1B6HA

Oligo-peptide binding protein complexed with lysyl-norvalyl-lysine
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGO-PEPTIDE BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 193
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b6hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b6hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b6hA02
5EHMA 1Y1MA 4MF3A 4LA9A 3DRJA 1A55A 4OFJA 4YMBA 4NWDA 5DVIA 1AMFA 3PV0E 3PUWE 3P7IA 4F22A 4F3SA 1H3DA 3DP6A 3SESA 3MJNA 5DYHA 2HXWA 4F3PA 2QSXA 3FJGA 1MRPA 4YKKA 3U93A 2QS1A 3R7XA 5CC2A 4OZ9A 3TQWA 4E0XA 3FXRA 5I2KA 4ZZAA 4G77A 3QK6A 1N04A 3OSRA 3B6WA 2P1SA 1JEUA 2OLBA 3KEIA 4F31B 3DRHA 2ZMBA 1MXYA 1DTZA 4R74A 2IEEA 2WOKA 4DIGA 4YAHX 3GBBA 1SYHA 2M8CA 5TPAB 2PMSA 3MQ9A 4EDPA 4DXUA 3PMXA 4JXIA 5H8NB 5AA4B 3LVUA 2DSFA 1XVXA 3MP1A 3Q26A 5HM4B 1P1QA 3EPEA 3N94A 3RTWB 1ZKBA 3K6VA 1Y9UA 4WEDA 4I8CA 1EZ9A 1PBPA 1QULA 1OLAA 2VP1A 1T0KA 4PFTA 4QFNA 2V25A 4OETA 1P1NA 3G3FA 5ELVA 2Y7PA 3GXAA 3KN8A 2HCAA 2ZYKA 5EHSA 2F6GA 1DTGA 2I48A 3S9LC 1H43A 3QAXA 5L9SA 5DEXA 2F35A 3E4RA 3OO6A 4JSOA 3OEMA 3OEKA 1P1WA 4JDFA 4AB5A 4BDRA 1HSEA 2D21A 4BDOA 2AIXA 4YB5A 4OHNA 3QUJA 3N5LA 1N7WA 5BUUA 3MP6A 1FW0A 3QIMA 1BP5A 4Q8RA 4ZE8A 2I4CA 4OVJA 3CR9A 4POXA 2I49A 4GL8A 4LQ2A 1P1OA 2ONKE 3VLUA 4KR5A 1N0TA 3M3KA 3LR1A 2V3QA 5AA1A 4ZDMA 5M2VA 3I3VA 1D9VA 4OESA 4U1ZA 3SEWA 4JSDA 3ZSFA 2GFEA 1PB8A 1QVSA 1NKXA 1DMBA 1MPBA 2PT1A 2NVUB 3E9XA 2O68A 1N76A 1Y4CA 5JTYB 1FQBA 1B1HA 3H06B 1B7UA 4F18A 4BDLA 4ZEKA 2QS4A 2P0SA 2VGQA 5DT6A 3MBPA 2B65A 2A5TB 1JNFA 1IXIA 2B4MA 4GXSB 1WODA 2WOLA 1IITA 5TP9A 4XKRA 5ISUA 4G8MA 3VVDA 3UK4A 3G3JA 3OOAA 1JEVA 4H5FA 2F34A 3FV1A 3MVZA 2XX7A 3MP8A 3CI8A 3G3KA 3A3UA 3TQLA 3T22A 1B51A 3RQTA 3PPQA 2FYIA 3C9HA 2H99A 3TKDA 5CMCA 3H6VA 3VDFA 1S7YA 3H6TA 2UYFA 3IOVA 2LAOA 3RYBA 4H1XA 1TXFA 4LZ5A 2OBGA 4F2QA 3N26A 4R9GA 2Y7WA 4PQJA 3TDJA 1D4NA 4YMAA 4ZEBA 3QUFA 4NF8B 4QFOA 3KSJA 1M5FA 4H8IA 3K00A 4GL0A 4OTEA 4Q5TA 3SEYA 4MLVA 3C36A 3FVNA 4XKPA 2F36A 2Q9TA 3RNNA 4DXBA 2Y84A 3O29A 3OO9A 1GVCA 5H8FB 1ATGA 3IAZA 5ICQA 1JVXA 1B3HA 1EZPA 3RPWA 3MZ9A 3PAMA 5L9OA 4I9DA 4H5GA 1PC3A 2QRYA 4R72A 2XXTA 3H4ZA 2XD2A 3PD9A 4EF2A 5A5XA 4X9TA 3VV5A 2VOZA 2HAUA 1IUDA 5L9MA 5IKBA 5AA2A 3K6XA 3PUZE 2IA4A 2AL4A 1DSNA 3BFUA 4GD5A 3S9EA 4X1BA 4OENA 4IGTA 3CFLA 3CRBA 4IO4A 5I2NA 3LC8A 1RKMA 2VD3A 4LZ8A 1R9QA 3VXBA 4RPOA 3DLNA 3JYRA 2DQVA 2XHDA 2X7PA 1MY3A 1FTOA 3LUYA 4YKIA 3T96B 5I57A 5FHMA 1TFDA 1B5HA 5AA2D 4LVQA 3TPAA 3USDA 4RK9A 4PFWA 2QPQA 3PPNA 4MFIA 1IXGA 3EF7A 5EYFA 4EF1A 1POY1 3K6WA 1II5A 1B7ZA 4IY6A 2NOOA 3RT6B 1MDQA 4Z7EA 2V93A 3IX1A 4ESXA 3KJ7A 4P11A 2NWJA 3RTFB 2ALUA 4X48A 4R6HA 1LB8A 3MVYA 1SW4A 2I6EA 2QS3A 1JETA 4OERA 5K2YA 2O6AA 5L8DA 3TFLA 4KQPA 3E3KA 3MZ1A 4BDNA 3ONMA 3Q27A 5I56A 1IQ7A 3K0VA 3K02A 4GWOA 2RF1A 1UTHB 2O1LA 2CMOA 5FTHA 4U1OA 3ZS6A 1N84A 3T66A 1B05A 1NNPA 3TTNA 2R71A 3FZVA 5H8SA 5I58B 3IJXB 3TODA 1NMUA 3DRFA 1MH3A 4TOZA 4H8JA 1LBCA 2Q89A 3MC2A 3T9XB 4RY1A 1SQYA 3UP9A 2O7UA 2XXPA 2YPNA 3K4UA 1USYH 1Q1KA 4L17A 3HO7A 1B4ZA 3CHGA 2ZNTA 5HBCA 2H4IA 2DXYA 3FD3A 1L5TA 4FE8A 4ZE9A 3UN6A 3O6IA 2DE3A 2O1MA 4ZS9A 2H98A 3KSXA 4XTCQ 5FTIA 2Y7IA 5KDTB 1CB6A 1GR2A 3IB0A 3C32A 3HV1A 4O3AA 3L6HA 2E0SA 4KPTA 4HW8A 1VFEA 2YJPA 5ITOA 4QFLA 2ZNUA 3KGCA 1LLSA 4FATA 3R6UA 3V83A 1F9BA 4R75A 4IB2A 3TCGA 1H45A 3GZGA 4C0RA 3D4GA 5H8QA 1J1NA 1MM7A 1ZLQA 2DVCA 1SW2A 4NF6B 1QJMA 4YU0A 4LONB 5I59B 1MY4A 4M1VA 1BTJA 4JWYA 4EQBA 3KN3A 1I6QA 4ZEFA 3JV9A 3S9MC 1B6HA 2DYXA 3C35A 1YCJA 2Q8JA 4ELRA 2I0BA 5CRYA 1P99A 2VD2A 5F7VA 5HPQA 3G3HA 1UTBB 4OMBA 4AB6A 1FQAA 1HSJA 3UORA 1ZMGA 3TTRA 2O84X 1M5DA 3BBRA 2V3TA 1MY2A 1N3XA 2NUVA 3FXQA 5K2XA 3FJMA 4KYEA 2DOJA 3CVGA 3ILUB 3K1PA 5B70A 3T9HB 1QUJA 2AYSA 2FNCA 1LAHE 2THIA 3DRGA 4EQ7A 4QHQA 3VXCA 5TP9B 2RC7A 1YAEA 2V84A 4OEVA 3LSXA 4DXCA 3IB2A 1NH7A 3DP4A 3A3CA 3IOTA 4THIA 1LFGA 5KZTA 4NE4A 1LSTA 4IO3A 4GFRA 1MXWA 1QUIA 4EXKA 2DWIA 2QJEA 3O97A 1DPPA 3VFJA 3AXFA 2H9BA 4IO5A 1LBBA 3FVGA 1SI1A 5CI5A 3C31A 2XXUA 3FVKA 3RGYA 1R1NA 4NWCA 5KCJB 4POWA 2ZYNA 5JEIA 2O7IA 3HCQA 5TPAA 1PEBA 3IR1A 4QSEA 1NNTA 4NF5B 4GIZA 3QXMA 1VFDA 5H8NA 1TWYA 5AA4A 2AL5A 1D3KA 3MUQA 1B5JA 1MM6A 3RLFE 4Q0CA 1GTKA 1TT1A 1Y3QA 3Q28A 1Z7ME 1NNKA 1RYXA 1A40A 3S9NC 2UXAA 1O63A 2I58A 1Q35A 4DCYA 3B7DA 4R6YA 2B4LA 3EQ1A 2DWJA 4IO6A 3D4CA 3FUZA 4KCDA 1QW0A 3Q25A 1A8FA 4WKMA 4YB6A 2G93A 3KFMA 1LCFA 2OCUA 5H8HB 1B3EA 3UA8A 1UIUA 3MPKA 2QL3A 1KWHA 1MQJA 3W9VA 1B46A 1IIWA 4G8HA 3KJTA 4YICA 3VLWA 1BIYA 1LGBC 1FQFA 2FA7A 4O3BA 1Y4TA 1B9JA 2I0CA 1NNFA 3FIRA 3U92A 4R73A 3IK6B 2XXQA 3H6WA 3C33A 3IL1B 1EU8A 1MXXA 3ECRA 3DP8A 2XXYA 3EHUA 4ECFA 4ELPA 2R9JA 1MH4A 4OYVA 1LFIA 4KFQA 2CZLA 4G68C 1YPNA 4XKQA 4YKJA 1AIVA 4OEUA 4ZECA 2YLNA 3CSGA 1XVYA 3WAEA 3FASA 1H44A 4U21A 5ICTA 3RY3A 4P0IA 4N6PA 4I62A 5JTYA 3DELB 4FAJA 2UVHA 1FTJA 1PDAA 1EZOA 4QSDA 1ZIUA 3TELA 3OELA 4TLLB 2DWHA 3O66A 5CMMA 2UYEA 4C1UA 3M8UA 2X7QA 3SETA 2A5TA 4RNSA 4OQOA 3UIFA 1ZBMA 4NTLA 3RT8A 1EH3A 4G4PA 4F19A 2ONRA 4XIGQ 3PPOA 1SW1A 2GHBA 2H25A 4G68B 1MXZA 1NH8A 1O7TA 1JVYA 3OENA 4Q30B 2I3WA 3TCFA 4R6KA 1I6BA 2F7BA 1MS7A 1B40A 4H0WA 2R6GE 4KCCA 5JK4A 4ZEIA 3GBAA 3H3GA 3DRKA 3UGWA 1B58A 1OIBA 1OVTA 1MPDA 4ISUA 4KHZE 4R2FA 4P0GA 2Z8FA 3T9VA 1BLFA 1QKAA 4ND9A 3E13X 1AL3A 4NF8A 4ESWA 3K1NA 1Y3PA 1Y20A 1ZJLA 3TZAA 4HS7A 3M3FA 3IO6A 3IOWA 1MDP1 5CMBA 5I2KB 2PVUA 1CE2A 4TQUQ 1N3WA 4NMYA 1XS5A 4I1DA 1WDNA 3O6PA 3W9WA 2ESNA 4TLMB 2HFBA 4G8NA 3T9UA 3N6UA 3W15C 3KOSA 3PMWA 1MG1A 1ZTYA 4RK2A 3FJ7A 4NF4A 3V8XB 4F3BA 3B6TA 1B3FA 1BKAA 4DDDA 3K2DA 1MQDA 3V5AA 2X26A 4XXUA 3HPIA 3DRIA 5TU0A 3C34A 2VHAA 1XC1A 3K01A 5DTBA 3H6UA 2P2AA 2HZLA 2I3VA 1FCKA 1B52A 1UIVA 4KD5A 4PP0A 1B2HA 1NFTA 2Z8EA 4KYSA 4EXLA 4YB7A 4NEDA 4F3GA 3PUYE 5IAIA 4LQ5A 3FVOA 3F11A 4RXLA 2GH9A 3HHFA 4F1UA 2HEUA 3PPRA 5CBSA 2DWAA 3RUMA 3FTOA 3EN3A 5DEXB 1URDA 4N07A 1FTMA 4RYAA 2Q2AA 3N6TA 3SEUA 4OXVA 1LB9A 3H03A 1OQHA 1Z7NE 4RA1A 3O9PA 2XXIA 3MAMA 2PYYA 3LSFB 3QYTA 2D5WA 2XX9A 4RJZA 1SW5A 2Q2CA 1XHYA 1IXHA 5DVJA 4JWXA 3CSBA 2O51A 5FHNA 1SD3A 1MQIA 3ODBA 1S9TA 3U72A 2XXWA 4DLDA 2OWSA 3HHGA 1YTVA 2DP8A 2QMWA 3H7MA 3VVEA 5BWJA 1UTHA 2H5YA 1QUKA 1IEJA 1VSOA 2RC8A 2F97A 3M3LA 1LCTA 4FEDA 3MVXA 4Z0IA 3SKPA 3BKIB 1URSA 2XD3A 1A99A 4H6DA 4U4SA 5I58A 3U94A 3KG2A 1FQDA 2Y7RA 2XX8A 4QRZA 1USYE 3PGFA 1MQGA 1VR5A 4BDQA 4GQOA 4U2RA 3VE1B 2F7CA 2WOPA 4FEBA 1B3LA 2DE4A 2RC9A 3WAFA 1SYIA 3CG3A 2UVGA 3SEVA 5AA3A 2DVZA 4F39A 3FATA 3OO8A 5ITPA 3I5OA 1ANFA 2OZZA 2XXRA 3DM0A 5KDTA 1VE4A 3R26A 1JW5A 2KLFA 1PB7A 3LSLA 1N7XA 4GLIA 2REJA 5I84A 2QMXA 2Z8DA 2F6PA 3K6UA 1LAFE 3PUVE 3CFZA 1MY1A 1LFHA 4QFPA 2F78A 3IOUA 2HQ0A 4G2ZA 1B5IA 4PFYA 4NF6A 2REGA 3SEXA 3KOTA 3S4UA 1P1UA 5I59A 2V3UA 4MBPA 1B0LA 3TTMA 5CMKA 5CM6A 1JW4A 4C1TA 1A8EA 1B32A 4HTGA 1FQCA 2OK2A 4LATA 2D3IA 5B7DA 1PBQA 2UVIA 1NL5A 3PD8A 1Y3NA 4RPNA 2PX1A 2DS9A 3IB1A 3TTKA 4U23A 1UTBA 4PE5B 3TUSA 3GLBA 3O6GA 5J1DA 3TMGA 4FIMA 2ONSA 2ZYMA 1B4HA 4KYDA 4ELQA 1B0HA 3KZGA 5A5XB 4R2BA 3JZJA 3IORA 2WKYA 3U8QA 4F29A 5AA2B 5F1QA 4DE8A 2OJTA 2GRVA 4X1DA 2OWTA 4JWOA 3SDFA 2RCAA 4EUOA 4F1YA 4U4XA 1A54A 2XXVA 3EHSA 3PU5A 4QFKA 3CG1A 2DE2A 2XXXA 1MY0A 4WXJA 1DOTA 2Y7KA 2ZYOA 5I2NB 1URGA 2B3BA 1JW1A 3O6HA 1B3GA 3O2AA 4FECA 1D9YA 5DVFA 3O28A 5I57B 4LZ7A 4ELOA 3ZKKA 3MPLA 4U22A 4EQ9A 1XT8A 2ANJA 3HN0A 2UVJA 5CBRA 3B6QA 4LUBA 3SERA 3CIJA 2HZKA 3THIA 3V89B 4BLAA 4FJPA 4AQ4A 2GHAA 3IO4A 1HSLA 2ZNSA 4BDMA 4YKPA 1R9LA 2G29A 3LSWA 3TEPA 1SVXB 2RKMA 5KCJA 3ZKLA 1S50A 3MWBA 4N13A 3BFTA 4IGRA 4PETA 3OD7A 3OO7A 3L6GA 4NF5A 1QKBA 5AE4A 1XOCA 1AH5A 4OFLA 4GOTA 4GXAA 5FHOA 2QS2A 3KN7A 1R6ZA 1I6AA 3QSLA 3RN8A 3FXUA 5I56B 1OMPA 1B7HA 3MW0A 2HAVA 3CFXA 1M5EA 4R9FA 3TTLA 2ZXTA 3EHTA 3PUXE 3S2VA 2RCBA 1US5A 4NF4B 4YZZA 4UACA 1RYOA 1ELJA 1MXVA 3K1MA 2F5XA 2F8DA 2Z22A 1TFAA 3I6VA 4H67A 5H8HA 4ONYA 1SDXA 1Y1ZA 1JQFA 1LAXA 2XXHA 3VVFA 2PT2A 4KI0E 3G3IA 4WEPA 1ZU0A 4OFOA 1IXCA 4F2OA 2O69A 4QF9A 4XKNA 1FTKA 4E0WA 3MZBA 3RYAA 5LOMA 1MXUA 3OXNA 4GRKA 4DCXA 1MQHA 1B1XA 3OMBA 3TYHA 1US4A 1M5CA 3VLVA 1LAGE 3TAJA 3ILTB 4F1VA 1MPCA 4IO2A 2Q88A 3Q29A 4K3FA 4LP2B 1GV8A 1DPEA 4JBZA 2E1SA 3PMVA 4JB7A 1PB9A 2BJJX 3KBRA 4UA8A 5H8FA 5H8QB 1A7LA 4IY5A 3IJOB 1SBPA 2A5SA 3HSTA 4PFUA 2PBWA 4H65A 1SI0A 3FV2A 2F7AA 2ABHA 3C4MA 4M4GA 1POTA 4GF8A 1OQGA 2W7YA 3LBSA 3OSQA 2DXRA 1FTLA 4IO7A 1GGGA 3U1OA 4ZZEA 4MH5A 4OWDA 3TCHA 4O3CA 3MVWA 1FQEA 1OVBA 1AOVA 2B3FA 2I4BA 1H76A 3FGSA 1OLCA 4HCWA 1M5BA 3PPPA 4HCYA 3G7WA 2RINA 4FORA 3G3GA 1WVJA 2Z23A 4GVOA 1O64A 4QSCA 1IZ1A 3T93B 3A09A 4G68A 4ZEDA 2NXOA 4DZ1A 1UQWA 4MLQA 1I69A
chains in the Genus database with same CATH superfamily
5EHMA 1SPIA 1Y1MA 4MF3A 4LA9A 3DRJA 1A55A 4OFJA 4YMBA 4NWDA 5DVIA 4AS5A 1AMFA 3PV0E 3PUWE 3P7IA 4F22A 4F3SA 1XI6A 1H3DA 3DP6A 3SESA 1LBVA 3MJNA 5DYHA 2HXWA 4F3PA 2QSXA 3FJGA 1MRPA 4YKKA 3U93A 2QS1A 2XWKA 3R7XA 5CC2A 4OZ9A 3TQWA 4E0XA 3FXRA 5I2KA 4ZZAA 4G77A 3QK6A 1N04A 3FBPA 5I7IA 3OSRA 3B6WA 2P1SA 1JEUA 4P9KA 2OLBA 1RDYA 3KEIA 4MNPA 1VDWA 4F31B 3DRHA 2ZMBA 1MXYA 1DTZA 4R74A 1LBYA 2IEEA 2WOKA 4DIGA 4YAHX 3GBBA 1SYHA 2M8CA 5TPAB 1YYZA 2PMSA 3MQ9A 4EDPA 4DXUA 3PMXA 4JXIA 4MMPA 5H8NB 5AA4B 3LVUA 2DSFA 1XVXA 3MP1A 3Q26A 5HM4B 1P1QA 3EPEA 3N94A 3RTWB 1ZKBA 3K6VA 1Y9UA 4WEDA 4I8CA 2HXRA 1EZ9A 1PBPA 1QULA 1OLAA 4O7IA 2QVUA 2VP1A 1T0KA 4PFTA 4QFNA 1FPLA 2V25A 4OETA 1P1NA 3G3FA 1D9QA 5ELVA 2Y7PA 3GXAA 2MKZA 3KN8A 2HCAA 1FPEA 2ZYKA 5EHSA 2F6GA 1DTGA 2I48A 4PC9A 3S9LC 1H43A 3QAXA 4PBHA 5L9SA 4PFBA 5DEXA 2F35A 3E4RA 3OO6A 4JSOA 3OEMA 3OEKA 1P1WA 4JDFA 4AB5A 4BDRA 2FIEA 1HSEA 2D21A 4BDOA 2AIXA 4YB5A 4OHNA 3QUJA 4GBWA 3N5LA 1N7WA 5BUUA 3MP6A 1FW0A 4GWSA 3QIMA 4NX1A 1BP5A 4Q8RA 4ZE8A 2I4CA 4OVJA 3CR9A 4POXA 2I49A 4GL8A 4LQ2A 1P1OA 2ONKE 3VLUA 4MAGA 4PDHA 4KR5A 1N0TA 3M3KA 3LR1A 2V3QA 5AA1A 4ZDMA 5M2VA 3I3VA 1D9VA 4HE0A 4OESA 4U1ZA 3SEWA 4JSDA 3ZSFA 2GFEA 1PB8A 1QVSA 1NKXA 5EYGA 1DMBA 1MPBA 2PT1A 4P8BA 2WYKA 2NVUB 3E9XA 1IMFA 2O68A 4MX6A 1N76A 1Y4CA 5JTYB 1FQBA 1B1HA 4N81A 3H06B 1B7UA 4AS4A 4F18A 4BDLA 4ZEKA 2QS4A 2P0SA 2VGQA 5DT6A 2FHYA 3MBPA 2B65A 2A5TB 1JNFA 1IXIA 2B4MA 4GXSB 1WODA 2CZKA 2WOLA 1IITA 5TP9A 4XKRA 5ISUA 4G8MA 3VVDA 3UK4A 3G3JA 3OOAA 1JEVA 4H5FA 2F34A 3FV1A 3MVZA 2XX7A 3MP8A 3CI8A 3G3KA 5EQ7A 3A3UA 3TQLA 3T22A 1B51A 3RQTA 3PPQA 2FYIA 5IM2A 5ET8A 3C9HA 2H99A 4MCOA 3TKDA 5CMCA 3H6VA 1BK4A 3VDFA 1S7YA 3H6TA 2UYFA 4NF0A 3IOVA 2LAOA 3RYBA 4H1XA 1TXFA 4LZ5A 2OBGA 4F2QA 3N26A 4O7MA 4R9GA 2Y7WA 4PQJA 3TDJA 1D4NA 4YMAA 4ZEBA 3QUFA 4P1EA 4NF8B 4QFOA 4N15A 3KSJA 1FPFA 1M5FA 4H8IA 5T3JA 3B50A 3K00A 4DI4B 4GL0A 4OTEA 4Q5TA 1LBZA 3SEYA 4MLVA 3C36A 3FVNA 4XKPA 2F36A 2Q9TA 1NUZA 3RNNA 4DXBA 2Y84A 3O29A 3OO9A 5IZ3A 1GVCA 5H8FB 1ATGA 2XWOA 3IAZA 1NUYA 4NGUA 5ICQA 1JVXA 1B3HA 1EZPA 3RPWA 3MZ9A 3PAMA 3KBZA 5L9OA 4I9DA 2F3BA 4H5GA 1PC3A 2QRYA 4R72A 2XXTA 4XEQA 3H4ZA 2XD2A 3PD9A 2Q74A 4N6DA 4EF2A 5A5XA 4HE1A 4X9TA 3VV5A 2VOZA 2HAUA 1IUDA 5L9MA 5IKBA 5AA2A 3K6XA 3PUZE 2WEFA 2IA4A 2AL4A 1DSNA 1IMEA 3BFUA 4GD5A 3S9EA 2P3VA 4X1BA 4OENA 4IGTA 4XFEA 3CFLA 3CRBA 4IO4A 4NQ8A 5I2NA 3LC8A 1RKMA 2VD3A 4LZ8A 1R9QA 3VXBA 4RPOA 3DLNA 3JYRA 2DQVA 2XHDA 2X7PA 1MY3A 1FTOA 3LUYA 4YKIA 3T96B 5I57A 5FHMA 2Y5LA 4GBVA 1TFDA 1B5HA 1FSAA 5AA2D 4LVQA 3TPAA 4X04A 3USDA 4RK9A 4PFWA 2QPQA 3PPNA 4HE2A 4MFIA 4GX6A 1IXGA 3EF7A 5EYFA 4EF1A 1POY1 3K6WA 4MNCA 1II5A 1B7ZA 4IY6A 4PDDA 2NOOA 5EQ9A 3RT6B 1MDQA 4Z7EA 2V93A 3IX1A 4ESXA 3KJ7A 4P11A 2NWJA 3RTFB 2F3DA 2ALUA 4X48A 4R6HA 1LB8A 3MVYA 1SW4A 2I6EA 2QS3A 3D1RA 2FIXA 1JETA 4OERA 5K2YA 2O6AA 1NV4A 5L8DA 3TFLA 4G61A 4KQPA 3E3KA 3MZ1A 4BDNA 3ONMA 3Q27A 5I56A 1IQ7A 4JVCA 3K0VA 3K02A 4GWOA 2RF1A 1UTHB 2XWVA 2GQ1A 2HPGA 2ZZWA 2O1LA 1DBZA 3BIHA 2CMOA 3LUZA 4NN3A 5FTHA 4U1OA 3ZS6A 1N84A 3T66A 1B05A 2VPNA 1NNPA 3TTNA 2R71A 3FZVA 5H8SA 5I58B 3IJXB 3TODA 1NMUA 3DRFA 1MH3A 5F24A 4TOZA 4H8JA 1LBCA 2Q89A 3MC2A 3T9XB 4RY1A 1SQYA 3UP9A 2O7UA 2XXPA 2YPNA 3K4UA 1FBCA 1USYH 1Q1KA 4L17A 3HO7A 2OWZA 1B4ZA 3CHGA 2ZNTA 5HBCA 2H4IA 4IR8A 2DXYA 3FD3A 1L5TA 4FE8A 4ZE9A 3B8BA 3UN6A 3RPLA 3O6IA 2DE3A 2WX9A 4H46A 1LEVA 2O1MA 4ZS9A 2H98A 4N8GA 3KSXA 4XTCQ 5FTIA 3RYDA 2Y7IA 5KDTB 1CB6A 1GR2A 3IB0A 3C32A 3HV1A 4O3AA 3L6HA 2E0SA 4KPTA 3E78A 4HW8A 1VFEA 2YJPA 5ITOA 4O8MA 4QFLA 4PFRA 2ZNUA 3KGCA 1LLSA 4FATA 3R6UA 3V83A 1F9BA 4R75A 4IB2A 3TCGA 1H45A 5IZ1A 3GZGA 4C0RA 3D4GA 5H8QA 1J1NA 1MM7A 1ZLQA 2DVCA 3A29A 1SW2A 4NF6B 1QJMA 4OVPA 4LONB 4YU0A 5I59B 1MY4A 4M1VA 1BTJA 4JWYA 3IFCA 3MYUA 4EQBA 3KN3A 1I6QA 4QXDA 4ZEFA 3GYYA 3JV9A 2P3NA 3S9MC 1B6HA 2DYXA 3C35A 4MEVA 2L5VA 1YCJA 2Q8JA 2I0BA 5CRYA 4ELRA 4PAFA 1P99A 2VD2A 5F7VA 5HPQA 3G3HA 1UTBB 4OMBA 1JP4A 4P3LA 4AB6A 1FQAA 1HSJA 4PGNA 3T0JA 1ZMGA 3UORA 3TTRA 2O84X 1M5DA 2V4CA 3BBRA 1IMAA 2V3TA 1DK4A 1MY2A 1N3XA 1KA1A 2NUVA 3FXQA 5K2XA 3FJMA 4GWWA 4KYEA 2DOJA 3CVGA 3ILUB 3K1PA 5B70A 3T9HB 1QUJA 2AYSA 2FNCA 1LAHE 2THIA 3DRGA 4EQ7A 2PFYA 4QHQA 3VXCA 4KXPA 5TP9B 2RC7A 1YAEA 2V84A 2FVZA 4OEVA 3LSXA 4DXCA 3IB2A 1NH7A 3DP4A 1FBDA 3A3CA 3IOTA 4THIA 1LFGA 5KZTA 4NE4A 4FBPA 1LSTA 4IO3A 4GFRA 1MXWA 1QUIA 4DI3D 4EXKA 2DWIA 2QJEA 3O97A 1DPPA 5I5PA 3VFJA 3AXFA 2H9BA 4IO5A 1LBBA 3FVGA 1SI1A 5CI5A 3C31A 2XXUA 3FVKA 3FXBA 3RGYA 1R1NA 4NWCA 5KCJB 4POWA 2ZYNA 2CEYA 5JEIA 4GX3A 2O7IA 3HCQA 5TPAA 1PEBA 3IR1A 4PAIA 4QSEA 1NNTA 4NF5B 4GIZA 4I3YA 3QXMA 1VFDA 5H8NA 1TWYA 5AA4A 5IZ3B 3E79A 2AL5A 1D3KA 3MUQA 1B5JA 1MM6A 3RLFE 4Q0CA 1GTKA 1TT1A 1Y3QA 3Q28A 1Z7ME 1NNKA 1RYXA 1A40A 3S9NC 2UXAA 2FBPA 1G0IA 1O63A 2I58A 1Q35A 4DCYA 3B7DA 4R6YA 2B4LA 3EQ1A 2DWJA 4IO6A 3D4CA 3FUZA 4NHBA 3U65A 4KCDA 1QW0A 3Q25A 1A8FA 4WKMA 4YB6A 1FBGA 2G93A 1FRPA 3KFMA 1LCFA 2OCUA 5H8HB 1B3EA 4N4UA 3UA8A 1UIUA 3MPKA 2QL3A 1KWHA 1MQJA 3W9VA 4PGPA 1B46A 1IIWA 4N17A 4G8HA 1QGXA 3KJTA 4YICA 3VLWA 1BIYA 1LGBC 1FQFA 2FA7A 4O3BA 1Y4TA 1B9JA 2I0CA 4PCDA 5IGAA 1NNFA 3FIRA 3U92A 4R73A 3IK6B 2XXQA 3H6WA 3C33A 3IL1B 1EU8A 1MXXA 2QVVA 3ECRA 3DP8A 2XXYA 3EHUA 4ECFA 4ELPA 2R9JA 1NV6A 1K9YA 1MH4A 4OYVA 1LFIA 4KFQA 2CZLA 4G68C 1YPNA 4XKQA 4OVRA 4YKJA 1AIVA 4OEUA 4ZECA 2YLNA 3CSGA 1XVYA 3WAEA 3FASA 1H44A 4U21A 1INPA 2XXKA 5ICTA 5ET6A 3RY3A 4P0IA 5DW8A 4N6PA 4H45A 3EKIA 4I62A 2QFLA 5JTYA 3DELB 4FAJA 4JVDA 2UVHA 1FTJA 1PDAA 1EZOA 4QSDA 1FTAA 1ZIUA 3TELA 3OELA 4TLLB 2DWHA 3O66A 5CMMA 2UYEA 4C1UA 3M8UA 2X7QA 3SETA 2A5TA 4RNSA 4OQOA 3UIFA 1ZBMA 4NTLA 3RT8A 1EH3A 4PE3A 4G4PA 4F19A 1KZ8A 2ONRA 4XIGQ 3PPOA 1FPBA 1SW1A 2GHBA 2H25A 4G68B 4OA4A 1MXZA 1NH8A 1O7TA 1JVYA 3OENA 4JVIA 4Q30B 2I3WA 2XA5A 3TCFA 4R6KA 1EYKA 1I6BA 4MNIA 2F7BA 1MS7A 1B40A 4H0WA 4GWYA 2R6GE 2ZZXA 4KCCA 5JK4A 4ZEIA 3GBAA 3H3GA 3DRKA 3UGWA 1B58A 1OIBA 1OVTA 1MPDA 4ISUA 4KHZE 4R2FA 4P0GA 2Z8FA 3T9VA 1BLFA 1QKAA 4MHFA 4ND9A 2CZHA 3E13X 1AL3A 4NF8A 4NG7A 4ESWA 3K1NA 1Y3PA 1Y20A 1ZJLA 4PBQA 3TZAA 3MSTA 1G0HA 4HS7A 4PF6A 3M3FA 3IO6A 2Q8MA 3IOWA 1MDP1 5CMBA 5I2KB 2PVUA 1CE2A 4TQUQ 1N3WA 4NMYA 1XS5A 4I1DA 1NI9A 1WDNA 3O6PA 3W9WA 2ESNA 4TLMB 2HFBA 4G8NA 3T9UA 4GWUA 3N6UA 3W15C 3KOSA 3PMWA 1MG1A 4NAPA 1ZTYA 4PTKA 4RK2A 3FJ7A 4NF4A 3V8XB 4F3BA 3B6TA 4XF5A 1AWBA 1B3FA 5J16A 1BKAA 4DDDA 1LBWA 1MQDA 3K2DA 3V5AA 2X26A 4XXUA 3HPIA 2KR0A 2JJKA 3DRIA 5TU0A 3C34A 2VHAA 1XC1A 3K01A 5DTBA 3H6UA 3NOHA 2P2AA 2HZLA 2I3VA 1FCKA 1B52A 1UIVA 4KD5A 4PP0A 1B2HA 1NFTA 2Z8EA 4KYSA 4EXLA 4YB7A 4NEDA 4F3GA 3PUYE 4UABA 5IAIA 2R8TA 1YZ0A 4LQ5A 4LN5A 3FVOA 3F11A 4RXLA 2GH9A 3HHFA 4F1UA 2HEUA 3PPRA 5CBSA 2DWAA 3RUMA 3FTOA 5LDZA 5ET7A 3EN3A 5DEXB 3SZPA 1URDA 4N07A 1FTMA 2Q2AA 3N6TA 4RYAA 3SEUA 4OXVA 1LB9A 3H03A 1OQHA 1Z7NE 4RA1A 3O9PA 5IZZA 2XXIA 3MAMA 4OVQA 2PYYA 1EYIA 3LSFB 3QYTA 2D5WA 2XX9A 4RJZA 1SW5A 2Q2CA 1XHYA 1FBHA 1IXHA 5DVJA 4JWXA 3CSBA 2O51A 5FHNA 1SD3A 1MQIA 3ODBA 1S9TA 3U72A 2XXWA 4DLDA 2OWSA 3HHGA 1YTVA 2DP8A 2QMWA 3H7MA 3VVEA 5BWJA 1UTHA 4GX4A 2H5YA 1QUKA 3KC1A 1IEJA 1VSOA 2RC8A 2F97A 5FBPA 5EQ8A 3M3LA 1LCTA 4FEDA 3MVXA 4Z0IA 3SKPA 3BKIB 4N8YA 1URSA 2XD3A 1A99A 2CZIA 4H6DA 4U4SA 5I58A 3IFAA 3U94A 3KG2A 1FQDA 2Y7RA 1FBFA 2XX8A 4QRZA 1LBXA 1NV5A 1USYE 3PGFA 1NV7A 1MQGA 1VR5A 4BDQA 2PFZA 4GQOA 4U2RA 3VE1B 2F7CA 2WOPA 3HFUA 4FEBA 1B3LA 2DE4A 2RC9A 3WAFA 5EQAA 1SYIA 3PTYA 3CG3A 2UVGA 3SEVA 5AA3A 2DVZA 1FPKA 4F39A 3FATA 3OO8A 2CEXA 5ITPA 3I5OA 1ANFA 2OZZA 2XXRA 3DM0A 5KDTA 1VE4A 3R26A 1JW5A 2KLFA 1PB7A 2PCRA 1YXIA 3ISPA 5ET5A 3LSLA 1N7XA 4GLIA 1FBEA 2REJA 5I84A 2QMXA 2Z8DA 5EYHA 2F6PA 1NV0A 3K6UA 1LAFE 3PUVE 3CFZA 1MY1A 1LFHA 4QFPA 2F78A 3IOUA 2HQ0A 4G2ZA 1B5IA 4PFYA 4NF6A 2REGA 3SEXA 3KOTA 3S4UA 1P1UA 5I59A 1FJ9A 2V3UA 4MBPA 1B0LA 3TTMA 1NV1A 1NUWA 5CMKA 5CM6A 1JW4A 4C1TA 1A8EA 1B32A 4HTGA 5LTCA 1FQCA 2OK2A 4LATA 2D3IA 5B7DA 1PBQA 2UVIA 1NL5A 3PD8A 1K9ZA 1Y3NA 4RPNA 2PX1A 2DS9A 3IB1A 4I3EA 3TTKA 4U23A 1UTBA 4PE5B 1EYJA 3TUSA 3GLBA 3BIGA 3O6GA 5J1DA 3TMGA 4FIMA 2ONSA 2ZYMA 1FBPA 1B4HA 4KYDA 4ELQA 1B0HA 3KZGA 4OVTA 2DDKA 5A5XB 4R2BA 3QMFA 3JZJA 3IORA 2WKYA 3U8QA 4F29A 5AA2B 5F1QA 1RDZA 4DE8A 2OJTA 2GRVA 4X1DA 2OWTA 4JWOA 3SDFA 2RCAA 5I3SA 4EUOA 4F1YA 4U4XA 1A54A 1RDXA 2XXVA 3EHSA 3PU5A 4QFKA 3CG1A 2DE2A 2Y5KA 2XXXA 1MY0A 4OVSA 4WXJA 1DOTA 2Y7KA 2ZYOA 1FJ6A 5I2NB 1URGA 2B3BA 1JW1A 3O6HA 1B3GA 4GWXA 3O2AA 4MJOA 4FECA 2VPOA 1D9YA 5DVFA 3O28A 5I57B 4LZ7A 4ELOA 3ZKKA 3MPLA 4U22A 4EQ9A 1XT8A 2ANJA 3HN0A 2UVJA 5CBRA 3B6QA 2XWIA 4LUBA 3SERA 3CIJA 4X8RA 2HZKA 3THIA 1FPGA 3V89B 4BLAA 4FJPA 4AQ4A 2GHAA 3IO4A 1HSLA 2ZNSA 4BDMA 4YKPA 1R9LA 3KC0A 2G29A 3LSWA 3TEPA 1DCUA 4N6KA 1SVXB 2RKMA 5KCJA 3ZKLA 1S50A 3MWBA 4N13A 3BFTA 1FPJA 4IGRA 4PETA 3OD7A 3OO7A 3L6GA 4NF5A 1QKBA 5AE4A 1XOCA 3T1BA 1AH5A 4OFLA 4GOTA 4GXAA 4QBAA 5FHOA 1IMCA 2QS2A 3KN7A 1R6ZA 1I6AA 3QSLA 4HXVA 3RN8A 4PFIA 3FXUA 5I56B 1OMPA 1B7HA 3MW0A 2WBBA 2HAVA 3CFXA 1M5EA 4R9FA 3TTLA 2ZXTA 3EHTA 3PUXE 3S2VA 2RCBA 4I40A 1US5A 4NF4B 4YZZA 4UACA 4PF8A 1RYOA 1ELJA 1MXVA 3K1MA 2OX3A 2F5XA 2F8DA 2Z22A 1TFAA 5A5LA 4GWZA 1NUXA 3ROJA 3I6VA 4N91A 4H67A 5H8HA 4ONYA 1SDXA 1Y1ZA 2QVRA 1JQFA 1LAXA 2XXHA 3VVFA 2PT2A 4KI0E 3G3IA 2WBDA 1IMBA 2VT5A 4WEPA 1ZU0A 4OFOA 1IXCA 4F2OA 2O69A 4P56A 4QF9A 4XKNA 3LV0A 1FTKA 1FPIA 4E0WA 3MZBA 3RYAA 5LOMA 2KQZA 3RPLB 1MXUA 3OXNA 4GRKA 4DCXA 1MQHA 1B1XA 4PAKA 3OMBA 4OANA 3TYHA 1US4A 1M5CA 3VLVA 1LAGE 3TAJA 3ILTB 4F1VA 1MPCA 4IO2A 2Q88A 3Q29A 4K3FA 4LP2B 1GV8A 1DPEA 4JBZA 4O94A 2E1SA 3PMVA 4JB7A 1FPDA 1NV3A 1PB9A 2BJJX 3KBRA 4UA8A 5H8FA 5H8QB 1A7LA 4IY5A 3IJOB 1SBPA 2A5SA 3HSTA 4PFUA 1NV2A 2PBWA 4H65A 1SI0A 3FV2A 2F7AA 2ABHA 3C4MA 4M4GA 1POTA 4GF8A 1OQGA 2W7YA 1CNQA 3LBSA 3OSQA 2DXRA 1FTLA 4IO7A 4P47A 2WYPA 1GGGA 4ZZEA 3U1OA 4MH5A 4OWDA 3TCHA 4O3CA 3MVWA 1FQEA 1OVBA 1AOVA 1Q9DA 2B3FA 2I4BA 4P1LA 1H76A 3FGSA 1OLCA 4HCWA 2ZZVA 1M5BA 5ESYA 3PPPA 4HCYA 3G7WA 2RINA 4FORA 3G3GA 1WVJA 2Z23A 4GVOA 1O64A 4QSCA 1IZ1A 3T93B 3A09A 4G68A 4ZEDA 2NXOA 4MIJA 2BJIA 4DZ1A 1UQWA 4MLQA 1KA0A 1I69A 2HHMA 1IMDA
chains in the Genus database with same CATH topology
5EHMA 1Y1MA 4MF3A 4LA9A 3DRJA 1A55A 4OFJA 4YMBA 4NWDA 5DVIA 1AMFA 3PV0E 3PUWE 3P7IA 4F22A 4F3SA 1H3DA 3DP6A 3SESA 3MJNA 5DYHA 2HXWA 4F3PA 2QSXA 3FJGA 1MRPA 4YKKA 3U93A 2QS1A 3R7XA 5CC2A 4OZ9A 3TQWA 4E0XA 3FXRA 5I2KA 4ZZAA 4G77A 3QK6A 1N04A 3OSRA 3B6WA 2P1SA 1JEUA 2OLBA 3KEIA 4F31B 3DRHA 2ZMBA 1MXYA 1DTZA 4R74A 2IEEA 2WOKA 4DIGA 4YAHX 3GBBA 1SYHA 2M8CA 5TPAB 2PMSA 3MQ9A 4EDPA 4DXUA 3PMXA 4JXIA 5H8NB 5AA4B 3LVUA 2DSFA 1XVXA 3MP1A 3Q26A 5HM4B 1P1QA 3EPEA 3N94A 3RTWB 1ZKBA 3K6VA 1Y9UA 4WEDA 4I8CA 1EZ9A 1PBPA 1QULA 1OLAA 2VP1A 1T0KA 4PFTA 4QFNA 2V25A 4OETA 1P1NA 3G3FA 5ELVA 2Y7PA 3GXAA 3KN8A 2HCAA 2ZYKA 5EHSA 2F6GA 1DTGA 2I48A 3S9LC 1H43A 3QAXA 5L9SA 5DEXA 2F35A 3E4RA 3OO6A 4JSOA 3OEMA 3OEKA 1P1WA 4JDFA 4AB5A 4BDRA 1HSEA 2D21A 4BDOA 2AIXA 4YB5A 4OHNA 3QUJA 3N5LA 1N7WA 5BUUA 3MP6A 1FW0A 3QIMA 1BP5A 4Q8RA 4ZE8A 2I4CA 4OVJA 3CR9A 4POXA 2I49A 4GL8A 4LQ2A 1P1OA 2ONKE 3VLUA 4KR5A 1N0TA 3M3KA 3LR1A 2V3QA 5AA1A 4ZDMA 5M2VA 3I3VA 1D9VA 4OESA 4U1ZA 3SEWA 4JSDA 3ZSFA 2GFEA 1PB8A 1QVSA 1NKXA 1DMBA 1MPBA 2PT1A 2NVUB 3E9XA 2O68A 1N76A 1Y4CA 5JTYB 1FQBA 1B1HA 3H06B 1B7UA 4F18A 4BDLA 4ZEKA 2QS4A 2P0SA 2VGQA 5DT6A 3MBPA 2B65A 2A5TB 1JNFA 1IXIA 2B4MA 4GXSB 1WODA 2WOLA 1IITA 5TP9A 4XKRA 5ISUA 4G8MA 3VVDA 3UK4A 3G3JA 3OOAA 1JEVA 4H5FA 2F34A 3FV1A 3MVZA 2XX7A 3MP8A 3CI8A 3G3KA 3A3UA 3TQLA 3T22A 1B51A 3RQTA 3PPQA 2FYIA 3C9HA 2H99A 3TKDA 5CMCA 3H6VA 3VDFA 1S7YA 3H6TA 2UYFA 3IOVA 2LAOA 3RYBA 4H1XA 1TXFA 4LZ5A 2OBGA 4F2QA 3N26A 4R9GA 2Y7WA 4PQJA 3TDJA 1D4NA 4YMAA 4ZEBA 3QUFA 4NF8B 4QFOA 3KSJA 1M5FA 4H8IA 3K00A 4GL0A 4OTEA 4Q5TA 3SEYA 4MLVA 3C36A 3FVNA 4XKPA 2F36A 2Q9TA 3RNNA 4DXBA 2Y84A 3O29A 3OO9A 1GVCA 5H8FB 1ATGA 3IAZA 5ICQA 1JVXA 1B3HA 1EZPA 3RPWA 3MZ9A 3PAMA 5L9OA 4I9DA 4H5GA 1PC3A 2QRYA 4R72A 2XXTA 3H4ZA 2XD2A 3PD9A 4EF2A 5A5XA 4X9TA 3VV5A 2VOZA 2HAUA 1IUDA 5L9MA 5IKBA 5AA2A 3K6XA 3PUZE 2IA4A 2AL4A 1DSNA 3BFUA 4GD5A 3S9EA 4X1BA 4OENA 4IGTA 3CFLA 3CRBA 4IO4A 5I2NA 3LC8A 1RKMA 2VD3A 4LZ8A 1R9QA 3VXBA 4RPOA 3DLNA 3JYRA 2DQVA 2XHDA 2X7PA 1MY3A 1FTOA 3LUYA 4YKIA 3T96B 5I57A 5FHMA 1TFDA 1B5HA 5AA2D 4LVQA 3TPAA 3USDA 4RK9A 4PFWA 2QPQA 3PPNA 4MFIA 1IXGA 3EF7A 5EYFA 4EF1A 1POY1 3K6WA 1II5A 1B7ZA 4IY6A 2NOOA 3RT6B 1MDQA 4Z7EA 2V93A 3IX1A 4ESXA 3KJ7A 4P11A 2NWJA 3RTFB 2ALUA 4X48A 4R6HA 1LB8A 3MVYA 1SW4A 2I6EA 2QS3A 1JETA 4OERA 5K2YA 2O6AA 5L8DA 3TFLA 4KQPA 3E3KA 3MZ1A 4BDNA 3ONMA 3Q27A 5I56A 1IQ7A 3K0VA 3K02A 4GWOA 2RF1A 1UTHB 2O1LA 2CMOA 5FTHA 4U1OA 3ZS6A 1N84A 3T66A 1B05A 1NNPA 3TTNA 2R71A 3FZVA 5H8SA 5I58B 3IJXB 3TODA 1NMUA 3DRFA 1MH3A 4TOZA 4H8JA 1LBCA 2Q89A 3MC2A 3T9XB 4RY1A 1SQYA 3UP9A 2O7UA 2XXPA 2YPNA 3K4UA 1USYH 1Q1KA 4L17A 3HO7A 1B4ZA 3CHGA 2ZNTA 5HBCA 2H4IA 2DXYA 3FD3A 1L5TA 4FE8A 4ZE9A 3UN6A 3O6IA 2DE3A 2O1MA 4ZS9A 2H98A 3KSXA 4XTCQ 5FTIA 2Y7IA 5KDTB 1CB6A 1GR2A 3IB0A 3C32A 3HV1A 4O3AA 3L6HA 2E0SA 4KPTA 4HW8A 1VFEA 2YJPA 5ITOA 4QFLA 2ZNUA 3KGCA 1LLSA 4FATA 3R6UA 3V83A 1F9BA 4R75A 4IB2A 3TCGA 1H45A 3GZGA 4C0RA 3D4GA 5H8QA 1J1NA 1MM7A 1ZLQA 2DVCA 1SW2A 4NF6B 1QJMA 4YU0A 4LONB 5I59B 1MY4A 4M1VA 1BTJA 4JWYA 4EQBA 3KN3A 1I6QA 4ZEFA 3JV9A 3S9MC 1B6HA 2DYXA 3C35A 1YCJA 2Q8JA 4ELRA 2I0BA 5CRYA 1P99A 2VD2A 5F7VA 5HPQA 3G3HA 1UTBB 4OMBA 4AB6A 1FQAA 1HSJA 3UORA 1ZMGA 3TTRA 2O84X 1M5DA 3BBRA 2V3TA 1MY2A 1N3XA 2NUVA 3FXQA 5K2XA 3FJMA 4KYEA 2DOJA 3CVGA 3ILUB 3K1PA 5B70A 3T9HB 1QUJA 2AYSA 2FNCA 1LAHE 2THIA 3DRGA 4EQ7A 4QHQA 3VXCA 5TP9B 2RC7A 1YAEA 2V84A 4OEVA 3LSXA 4DXCA 3IB2A 1NH7A 3DP4A 3A3CA 3IOTA 4THIA 1LFGA 5KZTA 4NE4A 1LSTA 4IO3A 4GFRA 1MXWA 1QUIA 4EXKA 2DWIA 2QJEA 3O97A 1DPPA 3VFJA 3AXFA 2H9BA 4IO5A 1LBBA 3FVGA 1SI1A 5CI5A 3C31A 2XXUA 3FVKA 3RGYA 1R1NA 4NWCA 5KCJB 4POWA 2ZYNA 5JEIA 2O7IA 3HCQA 5TPAA 1PEBA 3IR1A 4QSEA 1NNTA 4NF5B 4GIZA 3QXMA 1VFDA 5H8NA 1TWYA 5AA4A 2AL5A 1D3KA 3MUQA 1B5JA 1MM6A 3RLFE 4Q0CA 1GTKA 1TT1A 1Y3QA 3Q28A 1Z7ME 1NNKA 1RYXA 1A40A 3S9NC 2UXAA 1O63A 2I58A 1Q35A 4DCYA 3B7DA 4R6YA 2B4LA 3EQ1A 2DWJA 4IO6A 3D4CA 3FUZA 4KCDA 1QW0A 3Q25A 1A8FA 4WKMA 4YB6A 2G93A 3KFMA 1LCFA 2OCUA 5H8HB 1B3EA 3UA8A 1UIUA 3MPKA 2QL3A 1KWHA 1MQJA 3W9VA 1B46A 1IIWA 4G8HA 3KJTA 4YICA 3VLWA 1BIYA 1LGBC 1FQFA 2FA7A 4O3BA 1Y4TA 1B9JA 2I0CA 1NNFA 3FIRA 3U92A 4R73A 3IK6B 2XXQA 3H6WA 3C33A 3IL1B 1EU8A 1MXXA 3ECRA 3DP8A 2XXYA 3EHUA 4ECFA 4ELPA 2R9JA 1MH4A 4OYVA 1LFIA 4KFQA 2CZLA 4G68C 1YPNA 4XKQA 4YKJA 1AIVA 4OEUA 4ZECA 2YLNA 3CSGA 1XVYA 3WAEA 3FASA 1H44A 4U21A 5ICTA 3RY3A 4P0IA 4N6PA 4I62A 5JTYA 3DELB 4FAJA 2UVHA 1FTJA 1PDAA 1EZOA 4QSDA 1ZIUA 3TELA 3OELA 4TLLB 2DWHA 3O66A 5CMMA 2UYEA 4C1UA 3M8UA 2X7QA 3SETA 2A5TA 4RNSA 4OQOA 3UIFA 1ZBMA 4NTLA 3RT8A 1EH3A 4G4PA 4F19A 2ONRA 4XIGQ 3PPOA 1SW1A 2GHBA 2H25A 4G68B 1MXZA 1NH8A 1O7TA 1JVYA 3OENA 4Q30B 2I3WA 3TCFA 4R6KA 1I6BA 2F7BA 1MS7A 1B40A 4H0WA 2R6GE 4KCCA 5JK4A 4ZEIA 3GBAA 3H3GA 3DRKA 3UGWA 1B58A 1OIBA 1OVTA 1MPDA 4ISUA 4KHZE 4R2FA 4P0GA 2Z8FA 3T9VA 1BLFA 1QKAA 4ND9A 3E13X 1AL3A 4NF8A 4ESWA 3K1NA 1Y3PA 1Y20A 1ZJLA 3TZAA 4HS7A 3M3FA 3IO6A 3IOWA 1MDP1 5CMBA 5I2KB 2PVUA 1CE2A 4TQUQ 1N3WA 4NMYA 1XS5A 4I1DA 1WDNA 3O6PA 3W9WA 2ESNA 4TLMB 2HFBA 4G8NA 3T9UA 3N6UA 3W15C 3KOSA 3PMWA 1MG1A 1ZTYA 4RK2A 3FJ7A 4NF4A 3V8XB 4F3BA 3B6TA 1B3FA 1BKAA 4DDDA 3K2DA 1MQDA 3V5AA 2X26A 4XXUA 3HPIA 3DRIA 5TU0A 3C34A 2VHAA 1XC1A 3K01A 5DTBA 3H6UA 2P2AA 2HZLA 2I3VA 1FCKA 1B52A 1UIVA 4KD5A 4PP0A 1B2HA 1NFTA 2Z8EA 4KYSA 4EXLA 4YB7A 4NEDA 4F3GA 3PUYE 5IAIA 4LQ5A 3FVOA 3F11A 4RXLA 2GH9A 3HHFA 4F1UA 2HEUA 3PPRA 5CBSA 2DWAA 3RUMA 3FTOA 3EN3A 5DEXB 1URDA 4N07A 1FTMA 4RYAA 2Q2AA 3N6TA 3SEUA 4OXVA 1LB9A 3H03A 1OQHA 1Z7NE 4RA1A 3O9PA 2XXIA 3MAMA 2PYYA 3LSFB 3QYTA 2D5WA 2XX9A 4RJZA 1SW5A 2Q2CA 1XHYA 1IXHA 5DVJA 4JWXA 3CSBA 2O51A 5FHNA 1SD3A 1MQIA 3ODBA 1S9TA 3U72A 2XXWA 4DLDA 2OWSA 3HHGA 1YTVA 2DP8A 2QMWA 3H7MA 3VVEA 5BWJA 1UTHA 2H5YA 1QUKA 1IEJA 1VSOA 2RC8A 2F97A 3M3LA 1LCTA 4FEDA 3MVXA 4Z0IA 3SKPA 3BKIB 1URSA 2XD3A 1A99A 4H6DA 4U4SA 5I58A 3U94A 3KG2A 1FQDA 2Y7RA 2XX8A 4QRZA 1USYE 3PGFA 1MQGA 1VR5A 4BDQA 4GQOA 4U2RA 3VE1B 2F7CA 2WOPA 4FEBA 1B3LA 2DE4A 2RC9A 3WAFA 1SYIA 3CG3A 2UVGA 3SEVA 5AA3A 2DVZA 4F39A 3FATA 3OO8A 5ITPA 3I5OA 1ANFA 2OZZA 2XXRA 3DM0A 5KDTA 1VE4A 3R26A 1JW5A 2KLFA 1PB7A 3LSLA 1N7XA 4GLIA 2REJA 5I84A 2QMXA 2Z8DA 2F6PA 3K6UA 1LAFE 3PUVE 3CFZA 1MY1A 1LFHA 4QFPA 2F78A 3IOUA 2HQ0A 4G2ZA 1B5IA 4PFYA 4NF6A 2REGA 3SEXA 3KOTA 3S4UA 1P1UA 5I59A 2V3UA 4MBPA 1B0LA 3TTMA 5CMKA 5CM6A 1JW4A 4C1TA 1A8EA 1B32A 4HTGA 1FQCA 2OK2A 4LATA 2D3IA 5B7DA 1PBQA 2UVIA 1NL5A 3PD8A 1Y3NA 4RPNA 2PX1A 2DS9A 3IB1A 3TTKA 4U23A 1UTBA 4PE5B 3TUSA 3GLBA 3O6GA 5J1DA 3TMGA 4FIMA 2ONSA 2ZYMA 1B4HA 4KYDA 4ELQA 1B0HA 3KZGA 5A5XB 4R2BA 3JZJA 3IORA 2WKYA 3U8QA 4F29A 5AA2B 5F1QA 4DE8A 2OJTA 2GRVA 4X1DA 2OWTA 4JWOA 3SDFA 2RCAA 4EUOA 4F1YA 4U4XA 1A54A 2XXVA 3EHSA 3PU5A 4QFKA 3CG1A 2DE2A 2XXXA 1MY0A 4WXJA 1DOTA 2Y7KA 2ZYOA 5I2NB 1URGA 2B3BA 1JW1A 3O6HA 1B3GA 3O2AA 4FECA 1D9YA 5DVFA 3O28A 5I57B 4LZ7A 4ELOA 3ZKKA 3MPLA 4U22A 4EQ9A 1XT8A 2ANJA 3HN0A 2UVJA 5CBRA 3B6QA 4LUBA 3SERA 3CIJA 2HZKA 3THIA 3V89B 4BLAA 4FJPA 4AQ4A 2GHAA 3IO4A 1HSLA 2ZNSA 4BDMA 4YKPA 1R9LA 2G29A 3LSWA 3TEPA 1SVXB 2RKMA 5KCJA 3ZKLA 1S50A 3MWBA 4N13A 3BFTA 4IGRA 4PETA 3OD7A 3OO7A 3L6GA 4NF5A 1QKBA 5AE4A 1XOCA 1AH5A 4OFLA 4GOTA 4GXAA 5FHOA 2QS2A 3KN7A 1R6ZA 1I6AA 3QSLA 3RN8A 3FXUA 5I56B 1OMPA 1B7HA 3MW0A 2HAVA 3CFXA 1M5EA 4R9FA 3TTLA 2ZXTA 3EHTA 3PUXE 3S2VA 2RCBA 1US5A 4NF4B 4YZZA 4UACA 1RYOA 1ELJA 1MXVA 3K1MA 2F5XA 2F8DA 2Z22A 1TFAA 3I6VA 4H67A 5H8HA 4ONYA 1SDXA 1Y1ZA 1JQFA 1LAXA 2XXHA 3VVFA 2PT2A 4KI0E 3G3IA 4WEPA 1ZU0A 4OFOA 1IXCA 4F2OA 2O69A 4QF9A 4XKNA 1FTKA 4E0WA 3MZBA 3RYAA 5LOMA 1MXUA 3OXNA 4GRKA 4DCXA 1MQHA 1B1XA 3OMBA 3TYHA 1US4A 1M5CA 3VLVA 1LAGE 3TAJA 3ILTB 4F1VA 1MPCA 4IO2A 2Q88A 3Q29A 4K3FA 4LP2B 1GV8A 1DPEA 4JBZA 2E1SA 3PMVA 4JB7A 1PB9A 2BJJX 3KBRA 4UA8A 5H8FA 5H8QB 1A7LA 4IY5A 3IJOB 1SBPA 2A5SA 3HSTA 4PFUA 2PBWA 4H65A 1SI0A 3FV2A 2F7AA 2ABHA 3C4MA 4M4GA 1POTA 4GF8A 1OQGA 2W7YA 3LBSA 3OSQA 2DXRA 1FTLA 4IO7A 1GGGA 3U1OA 4ZZEA 4MH5A 4OWDA 3TCHA 4O3CA 3MVWA 1FQEA 1OVBA 1AOVA 2B3FA 2I4BA 1H76A 3FGSA 1OLCA 4HCWA 1M5BA 3PPPA 4HCYA 3G7WA 2RINA 4FORA 3G3GA 1WVJA 2Z23A 4GVOA 1O64A 4QSCA 1IZ1A 3T93B 3A09A 4G68A 4ZEDA 2NXOA 4DZ1A 1UQWA 4MLQA 1I69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EHM A;  1Y1M A;  4MF3 A;  4LA9 A;  3DRJ A;  1A55 A;  4OFJ A;  4YMB A;  4NWD A;  5DVI A;  1AMF A;  3PV0 E;  3PUW E;  3P7I A;  4F22 A;  4F3S A;  1H3D A;  3DP6 A;  3SES A;  3MJN A;  5DYH A;  2HXW A;  4F3P A;  2QSX A;  3FJG A;  1MRP A;  4YKK A;  3U93 A;  2QS1 A;  3R7X A;  5CC2 A;  4OZ9 A;  3TQW A;  4E0X A;  3FXR A;  5I2K A;  4ZZA A;  4G77 A;  3QK6 A;  1N04 A;  3OSR A;  3B6W A;  2P1S A;  1JEU A;  2OLB A;  3KEI A;  4F31 B;  3DRH A;  2ZMB A;  1MXY A;  1DTZ A;  4R74 A;  2IEE A;  2WOK A;  4DIG A;  4YAH X;  3GBB A;  1SYH A;  2M8C A;  5TPA B;  2PMS A;  3MQ9 A;  4EDP A;  4DXU A;  3PMX A;  4JXI A;  5H8N B;  5AA4 B;  3LVU A;  2DSF A;  1XVX A;  3MP1 A;  3Q26 A;  5HM4 B;  1P1Q A;  3EPE A;  3N94 A;  3RTW B;  1ZKB A;  3K6V A;  1Y9U A;  4WED A;  4I8C A;  1EZ9 A;  1PBP A;  1QUL A;  1OLA A;  2VP1 A;  1T0K A;  4PFT A;  4QFN A;  2V25 A;  4OET A;  1P1N A;  3G3F A;  5ELV A;  2Y7P A;  3GXA A;  3KN8 A;  2HCA A;  2ZYK A;  5EHS A;  2F6G A;  1DTG A;  2I48 A;  3S9L C;  1H43 A;  3QAX A;  5L9S A;  5DEX A;  2F35 A;  3E4R A;  3OO6 A;  4JSO A;  3OEM A;  3OEK A;  1P1W A;  4JDF A;  4AB5 A;  4BDR A;  1HSE A;  2D21 A;  4BDO A;  2AIX A;  4YB5 A;  4OHN A;  3QUJ A;  3N5L A;  1N7W A;  5BUU A;  3MP6 A;  1FW0 A;  3QIM A;  1BP5 A;  4Q8R A;  4ZE8 A;  2I4C A;  4OVJ A;  3CR9 A;  4POX A;  2I49 A;  4GL8 A;  4LQ2 A;  1P1O A;  2ONK E;  3VLU A;  4KR5 A;  1N0T A;  3M3K A;  3LR1 A;  2V3Q A;  5AA1 A;  4ZDM A;  5M2V A;  3I3V A;  1D9V A;  4OES A;  4U1Z A;  3SEW A;  4JSD A;  3ZSF A;  2GFE A;  1PB8 A;  1QVS A;  1NKX A;  1DMB A;  1MPB A;  2PT1 A;  2NVU B;  3E9X A;  2O68 A;  1N76 A;  1Y4C A;  5JTY B;  1FQB A;  1B1H A;  3H06 B;  1B7U A;  4F18 A;  4BDL A;  4ZEK A;  2QS4 A;  2P0S A;  2VGQ A;  5DT6 A;  3MBP A;  2B65 A;  2A5T B;  1JNF A;  1IXI A;  2B4M A;  4GXS B;  1WOD A;  2WOL A;  1IIT A;  5TP9 A;  4XKR A;  5ISU A;  4G8M A;  3VVD A;  3UK4 A;  3G3J A;  3OOA A;  1JEV A;  4H5F A;  2F34 A;  3FV1 A;  3MVZ A;  2XX7 A;  3MP8 A;  3CI8 A;  3G3K A;  3A3U A;  3TQL A;  3T22 A;  1B51 A;  3RQT A;  3PPQ A;  2FYI A;  3C9H A;  2H99 A;  3TKD A;  5CMC A;  3H6V A;  3VDF A;  1S7Y A;  3H6T A;  2UYF A;  3IOV A;  2LAO A;  3RYB A;  4H1X A;  1TXF A;  4LZ5 A;  2OBG A;  4F2Q A;  3N26 A;  4R9G A;  2Y7W A;  4PQJ A;  3TDJ A;  1D4N A;  4YMA A;  4ZEB A;  3QUF A;  4NF8 B;  4QFO A;  3KSJ A;  1M5F A;  4H8I A;  3K00 A;  4GL0 A;  4OTE A;  4Q5T A;  3SEY A;  4MLV A;  3C36 A;  3FVN A;  4XKP A;  2F36 A;  2Q9T A;  3RNN A;  4DXB A;  2Y84 A;  3O29 A;  3OO9 A;  1GVC A;  5H8F B;  1ATG A;  3IAZ A;  5ICQ A;  1JVX A;  1B3H A;  1EZP A;  3RPW A;  3MZ9 A;  3PAM A;  5L9O A;  4I9D A;  4H5G A;  1PC3 A;  2QRY A;  4R72 A;  2XXT A;  3H4Z A;  2XD2 A;  3PD9 A;  4EF2 A;  5A5X A;  4X9T A;  3VV5 A;  2VOZ A;  2HAU A;  1IUD A;  5L9M A;  5IKB A;  5AA2 A;  3K6X A;  3PUZ E;  2IA4 A;  2AL4 A;  1DSN A;  3BFU A;  4GD5 A;  3S9E A;  4X1B A;  4OEN A;  4IGT A;  3CFL A;  3CRB A;  4IO4 A;  5I2N A;  3LC8 A;  1RKM A;  2VD3 A;  4LZ8 A;  1R9Q A;  3VXB A;  4RPO A;  3DLN A;  3JYR A;  2DQV A;  2XHD A;  2X7P A;  1MY3 A;  1FTO A;  3LUY A;  4YKI A;  3T96 B;  5I57 A;  5FHM A;  1TFD A;  1B5H A;  5AA2 D;  4LVQ A;  3TPA A;  3USD A;  4RK9 A;  4PFW A;  2QPQ A;  3PPN A;  4MFI A;  1IXG A;  3EF7 A;  5EYF A;  4EF1 A;  1POY 1;  3K6W A;  1II5 A;  1B7Z A;  4IY6 A;  2NOO A;  3RT6 B;  1MDQ A;  4Z7E A;  2V93 A;  3IX1 A;  4ESX A;  3KJ7 A;  4P11 A;  2NWJ A;  3RTF B;  2ALU A;  4X48 A;  4R6H A;  1LB8 A;  3MVY A;  1SW4 A;  2I6E A;  2QS3 A;  1JET A;  4OER A;  5K2Y A;  2O6A A;  5L8D A;  3TFL A;  4KQP A;  3E3K A;  3MZ1 A;  4BDN A;  3ONM A;  3Q27 A;  5I56 A;  1IQ7 A;  3K0V A;  3K02 A;  4GWO A;  2RF1 A;  1UTH B;  2O1L A;  2CMO A;  5FTH A;  4U1O A;  3ZS6 A;  1N84 A;  3T66 A;  1B05 A;  1NNP A;  3TTN A;  2R71 A;  3FZV A;  5H8S A;  5I58 B;  3IJX B;  3TOD A;  1NMU A;  3DRF A;  1MH3 A;  4TOZ A;  4H8J A;  1LBC A;  2Q89 A;  3MC2 A;  3T9X B;  4RY1 A;  1SQY A;  3UP9 A;  2O7U A;  2XXP A;  2YPN A;  3K4U A;  1USY H;  1Q1K A;  4L17 A;  3HO7 A;  1B4Z A;  3CHG A;  2ZNT A;  5HBC A;  2H4I A;  2DXY A;  3FD3 A;  1L5T A;  4FE8 A;  4ZE9 A;  3UN6 A;  3O6I A;  2DE3 A;  2O1M A;  4ZS9 A;  2H98 A;  3KSX A;  4XTC Q;  5FTI A;  2Y7I A;  5KDT B;  1CB6 A;  1GR2 A;  3IB0 A;  3C32 A;  3HV1 A;  4O3A A;  3L6H A;  2E0S A;  4KPT A;  4HW8 A;  1VFE A;  2YJP A;  5ITO A;  4QFL A;  2ZNU A;  3KGC A;  1LLS A;  4FAT A;  3R6U A;  3V83 A;  1F9B A;  4R75 A;  4IB2 A;  3TCG A;  1H45 A;  3GZG A;  4C0R A;  3D4G A;  5H8Q A;  1J1N A;  1MM7 A;  1ZLQ A;  2DVC A;  1SW2 A;  4NF6 B;  1QJM A;  4YU0 A;  4LON B;  5I59 B;  1MY4 A;  4M1V A;  1BTJ A;  4JWY A;  4EQB A;  3KN3 A;  1I6Q A;  4ZEF A;  3JV9 A;  3S9M C;  1B6H A;  2DYX A;  3C35 A;  1YCJ A;  2Q8J A;  4ELR A;  2I0B A;  5CRY A;  1P99 A;  2VD2 A;  5F7V A;  5HPQ A;  3G3H A;  1UTB B;  4OMB A;  4AB6 A;  1FQA A;  1HSJ A;  3UOR A;  1ZMG A;  3TTR A;  2O84 X;  1M5D A;  3BBR A;  2V3T A;  1MY2 A;  1N3X A;  2NUV A;  3FXQ A;  5K2X A;  3FJM A;  4KYE A;  2DOJ A;  3CVG A;  3ILU B;  3K1P A;  5B70 A;  3T9H B;  1QUJ A;  2AYS A;  2FNC A;  1LAH E;  2THI A;  3DRG A;  4EQ7 A;  4QHQ A;  3VXC A;  5TP9 B;  2RC7 A;  1YAE A;  2V84 A;  4OEV A;  3LSX A;  4DXC A;  3IB2 A;  1NH7 A;  3DP4 A;  3A3C A;  3IOT A;  4THI A;  1LFG A;  5KZT A;  4NE4 A;  1LST A;  4IO3 A;  4GFR A;  1MXW A;  1QUI A;  4EXK A;  2DWI A;  2QJE A;  3O97 A;  1DPP A;  3VFJ A;  3AXF A;  2H9B A;  4IO5 A;  1LBB A;  3FVG A;  1SI1 A;  5CI5 A;  3C31 A;  2XXU A;  3FVK A;  3RGY A;  1R1N A;  4NWC A;  5KCJ B;  4POW A;  2ZYN A;  5JEI A;  2O7I A;  3HCQ A;  5TPA A;  1PEB A;  3IR1 A;  4QSE A;  1NNT A;  4NF5 B;  4GIZ A;  3QXM A;  1VFD A;  5H8N A;  1TWY A;  5AA4 A;  2AL5 A;  1D3K A;  3MUQ A;  1B5J A;  1MM6 A;  3RLF E;  4Q0C A;  1GTK A;  1TT1 A;  1Y3Q A;  3Q28 A;  1Z7M E;  1NNK A;  1RYX A;  1A40 A;  3S9N C;  2UXA A;  1O63 A;  2I58 A;  1Q35 A;  4DCY A;  3B7D A;  4R6Y A;  2B4L A;  3EQ1 A;  2DWJ A;  4IO6 A;  3D4C A;  3FUZ A;  4KCD A;  1QW0 A;  3Q25 A;  1A8F A;  4WKM A;  4YB6 A;  2G93 A;  3KFM A;  1LCF A;  2OCU A;  5H8H B;  1B3E A;  3UA8 A;  1UIU A;  3MPK A;  2QL3 A;  1KWH A;  1MQJ A;  3W9V A;  1B46 A;  1IIW A;  4G8H A;  3KJT A;  4YIC A;  3VLW A;  1BIY A;  1LGB C;  1FQF A;  2FA7 A;  4O3B A;  1Y4T A;  1B9J A;  2I0C A;  1NNF A;  3FIR A;  3U92 A;  4R73 A;  3IK6 B;  2XXQ A;  3H6W A;  3C33 A;  3IL1 B;  1EU8 A;  1MXX A;  3ECR A;  3DP8 A;  2XXY A;  3EHU A;  4ECF A;  4ELP A;  2R9J A;  1MH4 A;  4OYV A;  1LFI A;  4KFQ A;  2CZL A;  4G68 C;  1YPN A;  4XKQ A;  4YKJ A;  1AIV A;  4OEU A;  4ZEC A;  2YLN A;  3CSG A;  1XVY A;  3WAE A;  3FAS A;  1H44 A;  4U21 A;  5ICT A;  3RY3 A;  4P0I A;  4N6P A;  4I62 A;  5JTY A;  3DEL B;  4FAJ A;  2UVH A;  1FTJ A;  1PDA A;  1EZO A;  4QSD A;  1ZIU A;  3TEL A;  3OEL A;  4TLL B;  2DWH A;  3O66 A;  5CMM A;  2UYE A;  4C1U A;  3M8U A;  2X7Q A;  3SET A;  2A5T A;  4RNS A;  4OQO A;  3UIF A;  1ZBM A;  4NTL A;  3RT8 A;  1EH3 A;  4G4P A;  4F19 A;  2ONR A;  4XIG Q;  3PPO A;  1SW1 A;  2GHB A;  2H25 A;  4G68 B;  1MXZ A;  1NH8 A;  1O7T A;  1JVY A;  3OEN A;  4Q30 B;  2I3W A;  3TCF A;  4R6K A;  1I6B A;  2F7B A;  1MS7 A;  1B40 A;  4H0W A;  2R6G E;  4KCC A;  5JK4 A;  4ZEI A;  3GBA A;  3H3G A;  3DRK A;  3UGW A;  1B58 A;  1OIB A;  1OVT A;  1MPD A;  4ISU A;  4KHZ E;  4R2F A;  4P0G A;  2Z8F A;  3T9V A;  1BLF A;  1QKA A;  4ND9 A;  3E13 X;  1AL3 A;  4NF8 A;  4ESW A;  3K1N A;  1Y3P A;  1Y20 A;  1ZJL A;  3TZA A;  4HS7 A;  3M3F A;  3IO6 A;  3IOW A;  1MDP 1;  5CMB A;  5I2K B;  2PVU A;  1CE2 A;  4TQU Q;  1N3W A;  4NMY A;  1XS5 A;  4I1D A;  1WDN A;  3O6P A;  3W9W A;  2ESN A;  4TLM B;  2HFB A;  4G8N A;  3T9U A;  3N6U A;  3W15 C;  3KOS A;  3PMW A;  1MG1 A;  1ZTY A;  4RK2 A;  3FJ7 A;  4NF4 A;  3V8X B;  4F3B A;  3B6T A;  1B3F A;  1BKA A;  4DDD A;  3K2D A;  1MQD A;  3V5A A;  2X26 A;  4XXU A;  3HPI A;  3DRI A;  5TU0 A;  3C34 A;  2VHA A;  1XC1 A;  3K01 A;  5DTB A;  3H6U A;  2P2A A;  2HZL A;  2I3V A;  1FCK A;  1B52 A;  1UIV A;  4KD5 A;  4PP0 A;  1B2H A;  1NFT A;  2Z8E A;  4KYS A;  4EXL A;  4YB7 A;  4NED A;  4F3G A;  3PUY E;  5IAI A;  4LQ5 A;  3FVO A;  3F11 A;  4RXL A;  2GH9 A;  3HHF A;  4F1U A;  2HEU A;  3PPR A;  5CBS A;  2DWA A;  3RUM A;  3FTO A;  3EN3 A;  5DEX B;  1URD A;  4N07 A;  1FTM A;  4RYA A;  2Q2A A;  3N6T A;  3SEU A;  4OXV A;  1LB9 A;  3H03 A;  1OQH A;  1Z7N E;  4RA1 A;  3O9P A;  2XXI A;  3MAM A;  2PYY A;  3LSF B;  3QYT A;  2D5W A;  2XX9 A;  4RJZ A;  1SW5 A;  2Q2C A;  1XHY A;  1IXH A;  5DVJ A;  4JWX A;  3CSB A;  2O51 A;  5FHN A;  1SD3 A;  1MQI A;  3ODB A;  1S9T A;  3U72 A;  2XXW A;  4DLD A;  2OWS A;  3HHG A;  1YTV A;  2DP8 A;  2QMW A;  3H7M A;  3VVE A;  5BWJ A;  1UTH A;  2H5Y A;  1QUK A;  1IEJ A;  1VSO A;  2RC8 A;  2F97 A;  3M3L A;  1LCT A;  4FED A;  3MVX A;  4Z0I A;  3SKP A;  3BKI B;  1URS A;  2XD3 A;  1A99 A;  4H6D A;  4U4S A;  5I58 A;  3U94 A;  3KG2 A;  1FQD A;  2Y7R A;  2XX8 A;  4QRZ A;  1USY E;  3PGF A;  1MQG A;  1VR5 A;  4BDQ A;  4GQO A;  4U2R A;  3VE1 B;  2F7C A;  2WOP A;  4FEB A;  1B3L A;  2DE4 A;  2RC9 A;  3WAF A;  1SYI A;  3CG3 A;  2UVG A;  3SEV A;  5AA3 A;  2DVZ A;  4F39 A;  3FAT A;  3OO8 A;  5ITP A;  3I5O A;  1ANF A;  2OZZ A;  2XXR A;  3DM0 A;  5KDT A;  1VE4 A;  3R26 A;  1JW5 A;  2KLF A;  1PB7 A;  3LSL A;  1N7X A;  4GLI A;  2REJ A;  5I84 A;  2QMX A;  2Z8D A;  2F6P A;  3K6U A;  1LAF E;  3PUV E;  3CFZ A;  1MY1 A;  1LFH A;  4QFP A;  2F78 A;  3IOU A;  2HQ0 A;  4G2Z A;  1B5I A;  4PFY A;  4NF6 A;  2REG A;  3SEX A;  3KOT A;  3S4U A;  1P1U A;  5I59 A;  2V3U A;  4MBP A;  1B0L A;  3TTM A;  5CMK A;  5CM6 A;  1JW4 A;  4C1T A;  1A8E A;  1B32 A;  4HTG A;  1FQC A;  2OK2 A;  4LAT A;  2D3I A;  5B7D A;  1PBQ A;  2UVI A;  1NL5 A;  3PD8 A;  1Y3N A;  4RPN A;  2PX1 A;  2DS9 A;  3IB1 A;  3TTK A;  4U23 A;  1UTB A;  4PE5 B;  3TUS A;  3GLB A;  3O6G A;  5J1D A;  3TMG A;  4FIM A;  2ONS A;  2ZYM A;  1B4H A;  4KYD A;  4ELQ A;  1B0H A;  3KZG A;  5A5X B;  4R2B A;  3JZJ A;  3IOR A;  2WKY A;  3U8Q A;  4F29 A;  5AA2 B;  5F1Q A;  4DE8 A;  2OJT A;  2GRV A;  4X1D A;  2OWT A;  4JWO A;  3SDF A;  2RCA A;  4EUO A;  4F1Y A;  4U4X A;  1A54 A;  2XXV A;  3EHS A;  3PU5 A;  4QFK A;  3CG1 A;  2DE2 A;  2XXX A;  1MY0 A;  4WXJ A;  1DOT A;  2Y7K A;  2ZYO A;  5I2N B;  1URG A;  2B3B A;  1JW1 A;  3O6H A;  1B3G A;  3O2A A;  4FEC A;  1D9Y A;  5DVF A;  3O28 A;  5I57 B;  4LZ7 A;  4ELO A;  3ZKK A;  3MPL A;  4U22 A;  4EQ9 A;  1XT8 A;  2ANJ A;  3HN0 A;  2UVJ A;  5CBR A;  3B6Q A;  4LUB A;  3SER A;  3CIJ A;  2HZK A;  3THI A;  3V89 B;  4BLA A;  4FJP A;  4AQ4 A;  2GHA A;  3IO4 A;  1HSL A;  2ZNS A;  4BDM A;  4YKP A;  1R9L A;  2G29 A;  3LSW A;  3TEP A;  1SVX B;  2RKM A;  5KCJ A;  3ZKL A;  1S50 A;  3MWB A;  4N13 A;  3BFT A;  4IGR A;  4PET A;  3OD7 A;  3OO7 A;  3L6G A;  4NF5 A;  1QKB A;  5AE4 A;  1XOC A;  1AH5 A;  4OFL A;  4GOT A;  4GXA A;  5FHO A;  2QS2 A;  3KN7 A;  1R6Z A;  1I6A A;  3QSL A;  3RN8 A;  3FXU A;  5I56 B;  1OMP A;  1B7H A;  3MW0 A;  2HAV A;  3CFX A;  1M5E A;  4R9F A;  3TTL A;  2ZXT A;  3EHT A;  3PUX E;  3S2V A;  2RCB A;  1US5 A;  4NF4 B;  4YZZ A;  4UAC A;  1RYO A;  1ELJ A;  1MXV A;  3K1M A;  2F5X A;  2F8D A;  2Z22 A;  1TFA A;  3I6V A;  4H67 A;  5H8H A;  4ONY A;  1SDX A;  1Y1Z A;  1JQF A;  1LAX A;  2XXH A;  3VVF A;  2PT2 A;  4KI0 E;  3G3I A;  4WEP A;  1ZU0 A;  4OFO A;  1IXC A;  4F2O A;  2O69 A;  4QF9 A;  4XKN A;  1FTK A;  4E0W A;  3MZB A;  3RYA A;  5LOM A;  1MXU A;  3OXN A;  4GRK A;  4DCX A;  1MQH A;  1B1X A;  3OMB A;  3TYH A;  1US4 A;  1M5C A;  3VLV A;  1LAG E;  3TAJ A;  3ILT B;  4F1V A;  1MPC A;  4IO2 A;  2Q88 A;  3Q29 A;  4K3F A;  4LP2 B;  1GV8 A;  1DPE A;  4JBZ A;  2E1S A;  3PMV A;  4JB7 A;  1PB9 A;  2BJJ X;  3KBR A;  4UA8 A;  5H8F A;  5H8Q B;  1A7L A;  4IY5 A;  3IJO B;  1SBP A;  2A5S A;  3HST A;  4PFU A;  2PBW A;  4H65 A;  1SI0 A;  3FV2 A;  2F7A A;  2ABH A;  3C4M A;  4M4G A;  1POT A;  4GF8 A;  1OQG A;  2W7Y A;  3LBS A;  3OSQ A;  2DXR A;  1FTL A;  4IO7 A;  1GGG A;  3U1O A;  4ZZE A;  4MH5 A;  4OWD A;  3TCH A;  4O3C A;  3MVW A;  1FQE A;  1OVB A;  1AOV A;  2B3F A;  2I4B A;  1H76 A;  3FGS A;  1OLC A;  4HCW A;  1M5B A;  3PPP A;  4HCY A;  3G7W A;  2RIN A;  4FOR A;  3G3G A;  1WVJ A;  2Z23 A;  4GVO A;  1O64 A;  4QSC A;  1IZ1 A;  3T93 B;  3A09 A;  4G68 A;  4ZED A;  2NXO A;  4DZ1 A;  1UQW A;  4MLQ A;  1I69 A; 
#chains in the Genus database with same CATH topology
 5EHM A;  1SPI A;  1Y1M A;  4MF3 A;  4LA9 A;  3DRJ A;  1A55 A;  4OFJ A;  4YMB A;  4NWD A;  5DVI A;  4AS5 A;  1AMF A;  3PV0 E;  3PUW E;  3P7I A;  4F22 A;  4F3S A;  1XI6 A;  1H3D A;  3DP6 A;  3SES A;  1LBV A;  3MJN A;  5DYH A;  2HXW A;  4F3P A;  2QSX A;  3FJG A;  1MRP A;  4YKK A;  3U93 A;  2QS1 A;  2XWK A;  3R7X A;  5CC2 A;  4OZ9 A;  3TQW A;  4E0X A;  3FXR A;  5I2K A;  4ZZA A;  4G77 A;  3QK6 A;  1N04 A;  3FBP A;  5I7I A;  3OSR A;  3B6W A;  2P1S A;  1JEU A;  4P9K A;  2OLB A;  1RDY A;  3KEI A;  4MNP A;  1VDW A;  4F31 B;  3DRH A;  2ZMB A;  1MXY A;  1DTZ A;  4R74 A;  1LBY A;  2IEE A;  2WOK A;  4DIG A;  4YAH X;  3GBB A;  1SYH A;  2M8C A;  5TPA B;  1YYZ A;  2PMS A;  3MQ9 A;  4EDP A;  4DXU A;  3PMX A;  4JXI A;  4MMP A;  5H8N B;  5AA4 B;  3LVU A;  2DSF A;  1XVX A;  3MP1 A;  3Q26 A;  5HM4 B;  1P1Q A;  3EPE A;  3N94 A;  3RTW B;  1ZKB A;  3K6V A;  1Y9U A;  4WED A;  4I8C A;  2HXR A;  1EZ9 A;  1PBP A;  1QUL A;  1OLA A;  4O7I A;  2QVU A;  2VP1 A;  1T0K A;  4PFT A;  4QFN A;  1FPL A;  2V25 A;  4OET A;  1P1N A;  3G3F A;  1D9Q A;  5ELV A;  2Y7P A;  3GXA A;  2MKZ A;  3KN8 A;  2HCA A;  1FPE A;  2ZYK A;  5EHS A;  2F6G A;  1DTG A;  2I48 A;  4PC9 A;  3S9L C;  1H43 A;  3QAX A;  4PBH A;  5L9S A;  4PFB A;  5DEX A;  2F35 A;  3E4R A;  3OO6 A;  4JSO A;  3OEM A;  3OEK A;  1P1W A;  4JDF A;  4AB5 A;  4BDR A;  2FIE A;  1HSE A;  2D21 A;  4BDO A;  2AIX A;  4YB5 A;  4OHN A;  3QUJ A;  4GBW A;  3N5L A;  1N7W A;  5BUU A;  3MP6 A;  1FW0 A;  4GWS A;  3QIM A;  4NX1 A;  1BP5 A;  4Q8R A;  4ZE8 A;  2I4C A;  4OVJ A;  3CR9 A;  4POX A;  2I49 A;  4GL8 A;  4LQ2 A;  1P1O A;  2ONK E;  3VLU A;  4MAG A;  4PDH A;  4KR5 A;  1N0T A;  3M3K A;  3LR1 A;  2V3Q A;  5AA1 A;  4ZDM A;  5M2V A;  3I3V A;  1D9V A;  4HE0 A;  4OES A;  4U1Z A;  3SEW A;  4JSD A;  3ZSF A;  2GFE A;  1PB8 A;  1QVS A;  1NKX A;  5EYG A;  1DMB A;  1MPB A;  2PT1 A;  4P8B A;  2WYK A;  2NVU B;  3E9X A;  1IMF A;  2O68 A;  4MX6 A;  1N76 A;  1Y4C A;  5JTY B;  1FQB A;  1B1H A;  4N81 A;  3H06 B;  1B7U A;  4AS4 A;  4F18 A;  4BDL A;  4ZEK A;  2QS4 A;  2P0S A;  2VGQ A;  5DT6 A;  2FHY A;  3MBP A;  2B65 A;  2A5T B;  1JNF A;  1IXI A;  2B4M A;  4GXS B;  1WOD A;  2CZK A;  2WOL A;  1IIT A;  5TP9 A;  4XKR A;  5ISU A;  4G8M A;  3VVD A;  3UK4 A;  3G3J A;  3OOA A;  1JEV A;  4H5F A;  2F34 A;  3FV1 A;  3MVZ A;  2XX7 A;  3MP8 A;  3CI8 A;  3G3K A;  5EQ7 A;  3A3U A;  3TQL A;  3T22 A;  1B51 A;  3RQT A;  3PPQ A;  2FYI A;  5IM2 A;  5ET8 A;  3C9H A;  2H99 A;  4MCO A;  3TKD A;  5CMC A;  3H6V A;  1BK4 A;  3VDF A;  1S7Y A;  3H6T A;  2UYF A;  4NF0 A;  3IOV A;  2LAO A;  3RYB A;  4H1X A;  1TXF A;  4LZ5 A;  2OBG A;  4F2Q A;  3N26 A;  4O7M A;  4R9G A;  2Y7W A;  4PQJ A;  3TDJ A;  1D4N A;  4YMA A;  4ZEB A;  3QUF A;  4P1E A;  4NF8 B;  4QFO A;  4N15 A;  3KSJ A;  1FPF A;  1M5F A;  4H8I A;  5T3J A;  3B50 A;  3K00 A;  4DI4 B;  4GL0 A;  4OTE A;  4Q5T A;  1LBZ A;  3SEY A;  4MLV A;  3C36 A;  3FVN A;  4XKP A;  2F36 A;  2Q9T A;  1NUZ A;  3RNN A;  4DXB A;  2Y84 A;  3O29 A;  3OO9 A;  5IZ3 A;  1GVC A;  5H8F B;  1ATG A;  2XWO A;  3IAZ A;  1NUY A;  4NGU A;  5ICQ A;  1JVX A;  1B3H A;  1EZP A;  3RPW A;  3MZ9 A;  3PAM A;  3KBZ A;  5L9O A;  4I9D A;  2F3B A;  4H5G A;  1PC3 A;  2QRY A;  4R72 A;  2XXT A;  4XEQ A;  3H4Z A;  2XD2 A;  3PD9 A;  2Q74 A;  4N6D A;  4EF2 A;  5A5X A;  4HE1 A;  4X9T A;  3VV5 A;  2VOZ A;  2HAU A;  1IUD A;  5L9M A;  5IKB A;  5AA2 A;  3K6X A;  3PUZ E;  2WEF A;  2IA4 A;  2AL4 A;  1DSN A;  1IME A;  3BFU A;  4GD5 A;  3S9E A;  2P3V A;  4X1B A;  4OEN A;  4IGT A;  4XFE A;  3CFL A;  3CRB A;  4IO4 A;  4NQ8 A;  5I2N A;  3LC8 A;  1RKM A;  2VD3 A;  4LZ8 A;  1R9Q A;  3VXB A;  4RPO A;  3DLN A;  3JYR A;  2DQV A;  2XHD A;  2X7P A;  1MY3 A;  1FTO A;  3LUY A;  4YKI A;  3T96 B;  5I57 A;  5FHM A;  2Y5L A;  4GBV A;  1TFD A;  1B5H A;  1FSA A;  5AA2 D;  4LVQ A;  3TPA A;  4X04 A;  3USD A;  4RK9 A;  4PFW A;  2QPQ A;  3PPN A;  4HE2 A;  4MFI A;  4GX6 A;  1IXG A;  3EF7 A;  5EYF A;  4EF1 A;  1POY 1;  3K6W A;  4MNC A;  1II5 A;  1B7Z A;  4IY6 A;  4PDD A;  2NOO A;  5EQ9 A;  3RT6 B;  1MDQ A;  4Z7E A;  2V93 A;  3IX1 A;  4ESX A;  3KJ7 A;  4P11 A;  2NWJ A;  3RTF B;  2F3D A;  2ALU A;  4X48 A;  4R6H A;  1LB8 A;  3MVY A;  1SW4 A;  2I6E A;  2QS3 A;  3D1R A;  2FIX A;  1JET A;  4OER A;  5K2Y A;  2O6A A;  1NV4 A;  5L8D A;  3TFL A;  4G61 A;  4KQP A;  3E3K A;  3MZ1 A;  4BDN A;  3ONM A;  3Q27 A;  5I56 A;  1IQ7 A;  4JVC A;  3K0V A;  3K02 A;  4GWO A;  2RF1 A;  1UTH B;  2XWV A;  2GQ1 A;  2HPG A;  2ZZW A;  2O1L A;  1DBZ A;  3BIH A;  2CMO A;  3LUZ A;  4NN3 A;  5FTH A;  4U1O A;  3ZS6 A;  1N84 A;  3T66 A;  1B05 A;  2VPN A;  1NNP A;  3TTN A;  2R71 A;  3FZV A;  5H8S A;  5I58 B;  3IJX B;  3TOD A;  1NMU A;  3DRF A;  1MH3 A;  5F24 A;  4TOZ A;  4H8J A;  1LBC A;  2Q89 A;  3MC2 A;  3T9X B;  4RY1 A;  1SQY A;  3UP9 A;  2O7U A;  2XXP A;  2YPN A;  3K4U A;  1FBC A;  1USY H;  1Q1K A;  4L17 A;  3HO7 A;  2OWZ A;  1B4Z A;  3CHG A;  2ZNT A;  5HBC A;  2H4I A;  4IR8 A;  2DXY A;  3FD3 A;  1L5T A;  4FE8 A;  4ZE9 A;  3B8B A;  3UN6 A;  3RPL A;  3O6I A;  2DE3 A;  2WX9 A;  4H46 A;  1LEV A;  2O1M A;  4ZS9 A;  2H98 A;  4N8G A;  3KSX A;  4XTC Q;  5FTI A;  3RYD A;  2Y7I A;  5KDT B;  1CB6 A;  1GR2 A;  3IB0 A;  3C32 A;  3HV1 A;  4O3A A;  3L6H A;  2E0S A;  4KPT A;  3E78 A;  4HW8 A;  1VFE A;  2YJP A;  5ITO A;  4O8M A;  4QFL A;  4PFR A;  2ZNU A;  3KGC A;  1LLS A;  4FAT A;  3R6U A;  3V83 A;  1F9B A;  4R75 A;  4IB2 A;  3TCG A;  1H45 A;  5IZ1 A;  3GZG A;  4C0R A;  3D4G A;  5H8Q A;  1J1N A;  1MM7 A;  1ZLQ A;  2DVC A;  3A29 A;  1SW2 A;  4NF6 B;  1QJM A;  4OVP A;  4LON B;  4YU0 A;  5I59 B;  1MY4 A;  4M1V A;  1BTJ A;  4JWY A;  3IFC A;  3MYU A;  4EQB A;  3KN3 A;  1I6Q A;  4QXD A;  4ZEF A;  3GYY A;  3JV9 A;  2P3N A;  3S9M C;  1B6H A;  2DYX A;  3C35 A;  4MEV A;  2L5V A;  1YCJ A;  2Q8J A;  2I0B A;  5CRY A;  4ELR A;  4PAF A;  1P99 A;  2VD2 A;  5F7V A;  5HPQ A;  3G3H A;  1UTB B;  4OMB A;  1JP4 A;  4P3L A;  4AB6 A;  1FQA A;  1HSJ A;  4PGN A;  3T0J A;  1ZMG A;  3UOR A;  3TTR A;  2O84 X;  1M5D A;  2V4C A;  3BBR A;  1IMA A;  2V3T A;  1DK4 A;  1MY2 A;  1N3X A;  1KA1 A;  2NUV A;  3FXQ A;  5K2X A;  3FJM A;  4GWW A;  4KYE A;  2DOJ A;  3CVG A;  3ILU B;  3K1P A;  5B70 A;  3T9H B;  1QUJ A;  2AYS A;  2FNC A;  1LAH E;  2THI A;  3DRG A;  4EQ7 A;  2PFY A;  4QHQ A;  3VXC A;  4KXP A;  5TP9 B;  2RC7 A;  1YAE A;  2V84 A;  2FVZ A;  4OEV A;  3LSX A;  4DXC A;  3IB2 A;  1NH7 A;  3DP4 A;  1FBD A;  3A3C A;  3IOT A;  4THI A;  1LFG A;  5KZT A;  4NE4 A;  4FBP A;  1LST A;  4IO3 A;  4GFR A;  1MXW A;  1QUI A;  4DI3 D;  4EXK A;  2DWI A;  2QJE A;  3O97 A;  1DPP A;  5I5P A;  3VFJ A;  3AXF A;  2H9B A;  4IO5 A;  1LBB A;  3FVG A;  1SI1 A;  5CI5 A;  3C31 A;  2XXU A;  3FVK A;  3FXB A;  3RGY A;  1R1N A;  4NWC A;  5KCJ B;  4POW A;  2ZYN A;  2CEY A;  5JEI A;  4GX3 A;  2O7I A;  3HCQ A;  5TPA A;  1PEB A;  3IR1 A;  4PAI A;  4QSE A;  1NNT A;  4NF5 B;  4GIZ A;  4I3Y A;  3QXM A;  1VFD A;  5H8N A;  1TWY A;  5AA4 A;  5IZ3 B;  3E79 A;  2AL5 A;  1D3K A;  3MUQ A;  1B5J A;  1MM6 A;  3RLF E;  4Q0C A;  1GTK A;  1TT1 A;  1Y3Q A;  3Q28 A;  1Z7M E;  1NNK A;  1RYX A;  1A40 A;  3S9N C;  2UXA A;  2FBP A;  1G0I A;  1O63 A;  2I58 A;  1Q35 A;  4DCY A;  3B7D A;  4R6Y A;  2B4L A;  3EQ1 A;  2DWJ A;  4IO6 A;  3D4C A;  3FUZ A;  4NHB A;  3U65 A;  4KCD A;  1QW0 A;  3Q25 A;  1A8F A;  4WKM A;  4YB6 A;  1FBG A;  2G93 A;  1FRP A;  3KFM A;  1LCF A;  2OCU A;  5H8H B;  1B3E A;  4N4U A;  3UA8 A;  1UIU A;  3MPK A;  2QL3 A;  1KWH A;  1MQJ A;  3W9V A;  4PGP A;  1B46 A;  1IIW A;  4N17 A;  4G8H A;  1QGX A;  3KJT A;  4YIC A;  3VLW A;  1BIY A;  1LGB C;  1FQF A;  2FA7 A;  4O3B A;  1Y4T A;  1B9J A;  2I0C A;  4PCD A;  5IGA A;  1NNF A;  3FIR A;  3U92 A;  4R73 A;  3IK6 B;  2XXQ A;  3H6W A;  3C33 A;  3IL1 B;  1EU8 A;  1MXX A;  2QVV A;  3ECR A;  3DP8 A;  2XXY A;  3EHU A;  4ECF A;  4ELP A;  2R9J A;  1NV6 A;  1K9Y A;  1MH4 A;  4OYV A;  1LFI A;  4KFQ A;  2CZL A;  4G68 C;  1YPN A;  4XKQ A;  4OVR A;  4YKJ A;  1AIV A;  4OEU A;  4ZEC A;  2YLN A;  3CSG A;  1XVY A;  3WAE A;  3FAS A;  1H44 A;  4U21 A;  1INP A;  2XXK A;  5ICT A;  5ET6 A;  3RY3 A;  4P0I A;  5DW8 A;  4N6P A;  4H45 A;  3EKI A;  4I62 A;  2QFL A;  5JTY A;  3DEL B;  4FAJ A;  4JVD A;  2UVH A;  1FTJ A;  1PDA A;  1EZO A;  4QSD A;  1FTA A;  1ZIU A;  3TEL A;  3OEL A;  4TLL B;  2DWH A;  3O66 A;  5CMM A;  2UYE A;  4C1U A;  3M8U A;  2X7Q A;  3SET A;  2A5T A;  4RNS A;  4OQO A;  3UIF A;  1ZBM A;  4NTL A;  3RT8 A;  1EH3 A;  4PE3 A;  4G4P A;  4F19 A;  1KZ8 A;  2ONR A;  4XIG Q;  3PPO A;  1FPB A;  1SW1 A;  2GHB A;  2H25 A;  4G68 B;  4OA4 A;  1MXZ A;  1NH8 A;  1O7T A;  1JVY A;  3OEN A;  4JVI A;  4Q30 B;  2I3W A;  2XA5 A;  3TCF A;  4R6K A;  1EYK A;  1I6B A;  4MNI A;  2F7B A;  1MS7 A;  1B40 A;  4H0W A;  4GWY A;  2R6G E;  2ZZX A;  4KCC A;  5JK4 A;  4ZEI A;  3GBA A;  3H3G A;  3DRK A;  3UGW A;  1B58 A;  1OIB A;  1OVT A;  1MPD A;  4ISU A;  4KHZ E;  4R2F A;  4P0G A;  2Z8F A;  3T9V A;  1BLF A;  1QKA A;  4MHF A;  4ND9 A;  2CZH A;  3E13 X;  1AL3 A;  4NF8 A;  4NG7 A;  4ESW A;  3K1N A;  1Y3P A;  1Y20 A;  1ZJL A;  4PBQ A;  3TZA A;  3MST A;  1G0H A;  4HS7 A;  4PF6 A;  3M3F A;  3IO6 A;  2Q8M A;  3IOW A;  1MDP 1;  5CMB A;  5I2K B;  2PVU A;  1CE2 A;  4TQU Q;  1N3W A;  4NMY A;  1XS5 A;  4I1D A;  1NI9 A;  1WDN A;  3O6P A;  3W9W A;  2ESN A;  4TLM B;  2HFB A;  4G8N A;  3T9U A;  4GWU A;  3N6U A;  3W15 C;  3KOS A;  3PMW A;  1MG1 A;  4NAP A;  1ZTY A;  4PTK A;  4RK2 A;  3FJ7 A;  4NF4 A;  3V8X B;  4F3B A;  3B6T A;  4XF5 A;  1AWB A;  1B3F A;  5J16 A;  1BKA A;  4DDD A;  1LBW A;  1MQD A;  3K2D A;  3V5A A;  2X26 A;  4XXU A;  3HPI A;  2KR0 A;  2JJK A;  3DRI A;  5TU0 A;  3C34 A;  2VHA A;  1XC1 A;  3K01 A;  5DTB A;  3H6U A;  3NOH A;  2P2A A;  2HZL A;  2I3V A;  1FCK A;  1B52 A;  1UIV A;  4KD5 A;  4PP0 A;  1B2H A;  1NFT A;  2Z8E A;  4KYS A;  4EXL A;  4YB7 A;  4NED A;  4F3G A;  3PUY E;  4UAB A;  5IAI A;  2R8T A;  1YZ0 A;  4LQ5 A;  4LN5 A;  3FVO A;  3F11 A;  4RXL A;  2GH9 A;  3HHF A;  4F1U A;  2HEU A;  3PPR A;  5CBS A;  2DWA A;  3RUM A;  3FTO A;  5LDZ A;  5ET7 A;  3EN3 A;  5DEX B;  3SZP A;  1URD A;  4N07 A;  1FTM A;  2Q2A A;  3N6T A;  4RYA A;  3SEU A;  4OXV A;  1LB9 A;  3H03 A;  1OQH A;  1Z7N E;  4RA1 A;  3O9P A;  5IZZ A;  2XXI A;  3MAM A;  4OVQ A;  2PYY A;  1EYI A;  3LSF B;  3QYT A;  2D5W A;  2XX9 A;  4RJZ A;  1SW5 A;  2Q2C A;  1XHY A;  1FBH A;  1IXH A;  5DVJ A;  4JWX A;  3CSB A;  2O51 A;  5FHN A;  1SD3 A;  1MQI A;  3ODB A;  1S9T A;  3U72 A;  2XXW A;  4DLD A;  2OWS A;  3HHG A;  1YTV A;  2DP8 A;  2QMW A;  3H7M A;  3VVE A;  5BWJ A;  1UTH A;  4GX4 A;  2H5Y A;  1QUK A;  3KC1 A;  1IEJ A;  1VSO A;  2RC8 A;  2F97 A;  5FBP A;  5EQ8 A;  3M3L A;  1LCT A;  4FED A;  3MVX A;  4Z0I A;  3SKP A;  3BKI B;  4N8Y A;  1URS A;  2XD3 A;  1A99 A;  2CZI A;  4H6D A;  4U4S A;  5I58 A;  3IFA A;  3U94 A;  3KG2 A;  1FQD A;  2Y7R A;  1FBF A;  2XX8 A;  4QRZ A;  1LBX A;  1NV5 A;  1USY E;  3PGF A;  1NV7 A;  1MQG A;  1VR5 A;  4BDQ A;  2PFZ A;  4GQO A;  4U2R A;  3VE1 B;  2F7C A;  2WOP A;  3HFU A;  4FEB A;  1B3L A;  2DE4 A;  2RC9 A;  3WAF A;  5EQA A;  1SYI A;  3PTY A;  3CG3 A;  2UVG A;  3SEV A;  5AA3 A;  2DVZ A;  1FPK A;  4F39 A;  3FAT A;  3OO8 A;  2CEX A;  5ITP A;  3I5O A;  1ANF A;  2OZZ A;  2XXR A;  3DM0 A;  5KDT A;  1VE4 A;  3R26 A;  1JW5 A;  2KLF A;  1PB7 A;  2PCR A;  1YXI A;  3ISP A;  5ET5 A;  3LSL A;  1N7X A;  4GLI A;  1FBE A;  2REJ A;  5I84 A;  2QMX A;  2Z8D A;  5EYH A;  2F6P A;  1NV0 A;  3K6U A;  1LAF E;  3PUV E;  3CFZ A;  1MY1 A;  1LFH A;  4QFP A;  2F78 A;  3IOU A;  2HQ0 A;  4G2Z A;  1B5I A;  4PFY A;  4NF6 A;  2REG A;  3SEX A;  3KOT A;  3S4U A;  1P1U A;  5I59 A;  1FJ9 A;  2V3U A;  4MBP A;  1B0L A;  3TTM A;  1NV1 A;  1NUW A;  5CMK A;  5CM6 A;  1JW4 A;  4C1T A;  1A8E A;  1B32 A;  4HTG A;  5LTC A;  1FQC A;  2OK2 A;  4LAT A;  2D3I A;  5B7D A;  1PBQ A;  2UVI A;  1NL5 A;  3PD8 A;  1K9Z A;  1Y3N A;  4RPN A;  2PX1 A;  2DS9 A;  3IB1 A;  4I3E A;  3TTK A;  4U23 A;  1UTB A;  4PE5 B;  1EYJ A;  3TUS A;  3GLB A;  3BIG A;  3O6G A;  5J1D A;  3TMG A;  4FIM A;  2ONS A;  2ZYM A;  1FBP A;  1B4H A;  4KYD A;  4ELQ A;  1B0H A;  3KZG A;  4OVT A;  2DDK A;  5A5X B;  4R2B A;  3QMF A;  3JZJ A;  3IOR A;  2WKY A;  3U8Q A;  4F29 A;  5AA2 B;  5F1Q A;  1RDZ A;  4DE8 A;  2OJT A;  2GRV A;  4X1D A;  2OWT A;  4JWO A;  3SDF A;  2RCA A;  5I3S A;  4EUO A;  4F1Y A;  4U4X A;  1A54 A;  1RDX A;  2XXV A;  3EHS A;  3PU5 A;  4QFK A;  3CG1 A;  2DE2 A;  2Y5K A;  2XXX A;  1MY0 A;  4OVS A;  4WXJ A;  1DOT A;  2Y7K A;  2ZYO A;  1FJ6 A;  5I2N B;  1URG A;  2B3B A;  1JW1 A;  3O6H A;  1B3G A;  4GWX A;  3O2A A;  4MJO A;  4FEC A;  2VPO A;  1D9Y A;  5DVF A;  3O28 A;  5I57 B;  4LZ7 A;  4ELO A;  3ZKK A;  3MPL A;  4U22 A;  4EQ9 A;  1XT8 A;  2ANJ A;  3HN0 A;  2UVJ A;  5CBR A;  3B6Q A;  2XWI A;  4LUB A;  3SER A;  3CIJ A;  4X8R A;  2HZK A;  3THI A;  1FPG A;  3V89 B;  4BLA A;  4FJP A;  4AQ4 A;  2GHA A;  3IO4 A;  1HSL A;  2ZNS A;  4BDM A;  4YKP A;  1R9L A;  3KC0 A;  2G29 A;  3LSW A;  3TEP A;  1DCU A;  4N6K A;  1SVX B;  2RKM A;  5KCJ A;  3ZKL A;  1S50 A;  3MWB A;  4N13 A;  3BFT A;  1FPJ A;  4IGR A;  4PET A;  3OD7 A;  3OO7 A;  3L6G A;  4NF5 A;  1QKB A;  5AE4 A;  1XOC A;  3T1B A;  1AH5 A;  4OFL A;  4GOT A;  4GXA A;  4QBA A;  5FHO A;  1IMC A;  2QS2 A;  3KN7 A;  1R6Z A;  1I6A A;  3QSL A;  4HXV A;  3RN8 A;  4PFI A;  3FXU A;  5I56 B;  1OMP A;  1B7H A;  3MW0 A;  2WBB A;  2HAV A;  3CFX A;  1M5E A;  4R9F A;  3TTL A;  2ZXT A;  3EHT A;  3PUX E;  3S2V A;  2RCB A;  4I40 A;  1US5 A;  4NF4 B;  4YZZ A;  4UAC A;  4PF8 A;  1RYO A;  1ELJ A;  1MXV A;  3K1M A;  2OX3 A;  2F5X A;  2F8D A;  2Z22 A;  1TFA A;  5A5L A;  4GWZ A;  1NUX A;  3ROJ A;  3I6V A;  4N91 A;  4H67 A;  5H8H A;  4ONY A;  1SDX A;  1Y1Z A;  2QVR A;  1JQF A;  1LAX A;  2XXH A;  3VVF A;  2PT2 A;  4KI0 E;  3G3I A;  2WBD A;  1IMB A;  2VT5 A;  4WEP A;  1ZU0 A;  4OFO A;  1IXC A;  4F2O A;  2O69 A;  4P56 A;  4QF9 A;  4XKN A;  3LV0 A;  1FTK A;  1FPI A;  4E0W A;  3MZB A;  3RYA A;  5LOM A;  2KQZ A;  3RPL B;  1MXU A;  3OXN A;  4GRK A;  4DCX A;  1MQH A;  1B1X A;  4PAK A;  3OMB A;  4OAN A;  3TYH A;  1US4 A;  1M5C A;  3VLV A;  1LAG E;  3TAJ A;  3ILT B;  4F1V A;  1MPC A;  4IO2 A;  2Q88 A;  3Q29 A;  4K3F A;  4LP2 B;  1GV8 A;  1DPE A;  4JBZ A;  4O94 A;  2E1S A;  3PMV A;  4JB7 A;  1FPD A;  1NV3 A;  1PB9 A;  2BJJ X;  3KBR A;  4UA8 A;  5H8F A;  5H8Q B;  1A7L A;  4IY5 A;  3IJO B;  1SBP A;  2A5S A;  3HST A;  4PFU A;  1NV2 A;  2PBW A;  4H65 A;  1SI0 A;  3FV2 A;  2F7A A;  2ABH A;  3C4M A;  4M4G A;  1POT A;  4GF8 A;  1OQG A;  2W7Y A;  1CNQ A;  3LBS A;  3OSQ A;  2DXR A;  1FTL A;  4IO7 A;  4P47 A;  2WYP A;  1GGG A;  4ZZE A;  3U1O A;  4MH5 A;  4OWD A;  3TCH A;  4O3C A;  3MVW A;  1FQE A;  1OVB A;  1AOV A;  1Q9D A;  2B3F A;  2I4B A;  4P1L A;  1H76 A;  3FGS A;  1OLC A;  4HCW A;  2ZZV A;  1M5B A;  5ESY A;  3PPP A;  4HCY A;  3G7W A;  2RIN A;  4FOR A;  3G3G A;  1WVJ A;  2Z23 A;  4GVO A;  1O64 A;  4QSC A;  1IZ1 A;  3T93 B;  3A09 A;  4G68 A;  4ZED A;  2NXO A;  4MIJ A;  2BJI A;  4DZ1 A;  1UQW A;  4MLQ A;  1KA0 A;  1I69 A;  2HHM A;  1IMD A; 
#chains in the Genus database with same CATH homology
 5EHM A;  1Y1M A;  4MF3 A;  4LA9 A;  3DRJ A;  1A55 A;  4OFJ A;  4YMB A;  4NWD A;  5DVI A;  1AMF A;  3PV0 E;  3PUW E;  3P7I A;  4F22 A;  4F3S A;  1H3D A;  3DP6 A;  3SES A;  3MJN A;  5DYH A;  2HXW A;  4F3P A;  2QSX A;  3FJG A;  1MRP A;  4YKK A;  3U93 A;  2QS1 A;  3R7X A;  5CC2 A;  4OZ9 A;  3TQW A;  4E0X A;  3FXR A;  5I2K A;  4ZZA A;  4G77 A;  3QK6 A;  1N04 A;  3OSR A;  3B6W A;  2P1S A;  1JEU A;  2OLB A;  3KEI A;  4F31 B;  3DRH A;  2ZMB A;  1MXY A;  1DTZ A;  4R74 A;  2IEE A;  2WOK A;  4DIG A;  4YAH X;  3GBB A;  1SYH A;  2M8C A;  5TPA B;  2PMS A;  3MQ9 A;  4EDP A;  4DXU A;  3PMX A;  4JXI A;  5H8N B;  5AA4 B;  3LVU A;  2DSF A;  1XVX A;  3MP1 A;  3Q26 A;  5HM4 B;  1P1Q A;  3EPE A;  3N94 A;  3RTW B;  1ZKB A;  3K6V A;  1Y9U A;  4WED A;  4I8C A;  1EZ9 A;  1PBP A;  1QUL A;  1OLA A;  2VP1 A;  1T0K A;  4PFT A;  4QFN A;  2V25 A;  4OET A;  1P1N A;  3G3F A;  5ELV A;  2Y7P A;  3GXA A;  3KN8 A;  2HCA A;  2ZYK A;  5EHS A;  2F6G A;  1DTG A;  2I48 A;  3S9L C;  1H43 A;  3QAX A;  5L9S A;  5DEX A;  2F35 A;  3E4R A;  3OO6 A;  4JSO A;  3OEM A;  3OEK A;  1P1W A;  4JDF A;  4AB5 A;  4BDR A;  1HSE A;  2D21 A;  4BDO A;  2AIX A;  4YB5 A;  4OHN A;  3QUJ A;  3N5L A;  1N7W A;  5BUU A;  3MP6 A;  1FW0 A;  3QIM A;  1BP5 A;  4Q8R A;  4ZE8 A;  2I4C A;  4OVJ A;  3CR9 A;  4POX A;  2I49 A;  4GL8 A;  4LQ2 A;  1P1O A;  2ONK E;  3VLU A;  4KR5 A;  1N0T A;  3M3K A;  3LR1 A;  2V3Q A;  5AA1 A;  4ZDM A;  5M2V A;  3I3V A;  1D9V A;  4OES A;  4U1Z A;  3SEW A;  4JSD A;  3ZSF A;  2GFE A;  1PB8 A;  1QVS A;  1NKX A;  1DMB A;  1MPB A;  2PT1 A;  2NVU B;  3E9X A;  2O68 A;  1N76 A;  1Y4C A;  5JTY B;  1FQB A;  1B1H A;  3H06 B;  1B7U A;  4F18 A;  4BDL A;  4ZEK A;  2QS4 A;  2P0S A;  2VGQ A;  5DT6 A;  3MBP A;  2B65 A;  2A5T B;  1JNF A;  1IXI A;  2B4M A;  4GXS B;  1WOD A;  2WOL A;  1IIT A;  5TP9 A;  4XKR A;  5ISU A;  4G8M A;  3VVD A;  3UK4 A;  3G3J A;  3OOA A;  1JEV A;  4H5F A;  2F34 A;  3FV1 A;  3MVZ A;  2XX7 A;  3MP8 A;  3CI8 A;  3G3K A;  3A3U A;  3TQL A;  3T22 A;  1B51 A;  3RQT A;  3PPQ A;  2FYI A;  3C9H A;  2H99 A;  3TKD A;  5CMC A;  3H6V A;  3VDF A;  1S7Y A;  3H6T A;  2UYF A;  3IOV A;  2LAO A;  3RYB A;  4H1X A;  1TXF A;  4LZ5 A;  2OBG A;  4F2Q A;  3N26 A;  4R9G A;  2Y7W A;  4PQJ A;  3TDJ A;  1D4N A;  4YMA A;  4ZEB A;  3QUF A;  4NF8 B;  4QFO A;  3KSJ A;  1M5F A;  4H8I A;  3K00 A;  4GL0 A;  4OTE A;  4Q5T A;  3SEY A;  4MLV A;  3C36 A;  3FVN A;  4XKP A;  2F36 A;  2Q9T A;  3RNN A;  4DXB A;  2Y84 A;  3O29 A;  3OO9 A;  1GVC A;  5H8F B;  1ATG A;  3IAZ A;  5ICQ A;  1JVX A;  1B3H A;  1EZP A;  3RPW A;  3MZ9 A;  3PAM A;  5L9O A;  4I9D A;  4H5G A;  1PC3 A;  2QRY A;  4R72 A;  2XXT A;  3H4Z A;  2XD2 A;  3PD9 A;  4EF2 A;  5A5X A;  4X9T A;  3VV5 A;  2VOZ A;  2HAU A;  1IUD A;  5L9M A;  5IKB A;  5AA2 A;  3K6X A;  3PUZ E;  2IA4 A;  2AL4 A;  1DSN A;  3BFU A;  4GD5 A;  3S9E A;  4X1B A;  4OEN A;  4IGT A;  3CFL A;  3CRB A;  4IO4 A;  5I2N A;  3LC8 A;  1RKM A;  2VD3 A;  4LZ8 A;  1R9Q A;  3VXB A;  4RPO A;  3DLN A;  3JYR A;  2DQV A;  2XHD A;  2X7P A;  1MY3 A;  1FTO A;  3LUY A;  4YKI A;  3T96 B;  5I57 A;  5FHM A;  1TFD A;  1B5H A;  5AA2 D;  4LVQ A;  3TPA A;  3USD A;  4RK9 A;  4PFW A;  2QPQ A;  3PPN A;  4MFI A;  1IXG A;  3EF7 A;  5EYF A;  4EF1 A;  1POY 1;  3K6W A;  1II5 A;  1B7Z A;  4IY6 A;  2NOO A;  3RT6 B;  1MDQ A;  4Z7E A;  2V93 A;  3IX1 A;  4ESX A;  3KJ7 A;  4P11 A;  2NWJ A;  3RTF B;  2ALU A;  4X48 A;  4R6H A;  1LB8 A;  3MVY A;  1SW4 A;  2I6E A;  2QS3 A;  1JET A;  4OER A;  5K2Y A;  2O6A A;  5L8D A;  3TFL A;  4KQP A;  3E3K A;  3MZ1 A;  4BDN A;  3ONM A;  3Q27 A;  5I56 A;  1IQ7 A;  3K0V A;  3K02 A;  4GWO A;  2RF1 A;  1UTH B;  2O1L A;  2CMO A;  5FTH A;  4U1O A;  3ZS6 A;  1N84 A;  3T66 A;  1B05 A;  1NNP A;  3TTN A;  2R71 A;  3FZV A;  5H8S A;  5I58 B;  3IJX B;  3TOD A;  1NMU A;  3DRF A;  1MH3 A;  4TOZ A;  4H8J A;  1LBC A;  2Q89 A;  3MC2 A;  3T9X B;  4RY1 A;  1SQY A;  3UP9 A;  2O7U A;  2XXP A;  2YPN A;  3K4U A;  1USY H;  1Q1K A;  4L17 A;  3HO7 A;  1B4Z A;  3CHG A;  2ZNT A;  5HBC A;  2H4I A;  2DXY A;  3FD3 A;  1L5T A;  4FE8 A;  4ZE9 A;  3UN6 A;  3O6I A;  2DE3 A;  2O1M A;  4ZS9 A;  2H98 A;  3KSX A;  4XTC Q;  5FTI A;  2Y7I A;  5KDT B;  1CB6 A;  1GR2 A;  3IB0 A;  3C32 A;  3HV1 A;  4O3A A;  3L6H A;  2E0S A;  4KPT A;  4HW8 A;  1VFE A;  2YJP A;  5ITO A;  4QFL A;  2ZNU A;  3KGC A;  1LLS A;  4FAT A;  3R6U A;  3V83 A;  1F9B A;  4R75 A;  4IB2 A;  3TCG A;  1H45 A;  3GZG A;  4C0R A;  3D4G A;  5H8Q A;  1J1N A;  1MM7 A;  1ZLQ A;  2DVC A;  1SW2 A;  4NF6 B;  1QJM A;  4YU0 A;  4LON B;  5I59 B;  1MY4 A;  4M1V A;  1BTJ A;  4JWY A;  4EQB A;  3KN3 A;  1I6Q A;  4ZEF A;  3JV9 A;  3S9M C;  1B6H A;  2DYX A;  3C35 A;  1YCJ A;  2Q8J A;  4ELR A;  2I0B A;  5CRY A;  1P99 A;  2VD2 A;  5F7V A;  5HPQ A;  3G3H A;  1UTB B;  4OMB A;  4AB6 A;  1FQA A;  1HSJ A;  3UOR A;  1ZMG A;  3TTR A;  2O84 X;  1M5D A;  3BBR A;  2V3T A;  1MY2 A;  1N3X A;  2NUV A;  3FXQ A;  5K2X A;  3FJM A;  4KYE A;  2DOJ A;  3CVG A;  3ILU B;  3K1P A;  5B70 A;  3T9H B;  1QUJ A;  2AYS A;  2FNC A;  1LAH E;  2THI A;  3DRG A;  4EQ7 A;  4QHQ A;  3VXC A;  5TP9 B;  2RC7 A;  1YAE A;  2V84 A;  4OEV A;  3LSX A;  4DXC A;  3IB2 A;  1NH7 A;  3DP4 A;  3A3C A;  3IOT A;  4THI A;  1LFG A;  5KZT A;  4NE4 A;  1LST A;  4IO3 A;  4GFR A;  1MXW A;  1QUI A;  4EXK A;  2DWI A;  2QJE A;  3O97 A;  1DPP A;  3VFJ A;  3AXF A;  2H9B A;  4IO5 A;  1LBB A;  3FVG A;  1SI1 A;  5CI5 A;  3C31 A;  2XXU A;  3FVK A;  3RGY A;  1R1N A;  4NWC A;  5KCJ B;  4POW A;  2ZYN A;  5JEI A;  2O7I A;  3HCQ A;  5TPA A;  1PEB A;  3IR1 A;  4QSE A;  1NNT A;  4NF5 B;  4GIZ A;  3QXM A;  1VFD A;  5H8N A;  1TWY A;  5AA4 A;  2AL5 A;  1D3K A;  3MUQ A;  1B5J A;  1MM6 A;  3RLF E;  4Q0C A;  1GTK A;  1TT1 A;  1Y3Q A;  3Q28 A;  1Z7M E;  1NNK A;  1RYX A;  1A40 A;  3S9N C;  2UXA A;  1O63 A;  2I58 A;  1Q35 A;  4DCY A;  3B7D A;  4R6Y A;  2B4L A;  3EQ1 A;  2DWJ A;  4IO6 A;  3D4C A;  3FUZ A;  4KCD A;  1QW0 A;  3Q25 A;  1A8F A;  4WKM A;  4YB6 A;  2G93 A;  3KFM A;  1LCF A;  2OCU A;  5H8H B;  1B3E A;  3UA8 A;  1UIU A;  3MPK A;  2QL3 A;  1KWH A;  1MQJ A;  3W9V A;  1B46 A;  1IIW A;  4G8H A;  3KJT A;  4YIC A;  3VLW A;  1BIY A;  1LGB C;  1FQF A;  2FA7 A;  4O3B A;  1Y4T A;  1B9J A;  2I0C A;  1NNF A;  3FIR A;  3U92 A;  4R73 A;  3IK6 B;  2XXQ A;  3H6W A;  3C33 A;  3IL1 B;  1EU8 A;  1MXX A;  3ECR A;  3DP8 A;  2XXY A;  3EHU A;  4ECF A;  4ELP A;  2R9J A;  1MH4 A;  4OYV A;  1LFI A;  4KFQ A;  2CZL A;  4G68 C;  1YPN A;  4XKQ A;  4YKJ A;  1AIV A;  4OEU A;  4ZEC A;  2YLN A;  3CSG A;  1XVY A;  3WAE A;  3FAS A;  1H44 A;  4U21 A;  5ICT A;  3RY3 A;  4P0I A;  4N6P A;  4I62 A;  5JTY A;  3DEL B;  4FAJ A;  2UVH A;  1FTJ A;  1PDA A;  1EZO A;  4QSD A;  1ZIU A;  3TEL A;  3OEL A;  4TLL B;  2DWH A;  3O66 A;  5CMM A;  2UYE A;  4C1U A;  3M8U A;  2X7Q A;  3SET A;  2A5T A;  4RNS A;  4OQO A;  3UIF A;  1ZBM A;  4NTL A;  3RT8 A;  1EH3 A;  4G4P A;  4F19 A;  2ONR A;  4XIG Q;  3PPO A;  1SW1 A;  2GHB A;  2H25 A;  4G68 B;  1MXZ A;  1NH8 A;  1O7T A;  1JVY A;  3OEN A;  4Q30 B;  2I3W A;  3TCF A;  4R6K A;  1I6B A;  2F7B A;  1MS7 A;  1B40 A;  4H0W A;  2R6G E;  4KCC A;  5JK4 A;  4ZEI A;  3GBA A;  3H3G A;  3DRK A;  3UGW A;  1B58 A;  1OIB A;  1OVT A;  1MPD A;  4ISU A;  4KHZ E;  4R2F A;  4P0G A;  2Z8F A;  3T9V A;  1BLF A;  1QKA A;  4ND9 A;  3E13 X;  1AL3 A;  4NF8 A;  4ESW A;  3K1N A;  1Y3P A;  1Y20 A;  1ZJL A;  3TZA A;  4HS7 A;  3M3F A;  3IO6 A;  3IOW A;  1MDP 1;  5CMB A;  5I2K B;  2PVU A;  1CE2 A;  4TQU Q;  1N3W A;  4NMY A;  1XS5 A;  4I1D A;  1WDN A;  3O6P A;  3W9W A;  2ESN A;  4TLM B;  2HFB A;  4G8N A;  3T9U A;  3N6U A;  3W15 C;  3KOS A;  3PMW A;  1MG1 A;  1ZTY A;  4RK2 A;  3FJ7 A;  4NF4 A;  3V8X B;  4F3B A;  3B6T A;  1B3F A;  1BKA A;  4DDD A;  3K2D A;  1MQD A;  3V5A A;  2X26 A;  4XXU A;  3HPI A;  3DRI A;  5TU0 A;  3C34 A;  2VHA A;  1XC1 A;  3K01 A;  5DTB A;  3H6U A;  2P2A A;  2HZL A;  2I3V A;  1FCK A;  1B52 A;  1UIV A;  4KD5 A;  4PP0 A;  1B2H A;  1NFT A;  2Z8E A;  4KYS A;  4EXL A;  4YB7 A;  4NED A;  4F3G A;  3PUY E;  5IAI A;  4LQ5 A;  3FVO A;  3F11 A;  4RXL A;  2GH9 A;  3HHF A;  4F1U A;  2HEU A;  3PPR A;  5CBS A;  2DWA A;  3RUM A;  3FTO A;  3EN3 A;  5DEX B;  1URD A;  4N07 A;  1FTM A;  4RYA A;  2Q2A A;  3N6T A;  3SEU A;  4OXV A;  1LB9 A;  3H03 A;  1OQH A;  1Z7N E;  4RA1 A;  3O9P A;  2XXI A;  3MAM A;  2PYY A;  3LSF B;  3QYT A;  2D5W A;  2XX9 A;  4RJZ A;  1SW5 A;  2Q2C A;  1XHY A;  1IXH A;  5DVJ A;  4JWX A;  3CSB A;  2O51 A;  5FHN A;  1SD3 A;  1MQI A;  3ODB A;  1S9T A;  3U72 A;  2XXW A;  4DLD A;  2OWS A;  3HHG A;  1YTV A;  2DP8 A;  2QMW A;  3H7M A;  3VVE A;  5BWJ A;  1UTH A;  2H5Y A;  1QUK A;  1IEJ A;  1VSO A;  2RC8 A;  2F97 A;  3M3L A;  1LCT A;  4FED A;  3MVX A;  4Z0I A;  3SKP A;  3BKI B;  1URS A;  2XD3 A;  1A99 A;  4H6D A;  4U4S A;  5I58 A;  3U94 A;  3KG2 A;  1FQD A;  2Y7R A;  2XX8 A;  4QRZ A;  1USY E;  3PGF A;  1MQG A;  1VR5 A;  4BDQ A;  4GQO A;  4U2R A;  3VE1 B;  2F7C A;  2WOP A;  4FEB A;  1B3L A;  2DE4 A;  2RC9 A;  3WAF A;  1SYI A;  3CG3 A;  2UVG A;  3SEV A;  5AA3 A;  2DVZ A;  4F39 A;  3FAT A;  3OO8 A;  5ITP A;  3I5O A;  1ANF A;  2OZZ A;  2XXR A;  3DM0 A;  5KDT A;  1VE4 A;  3R26 A;  1JW5 A;  2KLF A;  1PB7 A;  3LSL A;  1N7X A;  4GLI A;  2REJ A;  5I84 A;  2QMX A;  2Z8D A;  2F6P A;  3K6U A;  1LAF E;  3PUV E;  3CFZ A;  1MY1 A;  1LFH A;  4QFP A;  2F78 A;  3IOU A;  2HQ0 A;  4G2Z A;  1B5I A;  4PFY A;  4NF6 A;  2REG A;  3SEX A;  3KOT A;  3S4U A;  1P1U A;  5I59 A;  2V3U A;  4MBP A;  1B0L A;  3TTM A;  5CMK A;  5CM6 A;  1JW4 A;  4C1T A;  1A8E A;  1B32 A;  4HTG A;  1FQC A;  2OK2 A;  4LAT A;  2D3I A;  5B7D A;  1PBQ A;  2UVI A;  1NL5 A;  3PD8 A;  1Y3N A;  4RPN A;  2PX1 A;  2DS9 A;  3IB1 A;  3TTK A;  4U23 A;  1UTB A;  4PE5 B;  3TUS A;  3GLB A;  3O6G A;  5J1D A;  3TMG A;  4FIM A;  2ONS A;  2ZYM A;  1B4H A;  4KYD A;  4ELQ A;  1B0H A;  3KZG A;  5A5X B;  4R2B A;  3JZJ A;  3IOR A;  2WKY A;  3U8Q A;  4F29 A;  5AA2 B;  5F1Q A;  4DE8 A;  2OJT A;  2GRV A;  4X1D A;  2OWT A;  4JWO A;  3SDF A;  2RCA A;  4EUO A;  4F1Y A;  4U4X A;  1A54 A;  2XXV A;  3EHS A;  3PU5 A;  4QFK A;  3CG1 A;  2DE2 A;  2XXX A;  1MY0 A;  4WXJ A;  1DOT A;  2Y7K A;  2ZYO A;  5I2N B;  1URG A;  2B3B A;  1JW1 A;  3O6H A;  1B3G A;  3O2A A;  4FEC A;  1D9Y A;  5DVF A;  3O28 A;  5I57 B;  4LZ7 A;  4ELO A;  3ZKK A;  3MPL A;  4U22 A;  4EQ9 A;  1XT8 A;  2ANJ A;  3HN0 A;  2UVJ A;  5CBR A;  3B6Q A;  4LUB A;  3SER A;  3CIJ A;  2HZK A;  3THI A;  3V89 B;  4BLA A;  4FJP A;  4AQ4 A;  2GHA A;  3IO4 A;  1HSL A;  2ZNS A;  4BDM A;  4YKP A;  1R9L A;  2G29 A;  3LSW A;  3TEP A;  1SVX B;  2RKM A;  5KCJ A;  3ZKL A;  1S50 A;  3MWB A;  4N13 A;  3BFT A;  4IGR A;  4PET A;  3OD7 A;  3OO7 A;  3L6G A;  4NF5 A;  1QKB A;  5AE4 A;  1XOC A;  1AH5 A;  4OFL A;  4GOT A;  4GXA A;  5FHO A;  2QS2 A;  3KN7 A;  1R6Z A;  1I6A A;  3QSL A;  3RN8 A;  3FXU A;  5I56 B;  1OMP A;  1B7H A;  3MW0 A;  2HAV A;  3CFX A;  1M5E A;  4R9F A;  3TTL A;  2ZXT A;  3EHT A;  3PUX E;  3S2V A;  2RCB A;  1US5 A;  4NF4 B;  4YZZ A;  4UAC A;  1RYO A;  1ELJ A;  1MXV A;  3K1M A;  2F5X A;  2F8D A;  2Z22 A;  1TFA A;  3I6V A;  4H67 A;  5H8H A;  4ONY A;  1SDX A;  1Y1Z A;  1JQF A;  1LAX A;  2XXH A;  3VVF A;  2PT2 A;  4KI0 E;  3G3I A;  4WEP A;  1ZU0 A;  4OFO A;  1IXC A;  4F2O A;  2O69 A;  4QF9 A;  4XKN A;  1FTK A;  4E0W A;  3MZB A;  3RYA A;  5LOM A;  1MXU A;  3OXN A;  4GRK A;  4DCX A;  1MQH A;  1B1X A;  3OMB A;  3TYH A;  1US4 A;  1M5C A;  3VLV A;  1LAG E;  3TAJ A;  3ILT B;  4F1V A;  1MPC A;  4IO2 A;  2Q88 A;  3Q29 A;  4K3F A;  4LP2 B;  1GV8 A;  1DPE A;  4JBZ A;  2E1S A;  3PMV A;  4JB7 A;  1PB9 A;  2BJJ X;  3KBR A;  4UA8 A;  5H8F A;  5H8Q B;  1A7L A;  4IY5 A;  3IJO B;  1SBP A;  2A5S A;  3HST A;  4PFU A;  2PBW A;  4H65 A;  1SI0 A;  3FV2 A;  2F7A A;  2ABH A;  3C4M A;  4M4G A;  1POT A;  4GF8 A;  1OQG A;  2W7Y A;  3LBS A;  3OSQ A;  2DXR A;  1FTL A;  4IO7 A;  1GGG A;  3U1O A;  4ZZE A;  4MH5 A;  4OWD A;  3TCH A;  4O3C A;  3MVW A;  1FQE A;  1OVB A;  1AOV A;  2B3F A;  2I4B A;  1H76 A;  3FGS A;  1OLC A;  4HCW A;  1M5B A;  3PPP A;  4HCY A;  3G7W A;  2RIN A;  4FOR A;  3G3G A;  1WVJ A;  2Z23 A;  4GVO A;  1O64 A;  4QSC A;  1IZ1 A;  3T93 B;  3A09 A;  4G68 A;  4ZED A;  2NXO A;  4DZ1 A;  1UQW A;  4MLQ A;  1I69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...