3TCHA

Crystal structure of e. coli oppa in an open conformation
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
517
structure length
517
Chain Sequence
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Periplasmic oligopeptide-binding protein
publication title Escherichia coli peptide binding protein OppA has a preference for positively charged peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 181
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 3tchA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tchA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 3tchA02
1JW5A 3IL1B 4M4GA 1OVBA 2RCAA 4RPNA 5CMCA 3HHGA 1S50A 3CR9A 4IGRA 5ITPA 4N6PA 5CC2A 3RTWB 2YLNA 4LUBA 2AIXA 4KD5A 3KBRA 2D5WA 1D9YA 3IB1A 2V3TA 3KN3A 3PUXE 2RF1A 1QUKA 4L17A 4F39A 4BDQA 3HHFA 3C34A 2Z8EA 3QUJA 3S9EA 1N3XA 1JNFA 3ODBA 1QULA 1LAHE 3K6WA 2GH9A 2G29A 2XD2A 5I59A 2OZZA 1DOTA 1WVJA 2DS9A 4R6HA 3Q29A 1XS5A 3TEPA 4G8MA 4P0IA 2O68A 4XKRA 2B4MA 4KYDA 4HW8A 4RXLA 3K6VA 2O1MA 3U72A 2CZLA 1PEBA 2Q8JA 4QFNA 1Y1ZA 2REJA 3UORA 5H8NA 1LCFA 3LSWA 4DXCA 4EXLA 3FASA 1LLSA 4IO7A 3IOTA 1BIYA 1MH3A 2DWHA 4IY5A 3IOWA 4O3CA 4BDNA 2PVUA 1OVTA 2P2AA 4O3BA 4QRZA 1H44A 3K00A 1B4HA 1FTKA 1SYHA 3UP9A 2Y7RA 4Q30B 1OQHA 1N0TA 2GFEA 4LZ5A 4XIGQ 4I62A 3PUZE 4JWOA 3E4RA 3C33A 3ILUB 3FVNA 3H4ZA 1LFHA 1MXZA 1H76A 5FHMA 2YJPA 4KFQA 3T66A 2NWJA 5HPQA 2WKYA 3C9HA 5ELVA 2UVJA 1ATGA 2Q2AA 4DLDA 1YCJA 3PMVA 3T22A 3KFMA 4FECA 3DRGA 4UACA 2O7UA 4PQJA 3TTLA 2XXIA 4DXBA 1A99A 2BJJX 4R75A 4UA8A 3EHUA 2ZYKA 5BWJA 4JXIA 2I58A 3EPEA 2QS3A 3SKPA 1BP5A 2GRVA 2ZYOA 3IO6A 2Y7WA 2ZYMA 3RT8A 2HAVA 1USYE 1CB6A 5HM4B 3B6WA 3FTOA 1SI1A 2VD3A 3MUQA 3K02A 3GBAA 4EF1A 1ANFA 3SEVA 3DRJA 2V3UA 5DEXA 4R9GA 3FV2A 4OXVA 1FTMA 2QMWA 3TTNA 3RUMA 3MP1A 3IX1A 2HZKA 2PMSA 1N84A 2PT2A 3CFLA 3DRHA 5CBRA 4F3GA 3EHTA 1VFEA 3B7DA 3G3HA 4JB7A 1AL3A 3FUZA 1LCTA 4RA1A 5AA4A 3KZGA 4YAHX 3H03A 4G68B 3O6HA 4ZZAA 4OWDA 1II5A 3FVKA 3H6UA 3BFUA 3FJGA 4GL0A 2O51A 3VE1B 5ICQA 1DPPA 4H5FA 3TFLA 3TYHA 2HFBA 4N13A 4GIZA 3EHSA 5H8QA 3IJOB 2P1SA 2ONRA 5DVIA 1EZ9A 1LAFE 3CRBA 3LSFB 3T93B 5FHNA 1M5EA 4YB6A 4RNSA 1B0HA 3L6GA 4ZS9A 4GL8A 3FVOA 3ONMA 3RYBA 2V25A 3OSQA 5EYFA 4ECFA 3SEYA 3T9HB 1PB8A 1B3HA 3KJ7A 2ZXTA 2ALUA 2RC8A 1Y9UA 4NF6B 3PPQA 3U94A 3FVGA 2DP8A 4P0GA 1JQFA 3FV1A 1KWHA 2HCAA 2ZNSA 3TTKA 1IEJA 3OOAA 1CE2A 2WOLA 4YU0A 1NNTA 3PGFA 4R6KA 4GFRA 1RYOA 5JTYB 3CI8A 2B65A 3HV1A 3O6IA 1S9TA 4R2BA 4IY6A 3M3KA 4LONB 4NWDA 3S4UA 1NMUA 4IO6A 3H3GA 5I58A 3G3FA 2XXYA 2DXYA 1MDQA 1A8FA 2ZMBA 1B1XA 1PC3A 2H4IA 3G3IA 1QUJA 2AL4A 2ZNUA 4YKKA 3B6TA 1TFAA 3RY3A 5AA2B 5IAIA 4R74A 1GVCA 4R9FA 3QXMA 3SETA 4DIGA 1S7YA 3O6PA 2G93A 1DTGA 3RTFB 4QHQA 1XVXA 4QF9A 1MY2A 1HSEA 3F11A 3KOTA 3TTMA 1OIBA 4IO2A 1Z7ME 5B7DA 3QAXA 2F7AA 1IUDA 4NF8B 1TFDA 4QSEA 3C31A 2I3WA 5F7VA 5H8SA 2D3IA 4OFJA 2I4CA 2QS4A 1SDXA 4ZECA 5TPAA 1B5IA 3GXAA 3DRKA 4PE5B 1UTBA 4R6YA 3N26A 5JK4A 5FTIA 4FAJA 1FTOA 3N94A 4G68C 3UIFA 1VSOA 1Q1KA 4HS7A 1B7UA 3TZAA 4IB2A 3WAFA 3BFTA 2Z8FA 2ONKE 4KPTA 3UGWA 1XT8A 2HXWA 3OO7A 2DOJA 2LAOA 1SW1A 3OSRA 1MPCA 4XXUA 3Q28A 4U4XA 3E9XA 1ZIUA 1Y3NA 3H6TA 3K4UA 3KGCA 5H8FA 4C1TA 1AIVA 1USYH 4ZE9A 2GHAA 5L9SA 3ECRA 1SW2A 2XXVA 5TP9A 3VDFA 2E0SA 4ZEKA 3A3CA 3OEMA 3LUYA 4C1UA 1FCKA 4KYEA 2OJTA 2QS1A 3MP6A 2V3QA 3K2DA 1MPDA 5I57B 3UK4A 1P1QA 2A5TB 3CG3A 2H99A 1ZJLA 3EN3A 4RJZA 3IO4A 2A5SA 3OMBA 1MG1A 2O6AA 3TUSA 3TCFA 2XHDA 3CHGA 3HPIA 4XTCQ 5AA3A 1ZBMA 5L9MA 4ZEFA 3CSBA 5BUUA 2V93A 4ELRA 4F1YA 2RKMA 1B4ZA 1JEVA 2I48A 4PP0A 4FATA 2F8DA 3BBRA 3R7XA 5AE4A 3L6HA 1UIUA 4NF5B 4RK9A 3THIA 2HQ0A 4F3SA 1IQ7A 5DT6A 2DE2A 2XX9A 4PFUA 4KQPA 3H6WA 4YKPA 2AYSA 4LZ8A 3T9UA 1EU8A 1H3DA 4MBPA 2RCBA 2PYYA 3OENA 3VLUA 3K1PA 3MJNA 3MW0A 1LB8A 5HBCA 1SD3A 3VXBA 3CIJA 2F36A 3KN7A 1MXVA 2X7PA 3TMGA 1R6ZA 1M5FA 4PFTA 5IKBA 3TODA 5CMMA 1WDNA 3C35A 4WEPA 3PMWA 2Y7IA 2HAUA 5FHOA 2F97A 2DQVA 4OFOA 4U4SA 1B3GA 2D21A 4OYVA 5A5XA 2OWTA 2XXTA 3M8UA 1B1HA 3VVFA 1IXIA 1SI0A 1B5HA 1ZTYA 2UVGA 4GXAA 1EH3A 2QMXA 1PDAA 4G77A 4G68A 1B7HA 4KYSA 4EQBA 2F5XA 4THIA 1NFTA 1MQJA 2DE4A 1LFIA 4MF3A 3H6VA 5I59B 4QSDA 2UXAA 3I6VA 1R9QA 3MZBA 4XKQA 3FXUA 2XXRA 4BDOA 4LQ2A 4RPOA 1T0KA 1I6BA 1B3EA 4U1OA 1UTHB 4NEDA 3N6TA 4TOZA 2WOPA 1A7LA 3Q26A 2I3VA 4MH5A 2HZLA 3R26A 4NTLA 3VLVA 5H8NB 2UYFA 2XD3A 3T96B 1MXXA 4LP2B 1A8EA 3ZKLA 3KSXA 4OETA 2F7BA 1Y20A 4BDMA 2NOOA 2QJEA 2H9BA 4OFLA 3O97A 4Q0CA 1L5TA 1Z7NE 3S9MC 2IEEA 1Y4TA 1SQYA 3O29A 1P1NA 4N07A 2P0SA 4GRKA 2Z8DA 4AB5A 1MQDA 1F9BA 1JW4A 3PUYE 1SYIA 1QJMA 3GLBA 3O9PA 3EF7A 3CVGA 3O66A 3LSXA 2F6GA 1LAGE 4AB6A 3IJXB 1FTJA 1Y3QA 2VP1A 3SESA 4LVQA 4QFPA 1P1UA 4PFWA 4RK2A 5I2KA 1M5CA 1D4NA 4MLVA 3TKDA 4KR5A 5L8DA 3N6UA 3JYRA 4ND9A 2M8CA 1DMBA 4JSOA 4YB5A 3PPRA 3E13X 2OLBA 4FIMA 1VE4A 2X26A 1US4A 3FGSA 1JVYA 5F1QA 1FQEA 2E1SA 2YPNA 5DEXB 4NF8A 2Q9TA 4ESWA 1DTZA 3V5AA 3CFZA 2F78A 3N5LA 1XVYA 3W15C 3PPPA 4JDFA 4OMBA 5LOMA 5KCJB 2DVZA 4U1ZA 4G8NA 4JWXA 4TLMB 2DWJA 1EZOA 3SEUA 4AQ4A 5ICTA 2VOZA 1MQIA 3AXFA 5AA4B 4NF4B 3KJTA 4OQOA 3C4MA 1I6AA 4I9DA 4U22A 3PUWE 2W7YA 4E0XA 4ELQA 3K1MA 4R2FA 5ITOA 4YKJA 5H8HA 1HSLA 1FTLA 5H8QB 1JW1A 2QS2A 3MC2A 1FQBA 1H45A 5DYHA 3TPAA 3PD9A 1GTKA 3UA8A 4U21A 1MY1A 3VFJA 3LVUA 1Y3PA 5KDTA 4ZZEA 3KG2A 2QPQA 3TDJA 1PB9A 4XKNA 2GHBA 4WXJA 2F35A 4GVOA 2I0BA 3M3FA 2KLFA 5I56B 5AA2D 1NL5A 1URSA 1A40A 3QSLA 3W9WA 1MM6A 3IOVA 1BTJA 2FA7A 3LC8A 3R6UA 3S9NC 4F29A 1RKMA 3MVYA 5CMKA 3MVWA 3MZ1A 2FYIA 4H6DA 3M3LA 1GV8A 3RPWA 5I57A 3FXRA 1AH5A 2XXHA 2A5TA 2NVUB 3RQTA 4YB7A 1O63A 2Z23A 4R73A 1JETA 1MM7A 4EQ7A 5I58B 1B40A 1B05A 3T9XB 4DCYA 3I5OA 3MPLA 3K6UA 5I2NB 3OD7A 1FQCA 4DCXA 4LA9A 4RYAA 1LAXA 3MZ9A 5FTHA 4ZE8A 3DM0A 3RT6B 3IB2A 1OLCA 4ONYA 4YMAA 1US5A 4EQ9A 1B46A 4TLLB 3G3KA 4NWCA 4H8JA 1URGA 1B3FA 3CG1A 4GD5A 5J1DA 4HCYA 3RN8A 2XXQA 2XXUA 4OZ9A 3RGYA 1D3KA 1URDA 1VFDA 1PBQA 1MH4A 3DELB 4MLQA 3FJMA 3TCGA 2REGA 1OQGA 2UVIA 1ZMGA 3I3VA 1D9VA 4G8HA 1NNKA 2O69A 3P7IA 1IITA 1O64A 4HTGA 1A55A 2XX7A 1AMFA 3USDA 3KN8A 3TTRA 3QK6A 3G3JA 4OESA 3EQ1A 4NE4A 3OO9A 4H0WA 4G2ZA 5TPAB 4DZ1A 3HN0A 1BLFA 4F3PA 3IB0A 3QIMA 4O3AA 3VLWA 1XHYA 1UTBB 1MXUA 3K1NA 4ZDMA 1NKXA 3PPNA 5CI5A 4KCDA 4M1VA 4Z0IA 4YMBA 1MY4A 4HCWA 1B5JA 3PPOA 2I49A 1N04A 3ILTB 3PV0E 4F31B 3WAEA 3CSGA 1MS7A 3IAZA 3GZGA 1UIVA 4GLIA 2PT1A 4IGTA 3BKIB 3K0VA 3PD8A 4RY1A 4C0RA 2OK2A 3U92A 3OO6A 4X9TA 5H8FB 1MY3A 3G7WA 1BKAA 1OMPA 3RLFE 3FD3A 3VVDA 4ELOA 2DWIA 5TP9B 3DLNA 1ZKBA 4OEUA 3Q27A 1UTHA 4FEBA 3VXCA 1SBPA 3IOUA 4PETA 1N76A 1TT1A 2CMOA 1P1OA 5DVFA 5M2VA 5CRYA 3PU5A 1TWYA 4OENA 4XKPA 4F22A 5I84A 2QL3A 4F19A 2IA4A 1MXYA 1DSNA 1M5DA 4DE8A 4QSCA 4OHNA 3TQLA 2I6EA 3MPKA 2Q89A 1MQGA 3U1OA 3TELA 4F3BA 1B3LA 4ZEBA 4Q8RA 5CMBA 2OBGA 1DPEA 4X1BA 3QYTA 1MXWA 1B2HA 4R72A 3RNNA 3SERA 1IXCA 2VGQA 2NUVA 1EZPA 1IXGA 3IR1A 3MBPA 5B70A 4GQOA 1GGGA 4FJPA 1LFGA 4F2QA 1LBBA 2F7CA 1B0LA 5EHMA 4OERA 4POXA 1MDP1 2F34A 5CM6A 4LATA 2H25A 3O2AA 4BLAA 3MWBA 2WOKA 1QW0A 1LB9A 3LSLA 3V83A 1XOCA 5JEIA 2OCUA 3DP6A 2RC7A 4F2OA 4X48A 2R9JA 4K3FA 2DSFA 3H7MA 1Q35A 2ESNA 2AL5A 1H43A 3B6QA 2I0CA 3FXQA 3S2VA 5K2YA 1FQFA 4GF8A 2XXXA 3MP8A 3C32A 3ZS6A 4GXSB 4NF6A 2B3FA 3MAMA 4QFKA 2ANJA 1WODA 3MVZA 2FNCA 1VR5A 1IIWA 1R9LA 4G4PA 3RYAA 1YPNA 5A5XB 5JTYA 2DYXA 3IORA 4DDDA 1B9JA 5KCJA 1POY1 3PAMA 2VHAA 3PMXA 2I4BA 1JVXA 3U8QA 3KEIA 1I69A 3SEXA 4NF4A 1HSJA 1QKAA 3K01A 3PUVE 3TQWA 2XXWA 2Y84A 2UYEA 3OEKA 3OELA 4KI0E 3DRFA 3E3KA 5L9OA 1N7WA 4E0WA 4F1UA 4GOTA 5AA2A 4YICA 3MQ9A 1MPBA 3S9LC 4P11A 5EHSA 2RC9A 1GR2A 5TU0A 1AOVA 4JBZA 3GBBA 3FJ7A 1YTVA 2Q2CA 2QRYA 4I8CA 3D4GA 1B7ZA 1LBCA 2DVCA 3V89B 1B6HA 4KCCA 1B58A 4LQ5A 5CBSA 3UN6A 1A54A 3Q25A 3D4CA 4BDLA 2Y7KA 3DP4A 3CFXA 5I56A 1MRPA 3JZJA 5AA1A 1POTA 4PFYA 4U23A 5K2XA 4BDRA 2X7QA 3HCQA 3A3UA 4EUOA 2DXRA 3QUFA 4WKMA 4IO4A 1NH7A 3T9VA 4FORA 1RYXA 3A09A 4ELPA 1IZ1A 1TXFA 1B51A 2B3BA 3ZKKA 1M5BA 2PBWA 4GWOA 3OXNA 2ZNTA 1NH8A 5I2NA 1QKBA 4OVJA 3G3GA 4H8IA 4NMYA 1ELJA 4WEDA 5ISUA 1P1WA 4JSDA 4H5GA 2OWSA 2H5YA 3OO8A 4ESXA 2UVHA 4H1XA 1SW4A 1J1NA 4YKIA 5I2KB 4KHZE 3O6GA 3C36A 2Y7PA 4F1VA 4TQUQ 3SDFA 1ZU0A 2O84X 1LSTA 3FIRA 4FE8A 4POWA 3U93A 4Z7EA 3K6XA 3KSJA 3H06B 3DRIA 3O28A 4EDPA 3FATA 1FQAA 4MFIA 3HO7A 4OEVA 2QSXA 4FEDA 2ZYNA 4QFOA 2DE3A 4H67A 2PX1A 3VV5A 1Y1MA 3TAJA 1QUIA 4QFLA 5KZTA 2NXOA 3KOSA 2V84A 2RINA 2VD2A 2ABHA 3IK6B 3ZSFA 4X1DA 1R1NA 1I6QA 3LBSA 1SVXB 2HEUA 1N7XA 4OTEA 4ISUA 2XXPA 2Q88A 3W9VA 1UQWA 1QVSA 1LGBC 1MQHA 2O1LA 5H8HB 2DWAA 2F6PA 1FQDA 1B32A 1Y4CA 2B4LA 4ZEDA 4LZ7A 5DVJA 2Z22A 4I1DA 4EF2A 2R6GE 3VVEA 4NF5A 4ZEIA 1O7TA 1SW5A 5KDTB 2O7IA 4Q5TA 4F18A 1PBPA 4H65A 4YZZA 2ONSA 1IXHA 1YAEA 1PB7A 1B52A 5DTBA 1FW0A 3V8XB 3JV9A 1NNFA 1P99A 1NNPA 3FZVA 1JEUA 3MVXA 1ZLQA 4U2RA 1OLAA 3LR1A 2H98A 3TCHA 1XC1A 1MY0A 2XX8A 4IO5A 4JWYA 3SEWA 2R71A 4DXUA 4EXKA 3DP8A 4IO3A 1N3WA 3HSTA 2THIA
chains in the Genus database with same CATH superfamily
1VDWA 1JW5A 3IL1B 4M4GA 1OVBA 2RCAA 4RPNA 5CMCA 3HHGA 1S50A 3CR9A 4IGRA 5ITPA 4N6DA 4N6PA 5CC2A 3RTWB 2YLNA 4G61A 4LUBA 2AIXA 4KD5A 3KBRA 2D5WA 1D9YA 1IMDA 3IB1A 2V3TA 3KN3A 3PUXE 2RF1A 1QUKA 4L17A 4F39A 4BDQA 4I3YA 3HHFA 5EYHA 3C34A 2Z8EA 3QUJA 3S9EA 4OVRA 1N3XA 2Y5LA 1JNFA 3ODBA 1QULA 3FXBA 1LAHE 3K6WA 4HE0A 2GH9A 2G29A 2XD2A 5I59A 2OZZA 1DOTA 1WVJA 2DS9A 4R6HA 3Q29A 1INPA 1XS5A 3TEPA 4G8MA 4P0IA 2O68A 4XKRA 2B4MA 4KYDA 4HW8A 4RXLA 3K6VA 2O1MA 3U72A 2CZLA 4DI4B 1PEBA 5J16A 2Q8JA 4QFNA 1Y1ZA 2REJA 3UORA 5H8NA 1LCFA 3LSWA 4DXCA 4EXLA 3FASA 4GWYA 1LLSA 4IO7A 3IOTA 1BIYA 4PDDA 1MH3A 2DWHA 4IY5A 3IOWA 4O3CA 4BDNA 2PVUA 1OVTA 3A29A 2P2AA 4O3BA 4QRZA 1H44A 3K00A 1LBZA 1B4HA 1FPBA 1FTKA 1SYHA 4PTKA 3UP9A 3T1BA 2Y7RA 4Q30B 3RPLB 1OQHA 4MNCA 1N0TA 2KR0A 2GFEA 4N8GA 4LZ5A 1EYJA 4XIGQ 4I62A 3PUZE 4JWOA 3E4RA 3C33A 3ILUB 3FVNA 3H4ZA 1LFHA 1MXZA 1H76A 3NOHA 5FHMA 2YJPA 4KFQA 2FIEA 3T66A 1NI9A 2NWJA 5IZ1A 5HPQA 4NQ8A 2WKYA 3C9HA 5ELVA 4GX4A 2UVJA 1ATGA 2Q2AA 4DLDA 1D9QA 1YCJA 3PMVA 3T22A 4N6KA 4PF6A 3KFMA 4FECA 3DRGA 4UACA 2O7UA 4PQJA 3TTLA 2XXIA 4DXBA 1A99A 5A5LA 2BJJX 4R75A 4UA8A 3EHUA 2ZYKA 5BWJA 4JXIA 2I58A 3EPEA 2QS3A 2XWVA 3SKPA 1BP5A 2GRVA 2ZYOA 3IO6A 2Y7WA 2ZYMA 1G0HA 1FJ6A 3RT8A 2HAVA 1USYE 1CB6A 5HM4B 3B6WA 3FTOA 1SI1A 2VD3A 3MUQA 3K02A 3GBAA 4EF1A 1ANFA 3SEVA 3DRJA 2V3UA 5DEXA 4R9GA 3FV2A 4OXVA 1FTMA 2QMWA 3TTNA 4LN5A 3RUMA 3MP1A 3IX1A 2HZKA 4QBAA 2PMSA 1N84A 2PT2A 3CFLA 3DRHA 5CBRA 4F3GA 3EHTA 4XF5A 1VFEA 3B7DA 3G3HA 5ESYA 1FPLA 4JB7A 1AL3A 3FUZA 1LCTA 4RA1A 5AA4A 3KZGA 4YAHX 3H03A 4G68B 3O6HA 4ZZAA 5FBPA 4OWDA 1II5A 3FVKA 3H6UA 3BFUA 3FJGA 4GL0A 2O51A 4JVCA 3VE1B 5ICQA 1DPPA 4H5FA 3TFLA 3TYHA 2HFBA 4N13A 4GIZA 3EHSA 5H8QA 3IJOB 2P1SA 2ONRA 1RDZA 1EZ9A 5DVIA 1LAFE 3CRBA 4N8YA 5EQ9A 3LSFB 3T93B 4GX3A 2VT5A 5FHNA 2WYKA 1M5EA 4YB6A 1IMCA 4RNSA 1B0HA 3L6GA 4MJOA 4ZS9A 4GL8A 3FVOA 4UABA 3ONMA 3RYBA 2V25A 3OSQA 5EYFA 4ECFA 3SEYA 3T9HB 1PB8A 4X8RA 1B3HA 3KJ7A 2FIXA 2ZXTA 4JVIA 4HE1A 2ALUA 2RC8A 1Y9UA 4NF6B 3PPQA 4OVSA 3SZPA 3U94A 3FVGA 2DP8A 2FBPA 4P0GA 1JQFA 3FV1A 1KWHA 2HCAA 2ZNSA 3TTKA 1IEJA 3OOAA 1CE2A 2WOLA 4YU0A 3KBZA 1NNTA 3PGFA 2ZZWA 4R6KA 4GFRA 1RYOA 5JTYB 3CI8A 2B65A 3HV1A 3HFUA 3O6IA 1S9TA 4R2BA 4IY6A 3M3KA 1K9YA 4LONB 4NWDA 3S4UA 1NMUA 1IMBA 4PFIA 1FRPA 4IO6A 3H3GA 5I58A 1NUXA 3G3FA 2HHMA 2XXYA 5I5PA 2DXYA 1FBPA 4P9KA 1MDQA 1A8FA 2ZMBA 1B1XA 4N91A 1PC3A 2H4IA 3G3IA 3E78A 1QUJA 2F3BA 2AL4A 2ZNUA 4YKKA 3B6TA 1TFAA 3RY3A 5AA2B 5IAIA 4R74A 1GVCA 4R9FA 3QXMA 3SETA 4HXVA 4DIGA 1S7YA 2ZZVA 3O6PA 2G93A 1DTGA 3RTFB 4QHQA 1XVXA 4QF9A 1MY2A 1HSEA 2Q74A 3F11A 3KOTA 3TTMA 1OIBA 4IO2A 1Z7ME 4OVPA 4N4UA 5B7DA 3QAXA 2F7AA 1IUDA 4NF8B 1TFDA 4QSEA 4MEVA 3C31A 4IR8A 4I40A 2XWIA 2I3WA 5F7VA 5H8SA 2D3IA 4OFJA 2I4CA 2QS4A 1SDXA 4ZECA 5TPAA 4KXPA 1B5IA 3GXAA 3DRKA 4PCDA 4PE5B 1UTBA 4R6YA 3N26A 5JK4A 5FTIA 4FAJA 1FTOA 3N94A 5I3SA 4G68C 3UIFA 3FBPA 1VSOA 1Q1KA 4HS7A 1B7UA 3TZAA 4IB2A 3WAFA 3BFTA 1FBFA 2L5VA 2Z8FA 2ONKE 4KPTA 3UGWA 1XT8A 2HXWA 1LBVA 3OO7A 2DOJA 2LAOA 1SW1A 1XI6A 3OSRA 1MPCA 4MAGA 4XXUA 3Q28A 4U4XA 3E9XA 1ZIUA 1Y3NA 3H6TA 3K4UA 3KGCA 5H8FA 4C1TA 1NV4A 1AIVA 1USYH 2QVRA 4ZE9A 1NV3A 2GHAA 5L9SA 3ECRA 1SW2A 2XXVA 5TP9A 3VDFA 2E0SA 4ZEKA 3A3CA 3OEMA 3LUYA 3ROJA 4C1UA 1FCKA 4KYEA 4OVQA 3ISPA 2OJTA 2QS1A 3MP6A 2HPGA 2V3QA 3K2DA 1MPDA 2KQZA 5I57B 3UK4A 1P1QA 2A5TB 3CG3A 1FPKA 2H99A 1ZJLA 3EN3A 4RJZA 3IO4A 2A5SA 3OMBA 1MG1A 2O6AA 3TUSA 3TCFA 2XHDA 3CHGA 3HPIA 3RPLA 4XTCQ 5AA3A 1ZBMA 5L9MA 4ZEFA 3CSBA 5BUUA 2V93A 4ELRA 4F1YA 2RKMA 1B4ZA 2XXKA 1JEVA 1FBHA 4N17A 2I48A 4PP0A 4FATA 2F8DA 3BBRA 3R7XA 5AE4A 3L6HA 1UIUA 4NF5B 4RK9A 3THIA 2HQ0A 4F3SA 1IQ7A 5DT6A 4GBWA 2DE2A 2XX9A 1RDXA 4PFUA 4KQPA 3H6WA 4YKPA 2AYSA 4LZ8A 3T9UA 1EU8A 1H3DA 4MBPA 1CNQA 2RCBA 2PYYA 1JP4A 4FBPA 3QMFA 3B50A 3OENA 3VLUA 2R8TA 3K1PA 4P56A 4MX6A 3MJNA 3MW0A 1LB8A 5HBCA 1SD3A 3B8BA 3VXBA 3CIJA 2F36A 3KN7A 1MXVA 5EYGA 2X7PA 3TMGA 1R6ZA 1M5FA 4PFTA 5IKBA 3TODA 4PF8A 5CMMA 1WDNA 3C35A 4WEPA 3PMWA 2Y7IA 2HAUA 5FHOA 2F97A 1EYIA 2DQVA 4OFOA 4U4SA 1B3GA 2D21A 4OYVA 5A5XA 5LDZA 2OWTA 2XXTA 3M8UA 1B1HA 3VVFA 1IXIA 1SI0A 1B5HA 1ZTYA 2UVGA 5ET8A 4GXAA 1EH3A 2QMXA 1PDAA 2CZHA 4G77A 4G68A 1FPFA 1B7HA 4PAKA 4KYSA 4EQBA 2F5XA 4THIA 1NFTA 1MQJA 2DE4A 1LFIA 4MF3A 3H6VA 4H46A 5I59B 4QSDA 2UXAA 3I6VA 1R9QA 3MZBA 4XKQA 3FXUA 2XXRA 4BDOA 5ET5A 4LQ2A 4RPOA 1T0KA 1I6BA 1B3EA 2Q8MA 4U1OA 1UTHB 4NEDA 2F3DA 2QFLA 3N6TA 4TOZA 2WOPA 1A7LA 3Q26A 2WYPA 2I3VA 1FPGA 4MH5A 2HZLA 3R26A 4NTLA 3VLVA 5H8NB 2UYFA 2XD3A 4MHFA 3T96B 1YZ0A 1MXXA 4LP2B 1A8EA 3ZKLA 3KSXA 4OETA 4PFBA 2F7BA 3IFAA 1Y20A 4BDMA 1FSAA 2NOOA 5IGAA 2CEXA 2QJEA 2H9BA 4OFLA 3O97A 4Q0CA 1L5TA 1Z7NE 4MCOA 4XEQA 4PGPA 2OWZA 5IZ3A 3S9MC 2IEEA 1G0IA 1Y4TA 4NX1A 1SQYA 3O29A 5IM2A 1P1NA 4N15A 4N07A 2P0SA 4GRKA 2Z8DA 4AB5A 1MQDA 1F9BA 1JW4A 3PUYE 1SYIA 4PBHA 1SPIA 3RYDA 1QJMA 3GLBA 3O9PA 3EF7A 1KZ8A 3CVGA 3O66A 3LSXA 1QGXA 2F6GA 1LAGE 4P8BA 4AB6A 3IJXB 1FTJA 1Y3QA 4XFEA 2VP1A 3SESA 4LVQA 4QFPA 1P1UA 4PFWA 4RK2A 5I2KA 3IFCA 1M5CA 1D4NA 4MLVA 3TKDA 4KR5A 5L8DA 3N6UA 3JYRA 1AWBA 2PFZA 4ND9A 2M8CA 1DMBA 4JSOA 4YB5A 3PPRA 3E13X 2OLBA 4FIMA 2VPOA 2QVVA 2XWOA 1VE4A 2X26A 1US4A 3FGSA 1JVYA 5F1QA 1FQEA 1NV0A 2E1SA 2YPNA 5DEXB 4NF8A 2Q9TA 4ESWA 1DTZA 3V5AA 3CFZA 2F78A 3N5LA 1XVYA 3W15C 3PPPA 4JDFA 4OMBA 5LOMA 5KCJB 2DVZA 4U1ZA 4G8NA 4JWXA 4TLMB 2DWJA 1EZOA 3SEUA 3LV0A 4AQ4A 5ICTA 2VOZA 1MQIA 3AXFA 2WX9A 5AA4B 4NF4B 3KJTA 4OQOA 3C4MA 1NV6A 1I6AA 4I9DA 1FBGA 4U22A 3PUWE 2W7YA 4E0XA 4ELQA 3K1MA 4R2FA 5ITOA 5LTCA 3LUZA 4YKJA 5H8HA 1HSLA 1FTLA 5H8QB 1JW1A 2QS2A 3MC2A 1FQBA 2BJIA 2HXRA 4P1EA 1H45A 5DYHA 3TPAA 2ZZXA 3PD9A 1GTKA 3UA8A 4U21A 4GX6A 1MY1A 3VFJA 3LVUA 1Y3PA 2P3NA 4ZZEA 5KDTA 3KG2A 4AS5A 2QPQA 4O8MA 3TDJA 5F24A 1PB9A 4XKNA 2GHBA 4WXJA 2F35A 5I7IA 4GVOA 2I0BA 3M3FA 2KLFA 5I56B 5AA2D 1NL5A 1URSA 1A40A 1RDYA 3QSLA 1FBDA 3W9WA 1MM6A 3IOVA 1BTJA 2FA7A 3LC8A 3R6UA 3S9NC 1NUWA 1FPEA 4F29A 1RKMA 2WBDA 3MVYA 5CMKA 3MVWA 3MZ1A 2FYIA 4H6DA 3M3LA 1GV8A 3RPWA 5I57A 3FXRA 1FPJA 1NUZA 1AH5A 2XXHA 2A5TA 2NVUB 3GYYA 4NN3A 3RQTA 4YB7A 1O63A 4NHBA 2Z23A 2FVZA 4R73A 1JETA 1MM7A 4EQ7A 5I58B 1B40A 1B05A 3T9XB 4DCYA 4OVTA 3I5OA 3MPLA 3K6UA 5I2NB 3OD7A 1FQCA 4DCXA 4LA9A 4RYAA 1LAXA 3MZ9A 5FTHA 4ZE8A 3DM0A 5T3JA 3RT6B 3IB2A 1OLCA 4ONYA 4YMAA 2QVUA 1US5A 4EQ9A 1B46A 4TLLB 3G3KA 4NWCA 4H8JA 1URGA 1B3FA 3CG1A 4GD5A 5J1DA 1IMFA 4HCYA 3RN8A 1Q9DA 2XXQA 2XXUA 4OZ9A 3RGYA 1D3KA 1URDA 1VFDA 1PBQA 1MH4A 3DELB 4MLQA 3FJMA 1FBCA 1FTAA 3TCGA 2REGA 1OQGA 1NV7A 1ZMGA 2UVIA 3I3VA 1D9VA 1FPDA 4G8HA 1NNKA 2O69A 3P7IA 3U65A 2OX3A 1IITA 1IMAA 1O64A 2JJKA 4HTGA 4DI3D 1A55A 2XX7A 1AMFA 3USDA 3KN8A 3BIGA 3TTRA 3QK6A 3G3JA 4OESA 3EQ1A 4NE4A 3OO9A 4H0WA 4G2ZA 5TPAB 1NUYA 4DZ1A 3HN0A 5EQAA 1NV2A 1BLFA 4F3PA 3IB0A 3QIMA 4O3AA 3VLWA 1XHYA 1UTBB 1MXUA 3K1NA 4ZDMA 1NKXA 3PPNA 1K9ZA 5CI5A 4KCDA 4M1VA 3MSTA 4Z0IA 4YMBA 1MY4A 4HCWA 1B5JA 3KC1A 3PPOA 2I49A 1N04A 1FPIA 3ILTB 3PV0E 4F31B 3WAEA 3CSGA 1MS7A 4PAIA 4PBQA 3IAZA 3GZGA 1UIVA 4GLIA 2PT1A 3T0JA 4IGTA 3BKIB 3K0VA 4N81A 3PD8A 4P47A 4RY1A 4C0RA 2OK2A 3U92A 3OO6A 4X9TA 2CEYA 4X04A 5H8FB 1EYKA 1MY3A 3G7WA 1BKAA 1OMPA 3RLFE 3FD3A 3VVDA 4ELOA 2DWIA 5TP9B 3DLNA 1ZKBA 1LBYA 4OEUA 3Q27A 1UTHA 4FEBA 3VXCA 1SBPA 3IOUA 4PETA 1N76A 1TT1A 2CMOA 1P1OA 5DVFA 5M2VA 5CRYA 3PU5A 1TWYA 4OENA 4XKPA 4F22A 5I84A 2QL3A 4F19A 2IA4A 1MXYA 4H45A 1DSNA 1M5DA 4DE8A 4QSCA 4OHNA 3MYUA 1NV1A 3TQLA 2I6EA 2XA5A 3MPKA 2Q89A 1MQGA 3U1OA 3TELA 1KA0A 4F3BA 1B3LA 4ZEBA 3KC0A 4Q8RA 5CMBA 2OBGA 1DPEA 4PE3A 4X1BA 2DDKA 3QYTA 1MXWA 1B2HA 4R72A 1NV5A 3RNNA 3SERA 1IXCA 2VGQA 2NUVA 1EZPA 1IXGA 4P3LA 3IR1A 4O7MA 3MBPA 5B70A 4GQOA 1GGGA 4MIJA 4FJPA 1LFGA 3PTYA 4F2QA 1LBBA 2F7CA 1B0LA 5EHMA 4OERA 4POXA 2CZKA 1MDP1 2F34A 5CM6A 4LATA 2H25A 3O2AA 4BLAA 3MWBA 2WOKA 1QW0A 1LB9A 3LSLA 3V83A 1XOCA 5JEIA 2OCUA 3DP6A 2RC7A 4F2OA 4GWSA 4X48A 2R9JA 4K3FA 2DSFA 3H7MA 1Q35A 2ESNA 2AL5A 4OA4A 1H43A 3B6QA 2I0CA 3FXQA 2XWKA 3S2VA 5K2YA 1FQFA 4GF8A 2XXXA 3MP8A 3C32A 3E79A 3ZS6A 4OANA 4GXSB 4NF6A 2B3FA 1DK4A 3MAMA 4QFKA 2ANJA 1WODA 4NG7A 3MVZA 2FNCA 1VR5A 1IIWA 1R9LA 4G4PA 3RYAA 2FHYA 1YPNA 5A5XB 5JTYA 5DW8A 2DYXA 3IORA 4DDDA 1B9JA 5KCJA 1POY1 3PAMA 2VHAA 3PMXA 2I4BA 1KA1A 1JVXA 3U8QA 3KEIA 2WEFA 1I69A 3SEXA 3D1RA 4NF4A 1HSJA 1QKAA 3K01A 3PUVE 3TQWA 2XXWA 2Y84A 2P3VA 1LEVA 2UYEA 3OEKA 3OELA 4KI0E 3DRFA 3E3KA 5L9OA 1N7WA 1FJ9A 3BIHA 4E0WA 4F1UA 2GQ1A 4GOTA 4QXDA 5AA2A 5ET6A 4YICA 3MQ9A 1MPBA 3S9LC 4P11A 5EHSA 2RC9A 1GR2A 5TU0A 1AOVA 4HE2A 4JBZA 3GBBA 3FJ7A 1YTVA 2Q2CA 4NGUA 2QRYA 4I8CA 5IZZA 1LBXA 3D4GA 1B7ZA 1LBCA 2DVCA 3V89B 1B6HA 4O94A 4KCCA 1B58A 4LQ5A 5CBSA 4GWXA 3UN6A 1A54A 3Q25A 3D4CA 4BDLA 1LBWA 4PC9A 2Y7KA 3DP4A 3CFXA 5I56A 1MRPA 3JZJA 5AA1A 1POTA 4PFYA 4GWUA 4JVDA 4U23A 5K2XA 4BDRA 2X7QA 3HCQA 3EKIA 3A3UA 2WBBA 4EUOA 5IZ3B 2DXRA 3QUFA 4WKMA 4IO4A 2PCRA 1NH7A 3T9VA 4FORA 1RYXA 4MNPA 3A09A 4ELPA 1IZ1A 1TXFA 2Y5KA 1B51A 2B3BA 3ZKKA 1M5BA 2PBWA 4GWOA 3OXNA 4GWZA 2ZNTA 1NH8A 5I2NA 1QKBA 4OVJA 3G3GA 4H8IA 2MKZA 4NMYA 4I3EA 1ELJA 2V4CA 4WEDA 5ISUA 1P1WA 4JSDA 4H5GA 2OWSA 4PAFA 2H5YA 3OO8A 4ESXA 2UVHA 4H1XA 1SW4A 1J1NA 4YKIA 5I2KB 4KHZE 4NF0A 3O6GA 3C36A 1DBZA 2Y7PA 4F1VA 1YYZA 4TQUQ 3SDFA 1ZU0A 2O84X 1IMEA 1LSTA 3FIRA 4FE8A 4POWA 3U93A 4Z7EA 4MMPA 3K6XA 5EQ8A 3KSJA 3H06B 3DRIA 3O28A 4EDPA 3FATA 1FQAA 4MFIA 3HO7A 4OEVA 4PFRA 2QSXA 4FEDA 2ZYNA 4QFOA 2DE3A 4H67A 2PX1A 3VV5A 1Y1MA 2PFYA 3TAJA 1QUIA 4QFLA 2VPNA 5KZTA 2NXOA 3KOSA 2V84A 5EQ7A 2RINA 2VD2A 2ABHA 3IK6B 3ZSFA 4X1DA 1R1NA 4P1LA 1I6QA 3LBSA 1SVXB 2HEUA 1BK4A 1N7XA 4GWWA 4OTEA 4ISUA 2XXPA 2Q88A 3W9VA 1UQWA 1QVSA 1LGBC 1MQHA 2O1LA 5H8HB 4PGNA 2DWAA 2F6PA 1FQDA 1B32A 1Y4CA 2B4LA 4ZEDA 4LZ7A 5DVJA 2Z22A 4I1DA 4EF2A 1DCUA 2R6GE 3VVEA 4NF5A 4ZEIA 5ET7A 1O7TA 1SW5A 5KDTB 2O7IA 4Q5TA 4F18A 4PDHA 1PBPA 4H65A 4YZZA 2ONSA 2CZIA 4NAPA 1IXHA 1YAEA 1PB7A 1B52A 4O7IA 5DTBA 1FW0A 4AS4A 4GBVA 3V8XB 3JV9A 1NNFA 1P99A 1NNPA 3FZVA 1JEUA 3MVXA 1ZLQA 4U2RA 1OLAA 3LR1A 1FBEA 2H98A 3TCHA 1XC1A 1MY0A 2XX8A 4IO5A 4JWYA 3SEWA 1YXIA 2R71A 4DXUA 4EXKA 3DP8A 4IO3A 1N3WA 3HSTA 2THIA 4MNIA
chains in the Genus database with same CATH topology
1JW5A 3IL1B 4M4GA 1OVBA 2RCAA 4RPNA 5CMCA 3HHGA 1S50A 3CR9A 4IGRA 5ITPA 4N6PA 5CC2A 3RTWB 2YLNA 4LUBA 2AIXA 4KD5A 3KBRA 2D5WA 1D9YA 3IB1A 2V3TA 3KN3A 3PUXE 2RF1A 1QUKA 4L17A 4F39A 4BDQA 3HHFA 3C34A 2Z8EA 3QUJA 3S9EA 1N3XA 1JNFA 3ODBA 1QULA 1LAHE 3K6WA 2GH9A 2G29A 2XD2A 5I59A 2OZZA 1DOTA 1WVJA 2DS9A 4R6HA 3Q29A 1XS5A 3TEPA 4G8MA 4P0IA 2O68A 4XKRA 2B4MA 4KYDA 4HW8A 4RXLA 3K6VA 2O1MA 3U72A 2CZLA 1PEBA 2Q8JA 4QFNA 1Y1ZA 2REJA 3UORA 5H8NA 1LCFA 3LSWA 4DXCA 4EXLA 3FASA 1LLSA 4IO7A 3IOTA 1BIYA 1MH3A 2DWHA 4IY5A 3IOWA 4O3CA 4BDNA 2PVUA 1OVTA 2P2AA 4O3BA 4QRZA 1H44A 3K00A 1B4HA 1FTKA 1SYHA 3UP9A 2Y7RA 4Q30B 1OQHA 1N0TA 2GFEA 4LZ5A 4XIGQ 4I62A 3PUZE 4JWOA 3E4RA 3C33A 3ILUB 3FVNA 3H4ZA 1LFHA 1MXZA 1H76A 5FHMA 2YJPA 4KFQA 3T66A 2NWJA 5HPQA 2WKYA 3C9HA 5ELVA 2UVJA 1ATGA 2Q2AA 4DLDA 1YCJA 3PMVA 3T22A 3KFMA 4FECA 3DRGA 4UACA 2O7UA 4PQJA 3TTLA 2XXIA 4DXBA 1A99A 2BJJX 4R75A 4UA8A 3EHUA 2ZYKA 5BWJA 4JXIA 2I58A 3EPEA 2QS3A 3SKPA 1BP5A 2GRVA 2ZYOA 3IO6A 2Y7WA 2ZYMA 3RT8A 2HAVA 1USYE 1CB6A 5HM4B 3B6WA 3FTOA 1SI1A 2VD3A 3MUQA 3K02A 3GBAA 4EF1A 1ANFA 3SEVA 3DRJA 2V3UA 5DEXA 4R9GA 3FV2A 4OXVA 1FTMA 2QMWA 3TTNA 3RUMA 3MP1A 3IX1A 2HZKA 2PMSA 1N84A 2PT2A 3CFLA 3DRHA 5CBRA 4F3GA 3EHTA 1VFEA 3B7DA 3G3HA 4JB7A 1AL3A 3FUZA 1LCTA 4RA1A 5AA4A 3KZGA 4YAHX 3H03A 4G68B 3O6HA 4ZZAA 4OWDA 1II5A 3FVKA 3H6UA 3BFUA 3FJGA 4GL0A 2O51A 3VE1B 5ICQA 1DPPA 4H5FA 3TFLA 3TYHA 2HFBA 4N13A 4GIZA 3EHSA 5H8QA 3IJOB 2P1SA 2ONRA 5DVIA 1EZ9A 1LAFE 3CRBA 3LSFB 3T93B 5FHNA 1M5EA 4YB6A 4RNSA 1B0HA 3L6GA 4ZS9A 4GL8A 3FVOA 3ONMA 3RYBA 2V25A 3OSQA 5EYFA 4ECFA 3SEYA 3T9HB 1PB8A 1B3HA 3KJ7A 2ZXTA 2ALUA 2RC8A 1Y9UA 4NF6B 3PPQA 3U94A 3FVGA 2DP8A 4P0GA 1JQFA 3FV1A 1KWHA 2HCAA 2ZNSA 3TTKA 1IEJA 3OOAA 1CE2A 2WOLA 4YU0A 1NNTA 3PGFA 4R6KA 4GFRA 1RYOA 5JTYB 3CI8A 2B65A 3HV1A 3O6IA 1S9TA 4R2BA 4IY6A 3M3KA 4LONB 4NWDA 3S4UA 1NMUA 4IO6A 3H3GA 5I58A 3G3FA 2XXYA 2DXYA 1MDQA 1A8FA 2ZMBA 1B1XA 1PC3A 2H4IA 3G3IA 1QUJA 2AL4A 2ZNUA 4YKKA 3B6TA 1TFAA 3RY3A 5AA2B 5IAIA 4R74A 1GVCA 4R9FA 3QXMA 3SETA 4DIGA 1S7YA 3O6PA 2G93A 1DTGA 3RTFB 4QHQA 1XVXA 4QF9A 1MY2A 1HSEA 3F11A 3KOTA 3TTMA 1OIBA 4IO2A 1Z7ME 5B7DA 3QAXA 2F7AA 1IUDA 4NF8B 1TFDA 4QSEA 3C31A 2I3WA 5F7VA 5H8SA 2D3IA 4OFJA 2I4CA 2QS4A 1SDXA 4ZECA 5TPAA 1B5IA 3GXAA 3DRKA 4PE5B 1UTBA 4R6YA 3N26A 5JK4A 5FTIA 4FAJA 1FTOA 3N94A 4G68C 3UIFA 1VSOA 1Q1KA 4HS7A 1B7UA 3TZAA 4IB2A 3WAFA 3BFTA 2Z8FA 2ONKE 4KPTA 3UGWA 1XT8A 2HXWA 3OO7A 2DOJA 2LAOA 1SW1A 3OSRA 1MPCA 4XXUA 3Q28A 4U4XA 3E9XA 1ZIUA 1Y3NA 3H6TA 3K4UA 3KGCA 5H8FA 4C1TA 1AIVA 1USYH 4ZE9A 2GHAA 5L9SA 3ECRA 1SW2A 2XXVA 5TP9A 3VDFA 2E0SA 4ZEKA 3A3CA 3OEMA 3LUYA 4C1UA 1FCKA 4KYEA 2OJTA 2QS1A 3MP6A 2V3QA 3K2DA 1MPDA 5I57B 3UK4A 1P1QA 2A5TB 3CG3A 2H99A 1ZJLA 3EN3A 4RJZA 3IO4A 2A5SA 3OMBA 1MG1A 2O6AA 3TUSA 3TCFA 2XHDA 3CHGA 3HPIA 4XTCQ 5AA3A 1ZBMA 5L9MA 4ZEFA 3CSBA 5BUUA 2V93A 4ELRA 4F1YA 2RKMA 1B4ZA 1JEVA 2I48A 4PP0A 4FATA 2F8DA 3BBRA 3R7XA 5AE4A 3L6HA 1UIUA 4NF5B 4RK9A 3THIA 2HQ0A 4F3SA 1IQ7A 5DT6A 2DE2A 2XX9A 4PFUA 4KQPA 3H6WA 4YKPA 2AYSA 4LZ8A 3T9UA 1EU8A 1H3DA 4MBPA 2RCBA 2PYYA 3OENA 3VLUA 3K1PA 3MJNA 3MW0A 1LB8A 5HBCA 1SD3A 3VXBA 3CIJA 2F36A 3KN7A 1MXVA 2X7PA 3TMGA 1R6ZA 1M5FA 4PFTA 5IKBA 3TODA 5CMMA 1WDNA 3C35A 4WEPA 3PMWA 2Y7IA 2HAUA 5FHOA 2F97A 2DQVA 4OFOA 4U4SA 1B3GA 2D21A 4OYVA 5A5XA 2OWTA 2XXTA 3M8UA 1B1HA 3VVFA 1IXIA 1SI0A 1B5HA 1ZTYA 2UVGA 4GXAA 1EH3A 2QMXA 1PDAA 4G77A 4G68A 1B7HA 4KYSA 4EQBA 2F5XA 4THIA 1NFTA 1MQJA 2DE4A 1LFIA 4MF3A 3H6VA 5I59B 4QSDA 2UXAA 3I6VA 1R9QA 3MZBA 4XKQA 3FXUA 2XXRA 4BDOA 4LQ2A 4RPOA 1T0KA 1I6BA 1B3EA 4U1OA 1UTHB 4NEDA 3N6TA 4TOZA 2WOPA 1A7LA 3Q26A 2I3VA 4MH5A 2HZLA 3R26A 4NTLA 3VLVA 5H8NB 2UYFA 2XD3A 3T96B 1MXXA 4LP2B 1A8EA 3ZKLA 3KSXA 4OETA 2F7BA 1Y20A 4BDMA 2NOOA 2QJEA 2H9BA 4OFLA 3O97A 4Q0CA 1L5TA 1Z7NE 3S9MC 2IEEA 1Y4TA 1SQYA 3O29A 1P1NA 4N07A 2P0SA 4GRKA 2Z8DA 4AB5A 1MQDA 1F9BA 1JW4A 3PUYE 1SYIA 1QJMA 3GLBA 3O9PA 3EF7A 3CVGA 3O66A 3LSXA 2F6GA 1LAGE 4AB6A 3IJXB 1FTJA 1Y3QA 2VP1A 3SESA 4LVQA 4QFPA 1P1UA 4PFWA 4RK2A 5I2KA 1M5CA 1D4NA 4MLVA 3TKDA 4KR5A 5L8DA 3N6UA 3JYRA 4ND9A 2M8CA 1DMBA 4JSOA 4YB5A 3PPRA 3E13X 2OLBA 4FIMA 1VE4A 2X26A 1US4A 3FGSA 1JVYA 5F1QA 1FQEA 2E1SA 2YPNA 5DEXB 4NF8A 2Q9TA 4ESWA 1DTZA 3V5AA 3CFZA 2F78A 3N5LA 1XVYA 3W15C 3PPPA 4JDFA 4OMBA 5LOMA 5KCJB 2DVZA 4U1ZA 4G8NA 4JWXA 4TLMB 2DWJA 1EZOA 3SEUA 4AQ4A 5ICTA 2VOZA 1MQIA 3AXFA 5AA4B 4NF4B 3KJTA 4OQOA 3C4MA 1I6AA 4I9DA 4U22A 3PUWE 2W7YA 4E0XA 4ELQA 3K1MA 4R2FA 5ITOA 4YKJA 5H8HA 1HSLA 1FTLA 5H8QB 1JW1A 2QS2A 3MC2A 1FQBA 1H45A 5DYHA 3TPAA 3PD9A 1GTKA 3UA8A 4U21A 1MY1A 3VFJA 3LVUA 1Y3PA 5KDTA 4ZZEA 3KG2A 2QPQA 3TDJA 1PB9A 4XKNA 2GHBA 4WXJA 2F35A 4GVOA 2I0BA 3M3FA 2KLFA 5I56B 5AA2D 1NL5A 1URSA 1A40A 3QSLA 3W9WA 1MM6A 3IOVA 1BTJA 2FA7A 3LC8A 3R6UA 3S9NC 4F29A 1RKMA 3MVYA 5CMKA 3MVWA 3MZ1A 2FYIA 4H6DA 3M3LA 1GV8A 3RPWA 5I57A 3FXRA 1AH5A 2XXHA 2A5TA 2NVUB 3RQTA 4YB7A 1O63A 2Z23A 4R73A 1JETA 1MM7A 4EQ7A 5I58B 1B40A 1B05A 3T9XB 4DCYA 3I5OA 3MPLA 3K6UA 5I2NB 3OD7A 1FQCA 4DCXA 4LA9A 4RYAA 1LAXA 3MZ9A 5FTHA 4ZE8A 3DM0A 3RT6B 3IB2A 1OLCA 4ONYA 4YMAA 1US5A 4EQ9A 1B46A 4TLLB 3G3KA 4NWCA 4H8JA 1URGA 1B3FA 3CG1A 4GD5A 5J1DA 4HCYA 3RN8A 2XXQA 2XXUA 4OZ9A 3RGYA 1D3KA 1URDA 1VFDA 1PBQA 1MH4A 3DELB 4MLQA 3FJMA 3TCGA 2REGA 1OQGA 2UVIA 1ZMGA 3I3VA 1D9VA 4G8HA 1NNKA 2O69A 3P7IA 1IITA 1O64A 4HTGA 1A55A 2XX7A 1AMFA 3USDA 3KN8A 3TTRA 3QK6A 3G3JA 4OESA 3EQ1A 4NE4A 3OO9A 4H0WA 4G2ZA 5TPAB 4DZ1A 3HN0A 1BLFA 4F3PA 3IB0A 3QIMA 4O3AA 3VLWA 1XHYA 1UTBB 1MXUA 3K1NA 4ZDMA 1NKXA 3PPNA 5CI5A 4KCDA 4M1VA 4Z0IA 4YMBA 1MY4A 4HCWA 1B5JA 3PPOA 2I49A 1N04A 3ILTB 3PV0E 4F31B 3WAEA 3CSGA 1MS7A 3IAZA 3GZGA 1UIVA 4GLIA 2PT1A 4IGTA 3BKIB 3K0VA 3PD8A 4RY1A 4C0RA 2OK2A 3U92A 3OO6A 4X9TA 5H8FB 1MY3A 3G7WA 1BKAA 1OMPA 3RLFE 3FD3A 3VVDA 4ELOA 2DWIA 5TP9B 3DLNA 1ZKBA 4OEUA 3Q27A 1UTHA 4FEBA 3VXCA 1SBPA 3IOUA 4PETA 1N76A 1TT1A 2CMOA 1P1OA 5DVFA 5M2VA 5CRYA 3PU5A 1TWYA 4OENA 4XKPA 4F22A 5I84A 2QL3A 4F19A 2IA4A 1MXYA 1DSNA 1M5DA 4DE8A 4QSCA 4OHNA 3TQLA 2I6EA 3MPKA 2Q89A 1MQGA 3U1OA 3TELA 4F3BA 1B3LA 4ZEBA 4Q8RA 5CMBA 2OBGA 1DPEA 4X1BA 3QYTA 1MXWA 1B2HA 4R72A 3RNNA 3SERA 1IXCA 2VGQA 2NUVA 1EZPA 1IXGA 3IR1A 3MBPA 5B70A 4GQOA 1GGGA 4FJPA 1LFGA 4F2QA 1LBBA 2F7CA 1B0LA 5EHMA 4OERA 4POXA 1MDP1 2F34A 5CM6A 4LATA 2H25A 3O2AA 4BLAA 3MWBA 2WOKA 1QW0A 1LB9A 3LSLA 3V83A 1XOCA 5JEIA 2OCUA 3DP6A 2RC7A 4F2OA 4X48A 2R9JA 4K3FA 2DSFA 3H7MA 1Q35A 2ESNA 2AL5A 1H43A 3B6QA 2I0CA 3FXQA 3S2VA 5K2YA 1FQFA 4GF8A 2XXXA 3MP8A 3C32A 3ZS6A 4GXSB 4NF6A 2B3FA 3MAMA 4QFKA 2ANJA 1WODA 3MVZA 2FNCA 1VR5A 1IIWA 1R9LA 4G4PA 3RYAA 1YPNA 5A5XB 5JTYA 2DYXA 3IORA 4DDDA 1B9JA 5KCJA 1POY1 3PAMA 2VHAA 3PMXA 2I4BA 1JVXA 3U8QA 3KEIA 1I69A 3SEXA 4NF4A 1HSJA 1QKAA 3K01A 3PUVE 3TQWA 2XXWA 2Y84A 2UYEA 3OEKA 3OELA 4KI0E 3DRFA 3E3KA 5L9OA 1N7WA 4E0WA 4F1UA 4GOTA 5AA2A 4YICA 3MQ9A 1MPBA 3S9LC 4P11A 5EHSA 2RC9A 1GR2A 5TU0A 1AOVA 4JBZA 3GBBA 3FJ7A 1YTVA 2Q2CA 2QRYA 4I8CA 3D4GA 1B7ZA 1LBCA 2DVCA 3V89B 1B6HA 4KCCA 1B58A 4LQ5A 5CBSA 3UN6A 1A54A 3Q25A 3D4CA 4BDLA 2Y7KA 3DP4A 3CFXA 5I56A 1MRPA 3JZJA 5AA1A 1POTA 4PFYA 4U23A 5K2XA 4BDRA 2X7QA 3HCQA 3A3UA 4EUOA 2DXRA 3QUFA 4WKMA 4IO4A 1NH7A 3T9VA 4FORA 1RYXA 3A09A 4ELPA 1IZ1A 1TXFA 1B51A 2B3BA 3ZKKA 1M5BA 2PBWA 4GWOA 3OXNA 2ZNTA 1NH8A 5I2NA 1QKBA 4OVJA 3G3GA 4H8IA 4NMYA 1ELJA 4WEDA 5ISUA 1P1WA 4JSDA 4H5GA 2OWSA 2H5YA 3OO8A 4ESXA 2UVHA 4H1XA 1SW4A 1J1NA 4YKIA 5I2KB 4KHZE 3O6GA 3C36A 2Y7PA 4F1VA 4TQUQ 3SDFA 1ZU0A 2O84X 1LSTA 3FIRA 4FE8A 4POWA 3U93A 4Z7EA 3K6XA 3KSJA 3H06B 3DRIA 3O28A 4EDPA 3FATA 1FQAA 4MFIA 3HO7A 4OEVA 2QSXA 4FEDA 2ZYNA 4QFOA 2DE3A 4H67A 2PX1A 3VV5A 1Y1MA 3TAJA 1QUIA 4QFLA 5KZTA 2NXOA 3KOSA 2V84A 2RINA 2VD2A 2ABHA 3IK6B 3ZSFA 4X1DA 1R1NA 1I6QA 3LBSA 1SVXB 2HEUA 1N7XA 4OTEA 4ISUA 2XXPA 2Q88A 3W9VA 1UQWA 1QVSA 1LGBC 1MQHA 2O1LA 5H8HB 2DWAA 2F6PA 1FQDA 1B32A 1Y4CA 2B4LA 4ZEDA 4LZ7A 5DVJA 2Z22A 4I1DA 4EF2A 2R6GE 3VVEA 4NF5A 4ZEIA 1O7TA 1SW5A 5KDTB 2O7IA 4Q5TA 4F18A 1PBPA 4H65A 4YZZA 2ONSA 1IXHA 1YAEA 1PB7A 1B52A 5DTBA 1FW0A 3V8XB 3JV9A 1NNFA 1P99A 1NNPA 3FZVA 1JEUA 3MVXA 1ZLQA 4U2RA 1OLAA 3LR1A 2H98A 3TCHA 1XC1A 1MY0A 2XX8A 4IO5A 4JWYA 3SEWA 2R71A 4DXUA 4EXKA 3DP8A 4IO3A 1N3WA 3HSTA 2THIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JW5 A;  3IL1 B;  4M4G A;  1OVB A;  2RCA A;  4RPN A;  5CMC A;  3HHG A;  1S50 A;  3CR9 A;  4IGR A;  5ITP A;  4N6P A;  5CC2 A;  3RTW B;  2YLN A;  4LUB A;  2AIX A;  4KD5 A;  3KBR A;  2D5W A;  1D9Y A;  3IB1 A;  2V3T A;  3KN3 A;  3PUX E;  2RF1 A;  1QUK A;  4L17 A;  4F39 A;  4BDQ A;  3HHF A;  3C34 A;  2Z8E A;  3QUJ A;  3S9E A;  1N3X A;  1JNF A;  3ODB A;  1QUL A;  1LAH E;  3K6W A;  2GH9 A;  2G29 A;  2XD2 A;  5I59 A;  2OZZ A;  1DOT A;  1WVJ A;  2DS9 A;  4R6H A;  3Q29 A;  1XS5 A;  3TEP A;  4G8M A;  4P0I A;  2O68 A;  4XKR A;  2B4M A;  4KYD A;  4HW8 A;  4RXL A;  3K6V A;  2O1M A;  3U72 A;  2CZL A;  1PEB A;  2Q8J A;  4QFN A;  1Y1Z A;  2REJ A;  3UOR A;  5H8N A;  1LCF A;  3LSW A;  4DXC A;  4EXL A;  3FAS A;  1LLS A;  4IO7 A;  3IOT A;  1BIY A;  1MH3 A;  2DWH A;  4IY5 A;  3IOW A;  4O3C A;  4BDN A;  2PVU A;  1OVT A;  2P2A A;  4O3B A;  4QRZ A;  1H44 A;  3K00 A;  1B4H A;  1FTK A;  1SYH A;  3UP9 A;  2Y7R A;  4Q30 B;  1OQH A;  1N0T A;  2GFE A;  4LZ5 A;  4XIG Q;  4I62 A;  3PUZ E;  4JWO A;  3E4R A;  3C33 A;  3ILU B;  3FVN A;  3H4Z A;  1LFH A;  1MXZ A;  1H76 A;  5FHM A;  2YJP A;  4KFQ A;  3T66 A;  2NWJ A;  5HPQ A;  2WKY A;  3C9H A;  5ELV A;  2UVJ A;  1ATG A;  2Q2A A;  4DLD A;  1YCJ A;  3PMV A;  3T22 A;  3KFM A;  4FEC A;  3DRG A;  4UAC A;  2O7U A;  4PQJ A;  3TTL A;  2XXI A;  4DXB A;  1A99 A;  2BJJ X;  4R75 A;  4UA8 A;  3EHU A;  2ZYK A;  5BWJ A;  4JXI A;  2I58 A;  3EPE A;  2QS3 A;  3SKP A;  1BP5 A;  2GRV A;  2ZYO A;  3IO6 A;  2Y7W A;  2ZYM A;  3RT8 A;  2HAV A;  1USY E;  1CB6 A;  5HM4 B;  3B6W A;  3FTO A;  1SI1 A;  2VD3 A;  3MUQ A;  3K02 A;  3GBA A;  4EF1 A;  1ANF A;  3SEV A;  3DRJ A;  2V3U A;  5DEX A;  4R9G A;  3FV2 A;  4OXV A;  1FTM A;  2QMW A;  3TTN A;  3RUM A;  3MP1 A;  3IX1 A;  2HZK A;  2PMS A;  1N84 A;  2PT2 A;  3CFL A;  3DRH A;  5CBR A;  4F3G A;  3EHT A;  1VFE A;  3B7D A;  3G3H A;  4JB7 A;  1AL3 A;  3FUZ A;  1LCT A;  4RA1 A;  5AA4 A;  3KZG A;  4YAH X;  3H03 A;  4G68 B;  3O6H A;  4ZZA A;  4OWD A;  1II5 A;  3FVK A;  3H6U A;  3BFU A;  3FJG A;  4GL0 A;  2O51 A;  3VE1 B;  5ICQ A;  1DPP A;  4H5F A;  3TFL A;  3TYH A;  2HFB A;  4N13 A;  4GIZ A;  3EHS A;  5H8Q A;  3IJO B;  2P1S A;  2ONR A;  5DVI A;  1EZ9 A;  1LAF E;  3CRB A;  3LSF B;  3T93 B;  5FHN A;  1M5E A;  4YB6 A;  4RNS A;  1B0H A;  3L6G A;  4ZS9 A;  4GL8 A;  3FVO A;  3ONM A;  3RYB A;  2V25 A;  3OSQ A;  5EYF A;  4ECF A;  3SEY A;  3T9H B;  1PB8 A;  1B3H A;  3KJ7 A;  2ZXT A;  2ALU A;  2RC8 A;  1Y9U A;  4NF6 B;  3PPQ A;  3U94 A;  3FVG A;  2DP8 A;  4P0G A;  1JQF A;  3FV1 A;  1KWH A;  2HCA A;  2ZNS A;  3TTK A;  1IEJ A;  3OOA A;  1CE2 A;  2WOL A;  4YU0 A;  1NNT A;  3PGF A;  4R6K A;  4GFR A;  1RYO A;  5JTY B;  3CI8 A;  2B65 A;  3HV1 A;  3O6I A;  1S9T A;  4R2B A;  4IY6 A;  3M3K A;  4LON B;  4NWD A;  3S4U A;  1NMU A;  4IO6 A;  3H3G A;  5I58 A;  3G3F A;  2XXY A;  2DXY A;  1MDQ A;  1A8F A;  2ZMB A;  1B1X A;  1PC3 A;  2H4I A;  3G3I A;  1QUJ A;  2AL4 A;  2ZNU A;  4YKK A;  3B6T A;  1TFA A;  3RY3 A;  5AA2 B;  5IAI A;  4R74 A;  1GVC A;  4R9F A;  3QXM A;  3SET A;  4DIG A;  1S7Y A;  3O6P A;  2G93 A;  1DTG A;  3RTF B;  4QHQ A;  1XVX A;  4QF9 A;  1MY2 A;  1HSE A;  3F11 A;  3KOT A;  3TTM A;  1OIB A;  4IO2 A;  1Z7M E;  5B7D A;  3QAX A;  2F7A A;  1IUD A;  4NF8 B;  1TFD A;  4QSE A;  3C31 A;  2I3W A;  5F7V A;  5H8S A;  2D3I A;  4OFJ A;  2I4C A;  2QS4 A;  1SDX A;  4ZEC A;  5TPA A;  1B5I A;  3GXA A;  3DRK A;  4PE5 B;  1UTB A;  4R6Y A;  3N26 A;  5JK4 A;  5FTI A;  4FAJ A;  1FTO A;  3N94 A;  4G68 C;  3UIF A;  1VSO A;  1Q1K A;  4HS7 A;  1B7U A;  3TZA A;  4IB2 A;  3WAF A;  3BFT A;  2Z8F A;  2ONK E;  4KPT A;  3UGW A;  1XT8 A;  2HXW A;  3OO7 A;  2DOJ A;  2LAO A;  1SW1 A;  3OSR A;  1MPC A;  4XXU A;  3Q28 A;  4U4X A;  3E9X A;  1ZIU A;  1Y3N A;  3H6T A;  3K4U A;  3KGC A;  5H8F A;  4C1T A;  1AIV A;  1USY H;  4ZE9 A;  2GHA A;  5L9S A;  3ECR A;  1SW2 A;  2XXV A;  5TP9 A;  3VDF A;  2E0S A;  4ZEK A;  3A3C A;  3OEM A;  3LUY A;  4C1U A;  1FCK A;  4KYE A;  2OJT A;  2QS1 A;  3MP6 A;  2V3Q A;  3K2D A;  1MPD A;  5I57 B;  3UK4 A;  1P1Q A;  2A5T B;  3CG3 A;  2H99 A;  1ZJL A;  3EN3 A;  4RJZ A;  3IO4 A;  2A5S A;  3OMB A;  1MG1 A;  2O6A A;  3TUS A;  3TCF A;  2XHD A;  3CHG A;  3HPI A;  4XTC Q;  5AA3 A;  1ZBM A;  5L9M A;  4ZEF A;  3CSB A;  5BUU A;  2V93 A;  4ELR A;  4F1Y A;  2RKM A;  1B4Z A;  1JEV A;  2I48 A;  4PP0 A;  4FAT A;  2F8D A;  3BBR A;  3R7X A;  5AE4 A;  3L6H A;  1UIU A;  4NF5 B;  4RK9 A;  3THI A;  2HQ0 A;  4F3S A;  1IQ7 A;  5DT6 A;  2DE2 A;  2XX9 A;  4PFU A;  4KQP A;  3H6W A;  4YKP A;  2AYS A;  4LZ8 A;  3T9U A;  1EU8 A;  1H3D A;  4MBP A;  2RCB A;  2PYY A;  3OEN A;  3VLU A;  3K1P A;  3MJN A;  3MW0 A;  1LB8 A;  5HBC A;  1SD3 A;  3VXB A;  3CIJ A;  2F36 A;  3KN7 A;  1MXV A;  2X7P A;  3TMG A;  1R6Z A;  1M5F A;  4PFT A;  5IKB A;  3TOD A;  5CMM A;  1WDN A;  3C35 A;  4WEP A;  3PMW A;  2Y7I A;  2HAU A;  5FHO A;  2F97 A;  2DQV A;  4OFO A;  4U4S A;  1B3G A;  2D21 A;  4OYV A;  5A5X A;  2OWT A;  2XXT A;  3M8U A;  1B1H A;  3VVF A;  1IXI A;  1SI0 A;  1B5H A;  1ZTY A;  2UVG A;  4GXA A;  1EH3 A;  2QMX A;  1PDA A;  4G77 A;  4G68 A;  1B7H A;  4KYS A;  4EQB A;  2F5X A;  4THI A;  1NFT A;  1MQJ A;  2DE4 A;  1LFI A;  4MF3 A;  3H6V A;  5I59 B;  4QSD A;  2UXA A;  3I6V A;  1R9Q A;  3MZB A;  4XKQ A;  3FXU A;  2XXR A;  4BDO A;  4LQ2 A;  4RPO A;  1T0K A;  1I6B A;  1B3E A;  4U1O A;  1UTH B;  4NED A;  3N6T A;  4TOZ A;  2WOP A;  1A7L A;  3Q26 A;  2I3V A;  4MH5 A;  2HZL A;  3R26 A;  4NTL A;  3VLV A;  5H8N B;  2UYF A;  2XD3 A;  3T96 B;  1MXX A;  4LP2 B;  1A8E A;  3ZKL A;  3KSX A;  4OET A;  2F7B A;  1Y20 A;  4BDM A;  2NOO A;  2QJE A;  2H9B A;  4OFL A;  3O97 A;  4Q0C A;  1L5T A;  1Z7N E;  3S9M C;  2IEE A;  1Y4T A;  1SQY A;  3O29 A;  1P1N A;  4N07 A;  2P0S A;  4GRK A;  2Z8D A;  4AB5 A;  1MQD A;  1F9B A;  1JW4 A;  3PUY E;  1SYI A;  1QJM A;  3GLB A;  3O9P A;  3EF7 A;  3CVG A;  3O66 A;  3LSX A;  2F6G A;  1LAG E;  4AB6 A;  3IJX B;  1FTJ A;  1Y3Q A;  2VP1 A;  3SES A;  4LVQ A;  4QFP A;  1P1U A;  4PFW A;  4RK2 A;  5I2K A;  1M5C A;  1D4N A;  4MLV A;  3TKD A;  4KR5 A;  5L8D A;  3N6U A;  3JYR A;  4ND9 A;  2M8C A;  1DMB A;  4JSO A;  4YB5 A;  3PPR A;  3E13 X;  2OLB A;  4FIM A;  1VE4 A;  2X26 A;  1US4 A;  3FGS A;  1JVY A;  5F1Q A;  1FQE A;  2E1S A;  2YPN A;  5DEX B;  4NF8 A;  2Q9T A;  4ESW A;  1DTZ A;  3V5A A;  3CFZ A;  2F78 A;  3N5L A;  1XVY A;  3W15 C;  3PPP A;  4JDF A;  4OMB A;  5LOM A;  5KCJ B;  2DVZ A;  4U1Z A;  4G8N A;  4JWX A;  4TLM B;  2DWJ A;  1EZO A;  3SEU A;  4AQ4 A;  5ICT A;  2VOZ A;  1MQI A;  3AXF A;  5AA4 B;  4NF4 B;  3KJT A;  4OQO A;  3C4M A;  1I6A A;  4I9D A;  4U22 A;  3PUW E;  2W7Y A;  4E0X A;  4ELQ A;  3K1M A;  4R2F A;  5ITO A;  4YKJ A;  5H8H A;  1HSL A;  1FTL A;  5H8Q B;  1JW1 A;  2QS2 A;  3MC2 A;  1FQB A;  1H45 A;  5DYH A;  3TPA A;  3PD9 A;  1GTK A;  3UA8 A;  4U21 A;  1MY1 A;  3VFJ A;  3LVU A;  1Y3P A;  5KDT A;  4ZZE A;  3KG2 A;  2QPQ A;  3TDJ A;  1PB9 A;  4XKN A;  2GHB A;  4WXJ A;  2F35 A;  4GVO A;  2I0B A;  3M3F A;  2KLF A;  5I56 B;  5AA2 D;  1NL5 A;  1URS A;  1A40 A;  3QSL A;  3W9W A;  1MM6 A;  3IOV A;  1BTJ A;  2FA7 A;  3LC8 A;  3R6U A;  3S9N C;  4F29 A;  1RKM A;  3MVY A;  5CMK A;  3MVW A;  3MZ1 A;  2FYI A;  4H6D A;  3M3L A;  1GV8 A;  3RPW A;  5I57 A;  3FXR A;  1AH5 A;  2XXH A;  2A5T A;  2NVU B;  3RQT A;  4YB7 A;  1O63 A;  2Z23 A;  4R73 A;  1JET A;  1MM7 A;  4EQ7 A;  5I58 B;  1B40 A;  1B05 A;  3T9X B;  4DCY A;  3I5O A;  3MPL A;  3K6U A;  5I2N B;  3OD7 A;  1FQC A;  4DCX A;  4LA9 A;  4RYA A;  1LAX A;  3MZ9 A;  5FTH A;  4ZE8 A;  3DM0 A;  3RT6 B;  3IB2 A;  1OLC A;  4ONY A;  4YMA A;  1US5 A;  4EQ9 A;  1B46 A;  4TLL B;  3G3K A;  4NWC A;  4H8J A;  1URG A;  1B3F A;  3CG1 A;  4GD5 A;  5J1D A;  4HCY A;  3RN8 A;  2XXQ A;  2XXU A;  4OZ9 A;  3RGY A;  1D3K A;  1URD A;  1VFD A;  1PBQ A;  1MH4 A;  3DEL B;  4MLQ A;  3FJM A;  3TCG A;  2REG A;  1OQG A;  2UVI A;  1ZMG A;  3I3V A;  1D9V A;  4G8H A;  1NNK A;  2O69 A;  3P7I A;  1IIT A;  1O64 A;  4HTG A;  1A55 A;  2XX7 A;  1AMF A;  3USD A;  3KN8 A;  3TTR A;  3QK6 A;  3G3J A;  4OES A;  3EQ1 A;  4NE4 A;  3OO9 A;  4H0W A;  4G2Z A;  5TPA B;  4DZ1 A;  3HN0 A;  1BLF A;  4F3P A;  3IB0 A;  3QIM A;  4O3A A;  3VLW A;  1XHY A;  1UTB B;  1MXU A;  3K1N A;  4ZDM A;  1NKX A;  3PPN A;  5CI5 A;  4KCD A;  4M1V A;  4Z0I A;  4YMB A;  1MY4 A;  4HCW A;  1B5J A;  3PPO A;  2I49 A;  1N04 A;  3ILT B;  3PV0 E;  4F31 B;  3WAE A;  3CSG A;  1MS7 A;  3IAZ A;  3GZG A;  1UIV A;  4GLI A;  2PT1 A;  4IGT A;  3BKI B;  3K0V A;  3PD8 A;  4RY1 A;  4C0R A;  2OK2 A;  3U92 A;  3OO6 A;  4X9T A;  5H8F B;  1MY3 A;  3G7W A;  1BKA A;  1OMP A;  3RLF E;  3FD3 A;  3VVD A;  4ELO A;  2DWI A;  5TP9 B;  3DLN A;  1ZKB A;  4OEU A;  3Q27 A;  1UTH A;  4FEB A;  3VXC A;  1SBP A;  3IOU A;  4PET A;  1N76 A;  1TT1 A;  2CMO A;  1P1O A;  5DVF A;  5M2V A;  5CRY A;  3PU5 A;  1TWY A;  4OEN A;  4XKP A;  4F22 A;  5I84 A;  2QL3 A;  4F19 A;  2IA4 A;  1MXY A;  1DSN A;  1M5D A;  4DE8 A;  4QSC A;  4OHN A;  3TQL A;  2I6E A;  3MPK A;  2Q89 A;  1MQG A;  3U1O A;  3TEL A;  4F3B A;  1B3L A;  4ZEB A;  4Q8R A;  5CMB A;  2OBG A;  1DPE A;  4X1B A;  3QYT A;  1MXW A;  1B2H A;  4R72 A;  3RNN A;  3SER A;  1IXC A;  2VGQ A;  2NUV A;  1EZP A;  1IXG A;  3IR1 A;  3MBP A;  5B70 A;  4GQO A;  1GGG A;  4FJP A;  1LFG A;  4F2Q A;  1LBB A;  2F7C A;  1B0L A;  5EHM A;  4OER A;  4POX A;  1MDP 1;  2F34 A;  5CM6 A;  4LAT A;  2H25 A;  3O2A A;  4BLA A;  3MWB A;  2WOK A;  1QW0 A;  1LB9 A;  3LSL A;  3V83 A;  1XOC A;  5JEI A;  2OCU A;  3DP6 A;  2RC7 A;  4F2O A;  4X48 A;  2R9J A;  4K3F A;  2DSF A;  3H7M A;  1Q35 A;  2ESN A;  2AL5 A;  1H43 A;  3B6Q A;  2I0C A;  3FXQ A;  3S2V A;  5K2Y A;  1FQF A;  4GF8 A;  2XXX A;  3MP8 A;  3C32 A;  3ZS6 A;  4GXS B;  4NF6 A;  2B3F A;  3MAM A;  4QFK A;  2ANJ A;  1WOD A;  3MVZ A;  2FNC A;  1VR5 A;  1IIW A;  1R9L A;  4G4P A;  3RYA A;  1YPN A;  5A5X B;  5JTY A;  2DYX A;  3IOR A;  4DDD A;  1B9J A;  5KCJ A;  1POY 1;  3PAM A;  2VHA A;  3PMX A;  2I4B A;  1JVX A;  3U8Q A;  3KEI A;  1I69 A;  3SEX A;  4NF4 A;  1HSJ A;  1QKA A;  3K01 A;  3PUV E;  3TQW A;  2XXW A;  2Y84 A;  2UYE A;  3OEK A;  3OEL A;  4KI0 E;  3DRF A;  3E3K A;  5L9O A;  1N7W A;  4E0W A;  4F1U A;  4GOT A;  5AA2 A;  4YIC A;  3MQ9 A;  1MPB A;  3S9L C;  4P11 A;  5EHS A;  2RC9 A;  1GR2 A;  5TU0 A;  1AOV A;  4JBZ A;  3GBB A;  3FJ7 A;  1YTV A;  2Q2C A;  2QRY A;  4I8C A;  3D4G A;  1B7Z A;  1LBC A;  2DVC A;  3V89 B;  1B6H A;  4KCC A;  1B58 A;  4LQ5 A;  5CBS A;  3UN6 A;  1A54 A;  3Q25 A;  3D4C A;  4BDL A;  2Y7K A;  3DP4 A;  3CFX A;  5I56 A;  1MRP A;  3JZJ A;  5AA1 A;  1POT A;  4PFY A;  4U23 A;  5K2X A;  4BDR A;  2X7Q A;  3HCQ A;  3A3U A;  4EUO A;  2DXR A;  3QUF A;  4WKM A;  4IO4 A;  1NH7 A;  3T9V A;  4FOR A;  1RYX A;  3A09 A;  4ELP A;  1IZ1 A;  1TXF A;  1B51 A;  2B3B A;  3ZKK A;  1M5B A;  2PBW A;  4GWO A;  3OXN A;  2ZNT A;  1NH8 A;  5I2N A;  1QKB A;  4OVJ A;  3G3G A;  4H8I A;  4NMY A;  1ELJ A;  4WED A;  5ISU A;  1P1W A;  4JSD A;  4H5G A;  2OWS A;  2H5Y A;  3OO8 A;  4ESX A;  2UVH A;  4H1X A;  1SW4 A;  1J1N A;  4YKI A;  5I2K B;  4KHZ E;  3O6G A;  3C36 A;  2Y7P A;  4F1V A;  4TQU Q;  3SDF A;  1ZU0 A;  2O84 X;  1LST A;  3FIR A;  4FE8 A;  4POW A;  3U93 A;  4Z7E A;  3K6X A;  3KSJ A;  3H06 B;  3DRI A;  3O28 A;  4EDP A;  3FAT A;  1FQA A;  4MFI A;  3HO7 A;  4OEV A;  2QSX A;  4FED A;  2ZYN A;  4QFO A;  2DE3 A;  4H67 A;  2PX1 A;  3VV5 A;  1Y1M A;  3TAJ A;  1QUI A;  4QFL A;  5KZT A;  2NXO A;  3KOS A;  2V84 A;  2RIN A;  2VD2 A;  2ABH A;  3IK6 B;  3ZSF A;  4X1D A;  1R1N A;  1I6Q A;  3LBS A;  1SVX B;  2HEU A;  1N7X A;  4OTE A;  4ISU A;  2XXP A;  2Q88 A;  3W9V A;  1UQW A;  1QVS A;  1LGB C;  1MQH A;  2O1L A;  5H8H B;  2DWA A;  2F6P A;  1FQD A;  1B32 A;  1Y4C A;  2B4L A;  4ZED A;  4LZ7 A;  5DVJ A;  2Z22 A;  4I1D A;  4EF2 A;  2R6G E;  3VVE A;  4NF5 A;  4ZEI A;  1O7T A;  1SW5 A;  5KDT B;  2O7I A;  4Q5T A;  4F18 A;  1PBP A;  4H65 A;  4YZZ A;  2ONS A;  1IXH A;  1YAE A;  1PB7 A;  1B52 A;  5DTB A;  1FW0 A;  3V8X B;  3JV9 A;  1NNF A;  1P99 A;  1NNP A;  3FZV A;  1JEU A;  3MVX A;  1ZLQ A;  4U2R A;  1OLA A;  3LR1 A;  2H98 A;  3TCH A;  1XC1 A;  1MY0 A;  2XX8 A;  4IO5 A;  4JWY A;  3SEW A;  2R71 A;  4DXU A;  4EXK A;  3DP8 A;  4IO3 A;  1N3W A;  3HST A;  2THI A; 
#chains in the Genus database with same CATH topology
 1VDW A;  1JW5 A;  3IL1 B;  4M4G A;  1OVB A;  2RCA A;  4RPN A;  5CMC A;  3HHG A;  1S50 A;  3CR9 A;  4IGR A;  5ITP A;  4N6D A;  4N6P A;  5CC2 A;  3RTW B;  2YLN A;  4G61 A;  4LUB A;  2AIX A;  4KD5 A;  3KBR A;  2D5W A;  1D9Y A;  1IMD A;  3IB1 A;  2V3T A;  3KN3 A;  3PUX E;  2RF1 A;  1QUK A;  4L17 A;  4F39 A;  4BDQ A;  4I3Y A;  3HHF A;  5EYH A;  3C34 A;  2Z8E A;  3QUJ A;  3S9E A;  4OVR A;  1N3X A;  2Y5L A;  1JNF A;  3ODB A;  1QUL A;  3FXB A;  1LAH E;  3K6W A;  4HE0 A;  2GH9 A;  2G29 A;  2XD2 A;  5I59 A;  2OZZ A;  1DOT A;  1WVJ A;  2DS9 A;  4R6H A;  3Q29 A;  1INP A;  1XS5 A;  3TEP A;  4G8M A;  4P0I A;  2O68 A;  4XKR A;  2B4M A;  4KYD A;  4HW8 A;  4RXL A;  3K6V A;  2O1M A;  3U72 A;  2CZL A;  4DI4 B;  1PEB A;  5J16 A;  2Q8J A;  4QFN A;  1Y1Z A;  2REJ A;  3UOR A;  5H8N A;  1LCF A;  3LSW A;  4DXC A;  4EXL A;  3FAS A;  4GWY A;  1LLS A;  4IO7 A;  3IOT A;  1BIY A;  4PDD A;  1MH3 A;  2DWH A;  4IY5 A;  3IOW A;  4O3C A;  4BDN A;  2PVU A;  1OVT A;  3A29 A;  2P2A A;  4O3B A;  4QRZ A;  1H44 A;  3K00 A;  1LBZ A;  1B4H A;  1FPB A;  1FTK A;  1SYH A;  4PTK A;  3UP9 A;  3T1B A;  2Y7R A;  4Q30 B;  3RPL B;  1OQH A;  4MNC A;  1N0T A;  2KR0 A;  2GFE A;  4N8G A;  4LZ5 A;  1EYJ A;  4XIG Q;  4I62 A;  3PUZ E;  4JWO A;  3E4R A;  3C33 A;  3ILU B;  3FVN A;  3H4Z A;  1LFH A;  1MXZ A;  1H76 A;  3NOH A;  5FHM A;  2YJP A;  4KFQ A;  2FIE A;  3T66 A;  1NI9 A;  2NWJ A;  5IZ1 A;  5HPQ A;  4NQ8 A;  2WKY A;  3C9H A;  5ELV A;  4GX4 A;  2UVJ A;  1ATG A;  2Q2A A;  4DLD A;  1D9Q A;  1YCJ A;  3PMV A;  3T22 A;  4N6K A;  4PF6 A;  3KFM A;  4FEC A;  3DRG A;  4UAC A;  2O7U A;  4PQJ A;  3TTL A;  2XXI A;  4DXB A;  1A99 A;  5A5L A;  2BJJ X;  4R75 A;  4UA8 A;  3EHU A;  2ZYK A;  5BWJ A;  4JXI A;  2I58 A;  3EPE A;  2QS3 A;  2XWV A;  3SKP A;  1BP5 A;  2GRV A;  2ZYO A;  3IO6 A;  2Y7W A;  2ZYM A;  1G0H A;  1FJ6 A;  3RT8 A;  2HAV A;  1USY E;  1CB6 A;  5HM4 B;  3B6W A;  3FTO A;  1SI1 A;  2VD3 A;  3MUQ A;  3K02 A;  3GBA A;  4EF1 A;  1ANF A;  3SEV A;  3DRJ A;  2V3U A;  5DEX A;  4R9G A;  3FV2 A;  4OXV A;  1FTM A;  2QMW A;  3TTN A;  4LN5 A;  3RUM A;  3MP1 A;  3IX1 A;  2HZK A;  4QBA A;  2PMS A;  1N84 A;  2PT2 A;  3CFL A;  3DRH A;  5CBR A;  4F3G A;  3EHT A;  4XF5 A;  1VFE A;  3B7D A;  3G3H A;  5ESY A;  1FPL A;  4JB7 A;  1AL3 A;  3FUZ A;  1LCT A;  4RA1 A;  5AA4 A;  3KZG A;  4YAH X;  3H03 A;  4G68 B;  3O6H A;  4ZZA A;  5FBP A;  4OWD A;  1II5 A;  3FVK A;  3H6U A;  3BFU A;  3FJG A;  4GL0 A;  2O51 A;  4JVC A;  3VE1 B;  5ICQ A;  1DPP A;  4H5F A;  3TFL A;  3TYH A;  2HFB A;  4N13 A;  4GIZ A;  3EHS A;  5H8Q A;  3IJO B;  2P1S A;  2ONR A;  1RDZ A;  1EZ9 A;  5DVI A;  1LAF E;  3CRB A;  4N8Y A;  5EQ9 A;  3LSF B;  3T93 B;  4GX3 A;  2VT5 A;  5FHN A;  2WYK A;  1M5E A;  4YB6 A;  1IMC A;  4RNS A;  1B0H A;  3L6G A;  4MJO A;  4ZS9 A;  4GL8 A;  3FVO A;  4UAB A;  3ONM A;  3RYB A;  2V25 A;  3OSQ A;  5EYF A;  4ECF A;  3SEY A;  3T9H B;  1PB8 A;  4X8R A;  1B3H A;  3KJ7 A;  2FIX A;  2ZXT A;  4JVI A;  4HE1 A;  2ALU A;  2RC8 A;  1Y9U A;  4NF6 B;  3PPQ A;  4OVS A;  3SZP A;  3U94 A;  3FVG A;  2DP8 A;  2FBP A;  4P0G A;  1JQF A;  3FV1 A;  1KWH A;  2HCA A;  2ZNS A;  3TTK A;  1IEJ A;  3OOA A;  1CE2 A;  2WOL A;  4YU0 A;  3KBZ A;  1NNT A;  3PGF A;  2ZZW A;  4R6K A;  4GFR A;  1RYO A;  5JTY B;  3CI8 A;  2B65 A;  3HV1 A;  3HFU A;  3O6I A;  1S9T A;  4R2B A;  4IY6 A;  3M3K A;  1K9Y A;  4LON B;  4NWD A;  3S4U A;  1NMU A;  1IMB A;  4PFI A;  1FRP A;  4IO6 A;  3H3G A;  5I58 A;  1NUX A;  3G3F A;  2HHM A;  2XXY A;  5I5P A;  2DXY A;  1FBP A;  4P9K A;  1MDQ A;  1A8F A;  2ZMB A;  1B1X A;  4N91 A;  1PC3 A;  2H4I A;  3G3I A;  3E78 A;  1QUJ A;  2F3B A;  2AL4 A;  2ZNU A;  4YKK A;  3B6T A;  1TFA A;  3RY3 A;  5AA2 B;  5IAI A;  4R74 A;  1GVC A;  4R9F A;  3QXM A;  3SET A;  4HXV A;  4DIG A;  1S7Y A;  2ZZV A;  3O6P A;  2G93 A;  1DTG A;  3RTF B;  4QHQ A;  1XVX A;  4QF9 A;  1MY2 A;  1HSE A;  2Q74 A;  3F11 A;  3KOT A;  3TTM A;  1OIB A;  4IO2 A;  1Z7M E;  4OVP A;  4N4U A;  5B7D A;  3QAX A;  2F7A A;  1IUD A;  4NF8 B;  1TFD A;  4QSE A;  4MEV A;  3C31 A;  4IR8 A;  4I40 A;  2XWI A;  2I3W A;  5F7V A;  5H8S A;  2D3I A;  4OFJ A;  2I4C A;  2QS4 A;  1SDX A;  4ZEC A;  5TPA A;  4KXP A;  1B5I A;  3GXA A;  3DRK A;  4PCD A;  4PE5 B;  1UTB A;  4R6Y A;  3N26 A;  5JK4 A;  5FTI A;  4FAJ A;  1FTO A;  3N94 A;  5I3S A;  4G68 C;  3UIF A;  3FBP A;  1VSO A;  1Q1K A;  4HS7 A;  1B7U A;  3TZA A;  4IB2 A;  3WAF A;  3BFT A;  1FBF A;  2L5V A;  2Z8F A;  2ONK E;  4KPT A;  3UGW A;  1XT8 A;  2HXW A;  1LBV A;  3OO7 A;  2DOJ A;  2LAO A;  1SW1 A;  1XI6 A;  3OSR A;  1MPC A;  4MAG A;  4XXU A;  3Q28 A;  4U4X A;  3E9X A;  1ZIU A;  1Y3N A;  3H6T A;  3K4U A;  3KGC A;  5H8F A;  4C1T A;  1NV4 A;  1AIV A;  1USY H;  2QVR A;  4ZE9 A;  1NV3 A;  2GHA A;  5L9S A;  3ECR A;  1SW2 A;  2XXV A;  5TP9 A;  3VDF A;  2E0S A;  4ZEK A;  3A3C A;  3OEM A;  3LUY A;  3ROJ A;  4C1U A;  1FCK A;  4KYE A;  4OVQ A;  3ISP A;  2OJT A;  2QS1 A;  3MP6 A;  2HPG A;  2V3Q A;  3K2D A;  1MPD A;  2KQZ A;  5I57 B;  3UK4 A;  1P1Q A;  2A5T B;  3CG3 A;  1FPK A;  2H99 A;  1ZJL A;  3EN3 A;  4RJZ A;  3IO4 A;  2A5S A;  3OMB A;  1MG1 A;  2O6A A;  3TUS A;  3TCF A;  2XHD A;  3CHG A;  3HPI A;  3RPL A;  4XTC Q;  5AA3 A;  1ZBM A;  5L9M A;  4ZEF A;  3CSB A;  5BUU A;  2V93 A;  4ELR A;  4F1Y A;  2RKM A;  1B4Z A;  2XXK A;  1JEV A;  1FBH A;  4N17 A;  2I48 A;  4PP0 A;  4FAT A;  2F8D A;  3BBR A;  3R7X A;  5AE4 A;  3L6H A;  1UIU A;  4NF5 B;  4RK9 A;  3THI A;  2HQ0 A;  4F3S A;  1IQ7 A;  5DT6 A;  4GBW A;  2DE2 A;  2XX9 A;  1RDX A;  4PFU A;  4KQP A;  3H6W A;  4YKP A;  2AYS A;  4LZ8 A;  3T9U A;  1EU8 A;  1H3D A;  4MBP A;  1CNQ A;  2RCB A;  2PYY A;  1JP4 A;  4FBP A;  3QMF A;  3B50 A;  3OEN A;  3VLU A;  2R8T A;  3K1P A;  4P56 A;  4MX6 A;  3MJN A;  3MW0 A;  1LB8 A;  5HBC A;  1SD3 A;  3B8B A;  3VXB A;  3CIJ A;  2F36 A;  3KN7 A;  1MXV A;  5EYG A;  2X7P A;  3TMG A;  1R6Z A;  1M5F A;  4PFT A;  5IKB A;  3TOD A;  4PF8 A;  5CMM A;  1WDN A;  3C35 A;  4WEP A;  3PMW A;  2Y7I A;  2HAU A;  5FHO A;  2F97 A;  1EYI A;  2DQV A;  4OFO A;  4U4S A;  1B3G A;  2D21 A;  4OYV A;  5A5X A;  5LDZ A;  2OWT A;  2XXT A;  3M8U A;  1B1H A;  3VVF A;  1IXI A;  1SI0 A;  1B5H A;  1ZTY A;  2UVG A;  5ET8 A;  4GXA A;  1EH3 A;  2QMX A;  1PDA A;  2CZH A;  4G77 A;  4G68 A;  1FPF A;  1B7H A;  4PAK A;  4KYS A;  4EQB A;  2F5X A;  4THI A;  1NFT A;  1MQJ A;  2DE4 A;  1LFI A;  4MF3 A;  3H6V A;  4H46 A;  5I59 B;  4QSD A;  2UXA A;  3I6V A;  1R9Q A;  3MZB A;  4XKQ A;  3FXU A;  2XXR A;  4BDO A;  5ET5 A;  4LQ2 A;  4RPO A;  1T0K A;  1I6B A;  1B3E A;  2Q8M A;  4U1O A;  1UTH B;  4NED A;  2F3D A;  2QFL A;  3N6T A;  4TOZ A;  2WOP A;  1A7L A;  3Q26 A;  2WYP A;  2I3V A;  1FPG A;  4MH5 A;  2HZL A;  3R26 A;  4NTL A;  3VLV A;  5H8N B;  2UYF A;  2XD3 A;  4MHF A;  3T96 B;  1YZ0 A;  1MXX A;  4LP2 B;  1A8E A;  3ZKL A;  3KSX A;  4OET A;  4PFB A;  2F7B A;  3IFA A;  1Y20 A;  4BDM A;  1FSA A;  2NOO A;  5IGA A;  2CEX A;  2QJE A;  2H9B A;  4OFL A;  3O97 A;  4Q0C A;  1L5T A;  1Z7N E;  4MCO A;  4XEQ A;  4PGP A;  2OWZ A;  5IZ3 A;  3S9M C;  2IEE A;  1G0I A;  1Y4T A;  4NX1 A;  1SQY A;  3O29 A;  5IM2 A;  1P1N A;  4N15 A;  4N07 A;  2P0S A;  4GRK A;  2Z8D A;  4AB5 A;  1MQD A;  1F9B A;  1JW4 A;  3PUY E;  1SYI A;  4PBH A;  1SPI A;  3RYD A;  1QJM A;  3GLB A;  3O9P A;  3EF7 A;  1KZ8 A;  3CVG A;  3O66 A;  3LSX A;  1QGX A;  2F6G A;  1LAG E;  4P8B A;  4AB6 A;  3IJX B;  1FTJ A;  1Y3Q A;  4XFE A;  2VP1 A;  3SES A;  4LVQ A;  4QFP A;  1P1U A;  4PFW A;  4RK2 A;  5I2K A;  3IFC A;  1M5C A;  1D4N A;  4MLV A;  3TKD A;  4KR5 A;  5L8D A;  3N6U A;  3JYR A;  1AWB A;  2PFZ A;  4ND9 A;  2M8C A;  1DMB A;  4JSO A;  4YB5 A;  3PPR A;  3E13 X;  2OLB A;  4FIM A;  2VPO A;  2QVV A;  2XWO A;  1VE4 A;  2X26 A;  1US4 A;  3FGS A;  1JVY A;  5F1Q A;  1FQE A;  1NV0 A;  2E1S A;  2YPN A;  5DEX B;  4NF8 A;  2Q9T A;  4ESW A;  1DTZ A;  3V5A A;  3CFZ A;  2F78 A;  3N5L A;  1XVY A;  3W15 C;  3PPP A;  4JDF A;  4OMB A;  5LOM A;  5KCJ B;  2DVZ A;  4U1Z A;  4G8N A;  4JWX A;  4TLM B;  2DWJ A;  1EZO A;  3SEU A;  3LV0 A;  4AQ4 A;  5ICT A;  2VOZ A;  1MQI A;  3AXF A;  2WX9 A;  5AA4 B;  4NF4 B;  3KJT A;  4OQO A;  3C4M A;  1NV6 A;  1I6A A;  4I9D A;  1FBG A;  4U22 A;  3PUW E;  2W7Y A;  4E0X A;  4ELQ A;  3K1M A;  4R2F A;  5ITO A;  5LTC A;  3LUZ A;  4YKJ A;  5H8H A;  1HSL A;  1FTL A;  5H8Q B;  1JW1 A;  2QS2 A;  3MC2 A;  1FQB A;  2BJI A;  2HXR A;  4P1E A;  1H45 A;  5DYH A;  3TPA A;  2ZZX A;  3PD9 A;  1GTK A;  3UA8 A;  4U21 A;  4GX6 A;  1MY1 A;  3VFJ A;  3LVU A;  1Y3P A;  2P3N A;  4ZZE A;  5KDT A;  3KG2 A;  4AS5 A;  2QPQ A;  4O8M A;  3TDJ A;  5F24 A;  1PB9 A;  4XKN A;  2GHB A;  4WXJ A;  2F35 A;  5I7I A;  4GVO A;  2I0B A;  3M3F A;  2KLF A;  5I56 B;  5AA2 D;  1NL5 A;  1URS A;  1A40 A;  1RDY A;  3QSL A;  1FBD A;  3W9W A;  1MM6 A;  3IOV A;  1BTJ A;  2FA7 A;  3LC8 A;  3R6U A;  3S9N C;  1NUW A;  1FPE A;  4F29 A;  1RKM A;  2WBD A;  3MVY A;  5CMK A;  3MVW A;  3MZ1 A;  2FYI A;  4H6D A;  3M3L A;  1GV8 A;  3RPW A;  5I57 A;  3FXR A;  1FPJ A;  1NUZ A;  1AH5 A;  2XXH A;  2A5T A;  2NVU B;  3GYY A;  4NN3 A;  3RQT A;  4YB7 A;  1O63 A;  4NHB A;  2Z23 A;  2FVZ A;  4R73 A;  1JET A;  1MM7 A;  4EQ7 A;  5I58 B;  1B40 A;  1B05 A;  3T9X B;  4DCY A;  4OVT A;  3I5O A;  3MPL A;  3K6U A;  5I2N B;  3OD7 A;  1FQC A;  4DCX A;  4LA9 A;  4RYA A;  1LAX A;  3MZ9 A;  5FTH A;  4ZE8 A;  3DM0 A;  5T3J A;  3RT6 B;  3IB2 A;  1OLC A;  4ONY A;  4YMA A;  2QVU A;  1US5 A;  4EQ9 A;  1B46 A;  4TLL B;  3G3K A;  4NWC A;  4H8J A;  1URG A;  1B3F A;  3CG1 A;  4GD5 A;  5J1D A;  1IMF A;  4HCY A;  3RN8 A;  1Q9D A;  2XXQ A;  2XXU A;  4OZ9 A;  3RGY A;  1D3K A;  1URD A;  1VFD A;  1PBQ A;  1MH4 A;  3DEL B;  4MLQ A;  3FJM A;  1FBC A;  1FTA A;  3TCG A;  2REG A;  1OQG A;  1NV7 A;  1ZMG A;  2UVI A;  3I3V A;  1D9V A;  1FPD A;  4G8H A;  1NNK A;  2O69 A;  3P7I A;  3U65 A;  2OX3 A;  1IIT A;  1IMA A;  1O64 A;  2JJK A;  4HTG A;  4DI3 D;  1A55 A;  2XX7 A;  1AMF A;  3USD A;  3KN8 A;  3BIG A;  3TTR A;  3QK6 A;  3G3J A;  4OES A;  3EQ1 A;  4NE4 A;  3OO9 A;  4H0W A;  4G2Z A;  5TPA B;  1NUY A;  4DZ1 A;  3HN0 A;  5EQA A;  1NV2 A;  1BLF A;  4F3P A;  3IB0 A;  3QIM A;  4O3A A;  3VLW A;  1XHY A;  1UTB B;  1MXU A;  3K1N A;  4ZDM A;  1NKX A;  3PPN A;  1K9Z A;  5CI5 A;  4KCD A;  4M1V A;  3MST A;  4Z0I A;  4YMB A;  1MY4 A;  4HCW A;  1B5J A;  3KC1 A;  3PPO A;  2I49 A;  1N04 A;  1FPI A;  3ILT B;  3PV0 E;  4F31 B;  3WAE A;  3CSG A;  1MS7 A;  4PAI A;  4PBQ A;  3IAZ A;  3GZG A;  1UIV A;  4GLI A;  2PT1 A;  3T0J A;  4IGT A;  3BKI B;  3K0V A;  4N81 A;  3PD8 A;  4P47 A;  4RY1 A;  4C0R A;  2OK2 A;  3U92 A;  3OO6 A;  4X9T A;  2CEY A;  4X04 A;  5H8F B;  1EYK A;  1MY3 A;  3G7W A;  1BKA A;  1OMP A;  3RLF E;  3FD3 A;  3VVD A;  4ELO A;  2DWI A;  5TP9 B;  3DLN A;  1ZKB A;  1LBY A;  4OEU A;  3Q27 A;  1UTH A;  4FEB A;  3VXC A;  1SBP A;  3IOU A;  4PET A;  1N76 A;  1TT1 A;  2CMO A;  1P1O A;  5DVF A;  5M2V A;  5CRY A;  3PU5 A;  1TWY A;  4OEN A;  4XKP A;  4F22 A;  5I84 A;  2QL3 A;  4F19 A;  2IA4 A;  1MXY A;  4H45 A;  1DSN A;  1M5D A;  4DE8 A;  4QSC A;  4OHN A;  3MYU A;  1NV1 A;  3TQL A;  2I6E A;  2XA5 A;  3MPK A;  2Q89 A;  1MQG A;  3U1O A;  3TEL A;  1KA0 A;  4F3B A;  1B3L A;  4ZEB A;  3KC0 A;  4Q8R A;  5CMB A;  2OBG A;  1DPE A;  4PE3 A;  4X1B A;  2DDK A;  3QYT A;  1MXW A;  1B2H A;  4R72 A;  1NV5 A;  3RNN A;  3SER A;  1IXC A;  2VGQ A;  2NUV A;  1EZP A;  1IXG A;  4P3L A;  3IR1 A;  4O7M A;  3MBP A;  5B70 A;  4GQO A;  1GGG A;  4MIJ A;  4FJP A;  1LFG A;  3PTY A;  4F2Q A;  1LBB A;  2F7C A;  1B0L A;  5EHM A;  4OER A;  4POX A;  2CZK A;  1MDP 1;  2F34 A;  5CM6 A;  4LAT A;  2H25 A;  3O2A A;  4BLA A;  3MWB A;  2WOK A;  1QW0 A;  1LB9 A;  3LSL A;  3V83 A;  1XOC A;  5JEI A;  2OCU A;  3DP6 A;  2RC7 A;  4F2O A;  4GWS A;  4X48 A;  2R9J A;  4K3F A;  2DSF A;  3H7M A;  1Q35 A;  2ESN A;  2AL5 A;  4OA4 A;  1H43 A;  3B6Q A;  2I0C A;  3FXQ A;  2XWK A;  3S2V A;  5K2Y A;  1FQF A;  4GF8 A;  2XXX A;  3MP8 A;  3C32 A;  3E79 A;  3ZS6 A;  4OAN A;  4GXS B;  4NF6 A;  2B3F A;  1DK4 A;  3MAM A;  4QFK A;  2ANJ A;  1WOD A;  4NG7 A;  3MVZ A;  2FNC A;  1VR5 A;  1IIW A;  1R9L A;  4G4P A;  3RYA A;  2FHY A;  1YPN A;  5A5X B;  5JTY A;  5DW8 A;  2DYX A;  3IOR A;  4DDD A;  1B9J A;  5KCJ A;  1POY 1;  3PAM A;  2VHA A;  3PMX A;  2I4B A;  1KA1 A;  1JVX A;  3U8Q A;  3KEI A;  2WEF A;  1I69 A;  3SEX A;  3D1R A;  4NF4 A;  1HSJ A;  1QKA A;  3K01 A;  3PUV E;  3TQW A;  2XXW A;  2Y84 A;  2P3V A;  1LEV A;  2UYE A;  3OEK A;  3OEL A;  4KI0 E;  3DRF A;  3E3K A;  5L9O A;  1N7W A;  1FJ9 A;  3BIH A;  4E0W A;  4F1U A;  2GQ1 A;  4GOT A;  4QXD A;  5AA2 A;  5ET6 A;  4YIC A;  3MQ9 A;  1MPB A;  3S9L C;  4P11 A;  5EHS A;  2RC9 A;  1GR2 A;  5TU0 A;  1AOV A;  4HE2 A;  4JBZ A;  3GBB A;  3FJ7 A;  1YTV A;  2Q2C A;  4NGU A;  2QRY A;  4I8C A;  5IZZ A;  1LBX A;  3D4G A;  1B7Z A;  1LBC A;  2DVC A;  3V89 B;  1B6H A;  4O94 A;  4KCC A;  1B58 A;  4LQ5 A;  5CBS A;  4GWX A;  3UN6 A;  1A54 A;  3Q25 A;  3D4C A;  4BDL A;  1LBW A;  4PC9 A;  2Y7K A;  3DP4 A;  3CFX A;  5I56 A;  1MRP A;  3JZJ A;  5AA1 A;  1POT A;  4PFY A;  4GWU A;  4JVD A;  4U23 A;  5K2X A;  4BDR A;  2X7Q A;  3HCQ A;  3EKI A;  3A3U A;  2WBB A;  4EUO A;  5IZ3 B;  2DXR A;  3QUF A;  4WKM A;  4IO4 A;  2PCR A;  1NH7 A;  3T9V A;  4FOR A;  1RYX A;  4MNP A;  3A09 A;  4ELP A;  1IZ1 A;  1TXF A;  2Y5K A;  1B51 A;  2B3B A;  3ZKK A;  1M5B A;  2PBW A;  4GWO A;  3OXN A;  4GWZ A;  2ZNT A;  1NH8 A;  5I2N A;  1QKB A;  4OVJ A;  3G3G A;  4H8I A;  2MKZ A;  4NMY A;  4I3E A;  1ELJ A;  2V4C A;  4WED A;  5ISU A;  1P1W A;  4JSD A;  4H5G A;  2OWS A;  4PAF A;  2H5Y A;  3OO8 A;  4ESX A;  2UVH A;  4H1X A;  1SW4 A;  1J1N A;  4YKI A;  5I2K B;  4KHZ E;  4NF0 A;  3O6G A;  3C36 A;  1DBZ A;  2Y7P A;  4F1V A;  1YYZ A;  4TQU Q;  3SDF A;  1ZU0 A;  2O84 X;  1IME A;  1LST A;  3FIR A;  4FE8 A;  4POW A;  3U93 A;  4Z7E A;  4MMP A;  3K6X A;  5EQ8 A;  3KSJ A;  3H06 B;  3DRI A;  3O28 A;  4EDP A;  3FAT A;  1FQA A;  4MFI A;  3HO7 A;  4OEV A;  4PFR A;  2QSX A;  4FED A;  2ZYN A;  4QFO A;  2DE3 A;  4H67 A;  2PX1 A;  3VV5 A;  1Y1M A;  2PFY A;  3TAJ A;  1QUI A;  4QFL A;  2VPN A;  5KZT A;  2NXO A;  3KOS A;  2V84 A;  5EQ7 A;  2RIN A;  2VD2 A;  2ABH A;  3IK6 B;  3ZSF A;  4X1D A;  1R1N A;  4P1L A;  1I6Q A;  3LBS A;  1SVX B;  2HEU A;  1BK4 A;  1N7X A;  4GWW A;  4OTE A;  4ISU A;  2XXP A;  2Q88 A;  3W9V A;  1UQW A;  1QVS A;  1LGB C;  1MQH A;  2O1L A;  5H8H B;  4PGN A;  2DWA A;  2F6P A;  1FQD A;  1B32 A;  1Y4C A;  2B4L A;  4ZED A;  4LZ7 A;  5DVJ A;  2Z22 A;  4I1D A;  4EF2 A;  1DCU A;  2R6G E;  3VVE A;  4NF5 A;  4ZEI A;  5ET7 A;  1O7T A;  1SW5 A;  5KDT B;  2O7I A;  4Q5T A;  4F18 A;  4PDH A;  1PBP A;  4H65 A;  4YZZ A;  2ONS A;  2CZI A;  4NAP A;  1IXH A;  1YAE A;  1PB7 A;  1B52 A;  4O7I A;  5DTB A;  1FW0 A;  4AS4 A;  4GBV A;  3V8X B;  3JV9 A;  1NNF A;  1P99 A;  1NNP A;  3FZV A;  1JEU A;  3MVX A;  1ZLQ A;  4U2R A;  1OLA A;  3LR1 A;  1FBE A;  2H98 A;  3TCH A;  1XC1 A;  1MY0 A;  2XX8 A;  4IO5 A;  4JWY A;  3SEW A;  1YXI A;  2R71 A;  4DXU A;  4EXK A;  3DP8 A;  4IO3 A;  1N3W A;  3HST A;  2THI A;  4MNI A; 
#chains in the Genus database with same CATH homology
 1JW5 A;  3IL1 B;  4M4G A;  1OVB A;  2RCA A;  4RPN A;  5CMC A;  3HHG A;  1S50 A;  3CR9 A;  4IGR A;  5ITP A;  4N6P A;  5CC2 A;  3RTW B;  2YLN A;  4LUB A;  2AIX A;  4KD5 A;  3KBR A;  2D5W A;  1D9Y A;  3IB1 A;  2V3T A;  3KN3 A;  3PUX E;  2RF1 A;  1QUK A;  4L17 A;  4F39 A;  4BDQ A;  3HHF A;  3C34 A;  2Z8E A;  3QUJ A;  3S9E A;  1N3X A;  1JNF A;  3ODB A;  1QUL A;  1LAH E;  3K6W A;  2GH9 A;  2G29 A;  2XD2 A;  5I59 A;  2OZZ A;  1DOT A;  1WVJ A;  2DS9 A;  4R6H A;  3Q29 A;  1XS5 A;  3TEP A;  4G8M A;  4P0I A;  2O68 A;  4XKR A;  2B4M A;  4KYD A;  4HW8 A;  4RXL A;  3K6V A;  2O1M A;  3U72 A;  2CZL A;  1PEB A;  2Q8J A;  4QFN A;  1Y1Z A;  2REJ A;  3UOR A;  5H8N A;  1LCF A;  3LSW A;  4DXC A;  4EXL A;  3FAS A;  1LLS A;  4IO7 A;  3IOT A;  1BIY A;  1MH3 A;  2DWH A;  4IY5 A;  3IOW A;  4O3C A;  4BDN A;  2PVU A;  1OVT A;  2P2A A;  4O3B A;  4QRZ A;  1H44 A;  3K00 A;  1B4H A;  1FTK A;  1SYH A;  3UP9 A;  2Y7R A;  4Q30 B;  1OQH A;  1N0T A;  2GFE A;  4LZ5 A;  4XIG Q;  4I62 A;  3PUZ E;  4JWO A;  3E4R A;  3C33 A;  3ILU B;  3FVN A;  3H4Z A;  1LFH A;  1MXZ A;  1H76 A;  5FHM A;  2YJP A;  4KFQ A;  3T66 A;  2NWJ A;  5HPQ A;  2WKY A;  3C9H A;  5ELV A;  2UVJ A;  1ATG A;  2Q2A A;  4DLD A;  1YCJ A;  3PMV A;  3T22 A;  3KFM A;  4FEC A;  3DRG A;  4UAC A;  2O7U A;  4PQJ A;  3TTL A;  2XXI A;  4DXB A;  1A99 A;  2BJJ X;  4R75 A;  4UA8 A;  3EHU A;  2ZYK A;  5BWJ A;  4JXI A;  2I58 A;  3EPE A;  2QS3 A;  3SKP A;  1BP5 A;  2GRV A;  2ZYO A;  3IO6 A;  2Y7W A;  2ZYM A;  3RT8 A;  2HAV A;  1USY E;  1CB6 A;  5HM4 B;  3B6W A;  3FTO A;  1SI1 A;  2VD3 A;  3MUQ A;  3K02 A;  3GBA A;  4EF1 A;  1ANF A;  3SEV A;  3DRJ A;  2V3U A;  5DEX A;  4R9G A;  3FV2 A;  4OXV A;  1FTM A;  2QMW A;  3TTN A;  3RUM A;  3MP1 A;  3IX1 A;  2HZK A;  2PMS A;  1N84 A;  2PT2 A;  3CFL A;  3DRH A;  5CBR A;  4F3G A;  3EHT A;  1VFE A;  3B7D A;  3G3H A;  4JB7 A;  1AL3 A;  3FUZ A;  1LCT A;  4RA1 A;  5AA4 A;  3KZG A;  4YAH X;  3H03 A;  4G68 B;  3O6H A;  4ZZA A;  4OWD A;  1II5 A;  3FVK A;  3H6U A;  3BFU A;  3FJG A;  4GL0 A;  2O51 A;  3VE1 B;  5ICQ A;  1DPP A;  4H5F A;  3TFL A;  3TYH A;  2HFB A;  4N13 A;  4GIZ A;  3EHS A;  5H8Q A;  3IJO B;  2P1S A;  2ONR A;  5DVI A;  1EZ9 A;  1LAF E;  3CRB A;  3LSF B;  3T93 B;  5FHN A;  1M5E A;  4YB6 A;  4RNS A;  1B0H A;  3L6G A;  4ZS9 A;  4GL8 A;  3FVO A;  3ONM A;  3RYB A;  2V25 A;  3OSQ A;  5EYF A;  4ECF A;  3SEY A;  3T9H B;  1PB8 A;  1B3H A;  3KJ7 A;  2ZXT A;  2ALU A;  2RC8 A;  1Y9U A;  4NF6 B;  3PPQ A;  3U94 A;  3FVG A;  2DP8 A;  4P0G A;  1JQF A;  3FV1 A;  1KWH A;  2HCA A;  2ZNS A;  3TTK A;  1IEJ A;  3OOA A;  1CE2 A;  2WOL A;  4YU0 A;  1NNT A;  3PGF A;  4R6K A;  4GFR A;  1RYO A;  5JTY B;  3CI8 A;  2B65 A;  3HV1 A;  3O6I A;  1S9T A;  4R2B A;  4IY6 A;  3M3K A;  4LON B;  4NWD A;  3S4U A;  1NMU A;  4IO6 A;  3H3G A;  5I58 A;  3G3F A;  2XXY A;  2DXY A;  1MDQ A;  1A8F A;  2ZMB A;  1B1X A;  1PC3 A;  2H4I A;  3G3I A;  1QUJ A;  2AL4 A;  2ZNU A;  4YKK A;  3B6T A;  1TFA A;  3RY3 A;  5AA2 B;  5IAI A;  4R74 A;  1GVC A;  4R9F A;  3QXM A;  3SET A;  4DIG A;  1S7Y A;  3O6P A;  2G93 A;  1DTG A;  3RTF B;  4QHQ A;  1XVX A;  4QF9 A;  1MY2 A;  1HSE A;  3F11 A;  3KOT A;  3TTM A;  1OIB A;  4IO2 A;  1Z7M E;  5B7D A;  3QAX A;  2F7A A;  1IUD A;  4NF8 B;  1TFD A;  4QSE A;  3C31 A;  2I3W A;  5F7V A;  5H8S A;  2D3I A;  4OFJ A;  2I4C A;  2QS4 A;  1SDX A;  4ZEC A;  5TPA A;  1B5I A;  3GXA A;  3DRK A;  4PE5 B;  1UTB A;  4R6Y A;  3N26 A;  5JK4 A;  5FTI A;  4FAJ A;  1FTO A;  3N94 A;  4G68 C;  3UIF A;  1VSO A;  1Q1K A;  4HS7 A;  1B7U A;  3TZA A;  4IB2 A;  3WAF A;  3BFT A;  2Z8F A;  2ONK E;  4KPT A;  3UGW A;  1XT8 A;  2HXW A;  3OO7 A;  2DOJ A;  2LAO A;  1SW1 A;  3OSR A;  1MPC A;  4XXU A;  3Q28 A;  4U4X A;  3E9X A;  1ZIU A;  1Y3N A;  3H6T A;  3K4U A;  3KGC A;  5H8F A;  4C1T A;  1AIV A;  1USY H;  4ZE9 A;  2GHA A;  5L9S A;  3ECR A;  1SW2 A;  2XXV A;  5TP9 A;  3VDF A;  2E0S A;  4ZEK A;  3A3C A;  3OEM A;  3LUY A;  4C1U A;  1FCK A;  4KYE A;  2OJT A;  2QS1 A;  3MP6 A;  2V3Q A;  3K2D A;  1MPD A;  5I57 B;  3UK4 A;  1P1Q A;  2A5T B;  3CG3 A;  2H99 A;  1ZJL A;  3EN3 A;  4RJZ A;  3IO4 A;  2A5S A;  3OMB A;  1MG1 A;  2O6A A;  3TUS A;  3TCF A;  2XHD A;  3CHG A;  3HPI A;  4XTC Q;  5AA3 A;  1ZBM A;  5L9M A;  4ZEF A;  3CSB A;  5BUU A;  2V93 A;  4ELR A;  4F1Y A;  2RKM A;  1B4Z A;  1JEV A;  2I48 A;  4PP0 A;  4FAT A;  2F8D A;  3BBR A;  3R7X A;  5AE4 A;  3L6H A;  1UIU A;  4NF5 B;  4RK9 A;  3THI A;  2HQ0 A;  4F3S A;  1IQ7 A;  5DT6 A;  2DE2 A;  2XX9 A;  4PFU A;  4KQP A;  3H6W A;  4YKP A;  2AYS A;  4LZ8 A;  3T9U A;  1EU8 A;  1H3D A;  4MBP A;  2RCB A;  2PYY A;  3OEN A;  3VLU A;  3K1P A;  3MJN A;  3MW0 A;  1LB8 A;  5HBC A;  1SD3 A;  3VXB A;  3CIJ A;  2F36 A;  3KN7 A;  1MXV A;  2X7P A;  3TMG A;  1R6Z A;  1M5F A;  4PFT A;  5IKB A;  3TOD A;  5CMM A;  1WDN A;  3C35 A;  4WEP A;  3PMW A;  2Y7I A;  2HAU A;  5FHO A;  2F97 A;  2DQV A;  4OFO A;  4U4S A;  1B3G A;  2D21 A;  4OYV A;  5A5X A;  2OWT A;  2XXT A;  3M8U A;  1B1H A;  3VVF A;  1IXI A;  1SI0 A;  1B5H A;  1ZTY A;  2UVG A;  4GXA A;  1EH3 A;  2QMX A;  1PDA A;  4G77 A;  4G68 A;  1B7H A;  4KYS A;  4EQB A;  2F5X A;  4THI A;  1NFT A;  1MQJ A;  2DE4 A;  1LFI A;  4MF3 A;  3H6V A;  5I59 B;  4QSD A;  2UXA A;  3I6V A;  1R9Q A;  3MZB A;  4XKQ A;  3FXU A;  2XXR A;  4BDO A;  4LQ2 A;  4RPO A;  1T0K A;  1I6B A;  1B3E A;  4U1O A;  1UTH B;  4NED A;  3N6T A;  4TOZ A;  2WOP A;  1A7L A;  3Q26 A;  2I3V A;  4MH5 A;  2HZL A;  3R26 A;  4NTL A;  3VLV A;  5H8N B;  2UYF A;  2XD3 A;  3T96 B;  1MXX A;  4LP2 B;  1A8E A;  3ZKL A;  3KSX A;  4OET A;  2F7B A;  1Y20 A;  4BDM A;  2NOO A;  2QJE A;  2H9B A;  4OFL A;  3O97 A;  4Q0C A;  1L5T A;  1Z7N E;  3S9M C;  2IEE A;  1Y4T A;  1SQY A;  3O29 A;  1P1N A;  4N07 A;  2P0S A;  4GRK A;  2Z8D A;  4AB5 A;  1MQD A;  1F9B A;  1JW4 A;  3PUY E;  1SYI A;  1QJM A;  3GLB A;  3O9P A;  3EF7 A;  3CVG A;  3O66 A;  3LSX A;  2F6G A;  1LAG E;  4AB6 A;  3IJX B;  1FTJ A;  1Y3Q A;  2VP1 A;  3SES A;  4LVQ A;  4QFP A;  1P1U A;  4PFW A;  4RK2 A;  5I2K A;  1M5C A;  1D4N A;  4MLV A;  3TKD A;  4KR5 A;  5L8D A;  3N6U A;  3JYR A;  4ND9 A;  2M8C A;  1DMB A;  4JSO A;  4YB5 A;  3PPR A;  3E13 X;  2OLB A;  4FIM A;  1VE4 A;  2X26 A;  1US4 A;  3FGS A;  1JVY A;  5F1Q A;  1FQE A;  2E1S A;  2YPN A;  5DEX B;  4NF8 A;  2Q9T A;  4ESW A;  1DTZ A;  3V5A A;  3CFZ A;  2F78 A;  3N5L A;  1XVY A;  3W15 C;  3PPP A;  4JDF A;  4OMB A;  5LOM A;  5KCJ B;  2DVZ A;  4U1Z A;  4G8N A;  4JWX A;  4TLM B;  2DWJ A;  1EZO A;  3SEU A;  4AQ4 A;  5ICT A;  2VOZ A;  1MQI A;  3AXF A;  5AA4 B;  4NF4 B;  3KJT A;  4OQO A;  3C4M A;  1I6A A;  4I9D A;  4U22 A;  3PUW E;  2W7Y A;  4E0X A;  4ELQ A;  3K1M A;  4R2F A;  5ITO A;  4YKJ A;  5H8H A;  1HSL A;  1FTL A;  5H8Q B;  1JW1 A;  2QS2 A;  3MC2 A;  1FQB A;  1H45 A;  5DYH A;  3TPA A;  3PD9 A;  1GTK A;  3UA8 A;  4U21 A;  1MY1 A;  3VFJ A;  3LVU A;  1Y3P A;  5KDT A;  4ZZE A;  3KG2 A;  2QPQ A;  3TDJ A;  1PB9 A;  4XKN A;  2GHB A;  4WXJ A;  2F35 A;  4GVO A;  2I0B A;  3M3F A;  2KLF A;  5I56 B;  5AA2 D;  1NL5 A;  1URS A;  1A40 A;  3QSL A;  3W9W A;  1MM6 A;  3IOV A;  1BTJ A;  2FA7 A;  3LC8 A;  3R6U A;  3S9N C;  4F29 A;  1RKM A;  3MVY A;  5CMK A;  3MVW A;  3MZ1 A;  2FYI A;  4H6D A;  3M3L A;  1GV8 A;  3RPW A;  5I57 A;  3FXR A;  1AH5 A;  2XXH A;  2A5T A;  2NVU B;  3RQT A;  4YB7 A;  1O63 A;  2Z23 A;  4R73 A;  1JET A;  1MM7 A;  4EQ7 A;  5I58 B;  1B40 A;  1B05 A;  3T9X B;  4DCY A;  3I5O A;  3MPL A;  3K6U A;  5I2N B;  3OD7 A;  1FQC A;  4DCX A;  4LA9 A;  4RYA A;  1LAX A;  3MZ9 A;  5FTH A;  4ZE8 A;  3DM0 A;  3RT6 B;  3IB2 A;  1OLC A;  4ONY A;  4YMA A;  1US5 A;  4EQ9 A;  1B46 A;  4TLL B;  3G3K A;  4NWC A;  4H8J A;  1URG A;  1B3F A;  3CG1 A;  4GD5 A;  5J1D A;  4HCY A;  3RN8 A;  2XXQ A;  2XXU A;  4OZ9 A;  3RGY A;  1D3K A;  1URD A;  1VFD A;  1PBQ A;  1MH4 A;  3DEL B;  4MLQ A;  3FJM A;  3TCG A;  2REG A;  1OQG A;  2UVI A;  1ZMG A;  3I3V A;  1D9V A;  4G8H A;  1NNK A;  2O69 A;  3P7I A;  1IIT A;  1O64 A;  4HTG A;  1A55 A;  2XX7 A;  1AMF A;  3USD A;  3KN8 A;  3TTR A;  3QK6 A;  3G3J A;  4OES A;  3EQ1 A;  4NE4 A;  3OO9 A;  4H0W A;  4G2Z A;  5TPA B;  4DZ1 A;  3HN0 A;  1BLF A;  4F3P A;  3IB0 A;  3QIM A;  4O3A A;  3VLW A;  1XHY A;  1UTB B;  1MXU A;  3K1N A;  4ZDM A;  1NKX A;  3PPN A;  5CI5 A;  4KCD A;  4M1V A;  4Z0I A;  4YMB A;  1MY4 A;  4HCW A;  1B5J A;  3PPO A;  2I49 A;  1N04 A;  3ILT B;  3PV0 E;  4F31 B;  3WAE A;  3CSG A;  1MS7 A;  3IAZ A;  3GZG A;  1UIV A;  4GLI A;  2PT1 A;  4IGT A;  3BKI B;  3K0V A;  3PD8 A;  4RY1 A;  4C0R A;  2OK2 A;  3U92 A;  3OO6 A;  4X9T A;  5H8F B;  1MY3 A;  3G7W A;  1BKA A;  1OMP A;  3RLF E;  3FD3 A;  3VVD A;  4ELO A;  2DWI A;  5TP9 B;  3DLN A;  1ZKB A;  4OEU A;  3Q27 A;  1UTH A;  4FEB A;  3VXC A;  1SBP A;  3IOU A;  4PET A;  1N76 A;  1TT1 A;  2CMO A;  1P1O A;  5DVF A;  5M2V A;  5CRY A;  3PU5 A;  1TWY A;  4OEN A;  4XKP A;  4F22 A;  5I84 A;  2QL3 A;  4F19 A;  2IA4 A;  1MXY A;  1DSN A;  1M5D A;  4DE8 A;  4QSC A;  4OHN A;  3TQL A;  2I6E A;  3MPK A;  2Q89 A;  1MQG A;  3U1O A;  3TEL A;  4F3B A;  1B3L A;  4ZEB A;  4Q8R A;  5CMB A;  2OBG A;  1DPE A;  4X1B A;  3QYT A;  1MXW A;  1B2H A;  4R72 A;  3RNN A;  3SER A;  1IXC A;  2VGQ A;  2NUV A;  1EZP A;  1IXG A;  3IR1 A;  3MBP A;  5B70 A;  4GQO A;  1GGG A;  4FJP A;  1LFG A;  4F2Q A;  1LBB A;  2F7C A;  1B0L A;  5EHM A;  4OER A;  4POX A;  1MDP 1;  2F34 A;  5CM6 A;  4LAT A;  2H25 A;  3O2A A;  4BLA A;  3MWB A;  2WOK A;  1QW0 A;  1LB9 A;  3LSL A;  3V83 A;  1XOC A;  5JEI A;  2OCU A;  3DP6 A;  2RC7 A;  4F2O A;  4X48 A;  2R9J A;  4K3F A;  2DSF A;  3H7M A;  1Q35 A;  2ESN A;  2AL5 A;  1H43 A;  3B6Q A;  2I0C A;  3FXQ A;  3S2V A;  5K2Y A;  1FQF A;  4GF8 A;  2XXX A;  3MP8 A;  3C32 A;  3ZS6 A;  4GXS B;  4NF6 A;  2B3F A;  3MAM A;  4QFK A;  2ANJ A;  1WOD A;  3MVZ A;  2FNC A;  1VR5 A;  1IIW A;  1R9L A;  4G4P A;  3RYA A;  1YPN A;  5A5X B;  5JTY A;  2DYX A;  3IOR A;  4DDD A;  1B9J A;  5KCJ A;  1POY 1;  3PAM A;  2VHA A;  3PMX A;  2I4B A;  1JVX A;  3U8Q A;  3KEI A;  1I69 A;  3SEX A;  4NF4 A;  1HSJ A;  1QKA A;  3K01 A;  3PUV E;  3TQW A;  2XXW A;  2Y84 A;  2UYE A;  3OEK A;  3OEL A;  4KI0 E;  3DRF A;  3E3K A;  5L9O A;  1N7W A;  4E0W A;  4F1U A;  4GOT A;  5AA2 A;  4YIC A;  3MQ9 A;  1MPB A;  3S9L C;  4P11 A;  5EHS A;  2RC9 A;  1GR2 A;  5TU0 A;  1AOV A;  4JBZ A;  3GBB A;  3FJ7 A;  1YTV A;  2Q2C A;  2QRY A;  4I8C A;  3D4G A;  1B7Z A;  1LBC A;  2DVC A;  3V89 B;  1B6H A;  4KCC A;  1B58 A;  4LQ5 A;  5CBS A;  3UN6 A;  1A54 A;  3Q25 A;  3D4C A;  4BDL A;  2Y7K A;  3DP4 A;  3CFX A;  5I56 A;  1MRP A;  3JZJ A;  5AA1 A;  1POT A;  4PFY A;  4U23 A;  5K2X A;  4BDR A;  2X7Q A;  3HCQ A;  3A3U A;  4EUO A;  2DXR A;  3QUF A;  4WKM A;  4IO4 A;  1NH7 A;  3T9V A;  4FOR A;  1RYX A;  3A09 A;  4ELP A;  1IZ1 A;  1TXF A;  1B51 A;  2B3B A;  3ZKK A;  1M5B A;  2PBW A;  4GWO A;  3OXN A;  2ZNT A;  1NH8 A;  5I2N A;  1QKB A;  4OVJ A;  3G3G A;  4H8I A;  4NMY A;  1ELJ A;  4WED A;  5ISU A;  1P1W A;  4JSD A;  4H5G A;  2OWS A;  2H5Y A;  3OO8 A;  4ESX A;  2UVH A;  4H1X A;  1SW4 A;  1J1N A;  4YKI A;  5I2K B;  4KHZ E;  3O6G A;  3C36 A;  2Y7P A;  4F1V A;  4TQU Q;  3SDF A;  1ZU0 A;  2O84 X;  1LST A;  3FIR A;  4FE8 A;  4POW A;  3U93 A;  4Z7E A;  3K6X A;  3KSJ A;  3H06 B;  3DRI A;  3O28 A;  4EDP A;  3FAT A;  1FQA A;  4MFI A;  3HO7 A;  4OEV A;  2QSX A;  4FED A;  2ZYN A;  4QFO A;  2DE3 A;  4H67 A;  2PX1 A;  3VV5 A;  1Y1M A;  3TAJ A;  1QUI A;  4QFL A;  5KZT A;  2NXO A;  3KOS A;  2V84 A;  2RIN A;  2VD2 A;  2ABH A;  3IK6 B;  3ZSF A;  4X1D A;  1R1N A;  1I6Q A;  3LBS A;  1SVX B;  2HEU A;  1N7X A;  4OTE A;  4ISU A;  2XXP A;  2Q88 A;  3W9V A;  1UQW A;  1QVS A;  1LGB C;  1MQH A;  2O1L A;  5H8H B;  2DWA A;  2F6P A;  1FQD A;  1B32 A;  1Y4C A;  2B4L A;  4ZED A;  4LZ7 A;  5DVJ A;  2Z22 A;  4I1D A;  4EF2 A;  2R6G E;  3VVE A;  4NF5 A;  4ZEI A;  1O7T A;  1SW5 A;  5KDT B;  2O7I A;  4Q5T A;  4F18 A;  1PBP A;  4H65 A;  4YZZ A;  2ONS A;  1IXH A;  1YAE A;  1PB7 A;  1B52 A;  5DTB A;  1FW0 A;  3V8X B;  3JV9 A;  1NNF A;  1P99 A;  1NNP A;  3FZV A;  1JEU A;  3MVX A;  1ZLQ A;  4U2R A;  1OLA A;  3LR1 A;  2H98 A;  3TCH A;  1XC1 A;  1MY0 A;  2XX8 A;  4IO5 A;  4JWY A;  3SEW A;  2R71 A;  4DXU A;  4EXK A;  3DP8 A;  4IO3 A;  1N3W A;  3HST A;  2THI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...