2OZZA 3D1RA 2I0BA 3RYAA 4OTEA 1BTJA 1MY0A 5IZ3A 4ECFA 5I2NB 4O3CA 3B8BA 4ELRA 3TTKA 1NH8A 1TXFA 4R73A 1AMFA 1ZU0A 4QFPA 2Z8FA 5AA2D 1FBDA 4U1ZA 5B7DA 1P1QA 2F97A 4XF5A 3R6UA 4GVOA 4NG7A 2OK2A 2Z22A 4OWDA 3RGYA 2WOKA 4L17A 3MPLA 2NOOA 3MWBA 1TT1A 4XKNA 5KDTB 1ZIUA 1ZBMA 4OMBA 4PBQA 2DWAA 5H8QA 1SYIA 4NF8A 2H98A 2B4MA 1MXWA 3IJXB 3C34A 2FA7A 3CSBA 3HV1A 3LC8A 4JVCA 4GL0A 3HHFA 2I49A 1LLSA 2Y7RA 1IMFA 4LONB 3FJ7A 3LSWA 3EQ1A 3QK6A 3SZPA 1VE4A 1B3EA 1N7WA 2XXRA 3VLWA 2A5TA 1R6ZA 3EF7A 4F1YA 2REGA 2XX9A 4OEUA 1WDNA 2Q9TA 2P3VA 2WKYA 1B7HA 2ZZWA 2I4CA 3IFAA 4U22A 1YPNA 3HHGA 4IO3A 4NF6A 5DVFA 2ONRA 3CVGA 5EHSA 4DXCA 2FHYA 5AA2A 1LBYA 1QKBA 3OO6A 1MPDA 4PCDA 3DP4A 4GLIA 1SD3A 3IOVA 4ZZAA 4P3LA 1LBXA 3C33A 1XVXA 1FTKA 2CEXA 2Y7KA 2F34A 3S2VA 5H8HA 4OXVA 5TPAB 4JSDA 4RA1A 2Z8DA 5HBCA 4ELQA 4ZE8A 1DPEA 1FPGA 1UTHB 4POWA 1FQEA 2GH9A 1XT8A 2DVZA 3K6WA 3TCHA 4LQ5A 1SW5A 2GQ1A 2AL4A 2XXXA 4OANA 3D4CA 2DYXA 4K3FA 1DOTA 4N07A 2RC7A 1FPLA 1LAHE 4X8RA 1I6AA 1NV0A 3VVFA 2DP8A 2OWTA 1FPJA 3G3HA 2R8TA 4X04A 4PFIA 4YKJA 4F31B 1SBPA 2A5SA 2OX3A 4GL8A 3B6TA 4PAIA 1SW2A 5CBSA 2WOPA 3SESA 3HO7A 4UABA 5H8NA 3H03A 1SI1A 4YKKA 1LAGE 4GF8A 4DCYA 1XOCA 5DEXA 5IAIA 1NNTA 1FQBA 1OIBA 2W7YA 3MVYA 3CRBA 3PUZE 4HE0A 2PBWA 2KR0A 3D4GA
chains in the Genus database with same CATH topology
3CHGA 4XKQA 5JTYA 4R75A 3IJOB 4G4PA 3I5OA 3ILTB 3QUJA 2NXOA 2QRYA 1NNFA 3PPPA 3KJTA 1SVXB 4OHNA 3FXUA 3MC2A 2DWJA 3K6VA 3IO6A 1B40A 2Z8EA 1MXVA 1B0LA 4XXUA 4H6DA 1HSLA 5I2KA 1TWYA 4ZECA 3TTMA 2OJTA 3IO4A 2Y7IA 3RNNA 1A55A 3LBSA 1Y20A 4YKIA 1MDQA 3FVNA 4OFOA 3ZKLA 4FIMA 1B5JA 1IXGA 3TUSA 2THIA 4F3PA 3O29A 4QFKA 1UIVA 3FASA 3BKIB 3BFUA 1EZ9A 1MQJA 3G3GA 3K1NA 2E1SA 1Q1KA 1LFIA 3TQLA 4DE8A 1MDP1 1OVTA 3MUQA 4JXIA 3RY3A 3FIRA 1UIUA 2Z23A 1USYH 3MVZA 3PV0E 2B3BA 3OSRA 1WVJA 3TPAA 1I69A 4X9TA 5DT6A 4NF6B 4ELOA 3VFJA 3MPKA 1URGA 3R7XA 1AOVA 4F39A 4H1XA 3IOTA 1XHYA 1M5EA 4RPNA 2PT1A 4ZEIA 3IB2A 4PE5B 1MXZA 4F3SA 3N94A 3PAMA 5HM4B 3HPIA 5H8HB 4PFYA 2B4LA 3LUYA 3THIA 3L6GA 3U94A 4QHQA 5H8FA 1PB8A 1BIYA 2QL3A 4I1DA 2UXAA 5DYHA 5TP9B 1IZ1A 1GVCA 1H76A 5F7VA 5CMBA 1A7LA 2V25A 5H8SA 1QW0A 2YLNA 4RJZA 1IXIA 1NMUA 4DLDA 2Q88A 4GXAA 3TYHA 3E3KA 2Q8JA 1MM7A 4NE4A 2M8CA 5A5XA 4FEDA 5CM6A 2WOLA 4MH5A 4MFIA 4QF9A 2F6GA 3EPEA 3SEYA 1B05A 1MS7A 2X26A 4ZE9A 1B7ZA 4WXJA 4QFOA 3DRKA 2XXYA 4G68C 3UP9A 2LAOA 1AL3A 1F9BA 1B3GA 4PFUA 4NF5A 5JTYB 3SDFA 3TTRA 4KD5A 5CC2A 3PMWA 5FTHA 5KCJB 3S9NC 2ZYKA 3O9PA 4OEVA 2XXVA 3CI8A 4IB2A 4H8JA 4P0IA 4XTCQ 3QUFA 5I57A 3PMVA 3N26A 1D4NA 3EHSA 2DXRA 2RCAA 2NUVA 4KYDA 2UYEA 4OESA 1EH3A 3KBRA 3PUYE 4TLMB 1MG1A 2D21A 3Q25A 4GD5A 1JQFA 3PUVE 1EU8A 4JBZA 3IAZA 3PD8A 5HPQA 3CR9A 3S4UA 2AL5A 3GBBA 3O97A 2QMWA 2ALUA 2P2AA 3K00A 3QIMA 2QS4A 1MY4A 4GRKA 2RF1A 3IOWA 3IK6B 3KG2A 2H99A 1MH4A 3LVUA 3KFMA 3TDJA 3VVEA 3FXRA 4DCXA 2QJEA 1MRPA 1B2HA 2V3QA 1IITA 4DXBA 4LQ2A 2P1SA 4NF4B 1B4HA 1POTA 5L9OA 4YKPA 4MLVA 5ICQA 1BKAA 2O68A 4N13A 3H06B 1VSOA 1PB7A 1Y3QA 3O6GA 2V84A 4EXKA 3LR1A 3Q27A 3WAEA 3FGSA 4ELPA 3G3FA 3B6QA 1XC1A 4LATA 5I84A 4EDPA 4G68A 1LFGA 3I3VA 4GQOA 2VD2A 2DE4A 2YJPA 3T22A 3JV9A 1RKMA 2O6AA 5ICTA 3IX1A 4HCWA 5J1DA 5H8FB 4Q30B 2F6PA 3KEIA 2ESNA 3SETA 2HCAA 1B5IA 4KHZE 4Q8RA 3KSXA 3K4UA 4U23A 4MF3A 3MP8A 2ZYOA 4LZ5A 3TFLA 3FJGA 1N7XA 3V89B 1LB9A 3TELA 4LUBA 4R72A 2X7QA 3M8UA 3H6UA 1PBQA 1TFAA 3U8QA 3E13X 1FTLA 3PGFA 2DSFA 1YTVA 1NKXA 3G3IA 1QVSA 1US4A 4PFTA 5CBRA 4YMAA 3O2AA 1XS5A 1B51A 2Y7WA 4X1DA 2XXQA 2R9JA 1DMBA 1QUJA 3HCQA 2XXHA 3PPNA 4NF5B 1HSJA 4F1UA 1QJMA 3ZSFA 4F18A 5I58A 1O7TA 4PETA 2G29A 4RPOA 4FJPA 3CFZA 5I57B 2DS9A 3IL1B 3U1OA 3SEXA 1B58A 4E0XA 3OO8A 1FCKA 4U21A 3RTWB 3T93B 1IIWA 2HEUA 4YAHX 1USYE 2DE3A 1FTJA 5FHOA 2F78A 4R74A 4YB7A 2NVUB 3MVXA 2GRVA 3BFTA 2I4BA 4RXLA 1B5HA 2AYSA 3V5AA 4XIGQ 4ISUA 3OO7A 4RNSA 1US5A 4ZEDA 2HZKA 4NEDA 5BWJA 2PMSA 1MQHA 1Y3PA 3OD7A 2V3UA 2QPQA 1N3WA 4QFLA 1Y9UA 4Z0IA 5CMKA 3DELB 2XXPA 4DXUA 2D3IA 3V8XB 4DZ1A 2H5YA 4GFRA 3GXAA 1GR2A 1P1NA 1B3FA 2HAUA 1N04A 4F2QA 2F7CA 4G2ZA 4EQ9A 1II5A 2DXYA 2XX7A 4OFLA 2HXWA 3K02A 3OOAA 3DRIA 3DP6A 4KYEA 3W9WA 3CSGA 5H8QB 4EQBA 4GXSB 3H3GA 2DWIA 3PUXE 4HS7A 1IQ7A 4NF8B 5AE4A 3PU5A 3FD3A 1Q35A 4P0GA 4BDOA 3ODBA 3IR1A 3RT6B 2R6GE 2BJJX 3OMBA 4FORA 4G68B 1IXHA 4X48A 1JEUA 1O64A 4ONYA 1SW1A 4F29A 2P0SA 4X1BA 3KGCA 3OEMA 3G7WA 1LCFA 4F19A 3W9VA 1A54A 1OQHA 1LGBC 2HFBA 4YU0A 2OWSA 2OLBA 1QUIA 2A5TB 1JW5A 3G3KA 2ANJA 1LFHA 3N6UA 1OMPA 4XKPA 3RLFE 5FHNA 3OXNA 3KN8A 1DTZA 2ZNSA 2IEEA 2UYFA 3KSJA 3OENA 1Z7NE 3CFXA 1AIVA 1CE2A 2GHAA 4JWYA 5AA2B 5I2NA 3DRJA 1A40A 4G8NA 5KZTA 3FVOA 4F22A 2HQ0A 1BLFA 1QUKA 3KZGA 4EQ7A 3C36A 2RC8A 1N76A 1Y1MA 2ZYNA 5KDTA 1H44A 3V83A 3BBRA 5LOMA 3O6HA 2RINA 1UTBA 3KOTA 3DRFA 4HTGA 4IGRA 3T96B 4C1TA 4JDFA 1KWHA 2O1LA 3E9XA 3SERA 3SEUA 3RQTA 3LSXA 3FUZA 4C1UA 3S9MC 4OYVA 3MZ9A 1S50A 3C31A 3KN7A 1JW4A 3H6VA 3A3UA 4U1OA 2QSXA 4BDMA 1P1UA 2CZLA 4RK2A 1B1XA 1H45A 4O3BA 1H3DA 2OBGA 1NL5A 3CG3A 2YPNA 2D5WA 5H8NB 1H43A 1SQYA 5EHMA 4N6PA 3VXCA 1PDAA 5DEXB 1JNFA 4WEDA 1IUDA 2O7UA 3TMGA 4R6HA 3CIJA 3LSLA 1T0KA 3T9UA 4I62A 3PUWE 3KJ7A 3OSQA 5ISUA 2H25A 1LBBA 1PC3A 2ONKE 5IKBA 3VVDA 3A3CA 5M2VA 4H67A 4LZ8A 4EF1A 4KCDA 3MP1A 4QSDA 4JWOA 1Y1ZA 5K2XA 4IGTA 1I6BA 2Q2AA 1MH3A 4U4SA 2IA4A 1GV8A 4C0RA 2XXWA 3B7DA 5DTBA 4FAJA 5FTIA 1UTHA 3T66A 1URDA 1MXXA 1OLCA 3I6VA 1FQFA 3FV1A 1FTMA 3Q28A 2ZMBA 4U4XA 1NFTA 1R1NA 4H5GA 5AA1A 3O66A 5I2KB 3EN3A 4U2RA 1URSA 2I3VA 4R2FA 3GLBA 4Z7EA 3WAFA 3RN8A 1LAFE 3K1PA 4M4GA 1JETA 5I56A 3KOSA 4IO5A 3PPRA 1B6HA 2I48A 3QYTA 3ZS6A 5ITPA 2FYIA 4EXLA 3M3KA 3C4MA 3S9LC 1MPBA 5TU0A 1P1WA 2XXTA 1GTKA 1B9JA 3SKPA 4QFNA 1QKAA 2AIXA 1FTOA 3OO9A 2ZYMA 3P7IA 5EYFA 1HSEA 1R9QA 3U92A 3UN6A 2UVGA 1ZLQA 3OEKA 4NMYA 4YMBA 1FQDA 5JEIA 2QMXA 3FV2A 1SDXA 2UVHA 1DSNA 3U93A 3TKDA 1DPPA 4JB7A 3GBAA 1OLAA 2RCBA 4WEPA 3TAJA 1ZMGA 4TOZA 3N6TA 3DP8A 3Q29A 3RTFB 4WKMA 3MP6A 3TODA 3MAMA 3IB1A 3K0VA 4GWOA 3TZAA 2O84X 4OENA 1OQGA 5AA4A 1UTBB 2HZLA 1LSTA 2O51A 1B7UA 3S9EA 2B65A 2V93A 4LZ7A 3SEVA 2XX8A 4IY5A 1B52A 1NNKA 3G3JA 4BDLA 4AQ4A 1O63A 2DWHA 4TLLB 1NH7A 4FEBA 4IO6A 1S9TA 1S7YA 2ZNTA 1A8FA 2VHAA 4AB5A 3UORA 4JSOA 3UGWA 2B3FA 2ZXTA 1FW0A 4F3BA 5A5XB 1N84A 5I59A 4ZEBA 2PX1A 1Y4CA 2Y7PA 4DIGA 3MZBA 2XHDA 1SI0A 3IORA 4ND9A 1ZTYA 1LAXA 3DRHA 1J1NA 4EUOA 4EF2A 4G8MA 1XVYA 3VXBA 3FATA 4YB6A 1N3XA 4I8CA 3ONMA 1D9VA 4QRZA 2HAVA 3FZVA 3MJNA 1EZPA 1LBCA 4R9GA 1MPCA 1P99A 2X7PA 4QSEA 4YICA 4LVQA 4DDDA 2QS3A 4R2BA 3C9HA 1B3HA 3L6HA 4MLQA 4NWCA 1JVXA 2DOJA 3ECRA 2RKMA 2I58A 4Q0CA 4OQOA 4ESWA 3USDA 3B6WA 3HSTA 4HW8A 3T9XB 5TP9A 4RYAA 3AXFA 4O3AA 3K2DA 4BDNA 3T9HB 3MZ1A 4R6YA 4KR5A 3ILUB 2FNCA 3JZJA 1ZKBA 4IO7A 4KI0E 4UA8A 5FHMA 3RUMA 5I56B 1IEJA 2GFEA 1B32A 4ZS9A 4YB5A 4PQJA 2E0SA 4HCYA 1EZOA 1D9YA 4KFQA 4E0WA 1ANFA 3O28A 3VV5A 2KLFA 3QAXA 2NWJA 4KYSA 2G93A 2RC9A 1R9LA 3TCGA 2O7IA 1Z7ME 5L9MA 3MVWA 2F36A 4UACA 3C32A 4OFJA 3E4RA 4H65A 1MQDA 1BP5A 2UVIA 4ZDMA 3VE1B 2I3WA 4R6KA 4THIA 1MY3A 2DQVA 4NWDA 3RPWA 4BDRA 3DM0A 5KCJA 3MQ9A 1SYHA 3EHUA 1YAEA 4H5FA 1TFDA 3FTOA 3R26A 3FVGA 2UVJA 4OVJA 3IB0A 3A09A 4G8HA 3IOUA 3TTLA 1ZJLA 1M5DA 2F7AA 2REJA 4FECA 1B46A 3K01A 4OETA 5DVIA 3C35A 2GHBA 4MBPA 5AA4B 4XKRA 3TTNA 1VFEA 1N0TA 4AB6A 1LB8A 4OERA 3O6IA 4RY1A 1FQCA 2VP1A 4G77A 5F1QA 1RYXA 1A99A 1MQGA 3M3LA 3W15C 3H6TA 1QULA 1RYOA 1MY1A 3K6XA 3VLVA 4OZ9A 4F2OA 5CMCA 1UQWA 4QSCA 2I0CA 1A8EA 1ATGA 3UIFA 4POXA 1GGGA 2H9BA 1SW4A 5I59B 3T9VA 3TCFA 3U72A 2F8DA 2PT2A 3VLUA 2I6EA 4IO4A 4NF4A 1MM6A 4R9FA 4GIZA 1FQAA 4ZEKA 3PD9A 3PMXA 1PEBA 3CFLA 1JVYA 2Q89A 3DRGA 1I6QA 2ZNUA 3M3FA 1AH5A 1ELJA 3TEPA 3Q26A 2PYYA 4BLAA 1POY1 2PVUA 5B70A 5I58B 2F35A 4FE8A 3PPQA 3DLNA 4KCCA 5K2YA 4F3GA 5JK4A 1DTGA 4GOTA 2XD2A 3EHTA 3CG1A 3QSLA 1MXYA 1M5FA 4ESXA 3FXQA 1VFDA 1MY2A 2R71A 2QS1A 3H6WA 4NTLA 2V3TA 4M1VA 2DE2A 4YZZA 4Q5TA 3FVKA 1JW1A 2F5XA 4FATA 5CRYA 3KN3A 2XD3A 3SEWA 1M5BA 3O6PA 2H4IA 3LSFB 2OCUA 3ZKKA 3UK4A 2CMOA 2VD3A 4IY6A 2ABHA 4KPTA 3RT8A 4ZZEA 5CI5A 3GZGA 1B3LA 4I9DA 4RK9A 4PFWA 1M5CA 5CMMA 5L8DA 2QS2A 1D3KA 1B4ZA 3JYRA 3RYBA 4JWXA 1WODA 1LCTA 2XXUA 1Y3NA 4TQUQ 4IO2A 3FJMA 3F11A 3K6UA 5TPAA 4ZEFA 4P11A 2ONSA 1MXUA 3H4ZA 3HN0A 2Y84A 2DVCA 3TQWA 1Y4TA 1L5TA 2Q2CA 2O1MA 4PP0A 3QXMA 1MQIA 4KQPA 4H8IA 2O69A 2F7BA 1CB6A 1B1HA 1PBPA 1P1OA 1OVBA 1NNPA 5L9SA 3K1MA 3MBPA 4LA9A 3PPOA 5DVJA 3MW0A 4F1VA 3H7MA 4BDQA 1YCJA 2XXIA 4H0WA 5ITOA 2VOZA 1JEVA 5BUUA 3OELA 2VGQA 5AA3A 4LP2B 1B0HA 1PB9A 3N5LA 3VDFA 1VR5A 1IXCA 3UA8A 5ELVA 2OZZA 2I0BA 3RYAA 4OTEA 1BTJA 1MY0A 4ECFA 5I2NB 4O3CA 4ELRA 3TTKA 1NH8A 1TXFA 4R73A 1AMFA 1ZU0A 4QFPA 2Z8FA 5AA2D 4U1ZA 5B7DA 1P1QA 2F97A 3R6UA 4GVOA 2OK2A 2Z22A 4OWDA 3RGYA 2WOKA 4L17A 3MPLA 2NOOA 3MWBA 1TT1A 4XKNA 5KDTB 1ZIUA 1ZBMA 4OMBA 2DWAA 5H8QA 1SYIA 4NF8A 2H98A 2B4MA 1MXWA 3IJXB 3C34A 2FA7A 3CSBA 3HV1A 3LC8A 4GL0A 3HHFA 2I49A 1LLSA 2Y7RA 4LONB 3FJ7A 3LSWA 3EQ1A 3QK6A 1VE4A 1B3EA 1N7WA 2XXRA 3VLWA 2A5TA 1R6ZA 3EF7A 4F1YA 2REGA 2XX9A 4OEUA 1WDNA 2Q9TA 2WKYA 1B7HA 2I4CA 4U22A 1YPNA 3HHGA 4IO3A 4NF6A 5DVFA 2ONRA 3CVGA 5EHSA 4DXCA 5AA2A 1QKBA 3OO6A 1MPDA 3DP4A 4GLIA 1SD3A 3IOVA 4ZZAA 3C33A 1XVXA 1FTKA 2Y7KA 2F34A 3S2VA 5H8HA 4OXVA 5TPAB 4JSDA 4RA1A 2Z8DA 5HBCA 4ELQA 4ZE8A 1DPEA 1UTHB 4POWA 1FQEA 2GH9A 1XT8A 2DVZA 3K6WA 3TCHA 4LQ5A 1SW5A 2AL4A 2XXXA 3D4CA 2DYXA 4K3FA 1DOTA 4N07A 2RC7A 1LAHE 1I6AA 3VVFA 2DP8A 2OWTA 3G3HA 4YKJA 4F31B 1SBPA 2A5SA 4GL8A 3B6TA 1SW2A 5CBSA 2WOPA 3SESA 3HO7A 5H8NA 3H03A 1SI1A 4YKKA 1LAGE 4GF8A 4DCYA 1XOCA 5DEXA 5IAIA 1NNTA 1FQBA 1OIBA 2W7YA 3MVYA 3CRBA 3PUZE 2PBWA 3D4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CHG A;  4XKQ A;  5JTY A;  4R75 A;  3IJO B;  4G4P A;  3I5O A;  3ILT B;  3QUJ A;  2NXO A;  2QRY A;  1NNF A;  3PPP A;  3KJT A;  1SVX B;  4OHN A;  3FXU A;  3MC2 A;  2DWJ A;  3K6V A;  3IO6 A;  1B40 A;  2Z8E A;  1MXV A;  1B0L A;  4XXU A;  4H6D A;  1HSL A;  5I2K A;  1TWY A;  4ZEC A;  3TTM A;  2OJT A;  3IO4 A;  2Y7I A;  3RNN A;  1A55 A;  3LBS A;  1Y20 A;  4YKI A;  1MDQ A;  3FVN A;  4OFO A;  3ZKL A;  4FIM A;  1B5J A;  1IXG A;  3TUS A;  2THI A;  4F3P A;  3O29 A;  4QFK A;  1UIV A;  3FAS A;  3BKI B;  3BFU A;  1EZ9 A;  1MQJ A;  3G3G A;  3K1N A;  2E1S A;  1Q1K A;  1LFI A;  3TQL A;  4DE8 A;  1MDP 1;  1OVT A;  3MUQ A;  4JXI A;  3RY3 A;  3FIR A;  1UIU A;  2Z23 A;  1USY H;  3MVZ A;  3PV0 E;  2B3B A;  3OSR A;  1WVJ A;  3TPA A;  1I69 A;  4X9T A;  5DT6 A;  4NF6 B;  4ELO A;  3VFJ A;  3MPK A;  1URG A;  3R7X A;  1AOV A;  4F39 A;  4H1X A;  3IOT A;  1XHY A;  1M5E A;  4RPN A;  2PT1 A;  4ZEI A;  3IB2 A;  4PE5 B;  1MXZ A;  4F3S A;  3N94 A;  3PAM A;  5HM4 B;  3HPI A;  5H8H B;  4PFY A;  2B4L A;  3LUY A;  3THI A;  3L6G A;  3U94 A;  4QHQ A;  5H8F A;  1PB8 A;  1BIY A;  2QL3 A;  4I1D A;  2UXA A;  5DYH A;  5TP9 B;  1IZ1 A;  1GVC A;  1H76 A;  5F7V A;  5CMB A;  1A7L A;  2V25 A;  5H8S A;  1QW0 A;  2YLN A;  4RJZ A;  1IXI A;  1NMU A;  4DLD A;  2Q88 A;  4GXA A;  3TYH A;  3E3K A;  2Q8J A;  1MM7 A;  4NE4 A;  2M8C A;  5A5X A;  4FED A;  5CM6 A;  2WOL A;  4MH5 A;  4MFI A;  4QF9 A;  2F6G A;  3EPE A;  3SEY A;  1B05 A;  1MS7 A;  2X26 A;  4ZE9 A;  1B7Z A;  4WXJ A;  4QFO A;  3DRK A;  2XXY A;  4G68 C;  3UP9 A;  2LAO A;  1AL3 A;  1F9B A;  1B3G A;  4PFU A;  4NF5 A;  5JTY B;  3SDF A;  3TTR A;  4KD5 A;  5CC2 A;  3PMW A;  5FTH A;  5KCJ B;  3S9N C;  2ZYK A;  3O9P A;  4OEV A;  2XXV A;  3CI8 A;  4IB2 A;  4H8J A;  4P0I A;  4XTC Q;  3QUF A;  5I57 A;  3PMV A;  3N26 A;  1D4N A;  3EHS A;  2DXR A;  2RCA A;  2NUV A;  4KYD A;  2UYE A;  4OES A;  1EH3 A;  3KBR A;  3PUY E;  4TLM B;  1MG1 A;  2D21 A;  3Q25 A;  4GD5 A;  1JQF A;  3PUV E;  1EU8 A;  4JBZ A;  3IAZ A;  3PD8 A;  5HPQ A;  3CR9 A;  3S4U A;  2AL5 A;  3GBB A;  3O97 A;  2QMW A;  2ALU A;  2P2A A;  3K00 A;  3QIM A;  2QS4 A;  1MY4 A;  4GRK A;  2RF1 A;  3IOW A;  3IK6 B;  3KG2 A;  2H99 A;  1MH4 A;  3LVU A;  3KFM A;  3TDJ A;  3VVE A;  3FXR A;  4DCX A;  2QJE A;  1MRP A;  1B2H A;  2V3Q A;  1IIT A;  4DXB A;  4LQ2 A;  2P1S A;  4NF4 B;  1B4H A;  1POT A;  5L9O A;  4YKP A;  4MLV A;  5ICQ A;  1BKA A;  2O68 A;  4N13 A;  3H06 B;  1VSO A;  1PB7 A;  1Y3Q A;  3O6G A;  2V84 A;  4EXK A;  3LR1 A;  3Q27 A;  3WAE A;  3FGS A;  4ELP A;  3G3F A;  3B6Q A;  1XC1 A;  4LAT A;  5I84 A;  4EDP A;  4G68 A;  1LFG A;  3I3V A;  4GQO A;  2VD2 A;  2DE4 A;  2YJP A;  3T22 A;  3JV9 A;  1RKM A;  2O6A A;  5ICT A;  3IX1 A;  4HCW A;  5J1D A;  5H8F B;  4Q30 B;  2F6P A;  3KEI A;  2ESN A;  3SET A;  2HCA A;  1B5I A;  4KHZ E;  4Q8R A;  3KSX A;  3K4U A;  4U23 A;  4MF3 A;  3MP8 A;  2ZYO A;  4LZ5 A;  3TFL A;  3FJG A;  1N7X A;  3V89 B;  1LB9 A;  3TEL A;  4LUB A;  4R72 A;  2X7Q A;  3M8U A;  3H6U A;  1PBQ A;  1TFA A;  3U8Q A;  3E13 X;  1FTL A;  3PGF A;  2DSF A;  1YTV A;  1NKX A;  3G3I A;  1QVS A;  1US4 A;  4PFT A;  5CBR A;  4YMA A;  3O2A A;  1XS5 A;  1B51 A;  2Y7W A;  4X1D A;  2XXQ A;  2R9J A;  1DMB A;  1QUJ A;  3HCQ A;  2XXH A;  3PPN A;  4NF5 B;  1HSJ A;  4F1U A;  1QJM A;  3ZSF A;  4F18 A;  5I58 A;  1O7T A;  4PET A;  2G29 A;  4RPO A;  4FJP A;  3CFZ A;  5I57 B;  2DS9 A;  3IL1 B;  3U1O A;  3SEX A;  1B58 A;  4E0X A;  3OO8 A;  1FCK A;  4U21 A;  3RTW B;  3T93 B;  1IIW A;  2HEU A;  4YAH X;  1USY E;  2DE3 A;  1FTJ A;  5FHO A;  2F78 A;  4R74 A;  4YB7 A;  2NVU B;  3MVX A;  2GRV A;  3BFT A;  2I4B A;  4RXL A;  1B5H A;  2AYS A;  3V5A A;  4XIG Q;  4ISU A;  3OO7 A;  4RNS A;  1US5 A;  4ZED A;  2HZK A;  4NED A;  5BWJ A;  2PMS A;  1MQH A;  1Y3P A;  3OD7 A;  2V3U A;  2QPQ A;  1N3W A;  4QFL A;  1Y9U A;  4Z0I A;  5CMK A;  3DEL B;  2XXP A;  4DXU A;  2D3I A;  3V8X B;  4DZ1 A;  2H5Y A;  4GFR A;  3GXA A;  1GR2 A;  1P1N A;  1B3F A;  2HAU A;  1N04 A;  4F2Q A;  2F7C A;  4G2Z A;  4EQ9 A;  1II5 A;  2DXY A;  2XX7 A;  4OFL A;  2HXW A;  3K02 A;  3OOA A;  3DRI A;  3DP6 A;  4KYE A;  3W9W A;  3CSG A;  5H8Q B;  4EQB A;  4GXS B;  3H3G A;  2DWI A;  3PUX E;  4HS7 A;  1IQ7 A;  4NF8 B;  5AE4 A;  3PU5 A;  3FD3 A;  1Q35 A;  4P0G A;  4BDO A;  3ODB A;  3IR1 A;  3RT6 B;  2R6G E;  2BJJ X;  3OMB A;  4FOR A;  4G68 B;  1IXH A;  4X48 A;  1JEU A;  1O64 A;  4ONY A;  1SW1 A;  4F29 A;  2P0S A;  4X1B A;  3KGC A;  3OEM A;  3G7W A;  1LCF A;  4F19 A;  3W9V A;  1A54 A;  1OQH A;  1LGB C;  2HFB A;  4YU0 A;  2OWS A;  2OLB A;  1QUI A;  2A5T B;  1JW5 A;  3G3K A;  2ANJ A;  1LFH A;  3N6U A;  1OMP A;  4XKP A;  3RLF E;  5FHN A;  3OXN A;  3KN8 A;  1DTZ A;  2ZNS A;  2IEE A;  2UYF A;  3KSJ A;  3OEN A;  1Z7N E;  3CFX A;  1AIV A;  1CE2 A;  2GHA A;  4JWY A;  5AA2 B;  5I2N A;  3DRJ A;  1A40 A;  4G8N A;  5KZT A;  3FVO A;  4F22 A;  2HQ0 A;  1BLF A;  1QUK A;  3KZG A;  4EQ7 A;  3C36 A;  2RC8 A;  1N76 A;  1Y1M A;  2ZYN A;  5KDT A;  1H44 A;  3V83 A;  3BBR A;  5LOM A;  3O6H A;  2RIN A;  1UTB A;  3KOT A;  3DRF A;  4HTG A;  4IGR A;  3T96 B;  4C1T A;  4JDF A;  1KWH A;  2O1L A;  3E9X A;  3SER A;  3SEU A;  3RQT A;  3LSX A;  3FUZ A;  4C1U A;  3S9M C;  4OYV A;  3MZ9 A;  1S50 A;  3C31 A;  3KN7 A;  1JW4 A;  3H6V A;  3A3U A;  4U1O A;  2QSX A;  4BDM A;  1P1U A;  2CZL A;  4RK2 A;  1B1X A;  1H45 A;  4O3B A;  1H3D A;  2OBG A;  1NL5 A;  3CG3 A;  2YPN A;  2D5W A;  5H8N B;  1H43 A;  1SQY A;  5EHM A;  4N6P A;  3VXC A;  1PDA A;  5DEX B;  1JNF A;  4WED A;  1IUD A;  2O7U A;  3TMG A;  4R6H A;  3CIJ A;  3LSL A;  1T0K A;  3T9U A;  4I62 A;  3PUW E;  3KJ7 A;  3OSQ A;  5ISU A;  2H25 A;  1LBB A;  1PC3 A;  2ONK E;  5IKB A;  3VVD A;  3A3C A;  5M2V A;  4H67 A;  4LZ8 A;  4EF1 A;  4KCD A;  3MP1 A;  4QSD A;  4JWO A;  1Y1Z A;  5K2X A;  4IGT A;  1I6B A;  2Q2A A;  1MH3 A;  4U4S A;  2IA4 A;  1GV8 A;  4C0R A;  2XXW A;  3B7D A;  5DTB A;  4FAJ A;  5FTI A;  1UTH A;  3T66 A;  1URD A;  1MXX A;  1OLC A;  3I6V A;  1FQF A;  3FV1 A;  1FTM A;  3Q28 A;  2ZMB A;  4U4X A;  1NFT A;  1R1N A;  4H5G A;  5AA1 A;  3O66 A;  5I2K B;  3EN3 A;  4U2R A;  1URS A;  2I3V A;  4R2F A;  3GLB A;  4Z7E A;  3WAF A;  3RN8 A;  1LAF E;  3K1P A;  4M4G A;  1JET A;  5I56 A;  3KOS A;  4IO5 A;  3PPR A;  1B6H A;  2I48 A;  3QYT A;  3ZS6 A;  5ITP A;  2FYI A;  4EXL A;  3M3K A;  3C4M A;  3S9L C;  1MPB A;  5TU0 A;  1P1W A;  2XXT A;  1GTK A;  1B9J A;  3SKP A;  4QFN A;  1QKA A;  2AIX A;  1FTO A;  3OO9 A;  2ZYM A;  3P7I A;  5EYF A;  1HSE A;  1R9Q A;  3U92 A;  3UN6 A;  2UVG A;  1ZLQ A;  3OEK A;  4NMY A;  4YMB A;  1FQD A;  5JEI A;  2QMX A;  3FV2 A;  1SDX A;  2UVH A;  1DSN A;  3U93 A;  3TKD A;  1DPP A;  4JB7 A;  3GBA A;  1OLA A;  2RCB A;  4WEP A;  3TAJ A;  1ZMG A;  4TOZ A;  3N6T A;  3DP8 A;  3Q29 A;  3RTF B;  4WKM A;  3MP6 A;  3TOD A;  3MAM A;  3IB1 A;  3K0V A;  4GWO A;  3TZA A;  2O84 X;  4OEN A;  1OQG A;  5AA4 A;  1UTB B;  2HZL A;  1LST A;  2O51 A;  1B7U A;  3S9E A;  2B65 A;  2V93 A;  4LZ7 A;  3SEV A;  2XX8 A;  4IY5 A;  1B52 A;  1NNK A;  3G3J A;  4BDL A;  4AQ4 A;  1O63 A;  2DWH A;  4TLL B;  1NH7 A;  4FEB A;  4IO6 A;  1S9T A;  1S7Y A;  2ZNT A;  1A8F A;  2VHA A;  4AB5 A;  3UOR A;  4JSO A;  3UGW A;  2B3F A;  2ZXT A;  1FW0 A;  4F3B A;  5A5X B;  1N84 A;  5I59 A;  4ZEB A;  2PX1 A;  1Y4C A;  2Y7P A;  4DIG A;  3MZB A;  2XHD A;  1SI0 A;  3IOR A;  4ND9 A;  1ZTY A;  1LAX A;  3DRH A;  1J1N A;  4EUO A;  4EF2 A;  4G8M A;  1XVY A;  3VXB A;  3FAT A;  4YB6 A;  1N3X A;  4I8C A;  3ONM A;  1D9V A;  4QRZ A;  2HAV A;  3FZV A;  3MJN A;  1EZP A;  1LBC A;  4R9G A;  1MPC A;  1P99 A;  2X7P A;  4QSE A;  4YIC A;  4LVQ A;  4DDD A;  2QS3 A;  4R2B A;  3C9H A;  1B3H A;  3L6H A;  4MLQ A;  4NWC A;  1JVX A;  2DOJ A;  3ECR A;  2RKM A;  2I58 A;  4Q0C A;  4OQO A;  4ESW A;  3USD A;  3B6W A;  3HST A;  4HW8 A;  3T9X B;  5TP9 A;  4RYA A;  3AXF A;  4O3A A;  3K2D A;  4BDN A;  3T9H B;  3MZ1 A;  4R6Y A;  4KR5 A;  3ILU B;  2FNC A;  3JZJ A;  1ZKB A;  4IO7 A;  4KI0 E;  4UA8 A;  5FHM A;  3RUM A;  5I56 B;  1IEJ A;  2GFE A;  1B32 A;  4ZS9 A;  4YB5 A;  4PQJ A;  2E0S A;  4HCY A;  1EZO A;  1D9Y A;  4KFQ A;  4E0W A;  1ANF A;  3O28 A;  3VV5 A;  2KLF A;  3QAX A;  2NWJ A;  4KYS A;  2G93 A;  2RC9 A;  1R9L A;  3TCG A;  2O7I A;  1Z7M E;  5L9M A;  3MVW A;  2F36 A;  4UAC A;  3C32 A;  4OFJ A;  3E4R A;  4H65 A;  1MQD A;  1BP5 A;  2UVI A;  4ZDM A;  3VE1 B;  2I3W A;  4R6K A;  4THI A;  1MY3 A;  2DQV A;  4NWD A;  3RPW A;  4BDR A;  3DM0 A;  5KCJ A;  3MQ9 A;  1SYH A;  3EHU A;  1YAE A;  4H5F A;  1TFD A;  3FTO A;  3R26 A;  3FVG A;  2UVJ A;  4OVJ A;  3IB0 A;  3A09 A;  4G8H A;  3IOU A;  3TTL A;  1ZJL A;  1M5D A;  2F7A A;  2REJ A;  4FEC A;  1B46 A;  3K01 A;  4OET A;  5DVI A;  3C35 A;  2GHB A;  4MBP A;  5AA4 B;  4XKR A;  3TTN A;  1VFE A;  1N0T A;  4AB6 A;  1LB8 A;  4OER A;  3O6I A;  4RY1 A;  1FQC A;  2VP1 A;  4G77 A;  5F1Q A;  1RYX A;  1A99 A;  1MQG A;  3M3L A;  3W15 C;  3H6T A;  1QUL A;  1RYO A;  1MY1 A;  3K6X A;  3VLV A;  4OZ9 A;  4F2O A;  5CMC A;  1UQW A;  4QSC A;  2I0C A;  1A8E A;  1ATG A;  3UIF A;  4POX A;  1GGG A;  2H9B A;  1SW4 A;  5I59 B;  3T9V A;  3TCF A;  3U72 A;  2F8D A;  2PT2 A;  3VLU A;  2I6E A;  4IO4 A;  4NF4 A;  1MM6 A;  4R9F A;  4GIZ A;  1FQA A;  4ZEK A;  3PD9 A;  3PMX A;  1PEB A;  3CFL A;  1JVY A;  2Q89 A;  3DRG A;  1I6Q A;  2ZNU A;  3M3F A;  1AH5 A;  1ELJ A;  3TEP A;  3Q26 A;  2PYY A;  4BLA A;  1POY 1;  2PVU A;  5B70 A;  5I58 B;  2F35 A;  4FE8 A;  3PPQ A;  3DLN A;  4KCC A;  5K2Y A;  4F3G A;  5JK4 A;  1DTG A;  4GOT A;  2XD2 A;  3EHT A;  3CG1 A;  3QSL A;  1MXY A;  1M5F A;  4ESX A;  3FXQ A;  1VFD A;  1MY2 A;  2R71 A;  2QS1 A;  3H6W A;  4NTL A;  2V3T A;  4M1V A;  2DE2 A;  4YZZ A;  4Q5T A;  3FVK A;  1JW1 A;  2F5X A;  4FAT A;  5CRY A;  3KN3 A;  2XD3 A;  3SEW A;  1M5B A;  3O6P A;  2H4I A;  3LSF B;  2OCU A;  3ZKK A;  3UK4 A;  2CMO A;  2VD3 A;  4IY6 A;  2ABH A;  4KPT A;  3RT8 A;  4ZZE A;  5CI5 A;  3GZG A;  1B3L A;  4I9D A;  4RK9 A;  4PFW A;  1M5C A;  5CMM A;  5L8D A;  2QS2 A;  1D3K A;  1B4Z A;  3JYR A;  3RYB A;  4JWX A;  1WOD A;  1LCT A;  2XXU A;  1Y3N A;  4TQU Q;  4IO2 A;  3FJM A;  3F11 A;  3K6U A;  5TPA A;  4ZEF A;  4P11 A;  2ONS A;  1MXU A;  3H4Z A;  3HN0 A;  2Y84 A;  2DVC A;  3TQW A;  1Y4T A;  1L5T A;  2Q2C A;  2O1M A;  4PP0 A;  3QXM A;  1MQI A;  4KQP A;  4H8I A;  2O69 A;  2F7B A;  1CB6 A;  1B1H A;  1PBP A;  1P1O A;  1OVB A;  1NNP A;  5L9S A;  3K1M A;  3MBP A;  4LA9 A;  3PPO A;  5DVJ A;  3MW0 A;  4F1V A;  3H7M A;  4BDQ A;  1YCJ A;  2XXI A;  4H0W A;  5ITO A;  2VOZ A;  1JEV A;  5BUU A;  3OEL A;  2VGQ A;  5AA3 A;  4LP2 B;  1B0H A;  1PB9 A;  3N5L A;  3VDF A;  1VR5 A;  1IXC A;  3UA8 A;  5ELV A;  2OZZ A;  2I0B A;  3RYA A;  4OTE A;  1BTJ A;  1MY0 A;  4ECF A;  5I2N B;  4O3C A;  4ELR A;  3TTK A;  1NH8 A;  1TXF A;  4R73 A;  1AMF A;  1ZU0 A;  4QFP A;  2Z8F A;  5AA2 D;  4U1Z A;  5B7D A;  1P1Q A;  2F97 A;  3R6U A;  4GVO A;  2OK2 A;  2Z22 A;  4OWD A;  3RGY A;  2WOK A;  4L17 A;  3MPL A;  2NOO A;  3MWB A;  1TT1 A;  4XKN A;  5KDT B;  1ZIU A;  1ZBM A;  4OMB A;  2DWA A;  5H8Q A;  1SYI A;  4NF8 A;  2H98 A;  2B4M A;  1MXW A;  3IJX B;  3C34 A;  2FA7 A;  3CSB A;  3HV1 A;  3LC8 A;  4GL0 A;  3HHF A;  2I49 A;  1LLS A;  2Y7R A;  4LON B;  3FJ7 A;  3LSW A;  3EQ1 A;  3QK6 A;  1VE4 A;  1B3E A;  1N7W A;  2XXR A;  3VLW A;  2A5T A;  1R6Z A;  3EF7 A;  4F1Y A;  2REG A;  2XX9 A;  4OEU A;  1WDN A;  2Q9T A;  2WKY A;  1B7H A;  2I4C A;  4U22 A;  1YPN A;  3HHG A;  4IO3 A;  4NF6 A;  5DVF A;  2ONR A;  3CVG A;  5EHS A;  4DXC A;  5AA2 A;  1QKB A;  3OO6 A;  1MPD A;  3DP4 A;  4GLI A;  1SD3 A;  3IOV A;  4ZZA A;  3C33 A;  1XVX A;  1FTK A;  2Y7K A;  2F34 A;  3S2V A;  5H8H A;  4OXV A;  5TPA B;  4JSD A;  4RA1 A;  2Z8D A;  5HBC A;  4ELQ A;  4ZE8 A;  1DPE A;  1UTH B;  4POW A;  1FQE A;  2GH9 A;  1XT8 A;  2DVZ A;  3K6W A;  3TCH A;  4LQ5 A;  1SW5 A;  2AL4 A;  2XXX A;  3D4C A;  2DYX A;  4K3F A;  1DOT A;  4N07 A;  2RC7 A;  1LAH E;  1I6A A;  3VVF A;  2DP8 A;  2OWT A;  3G3H A;  4YKJ A;  4F31 B;  1SBP A;  2A5S A;  4GL8 A;  3B6T A;  1SW2 A;  5CBS A;  2WOP A;  3SES A;  3HO7 A;  5H8N A;  3H03 A;  1SI1 A;  4YKK A;  1LAG E;  4GF8 A;  4DCY A;  1XOC A;  5DEX A;  5IAI A;  1NNT A;  1FQB A;  1OIB A;  2W7Y A;  3MVY A;  3CRB A;  3PUZ E;  2PBW A;  3D4G A; 
#chains in the Genus database with same CATH topology
 3CHG A;  4XKQ A;  5JTY A;  4R75 A;  3IJO B;  4G4P A;  3I5O A;  4MJO A;  4PAF A;  3ILT B;  3QUJ A;  2NXO A;  2QRY A;  1NV3 A;  1NNF A;  3PPP A;  3KJT A;  1SVX B;  4OHN A;  2Y5L A;  3FXU A;  3MC2 A;  2DWJ A;  1FPD A;  3K6V A;  3IO6 A;  4JVD A;  1B40 A;  2Z8E A;  1MXV A;  1B0L A;  5I7I A;  4XXU A;  1NV5 A;  4H6D A;  1HSL A;  5I2K A;  1TWY A;  5ET6 A;  4ZEC A;  2L5V A;  3TTM A;  2OJT A;  3IO4 A;  2Y7I A;  3RNN A;  1A55 A;  3LBS A;  1Y20 A;  4YKI A;  1MDQ A;  3FVN A;  4OFO A;  3ZKL A;  2QVR A;  4FIM A;  1B5J A;  1IXG A;  3TUS A;  2THI A;  4F3P A;  3O29 A;  4QFK A;  1UIV A;  3FAS A;  3BKI B;  3BFU A;  1EZ9 A;  1MQJ A;  3MYU A;  3G3G A;  1RDZ A;  3K1N A;  2E1S A;  3IFC A;  1Q1K A;  1LFI A;  3TQL A;  4DE8 A;  1MDP 1;  1OVT A;  3MUQ A;  4JXI A;  3RY3 A;  3FIR A;  2Q74 A;  1UIU A;  2Z23 A;  1USY H;  3MVZ A;  3PV0 E;  1FJ6 A;  2B3B A;  4MNI A;  1NV1 A;  3OSR A;  1WVJ A;  3TPA A;  1I69 A;  4X9T A;  1DK4 A;  2FVZ A;  5DT6 A;  4NF6 B;  4ELO A;  3VFJ A;  3MPK A;  1URG A;  3R7X A;  1AOV A;  4F39 A;  4H1X A;  3IOT A;  1LBW A;  1XHY A;  1M5E A;  4RPN A;  2PT1 A;  1DCU A;  4ZEI A;  3IB2 A;  4PE5 B;  1MXZ A;  4OVS A;  4F3S A;  3N94 A;  3PAM A;  5HM4 B;  3HPI A;  5H8H B;  4PFY A;  2B4L A;  4O8M A;  3LUY A;  3THI A;  3L6G A;  3U94 A;  5FBP A;  4QHQ A;  2XWK A;  5H8F A;  1PB8 A;  1BIY A;  2QL3 A;  5IZ1 A;  4I1D A;  2XA5 A;  2UXA A;  5DYH A;  5TP9 B;  1IZ1 A;  1D9Q A;  1GVC A;  4I3E A;  1H76 A;  4N91 A;  5F7V A;  2OWZ A;  5CMB A;  1A7L A;  1NI9 A;  2V25 A;  5H8S A;  4HE1 A;  1QW0 A;  5ESY A;  2YLN A;  4RJZ A;  1IXI A;  1NMU A;  4DLD A;  2Q88 A;  4GXA A;  3TYH A;  3E3K A;  2Q8J A;  1MM7 A;  4NE4 A;  2M8C A;  5A5X A;  4FED A;  5CM6 A;  2WOL A;  4MH5 A;  4MFI A;  4QF9 A;  2F6G A;  2ZZX A;  3EPE A;  3SEY A;  2QFL A;  1B05 A;  1MS7 A;  2X26 A;  4ZE9 A;  1B7Z A;  4WXJ A;  4QFO A;  3DRK A;  2XXY A;  4G68 C;  3UP9 A;  2LAO A;  1AL3 A;  1F9B A;  1B3G A;  4PFU A;  4NF5 A;  1JP4 A;  5JTY B;  3SDF A;  4KD5 A;  4XFE A;  3TTR A;  3PMW A;  5FTH A;  5CC2 A;  5KCJ B;  3S9N C;  2ZYK A;  3O9P A;  4OEV A;  2XXV A;  3CI8 A;  4O7I A;  4IB2 A;  2F3D A;  3RPL B;  1DBZ A;  4H8J A;  4P0I A;  4XTC Q;  3QUF A;  5I57 A;  1FPK A;  3PMV A;  3N26 A;  1D4N A;  2FIE A;  3EHS A;  2DXR A;  2RCA A;  2NUV A;  4KYD A;  2UYE A;  4OES A;  1EH3 A;  3KBR A;  3PUY E;  4TLM B;  2KQZ A;  1MG1 A;  2D21 A;  3Q25 A;  4GD5 A;  1JQF A;  2XWI A;  3PUV E;  1EU8 A;  4JBZ A;  1NUX A;  3IAZ A;  3PD8 A;  5HPQ A;  3T0J A;  4P1L A;  3CR9 A;  3S4U A;  2AL5 A;  3GBB A;  3O97 A;  2QMW A;  4MNP A;  2ALU A;  2P2A A;  3K00 A;  3QIM A;  3BIH A;  1KA0 A;  2QS4 A;  1MY4 A;  4GRK A;  2MKZ A;  2RF1 A;  3IOW A;  2BJI A;  3IK6 B;  3KG2 A;  2H99 A;  1MH4 A;  3LVU A;  3KFM A;  4MNC A;  3TDJ A;  3VVE A;  3FXR A;  4MIJ A;  4DCX A;  2QJE A;  1MRP A;  1B2H A;  2V3Q A;  1IIT A;  1AWB A;  4DXB A;  1BK4 A;  4LQ2 A;  2P1S A;  4NF4 B;  1B4H A;  1POT A;  5L9O A;  3E79 A;  4YKP A;  1IMC A;  4H45 A;  4LN5 A;  5ICQ A;  1BKA A;  4MLV A;  2O68 A;  4N13 A;  4HE2 A;  3H06 B;  1VSO A;  1PB7 A;  1Y3Q A;  3O6G A;  2V84 A;  2PFZ A;  2WX9 A;  4EXK A;  4PGP A;  3LR1 A;  3Q27 A;  3WAE A;  3FGS A;  4ELP A;  3G3F A;  4IR8 A;  3B6Q A;  4GBV A;  4GBW A;  1XC1 A;  4LAT A;  5I84 A;  4EDP A;  2PFY A;  4N17 A;  4MEV A;  4G68 A;  1LFG A;  3I3V A;  4GQO A;  2VD2 A;  2DE4 A;  2YJP A;  3JV9 A;  3T22 A;  1RKM A;  2O6A A;  5ICT A;  3IX1 A;  4HCW A;  5J1D A;  5H8F B;  4Q30 B;  2F6P A;  3KEI A;  2ESN A;  3SET A;  2HCA A;  1B5I A;  4KHZ E;  5IM2 A;  4Q8R A;  3KSX A;  3K4U A;  4KXP A;  4U23 A;  4MF3 A;  3MP8 A;  2ZYO A;  4LZ5 A;  3TFL A;  3FJG A;  1N7X A;  3V89 B;  1LB9 A;  3TEL A;  4LUB A;  4R72 A;  2X7Q A;  2WYK A;  3M8U A;  3H6U A;  1PBQ A;  1TFA A;  3U8Q A;  3E13 X;  1FTL A;  3PGF A;  3FXB A;  2DSF A;  1YTV A;  1NKX A;  3G3I A;  4NN3 A;  1QVS A;  1US4 A;  4PFT A;  5CBR A;  4YMA A;  3O2A A;  1XS5 A;  1B51 A;  2Y7W A;  4X1D A;  2XXQ A;  2R9J A;  1DMB A;  1QUJ A;  3HCQ A;  2FIX A;  2XXH A;  3PPN A;  4NF5 B;  1HSJ A;  4F1U A;  1QJM A;  3ZSF A;  4F18 A;  4N15 A;  5I58 A;  1O7T A;  4PET A;  2G29 A;  3HFU A;  4RPO A;  4HXV A;  4FJP A;  3CFZ A;  5I57 B;  4OA4 A;  2DS9 A;  3IL1 B;  3U1O A;  3SEX A;  2ZZV A;  1B58 A;  4E0X A;  4XEQ A;  1EYJ A;  3OO8 A;  1FCK A;  4U21 A;  3RTW B;  3T93 B;  1IIW A;  2HEU A;  4YAH X;  5ET8 A;  1USY E;  1FBC A;  2DE3 A;  1FTJ A;  5F24 A;  5FHO A;  2F78 A;  4R74 A;  4YB7 A;  2NVU B;  1KZ8 A;  3MVX A;  2GRV A;  3BFT A;  1FRP A;  4PDD A;  2I4B A;  4RXL A;  1B5H A;  2AYS A;  3V5A A;  3PTY A;  4P47 A;  3RYD A;  4XIG Q;  4ISU A;  3OO7 A;  3GYY A;  1US5 A;  4RNS A;  4AS4 A;  4ZED A;  2HZK A;  4NED A;  5BWJ A;  2PMS A;  1MQH A;  1Y3P A;  3OD7 A;  4FBP A;  2V3U A;  2WEF A;  2QPQ A;  1N3W A;  4QFL A;  1Y9U A;  4Z0I A;  1FBP A;  5CMK A;  3DEL B;  2XXP A;  4H46 A;  4DXU A;  2D3I A;  5IZ3 B;  5DW8 A;  3V8X B;  4DZ1 A;  5J16 A;  2H5Y A;  4GFR A;  3GXA A;  1GR2 A;  1P1N A;  1B3F A;  2HAU A;  1N04 A;  4F2Q A;  2F7C A;  1FBH A;  4G2Z A;  5EYG A;  4N4U A;  4EQ9 A;  1II5 A;  2DXY A;  2XX7 A;  4OFL A;  2HXW A;  3K02 A;  3OOA A;  3DRI A;  3DP6 A;  4KYE A;  3W9W A;  3CSG A;  5H8Q B;  1LBZ A;  4EQB A;  4GXS B;  3H3G A;  2DWI A;  3PUX E;  4HS7 A;  1IQ7 A;  4NF8 B;  5AE4 A;  3PU5 A;  3FD3 A;  1Q35 A;  4P0G A;  1FBG A;  4BDO A;  3ODB A;  3IR1 A;  3RT6 B;  2R6G E;  2BJJ X;  3OMB A;  4FOR A;  4G68 B;  1NV4 A;  1IXH A;  4O7M A;  4X48 A;  1JEU A;  1O64 A;  4ONY A;  1SW1 A;  4NX1 A;  4F29 A;  2P0S A;  4X1B A;  3KGC A;  3OEM A;  4N8Y A;  3G7W A;  1LCF A;  4F19 A;  3W9V A;  1A54 A;  1OQH A;  1LGB C;  3NOH A;  2HFB A;  4YU0 A;  2OWS A;  2OLB A;  4DI4 B;  1QUI A;  2A5T B;  1JW5 A;  3G3K A;  2ANJ A;  1LFH A;  3N6U A;  1OMP A;  4XKP A;  3RLF E;  5FHN A;  3OXN A;  4GX4 A;  3KN8 A;  1DTZ A;  2ZNS A;  2IEE A;  2UYF A;  3KSJ A;  2Q8M A;  3OEN A;  1Z7N E;  3CFX A;  1AIV A;  1CE2 A;  2GHA A;  2CZK A;  4JWY A;  5AA2 B;  5I2N A;  5EQ8 A;  2XXK A;  1VDW A;  1NV6 A;  3DRJ A;  1A40 A;  4G8N A;  5KZT A;  3FVO A;  4F22 A;  2HQ0 A;  1BLF A;  1QUK A;  3KZG A;  4EQ7 A;  3C36 A;  2RC8 A;  3T1B A;  1N76 A;  1Y1M A;  2ZYN A;  5KDT A;  1H44 A;  3V83 A;  3BBR A;  5LOM A;  4P8B A;  3O6H A;  2RIN A;  1UTB A;  3KOT A;  3DRF A;  4HTG A;  5LDZ A;  3QMF A;  3E78 A;  4IGR A;  1LBV A;  3T96 B;  4C1T A;  4JDF A;  1KWH A;  2O1L A;  3E9X A;  3SER A;  3SEU A;  3RQT A;  3LSX A;  3FUZ A;  4C1U A;  3ROJ A;  3S9M C;  4OYV A;  3MZ9 A;  1S50 A;  3C31 A;  3KN7 A;  1JW4 A;  3H6V A;  3A3U A;  4U1O A;  4NF0 A;  2QSX A;  4PTK A;  4BDM A;  1P1U A;  4AS5 A;  2CZL A;  4RK2 A;  1B1X A;  1H45 A;  4O3B A;  2P3N A;  1H3D A;  2OBG A;  1NL5 A;  3CG3 A;  2YPN A;  2D5W A;  4GX3 A;  2VPN A;  5H8N B;  1H43 A;  1SQY A;  5EHM A;  4N6P A;  3VXC A;  4OVR A;  1PDA A;  5DEX B;  1JNF A;  1EYI A;  2FBP A;  4WED A;  1IUD A;  2O7U A;  3KBZ A;  3TMG A;  4R6H A;  3CIJ A;  3LSL A;  1T0K A;  3T9U A;  4I62 A;  3PUW E;  3KJ7 A;  3BIG A;  3OSQ A;  3KC0 A;  5ISU A;  1FPE A;  2H25 A;  1LBB A;  1PC3 A;  2ONK E;  5IKB A;  3VVD A;  3A3C A;  5M2V A;  4H67 A;  4LZ8 A;  4EF1 A;  4KCD A;  3MP1 A;  4QSD A;  4JWO A;  1Y1Z A;  5K2X A;  4IGT A;  1I6B A;  2Q2A A;  1MH3 A;  4U4S A;  2IA4 A;  1GV8 A;  5I3S A;  4C0R A;  2XXW A;  3B7D A;  5IGA A;  1NUY A;  5DTB A;  4FAJ A;  5FTI A;  1UTH A;  3T66 A;  1URD A;  5IZZ A;  1MXX A;  1OLC A;  3I6V A;  1FQF A;  4MHF A;  3FV1 A;  1FTM A;  3Q28 A;  2ZMB A;  4U4X A;  1NFT A;  1R1N A;  4H5G A;  3O66 A;  5AA1 A;  5I2K B;  3EN3 A;  4U2R A;  1URS A;  2I3V A;  4R2F A;  3GLB A;  4Z7E A;  4GWU A;  3WAF A;  3RN8 A;  1LAF E;  3K1P A;  4M4G A;  4MMP A;  1JET A;  5I56 A;  3KOS A;  4IO5 A;  3PPR A;  1B6H A;  2I48 A;  3QYT A;  3ZS6 A;  5ITP A;  2FYI A;  4PFR A;  4QBA A;  4EXL A;  3B50 A;  4PF6 A;  2PCR A;  3M3K A;  3C4M A;  3S9L C;  1MPB A;  5TU0 A;  1P1W A;  2XXT A;  1GTK A;  1B9J A;  3SKP A;  1FSA A;  4QFN A;  1QKA A;  2AIX A;  1FTO A;  3OO9 A;  3U65 A;  2ZYM A;  3P7I A;  5EYF A;  1HSE A;  1R9Q A;  3U92 A;  3UN6 A;  4PDH A;  2UVG A;  5EQ9 A;  1IMD A;  1ZLQ A;  3OEK A;  2HXR A;  4NMY A;  4YMB A;  1FQD A;  2JJK A;  5I5P A;  1K9Y A;  5JEI A;  2QMX A;  3FV2 A;  1SDX A;  2UVH A;  1LEV A;  1DSN A;  3U93 A;  3TKD A;  1DPP A;  4JB7 A;  3GBA A;  1OLA A;  2RCB A;  4WEP A;  3TAJ A;  1ZMG A;  4OVQ A;  1CNQ A;  4TOZ A;  3N6T A;  3DP8 A;  3Q29 A;  3EKI A;  3RTF B;  4WKM A;  3MP6 A;  4I40 A;  3TOD A;  4JVI A;  3MAM A;  3IB1 A;  3K0V A;  4GWO A;  3TZA A;  2O84 X;  4OEN A;  1OQG A;  5AA4 A;  1UTB B;  2HZL A;  1G0H A;  1LST A;  2O51 A;  1B7U A;  3S9E A;  2B65 A;  2V93 A;  4LZ7 A;  1QGX A;  4PGN A;  3SEV A;  2XX8 A;  4IY5 A;  1B52 A;  1NNK A;  3G3J A;  5A5L A;  4BDL A;  2QVV A;  4AQ4 A;  1O63 A;  2DWH A;  4TLL B;  1NH7 A;  4FEB A;  4IO6 A;  1S9T A;  1S7Y A;  1NUW A;  2ZNT A;  1A8F A;  2VHA A;  4AB5 A;  4GWS A;  3UOR A;  2HPG A;  4JSO A;  3UGW A;  2B3F A;  2ZXT A;  3ISP A;  1FW0 A;  4F3B A;  5A5X B;  1N84 A;  5I59 A;  4ZEB A;  2PX1 A;  1Y4C A;  2Y7P A;  4DIG A;  3MZB A;  2XHD A;  1SI0 A;  3IOR A;  4ND9 A;  1ZTY A;  1LAX A;  3DRH A;  1J1N A;  4N8G A;  4EF2 A;  4EUO A;  4G8M A;  1XVY A;  3VXB A;  3FAT A;  4YB6 A;  1N3X A;  4I8C A;  3A29 A;  3ONM A;  1D9V A;  4QRZ A;  4QXD A;  2HAV A;  3FZV A;  4GWZ A;  3MJN A;  1EZP A;  1FBE A;  1LBC A;  4R9G A;  4N81 A;  1MPC A;  5EQA A;  1P99 A;  2X7P A;  4QSE A;  4YIC A;  4LVQ A;  4DDD A;  4P1E A;  4PC9 A;  2QS3 A;  4NQ8 A;  4R2B A;  3C9H A;  1B3H A;  3L6H A;  4MLQ A;  4NWC A;  1JVX A;  4GWY A;  2DOJ A;  3ECR A;  2RKM A;  2I58 A;  4Q0C A;  4OQO A;  4ESW A;  3USD A;  3B6W A;  3FBP A;  2CEY A;  3HST A;  2VT5 A;  4HW8 A;  1FPB A;  3T9X B;  5TP9 A;  4RYA A;  3AXF A;  4O3A A;  3K2D A;  4BDN A;  3T9H B;  3MZ1 A;  4R6Y A;  4KR5 A;  3ILU B;  2FNC A;  3JZJ A;  1ZKB A;  4IO7 A;  4KI0 E;  4PBH A;  1RDY A;  1FPF A;  4UA8 A;  5FHM A;  2F3B A;  3RUM A;  5I56 B;  1IEJ A;  2CZI A;  2GFE A;  1B32 A;  4ZS9 A;  4YB5 A;  4PQJ A;  2E0S A;  4HCY A;  1EZO A;  1D9Y A;  4KFQ A;  4E0W A;  1ANF A;  3O28 A;  3VV5 A;  1KA1 A;  2KLF A;  3QAX A;  4DI3 D;  2NWJ A;  4PAK A;  1YZ0 A;  4KYS A;  2G93 A;  2RC9 A;  1R9L A;  3TCG A;  2O7I A;  1Z7M E;  5L9M A;  3MVW A;  2F36 A;  4UAC A;  3C32 A;  4OFJ A;  3E4R A;  4H65 A;  4P56 A;  1MQD A;  2XWO A;  1BP5 A;  2UVI A;  4ZDM A;  3VE1 B;  2I3W A;  4PE3 A;  4R6K A;  4THI A;  1MY3 A;  2DQV A;  4NWD A;  3RPW A;  4BDR A;  3DM0 A;  5KCJ A;  3MQ9 A;  1SYH A;  3RPL A;  3EHU A;  4PF8 A;  1YAE A;  4H5F A;  1TFD A;  3FTO A;  2WBB A;  5EQ7 A;  3R26 A;  3FVG A;  2UVJ A;  4OVJ A;  1IMA A;  3IB0 A;  4N6K A;  1IME A;  2Y5K A;  3A09 A;  4G8H A;  3IOU A;  3TTL A;  1ZJL A;  1M5D A;  4NHB A;  2F7A A;  2REJ A;  4FEC A;  1B46 A;  3K01 A;  4OET A;  5DVI A;  3C35 A;  2GHB A;  4MBP A;  5AA4 B;  4XKR A;  3TTN A;  1VFE A;  1N0T A;  4AB6 A;  1LB8 A;  4OER A;  1NUZ A;  3O6I A;  1NV7 A;  2WYP A;  4RY1 A;  1FQC A;  2VP1 A;  1RDX A;  4G77 A;  5F1Q A;  1RYX A;  1A99 A;  1MQG A;  3M3L A;  3W15 C;  3H6T A;  1QUL A;  1RYO A;  1MY1 A;  3K6X A;  3VLV A;  4OZ9 A;  4F2O A;  5CMC A;  4OVT A;  1UQW A;  4QSC A;  2I0C A;  1A8E A;  4I3Y A;  2CZH A;  1ATG A;  1FJ9 A;  3UIF A;  3LV0 A;  2DDK A;  4POX A;  1GGG A;  2H9B A;  1SW4 A;  5I59 B;  3T9V A;  3TCF A;  3U72 A;  4N6D A;  2F8D A;  1FBF A;  2PT2 A;  3VLU A;  2I6E A;  4IO4 A;  4NF4 A;  1MM6 A;  3LUZ A;  4MX6 A;  1FPI A;  4GIZ A;  4R9F A;  1FQA A;  4ZEK A;  3PD9 A;  3PMX A;  1PEB A;  3CFL A;  4P9K A;  1JVY A;  2Q89 A;  3DRG A;  1I6Q A;  2ZNU A;  3M3F A;  1AH5 A;  1ELJ A;  3TEP A;  1FTA A;  3Q26 A;  2PYY A;  4BLA A;  1POY 1;  4OVP A;  2PVU A;  3MST A;  3KC1 A;  5B70 A;  5I58 B;  2F35 A;  4FE8 A;  3PPQ A;  3DLN A;  1Q9D A;  4KCC A;  5K2Y A;  4G61 A;  4F3G A;  5JK4 A;  1DTG A;  1G0I A;  5T3J A;  1INP A;  4GX6 A;  4GOT A;  4O94 A;  2XD2 A;  2VPO A;  3EHT A;  3CG1 A;  3QSL A;  1MXY A;  1M5F A;  4ESX A;  3FXQ A;  1VFD A;  1MY2 A;  2V4C A;  2R71 A;  2QS1 A;  3H6W A;  4GWX A;  4NTL A;  5EYH A;  2V3T A;  4M1V A;  2DE2 A;  4YZZ A;  4Q5T A;  3FVK A;  1JW1 A;  4NAP A;  2F5X A;  4FAT A;  5ET5 A;  5CRY A;  3KN3 A;  2XD3 A;  1YXI A;  3SEW A;  1IMB A;  1M5B A;  3O6P A;  2H4I A;  3LSF B;  2OCU A;  3ZKK A;  2QVU A;  3UK4 A;  2CMO A;  2VD3 A;  4IY6 A;  2ABH A;  4KPT A;  3RT8 A;  4ZZE A;  5CI5 A;  3GZG A;  1B3L A;  4I9D A;  2XWV A;  4RK9 A;  4PFW A;  1M5C A;  5CMM A;  1K9Z A;  5L8D A;  2QS2 A;  1EYK A;  1D3K A;  1B4Z A;  3JYR A;  3RYB A;  4JWX A;  4MCO A;  1WOD A;  1LCT A;  2XXU A;  1Y3N A;  4TQU Q;  4IO2 A;  3FJM A;  3F11 A;  3K6U A;  5TPA A;  4ZEF A;  1SPI A;  2ONS A;  4P11 A;  1MXU A;  3H4Z A;  3HN0 A;  2Y84 A;  2DVC A;  3TQW A;  1Y4T A;  1L5T A;  2Q2C A;  1NV2 A;  2O1M A;  4PP0 A;  3QXM A;  1MQI A;  4KQP A;  2HHM A;  4H8I A;  4PFB A;  2O69 A;  2F7B A;  1CB6 A;  4MAG A;  5LTC A;  1B1H A;  1PBP A;  5ET7 A;  1P1O A;  1OVB A;  1NNP A;  5L9S A;  3K1M A;  3MBP A;  1XI6 A;  4LA9 A;  3PPO A;  5DVJ A;  3MW0 A;  4F1V A;  3H7M A;  4NGU A;  4BDQ A;  1YCJ A;  2XXI A;  4H0W A;  5ITO A;  2VOZ A;  1JEV A;  5BUU A;  3OEL A;  2VGQ A;  4GWW A;  5AA3 A;  4LP2 B;  1B0H A;  1PB9 A;  2WBD A;  1YYZ A;  3N5L A;  3VDF A;  1VR5 A;  1IXC A;  3UA8 A;  5ELV A;  2OZZ A;  3D1R A;  2I0B A;  3RYA A;  4OTE A;  1BTJ A;  1MY0 A;  5IZ3 A;  4ECF A;  5I2N B;  4O3C A;  3B8B A;  4ELR A;  3TTK A;  1NH8 A;  1TXF A;  4R73 A;  1AMF A;  1ZU0 A;  4QFP A;  2Z8F A;  5AA2 D;  1FBD A;  4U1Z A;  5B7D A;  1P1Q A;  2F97 A;  4XF5 A;  3R6U A;  4GVO A;  4NG7 A;  2OK2 A;  2Z22 A;  4OWD A;  3RGY A;  2WOK A;  4L17 A;  3MPL A;  2NOO A;  3MWB A;  1TT1 A;  4XKN A;  5KDT B;  1ZIU A;  1ZBM A;  4OMB A;  4PBQ A;  2DWA A;  5H8Q A;  1SYI A;  4NF8 A;  2H98 A;  2B4M A;  1MXW A;  3IJX B;  3C34 A;  2FA7 A;  3CSB A;  3HV1 A;  3LC8 A;  4JVC A;  4GL0 A;  3HHF A;  2I49 A;  1LLS A;  2Y7R A;  1IMF A;  4LON B;  3FJ7 A;  3LSW A;  3EQ1 A;  3QK6 A;  3SZP A;  1VE4 A;  1B3E A;  1N7W A;  2XXR A;  3VLW A;  2A5T A;  1R6Z A;  3EF7 A;  4F1Y A;  2REG A;  2XX9 A;  4OEU A;  1WDN A;  2Q9T A;  2P3V A;  2WKY A;  1B7H A;  2ZZW A;  2I4C A;  3IFA A;  4U22 A;  1YPN A;  3HHG A;  4IO3 A;  4NF6 A;  5DVF A;  2ONR A;  3CVG A;  5EHS A;  4DXC A;  2FHY A;  5AA2 A;  1LBY A;  1QKB A;  3OO6 A;  1MPD A;  4PCD A;  3DP4 A;  4GLI A;  1SD3 A;  3IOV A;  4ZZA A;  4P3L A;  1LBX A;  3C33 A;  1XVX A;  1FTK A;  2CEX A;  2Y7K A;  2F34 A;  3S2V A;  5H8H A;  4OXV A;  5TPA B;  4JSD A;  4RA1 A;  2Z8D A;  5HBC A;  4ELQ A;  4ZE8 A;  1DPE A;  1FPG A;  1UTH B;  4POW A;  1FQE A;  2GH9 A;  1XT8 A;  2DVZ A;  3K6W A;  3TCH A;  4LQ5 A;  1SW5 A;  2GQ1 A;  2AL4 A;  2XXX A;  4OAN A;  3D4C A;  2DYX A;  4K3F A;  1DOT A;  4N07 A;  2RC7 A;  1FPL A;  1LAH E;  4X8R A;  1I6A A;  1NV0 A;  3VVF A;  2DP8 A;  2OWT A;  1FPJ A;  3G3H A;  2R8T A;  4X04 A;  4PFI A;  4YKJ A;  4F31 B;  1SBP A;  2A5S A;  2OX3 A;  4GL8 A;  3B6T A;  4PAI A;  1SW2 A;  5CBS A;  2WOP A;  3SES A;  3HO7 A;  4UAB A;  5H8N A;  3H03 A;  1SI1 A;  4YKK A;  1LAG E;  4GF8 A;  4DCY A;  1XOC A;  5DEX A;  5IAI A;  1NNT A;  1FQB A;  1OIB A;  2W7Y A;  3MVY A;  3CRB A;  3PUZ E;  4HE0 A;  2PBW A;  2KR0 A;  3D4G A; 
#chains in the Genus database with same CATH homology
 3CHG A;  4XKQ A;  5JTY A;  4R75 A;  3IJO B;  4G4P A;  3I5O A;  3ILT B;  3QUJ A;  2NXO A;  2QRY A;  1NNF A;  3PPP A;  3KJT A;  1SVX B;  4OHN A;  3FXU A;  3MC2 A;  2DWJ A;  3K6V A;  3IO6 A;  1B40 A;  2Z8E A;  1MXV A;  1B0L A;  4XXU A;  4H6D A;  1HSL A;  5I2K A;  1TWY A;  4ZEC A;  3TTM A;  2OJT A;  3IO4 A;  2Y7I A;  3RNN A;  1A55 A;  3LBS A;  1Y20 A;  4YKI A;  1MDQ A;  3FVN A;  4OFO A;  3ZKL A;  4FIM A;  1B5J A;  1IXG A;  3TUS A;  2THI A;  4F3P A;  3O29 A;  4QFK A;  1UIV A;  3FAS A;  3BKI B;  3BFU A;  1EZ9 A;  1MQJ A;  3G3G A;  3K1N A;  2E1S A;  1Q1K A;  1LFI A;  3TQL A;  4DE8 A;  1MDP 1;  1OVT A;  3MUQ A;  4JXI A;  3RY3 A;  3FIR A;  1UIU A;  2Z23 A;  1USY H;  3MVZ A;  3PV0 E;  2B3B A;  3OSR A;  1WVJ A;  3TPA A;  1I69 A;  4X9T A;  5DT6 A;  4NF6 B;  4ELO A;  3VFJ A;  3MPK A;  1URG A;  3R7X A;  1AOV A;  4F39 A;  4H1X A;  3IOT A;  1XHY A;  1M5E A;  4RPN A;  2PT1 A;  4ZEI A;  3IB2 A;  4PE5 B;  1MXZ A;  4F3S A;  3N94 A;  3PAM A;  5HM4 B;  3HPI A;  5H8H B;  4PFY A;  2B4L A;  3LUY A;  3THI A;  3L6G A;  3U94 A;  4QHQ A;  5H8F A;  1PB8 A;  1BIY A;  2QL3 A;  4I1D A;  2UXA A;  5DYH A;  5TP9 B;  1IZ1 A;  1GVC A;  1H76 A;  5F7V A;  5CMB A;  1A7L A;  2V25 A;  5H8S A;  1QW0 A;  2YLN A;  4RJZ A;  1IXI A;  1NMU A;  4DLD A;  2Q88 A;  4GXA A;  3TYH A;  3E3K A;  2Q8J A;  1MM7 A;  4NE4 A;  2M8C A;  5A5X A;  4FED A;  5CM6 A;  2WOL A;  4MH5 A;  4MFI A;  4QF9 A;  2F6G A;  3EPE A;  3SEY A;  1B05 A;  1MS7 A;  2X26 A;  4ZE9 A;  1B7Z A;  4WXJ A;  4QFO A;  3DRK A;  2XXY A;  4G68 C;  3UP9 A;  2LAO A;  1AL3 A;  1F9B A;  1B3G A;  4PFU A;  4NF5 A;  5JTY B;  3SDF A;  3TTR A;  4KD5 A;  5CC2 A;  3PMW A;  5FTH A;  5KCJ B;  3S9N C;  2ZYK A;  3O9P A;  4OEV A;  2XXV A;  3CI8 A;  4IB2 A;  4H8J A;  4P0I A;  4XTC Q;  3QUF A;  5I57 A;  3PMV A;  3N26 A;  1D4N A;  3EHS A;  2DXR A;  2RCA A;  2NUV A;  4KYD A;  2UYE A;  4OES A;  1EH3 A;  3KBR A;  3PUY E;  4TLM B;  1MG1 A;  2D21 A;  3Q25 A;  4GD5 A;  1JQF A;  3PUV E;  1EU8 A;  4JBZ A;  3IAZ A;  3PD8 A;  5HPQ A;  3CR9 A;  3S4U A;  2AL5 A;  3GBB A;  3O97 A;  2QMW A;  2ALU A;  2P2A A;  3K00 A;  3QIM A;  2QS4 A;  1MY4 A;  4GRK A;  2RF1 A;  3IOW A;  3IK6 B;  3KG2 A;  2H99 A;  1MH4 A;  3LVU A;  3KFM A;  3TDJ A;  3VVE A;  3FXR A;  4DCX A;  2QJE A;  1MRP A;  1B2H A;  2V3Q A;  1IIT A;  4DXB A;  4LQ2 A;  2P1S A;  4NF4 B;  1B4H A;  1POT A;  5L9O A;  4YKP A;  4MLV A;  5ICQ A;  1BKA A;  2O68 A;  4N13 A;  3H06 B;  1VSO A;  1PB7 A;  1Y3Q A;  3O6G A;  2V84 A;  4EXK A;  3LR1 A;  3Q27 A;  3WAE A;  3FGS A;  4ELP A;  3G3F A;  3B6Q A;  1XC1 A;  4LAT A;  5I84 A;  4EDP A;  4G68 A;  1LFG A;  3I3V A;  4GQO A;  2VD2 A;  2DE4 A;  2YJP A;  3T22 A;  3JV9 A;  1RKM A;  2O6A A;  5ICT A;  3IX1 A;  4HCW A;  5J1D A;  5H8F B;  4Q30 B;  2F6P A;  3KEI A;  2ESN A;  3SET A;  2HCA A;  1B5I A;  4KHZ E;  4Q8R A;  3KSX A;  3K4U A;  4U23 A;  4MF3 A;  3MP8 A;  2ZYO A;  4LZ5 A;  3TFL A;  3FJG A;  1N7X A;  3V89 B;  1LB9 A;  3TEL A;  4LUB A;  4R72 A;  2X7Q A;  3M8U A;  3H6U A;  1PBQ A;  1TFA A;  3U8Q A;  3E13 X;  1FTL A;  3PGF A;  2DSF A;  1YTV A;  1NKX A;  3G3I A;  1QVS A;  1US4 A;  4PFT A;  5CBR A;  4YMA A;  3O2A A;  1XS5 A;  1B51 A;  2Y7W A;  4X1D A;  2XXQ A;  2R9J A;  1DMB A;  1QUJ A;  3HCQ A;  2XXH A;  3PPN A;  4NF5 B;  1HSJ A;  4F1U A;  1QJM A;  3ZSF A;  4F18 A;  5I58 A;  1O7T A;  4PET A;  2G29 A;  4RPO A;  4FJP A;  3CFZ A;  5I57 B;  2DS9 A;  3IL1 B;  3U1O A;  3SEX A;  1B58 A;  4E0X A;  3OO8 A;  1FCK A;  4U21 A;  3RTW B;  3T93 B;  1IIW A;  2HEU A;  4YAH X;  1USY E;  2DE3 A;  1FTJ A;  5FHO A;  2F78 A;  4R74 A;  4YB7 A;  2NVU B;  3MVX A;  2GRV A;  3BFT A;  2I4B A;  4RXL A;  1B5H A;  2AYS A;  3V5A A;  4XIG Q;  4ISU A;  3OO7 A;  4RNS A;  1US5 A;  4ZED A;  2HZK A;  4NED A;  5BWJ A;  2PMS A;  1MQH A;  1Y3P A;  3OD7 A;  2V3U A;  2QPQ A;  1N3W A;  4QFL A;  1Y9U A;  4Z0I A;  5CMK A;  3DEL B;  2XXP A;  4DXU A;  2D3I A;  3V8X B;  4DZ1 A;  2H5Y A;  4GFR A;  3GXA A;  1GR2 A;  1P1N A;  1B3F A;  2HAU A;  1N04 A;  4F2Q A;  2F7C A;  4G2Z A;  4EQ9 A;  1II5 A;  2DXY A;  2XX7 A;  4OFL A;  2HXW A;  3K02 A;  3OOA A;  3DRI A;  3DP6 A;  4KYE A;  3W9W A;  3CSG A;  5H8Q B;  4EQB A;  4GXS B;  3H3G A;  2DWI A;  3PUX E;  4HS7 A;  1IQ7 A;  4NF8 B;  5AE4 A;  3PU5 A;  3FD3 A;  1Q35 A;  4P0G A;  4BDO A;  3ODB A;  3IR1 A;  3RT6 B;  2R6G E;  2BJJ X;  3OMB A;  4FOR A;  4G68 B;  1IXH A;  4X48 A;  1JEU A;  1O64 A;  4ONY A;  1SW1 A;  4F29 A;  2P0S A;  4X1B A;  3KGC A;  3OEM A;  3G7W A;  1LCF A;  4F19 A;  3W9V A;  1A54 A;  1OQH A;  1LGB C;  2HFB A;  4YU0 A;  2OWS A;  2OLB A;  1QUI A;  2A5T B;  1JW5 A;  3G3K A;  2ANJ A;  1LFH A;  3N6U A;  1OMP A;  4XKP A;  3RLF E;  5FHN A;  3OXN A;  3KN8 A;  1DTZ A;  2ZNS A;  2IEE A;  2UYF A;  3KSJ A;  3OEN A;  1Z7N E;  3CFX A;  1AIV A;  1CE2 A;  2GHA A;  4JWY A;  5AA2 B;  5I2N A;  3DRJ A;  1A40 A;  4G8N A;  5KZT A;  3FVO A;  4F22 A;  2HQ0 A;  1BLF A;  1QUK A;  3KZG A;  4EQ7 A;  3C36 A;  2RC8 A;  1N76 A;  1Y1M A;  2ZYN A;  5KDT A;  1H44 A;  3V83 A;  3BBR A;  5LOM A;  3O6H A;  2RIN A;  1UTB A;  3KOT A;  3DRF A;  4HTG A;  4IGR A;  3T96 B;  4C1T A;  4JDF A;  1KWH A;  2O1L A;  3E9X A;  3SER A;  3SEU A;  3RQT A;  3LSX A;  3FUZ A;  4C1U A;  3S9M C;  4OYV A;  3MZ9 A;  1S50 A;  3C31 A;  3KN7 A;  1JW4 A;  3H6V A;  3A3U A;  4U1O A;  2QSX A;  4BDM A;  1P1U A;  2CZL A;  4RK2 A;  1B1X A;  1H45 A;  4O3B A;  1H3D A;  2OBG A;  1NL5 A;  3CG3 A;  2YPN A;  2D5W A;  5H8N B;  1H43 A;  1SQY A;  5EHM A;  4N6P A;  3VXC A;  1PDA A;  5DEX B;  1JNF A;  4WED A;  1IUD A;  2O7U A;  3TMG A;  4R6H A;  3CIJ A;  3LSL A;  1T0K A;  3T9U A;  4I62 A;  3PUW E;  3KJ7 A;  3OSQ A;  5ISU A;  2H25 A;  1LBB A;  1PC3 A;  2ONK E;  5IKB A;  3VVD A;  3A3C A;  5M2V A;  4H67 A;  4LZ8 A;  4EF1 A;  4KCD A;  3MP1 A;  4QSD A;  4JWO A;  1Y1Z A;  5K2X A;  4IGT A;  1I6B A;  2Q2A A;  1MH3 A;  4U4S A;  2IA4 A;  1GV8 A;  4C0R A;  2XXW A;  3B7D A;  5DTB A;  4FAJ A;  5FTI A;  1UTH A;  3T66 A;  1URD A;  1MXX A;  1OLC A;  3I6V A;  1FQF A;  3FV1 A;  1FTM A;  3Q28 A;  2ZMB A;  4U4X A;  1NFT A;  1R1N A;  4H5G A;  5AA1 A;  3O66 A;  5I2K B;  3EN3 A;  4U2R A;  1URS A;  2I3V A;  4R2F A;  3GLB A;  4Z7E A;  3WAF A;  3RN8 A;  1LAF E;  3K1P A;  4M4G A;  1JET A;  5I56 A;  3KOS A;  4IO5 A;  3PPR A;  1B6H A;  2I48 A;  3QYT A;  3ZS6 A;  5ITP A;  2FYI A;  4EXL A;  3M3K A;  3C4M A;  3S9L C;  1MPB A;  5TU0 A;  1P1W A;  2XXT A;  1GTK A;  1B9J A;  3SKP A;  4QFN A;  1QKA A;  2AIX A;  1FTO A;  3OO9 A;  2ZYM A;  3P7I A;  5EYF A;  1HSE A;  1R9Q A;  3U92 A;  3UN6 A;  2UVG A;  1ZLQ A;  3OEK A;  4NMY A;  4YMB A;  1FQD A;  5JEI A;  2QMX A;  3FV2 A;  1SDX A;  2UVH A;  1DSN A;  3U93 A;  3TKD A;  1DPP A;  4JB7 A;  3GBA A;  1OLA A;  2RCB A;  4WEP A;  3TAJ A;  1ZMG A;  4TOZ A;  3N6T A;  3DP8 A;  3Q29 A;  3RTF B;  4WKM A;  3MP6 A;  3TOD A;  3MAM A;  3IB1 A;  3K0V A;  4GWO A;  3TZA A;  2O84 X;  4OEN A;  1OQG A;  5AA4 A;  1UTB B;  2HZL A;  1LST A;  2O51 A;  1B7U A;  3S9E A;  2B65 A;  2V93 A;  4LZ7 A;  3SEV A;  2XX8 A;  4IY5 A;  1B52 A;  1NNK A;  3G3J A;  4BDL A;  4AQ4 A;  1O63 A;  2DWH A;  4TLL B;  1NH7 A;  4FEB A;  4IO6 A;  1S9T A;  1S7Y A;  2ZNT A;  1A8F A;  2VHA A;  4AB5 A;  3UOR A;  4JSO A;  3UGW A;  2B3F A;  2ZXT A;  1FW0 A;  4F3B A;  5A5X B;  1N84 A;  5I59 A;  4ZEB A;  2PX1 A;  1Y4C A;  2Y7P A;  4DIG A;  3MZB A;  2XHD A;  1SI0 A;  3IOR A;  4ND9 A;  1ZTY A;  1LAX A;  3DRH A;  1J1N A;  4EUO A;  4EF2 A;  4G8M A;  1XVY A;  3VXB A;  3FAT A;  4YB6 A;  1N3X A;  4I8C A;  3ONM A;  1D9V A;  4QRZ A;  2HAV A;  3FZV A;  3MJN A;  1EZP A;  1LBC A;  4R9G A;  1MPC A;  1P99 A;  2X7P A;  4QSE A;  4YIC A;  4LVQ A;  4DDD A;  2QS3 A;  4R2B A;  3C9H A;  1B3H A;  3L6H A;  4MLQ A;  4NWC A;  1JVX A;  2DOJ A;  3ECR A;  2RKM A;  2I58 A;  4Q0C A;  4OQO A;  4ESW A;  3USD A;  3B6W A;  3HST A;  4HW8 A;  3T9X B;  5TP9 A;  4RYA A;  3AXF A;  4O3A A;  3K2D A;  4BDN A;  3T9H B;  3MZ1 A;  4R6Y A;  4KR5 A;  3ILU B;  2FNC A;  3JZJ A;  1ZKB A;  4IO7 A;  4KI0 E;  4UA8 A;  5FHM A;  3RUM A;  5I56 B;  1IEJ A;  2GFE A;  1B32 A;  4ZS9 A;  4YB5 A;  4PQJ A;  2E0S A;  4HCY A;  1EZO A;  1D9Y A;  4KFQ A;  4E0W A;  1ANF A;  3O28 A;  3VV5 A;  2KLF A;  3QAX A;  2NWJ A;  4KYS A;  2G93 A;  2RC9 A;  1R9L A;  3TCG A;  2O7I A;  1Z7M E;  5L9M A;  3MVW A;  2F36 A;  4UAC A;  3C32 A;  4OFJ A;  3E4R A;  4H65 A;  1MQD A;  1BP5 A;  2UVI A;  4ZDM A;  3VE1 B;  2I3W A;  4R6K A;  4THI A;  1MY3 A;  2DQV A;  4NWD A;  3RPW A;  4BDR A;  3DM0 A;  5KCJ A;  3MQ9 A;  1SYH A;  3EHU A;  1YAE A;  4H5F A;  1TFD A;  3FTO A;  3R26 A;  3FVG A;  2UVJ A;  4OVJ A;  3IB0 A;  3A09 A;  4G8H A;  3IOU A;  3TTL A;  1ZJL A;  1M5D A;  2F7A A;  2REJ A;  4FEC A;  1B46 A;  3K01 A;  4OET A;  5DVI A;  3C35 A;  2GHB A;  4MBP A;  5AA4 B;  4XKR A;  3TTN A;  1VFE A;  1N0T A;  4AB6 A;  1LB8 A;  4OER A;  3O6I A;  4RY1 A;  1FQC A;  2VP1 A;  4G77 A;  5F1Q A;  1RYX A;  1A99 A;  1MQG A;  3M3L A;  3W15 C;  3H6T A;  1QUL A;  1RYO A;  1MY1 A;  3K6X A;  3VLV A;  4OZ9 A;  4F2O A;  5CMC A;  1UQW A;  4QSC A;  2I0C A;  1A8E A;  1ATG A;  3UIF A;  4POX A;  1GGG A;  2H9B A;  1SW4 A;  5I59 B;  3T9V A;  3TCF A;  3U72 A;  2F8D A;  2PT2 A;  3VLU A;  2I6E A;  4IO4 A;  4NF4 A;  1MM6 A;  4R9F A;  4GIZ A;  1FQA A;  4ZEK A;  3PD9 A;  3PMX A;  1PEB A;  3CFL A;  1JVY A;  2Q89 A;  3DRG A;  1I6Q A;  2ZNU A;  3M3F A;  1AH5 A;  1ELJ A;  3TEP A;  3Q26 A;  2PYY A;  4BLA A;  1POY 1;  2PVU A;  5B70 A;  5I58 B;  2F35 A;  4FE8 A;  3PPQ A;  3DLN A;  4KCC A;  5K2Y A;  4F3G A;  5JK4 A;  1DTG A;  4GOT A;  2XD2 A;  3EHT A;  3CG1 A;  3QSL A;  1MXY A;  1M5F A;  4ESX A;  3FXQ A;  1VFD A;  1MY2 A;  2R71 A;  2QS1 A;  3H6W A;  4NTL A;  2V3T A;  4M1V A;  2DE2 A;  4YZZ A;  4Q5T A;  3FVK A;  1JW1 A;  2F5X A;  4FAT A;  5CRY A;  3KN3 A;  2XD3 A;  3SEW A;  1M5B A;  3O6P A;  2H4I A;  3LSF B;  2OCU A;  3ZKK A;  3UK4 A;  2CMO A;  2VD3 A;  4IY6 A;  2ABH A;  4KPT A;  3RT8 A;  4ZZE A;  5CI5 A;  3GZG A;  1B3L A;  4I9D A;  4RK9 A;  4PFW A;  1M5C A;  5CMM A;  5L8D A;  2QS2 A;  1D3K A;  1B4Z A;  3JYR A;  3RYB A;  4JWX A;  1WOD A;  1LCT A;  2XXU A;  1Y3N A;  4TQU Q;  4IO2 A;  3FJM A;  3F11 A;  3K6U A;  5TPA A;  4ZEF A;  4P11 A;  2ONS A;  1MXU A;  3H4Z A;  3HN0 A;  2Y84 A;  2DVC A;  3TQW A;  1Y4T A;  1L5T A;  2Q2C A;  2O1M A;  4PP0 A;  3QXM A;  1MQI A;  4KQP A;  4H8I A;  2O69 A;  2F7B A;  1CB6 A;  1B1H A;  1PBP A;  1P1O A;  1OVB A;  1NNP A;  5L9S A;  3K1M A;  3MBP A;  4LA9 A;  3PPO A;  5DVJ A;  3MW0 A;  4F1V A;  3H7M A;  4BDQ A;  1YCJ A;  2XXI A;  4H0W A;  5ITO A;  2VOZ A;  1JEV A;  5BUU A;  3OEL A;  2VGQ A;  5AA3 A;  4LP2 B;  1B0H A;  1PB9 A;  3N5L A;  3VDF A;  1VR5 A;  1IXC A;  3UA8 A;  5ELV A;  2OZZ A;  2I0B A;  3RYA A;  4OTE A;  1BTJ A;  1MY0 A;  4ECF A;  5I2N B;  4O3C A;  4ELR A;  3TTK A;  1NH8 A;  1TXF A;  4R73 A;  1AMF A;  1ZU0 A;  4QFP A;  2Z8F A;  5AA2 D;  4U1Z A;  5B7D A;  1P1Q A;  2F97 A;  3R6U A;  4GVO A;  2OK2 A;  2Z22 A;  4OWD A;  3RGY A;  2WOK A;  4L17 A;  3MPL A;  2NOO A;  3MWB A;  1TT1 A;  4XKN A;  5KDT B;  1ZIU A;  1ZBM A;  4OMB A;  2DWA A;  5H8Q A;  1SYI A;  4NF8 A;  2H98 A;  2B4M A;  1MXW A;  3IJX B;  3C34 A;  2FA7 A;  3CSB A;  3HV1 A;  3LC8 A;  4GL0 A;  3HHF A;  2I49 A;  1LLS A;  2Y7R A;  4LON B;  3FJ7 A;  3LSW A;  3EQ1 A;  3QK6 A;  1VE4 A;  1B3E A;  1N7W A;  2XXR A;  3VLW A;  2A5T A;  1R6Z A;  3EF7 A;  4F1Y A;  2REG A;  2XX9 A;  4OEU A;  1WDN A;  2Q9T A;  2WKY A;  1B7H A;  2I4C A;  4U22 A;  1YPN A;  3HHG A;  4IO3 A;  4NF6 A;  5DVF A;  2ONR A;  3CVG A;  5EHS A;  4DXC A;  5AA2 A;  1QKB A;  3OO6 A;  1MPD A;  3DP4 A;  4GLI A;  1SD3 A;  3IOV A;  4ZZA A;  3C33 A;  1XVX A;  1FTK A;  2Y7K A;  2F34 A;  3S2V A;  5H8H A;  4OXV A;  5TPA B;  4JSD A;  4RA1 A;  2Z8D A;  5HBC A;  4ELQ A;  4ZE8 A;  1DPE A;  1UTH B;  4POW A;  1FQE A;  2GH9 A;  1XT8 A;  2DVZ A;  3K6W A;  3TCH A;  4LQ5 A;  1SW5 A;  2AL4 A;  2XXX A;  3D4C A;  2DYX A;  4K3F A;  1DOT A;  4N07 A;  2RC7 A;  1LAH E;  1I6A A;  3VVF A;  2DP8 A;  2OWT A;  3G3H A;  4YKJ A;  4F31 B;  1SBP A;  2A5S A;  4GL8 A;  3B6T A;  1SW2 A;  5CBS A;  2WOP A;  3SES A;  3HO7 A;  5H8N A;  3H03 A;  1SI1 A;  4YKK A;  1LAG E;  4GF8 A;  4DCY A;  1XOC A;  5DEX A;  5IAI A;  1NNT A;  1FQB A;  1OIB A;  2W7Y A;  3MVY A;  3CRB A;  3PUZ E;  2PBW A;  3D4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...