1B6HA

Oligo-peptide binding protein complexed with lysyl-norvalyl-lysine
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGO-PEPTIDE BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
total genus 193
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b6hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b6hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b6hA02
3HHGA 5H8NA 4X1DA 3C34A 3PD9A 3DRJA 3EF7A 5FHNA 1H76A 4OTEA 3VDFA 4F19A 3OO7A 2PX1A 2VD2A 1O7TA 1FTLA 1B3FA 5L9SA 3IOTA 3PPQA 1B3GA 2QMWA 2XXVA 5DTBA 4BLAA 3FASA 4YKKA 4MLVA 1MY4A 1B0LA 3R26A 4YMBA 2XD2A 3LBSA 1ATGA 5I59A 5H8NB 3GXAA 1TT1A 2XXQA 2I0CA 4MLQA 1MQJA 3IORA 4HCWA 2X7QA 4PP0A 3U72A 2UXAA 3FJ7A 3UIFA 3CIJA 4BDQA 5I56A 5I84A 3OENA 3SERA 4R75A 3HO7A 2NXOA 3T22A 1OQHA 4U23A 3MPLA 2AYSA 5I59B 1MXUA 4RPOA 4RK9A 1IXHA 3OEKA 5BWJA 5H8FB 5AE4A 1FQCA 4H1XA 1MPDA 1PB9A 4ECFA 3BBRA 2HFBA 3QIMA 2HEUA 2P0SA 4RYAA 4IY6A 1URGA 1JVYA 1PBQA 4KCDA 3FXRA 4R73A 5I56B 1PC3A 5K2XA 4IO3A 1N7XA 2I3WA 5LOMA 1SI0A 3W9VA 3SETA 4H65A 2DWIA 2DS9A 4XXUA 2ZYOA 1LCFA 5B70A 1S50A 3O2AA 3M8UA 4TQUQ 1SD3A 1SYIA 4GIZA 3K6XA 2OLBA 4NE4A 1RYOA 1RYXA 3RY3A 1NNFA 2RF1A 1IQ7A 3DELB 2XXIA 3MVXA 2VP1A 5CBRA 3AXFA 2DQVA 3R6UA 3PUZE 3KZGA 1Y4TA 3G3IA 1ZMGA 1B5JA 3HHFA 2A5SA 1MQGA 4PETA 4GD5A 5K2YA 3MWBA 1I6QA 4OEUA 2H99A 5J1DA 1GGGA 2F6PA 3ILTB 4DXBA 2QL3A 4QSEA 3O6IA 3TUSA 4HS7A 3QSLA 4BDOA 1SQYA 4U1OA 5AA2D 4RJZA 3N5LA 1VFEA 1M5EA 3V89B 3SDFA 2FNCA 3FV2A 4G77A 2IA4A 3LVUA 1YAEA 3C32A 4R6KA 1I69A 4OFOA 3KGCA 3LUYA 1LFHA 1FTJA 2GHBA 3GZGA 4FATA 1MH3A 2DE2A 1XS5A 4P0IA 4M1VA 4N07A 4EF1A 2F36A 3TAJA 3W9WA 4DIGA 1MRPA 4R9GA 2A5TB 3PU5A 1NNKA 1AMFA 2O6AA 3RT8A 4F31B 3Q28A 2DXRA 3KOSA 2ZYNA 3FVKA 1MDP1 4QFLA 3PUWE 3CG1A 4R6YA 4JWOA 2G93A 2I3VA 4AB6A 4OFJA 3HSTA 3N6TA 3TODA 4DZ1A 3G3FA 2F7CA 3PUVE 5DVIA 3O97A 1IUDA 3TFLA 3M3LA 3MZBA 1ANFA 3VXCA 3KBRA 4N6PA 3T66A 1QULA 1B0HA 1TWYA 3KEIA 2O68A 3H06B 4THIA 3H6VA 2DOJA 2G29A 1A99A 3TPAA 2O7UA 3B6TA 2V93A 1HSEA 3M3FA 3M3KA 3DP6A 5JTYA 1BTJA 3JV9A 1QJMA 2O1LA 1FQFA 1B3HA 2QS3A 5DVJA 1MG1A 4ZECA 3FGSA 1AH5A 3ZS6A 1NH7A 2I4CA 2QS2A 4C1UA 4C0RA 1LSTA 3P7IA 4OVJA 5M2VA 3PPRA 1PBPA 3S9NC 3CFZA 4PE5B 1UIVA 3DRKA 3SEUA 3EHSA 3C35A 1I6AA 2Z8EA 4GXAA 3MPKA 1B2HA 2VD3A 2QPQA 4KR5A 1MXWA 3DLNA 3SEYA 3S9MC 2OZZA 4KCCA 1B05A 4X1BA 1FTOA 3IOUA 4PFYA 1LAGE 3N94A 3U1OA 2F5XA 2D3IA 3ECRA 2HXWA 4IO6A 5TU0A 4H5GA 1B1XA 3Q26A 3LSWA 3CSGA 3EQ1A 4MH5A 4NF6A 3HV1A 3H6TA 4EQBA 1Y3QA 4GF8A 3C36A 5ITOA 2ZXTA 5DVFA 4XTCQ 3TTMA 4GXSB 5F7VA 3H6WA 3E4RA 1Y3PA 5I2KA 4F3GA 4JB7A 4QRZA 4WKMA 3PPPA 1ZTYA 4OMBA 4DXCA 2I48A 3BFUA 1QUJA 3N26A 1LBCA 3OO8A 3S2VA 2V3TA 2ZMBA 3R7XA 4DLDA 4MFIA 2RKMA 1WODA 1SVXB 4NF6B 3ZSFA 4F1UA 3TMGA 2HZKA 1JEVA 4BDMA 1POTA 4G68A 2F7BA 3K6WA 1LLSA 2RCAA 4OENA 2OCUA 3RT6B 3G3KA 2RC8A 1R9LA 3KN7A 4OHNA 4Q8RA 1UTBA 2HAUA 3EHTA 1B5IA 1P1OA 1D4NA 4Z0IA 3S4UA 2NVUB 3EN3A 3D4CA 1YCJA 3DRGA 2XHDA 2R71A 3S9EA 3T9UA 4G68B 4GOTA 3TZAA 1URDA 1B40A 3BFTA 3S9LC 1QKAA 3FATA 4LZ7A 5L9OA 4KHZE 1T0KA 1B7HA 3RUMA 1JNFA 3G7WA 5L8DA 1JQFA 5AA4A 3IR1A 1B3EA 1UTBB 2QJEA 1OVTA 1Z7ME 1NFTA 2ZNUA 1FQBA 1P1WA 1EZOA 1A7LA 2QSXA 3K6VA 4G8HA 3OO6A 3MVYA 3ZKLA 5H8QA 2DWAA 3O6GA 1FQEA 3C33A 4U1ZA 5ELVA 4R6HA 3LSXA 2DYXA 3TQWA 3C9HA 4QSCA 3IAZA 4YB6A 5AA4B 4UA8A 1B4HA 1ZIUA 4RK2A 4JWXA 2GHAA 1N3WA 2PYYA 2Y7KA 4OETA 3CVGA 4KPTA 5HM4B 2F6GA 2UVHA 3FD3A 5CBSA 2I0BA 3K01A 5H8QB 2ZNTA 2THIA 5H8FA 5DEXB 4ELRA 1R9QA 4QF9A 1OLAA 3A09A 2Z8DA 3LSLA 4JSOA 4LP2B 3K02A 4OFLA 3THIA 1FQDA 1GR2A 2B65A 3KSJA 3QYTA 1NH8A 4R2BA 4I8CA 3SKPA 1L5TA 3Q29A 2Q88A 5AA3A 3FXQA 4LA9A 4H8IA 4KYDA 4HW8A 4P0GA 3IOWA 1M5FA 1ZBMA 1OIBA 3GBAA 2OBGA 4YAHX 1PDAA 2AIXA 5HPQA 1Q35A 3K0VA 2XX9A 3I6VA 2WOKA 2W7YA 2NUVA 4EF2A 2B4MA 3RGYA 3OMBA 3F11A 4ONYA 3KJ7A 2KLFA 4NF8A 3PMWA 1P1NA 1SYHA 2UVIA 4ZEKA 1II5A 1JW5A 4ISUA 4JXIA 4Q5TA 3LC8A 4AB5A 4FECA 3T93B 1USYE 4QFNA 1IXIA 2HQ0A 2Y84A 1NMUA 3Q25A 3IOVA 3QK6A 1D3KA 4Z7EA 3MBPA 5H8HB 1VE4A 4C1TA 1ELJA 4U4XA 4JBZA 3H03A 4NF8B 4YKPA 4EXLA 1XOCA 4RA1A 2F78A 2PBWA 3VV5A 3PV0E 2OWTA 1QVSA 1MPCA 1B58A 2WOPA 3WAFA 1DTZA 3JZJA 1P1QA 4NMYA 1JEUA 2Q8JA 3U92A 2A5TA 3RTWB 4LZ5A 3FJMA 3FV1A 4IO7A 3LSFB 4GFRA 4RXLA 3G3HA 1S9TA 1N0TA 4G4PA 3MUQA 3RLFE 4GL8A 4XKRA 4YZZA 3K1PA 3K6UA 1MXXA 3HPIA 1FTMA 3B6QA 3RQTA 1KWHA 1TXFA 3TKDA 1USYH 4MBPA 3DRFA 2DP8A 4E0XA 4BDLA 4ELQA 4F1VA 1P1UA 5I2NA 2XXRA 5FHMA 1SW5A 4H5FA 4F2QA 2I4BA 4FE8A 1WVJA 3V8XB 3SESA 4HTGA 5H8SA 4O3BA 1VFDA 1O63A 1IZ1A 2HCAA 4NWCA 1LBBA 4FEDA 2DWJA 1MM6A 4GVOA 3PPNA 1N3XA 1UQWA 3IO4A 3H4ZA 1Y1ZA 4F22A 1QKBA 3T9HB 5I2NB 3UGWA 3CRBA 3PMXA 4ESXA 2B3BA 2QS1A 3E9XA 4E0WA 4ZZAA 2Y7PA 2Q2CA 2XXUA 1PB7A 2YPNA 2REJA 1QUKA 3VXBA 3H3GA 1N84A 2E1SA 3RN8A 5CRYA 1US5A 4LQ2A 2V84A 4QSDA 4QFOA 4OXVA 4X48A 4KFQA 1TFDA 4POXA 1B1HA 1R1NA 1MPBA 4DDDA 4U22A 2XXYA 2Q9TA 4ZEFA 2DSFA 2O1MA 3VVDA 1VSOA 1ZKBA 1BP5A 4LATA 3UK4A 4IO2A 3KJTA 4DE8A 3VLUA 4ZDMA 1WDNA 3MW0A 3VVEA 4JWYA 1R6ZA 2DXYA 5CC2A 2XD3A 2VOZA 2XXTA 5CM6A 2F7AA 1BIYA 4OWDA 3QUJA 4FORA 4NWDA 3CFXA 3O6PA 3EPEA 1NNTA 1MY3A 4FIMA 1OLCA 1MY1A 3IB2A 2Y7IA 2QMXA 2ONKE 3PAMA 4ESWA 4HCYA 5ISUA 3VLVA 4ELPA 1LFIA 3TQLA 3PUYE 1ZJLA 1H3DA 3O66A 2Y7RA 1Y4CA 1FW0A 1ZU0A 2R9JA 2V3QA 3IO6A 5TP9A 1CB6A 3ZKKA 1POY1 3MVWA 1BLFA 4KYEA 4F18A 1RKMA 3USDA 4RY1A 1D9VA 3PUXE 5B7DA 4F29A 3LR1A 4JDFA 2WOLA 3H7MA 4QFPA 3DP8A 4NF4B 1MQIA 3SEWA 4F3BA 3RTFB 3MAMA 1FQAA 2Z22A 1FCKA 2D21A 3VVFA 4AQ4A 2O84X 3OSRA 3PD8A 1AL3A 1EZ9A 4KYSA 3JYRA 3OOAA 5TP9B 1JW4A 4FEBA 4M4GA 1SBPA 4KI0E 5ITPA 4XKNA 3TCHA 1B7UA 4G8NA 2E0SA 3RYAA 1B9JA 2GH9A 5CMKA 1MH4A 3K00A 2R6GE 3L6HA 1LB8A 4GRKA 1LFGA 1LGBC 4G8MA 4YB7A 4OEVA 4PFTA 4OZ9A 4WEPA 5KDTA 4MF3A 4I1DA 4L17A 3FUZA 3IX1A 3O29A 3H6UA 3KG2A 3T9XB 2Z23A 4RNSA 3CG3A 2PT2A 2B4LA 4F3SA 3CI8A 1N76A 4O3AA 3FIRA 5AA1A 5CI5A 3UN6A 4NEDA 5FTHA 4YKJA 1H43A 1YTVA 4IO4A 3SEXA 2PT1A 3O28A 1B32A 4R2FA 4P11A 3UA8A 3GLBA 3IJOB 2F35A 2RC7A 3OEMA 5KDTB 2UVJA 1A55A 3K1MA 4GQOA 4GLIA 2BJJX 2CZLA 1LCTA 5DEXA 1B7ZA 4POWA 1LAFE 1XC1A 4EUOA 1MQHA 4IGRA 3B7DA 2UYEA 4F39A 4U21A 3KOTA 2ALUA 4ZEBA 5A5XA 2H4IA 3U94A 3EHUA 4U2RA 1PB8A 4F3PA 3PMVA 4EXKA 4QFKA 2QRYA 3FXUA 5FTIA 5L9MA 2AL5A 1FTKA 4H8JA 4BDRA 4N13A 3MP8A 2DVZA 2XXXA 4XKPA 1URSA 1A40A 2V25A 1A8EA 5A5XB 4UACA 2WKYA 3DM0A 4OESA 2VGQA 4U4SA 1DMBA 2ONRA 1B4ZA 3IB1A 4FJPA 1IIWA 4LZ8A 1M5CA 4YMAA 1H45A 3DRIA 2DE4A 1PEBA 3SEVA 3MVZA 5DT6A 1Y20A 2H9BA 4TOZA 3ONMA 1SW2A 3FJGA 1SW1A 5H8HA 1IXGA 3UORA 4F2OA 3G3GA 3KN8A 1UIUA 2H25A 2D5WA 3E13X 4IB2A 1GVCA 3VLWA 3TTRA 3QAXA 4ND9A 2F97A 2RINA 3MC2A 2RCBA 4BDNA 1NKXA 2ZNSA 3TCFA 1B3LA 1B51A 4XKQA 2NWJA 5KZTA 3T96B 3OXNA 3VE1B 3MQ9A 4KD5A 3IJXB 3RYBA 2X26A 2F34A 1I6BA 3T9VA 3FZVA 5FHOA 1H44A 3FVNA 4TLMB 3CR9A 2YJPA 1CE2A 3A3CA 1LAHE 4NF5A 1NL5A 2QS4A 2REGA 4ZEIA 4I62A 3TCGA 2XXHA 4DXUA 1YPNA 4EDPA 4F1YA 2ANJA 2VHAA 2P1SA 4WXJA 2H5YA 2O51A 4TLLB 5CMCA 1B5HA 3ILUB 4IO5A 1DSNA 3Q27A 2V3UA 2CMOA 1M5BA 4NF5B 1EU8A 1MM7A 4YICA 1ZLQA 1TFAA 1A54A 2RC9A 4LONB 2XXPA 3E3KA 3MJNA 3K2DA 3KSXA 1XT8A 1LB9A 1Y9UA 1MY0A 2DWHA 1SI1A 4X9TA 3TTNA 2ZYMA 1XVYA 1QW0A 4ELOA 5AA2A 4GWOA 3RPWA 2M8CA 3VFJA 4DCXA 3QXMA 4LUBA 1DTGA 3MZ1A 5HBCA 4OQOA 4NTLA 1SDXA 4YB5A 5F1QA 4OERA 4ZEDA 1GV8A 4YU0A 2ZYKA 2XXWA 5EHMA 3N6UA 2LAOA 4R72A 4PFWA 2Z8FA 4H67A 2HZLA 3HN0A 3G3JA 3OSQA 3TYHA 1B6HA 4K3FA 5AA2B 2HAVA 2NOOA 1DOTA 2ONSA 3MZ9A 1DPPA 1AIVA 2I6EA 3L6GA 3PPOA 1JVXA 2UVGA 2DVCA 3CFLA 5CMMA 4R9FA 3CHGA 5BUUA 4I9DA 3C4MA 1HSJA 3DP4A 2AL4A 1US4A 3QUFA 4JSDA 3O9PA 2O7IA 4WEDA 2Q89A 1LAXA 4H0WA 2OJTA 3FVGA 2XX7A 2F8DA 4IY5A 3DRHA 5I57A 3B6WA 2OWSA 1SW4A 1A8FA 2ABHA 3ODBA 4GL0A 4OYVA 5JTYB 3K1NA 4DCYA 1B52A 1S7YA 2GRVA 1MXZA 5KCJA 5I58A 3KFMA 5JEIA 1D9YA 4NF4A 3V83A 4G68C 3U8QA 4QHQA 2GFEA 4FAJA 2OK2A 4RPNA 1XHYA 3KN3A 1OQGA 3RNNA 3K4UA 3UP9A 1N04A 3WAEA 4G2ZA 2PVUA 5I57B 3OD7A 1OVBA 1MQDA 2XX8A 2FA7A 1M5DA 2Y7WA 1MS7A 3A3UA 1Q1KA 2P2AA 2H98A 4LVQA 3GBBA 3OO9A 1XVXA 2YLNA 5KCJB 3IK6B 5I58B 2ESNA 1P99A 1NNPA 1F9BA 3TEPA 3HCQA 1AOVA 4Q30B 3IB0A 2X7PA 4LQ5A 1JETA 4KQPA 3TTKA 3I3VA 2PMSA 5JK4A 1MXVA 3V5AA 2DE3A 5TPAA 4ZS9A 3OELA 4R74A 3PGFA 5CMBA 1DPEA 3O6HA 2Q2AA 5EYFA 4PQJA 1UTHA 1QUIA 1MXYA 4ZE8A 3W15C 1O64A 2UYFA 1IEJA 1Y3NA 4ZZEA 1JW1A 3C31A 5EHSA 3U93A 4PFUA 1GTKA 3MP1A 1OMPA 5I2KB 1Y1MA 2B3FA 5TPAB 3FTOA 5ICQA 1HSLA 1J1NA 1IITA 3FVOA 1Z7NE 3IL1B 4O3CA 4EQ9A 1UTHB 3I5OA 3TDJA 1MY2A 4H6DA 2I58A 4ZE9A 1MDQA 3D4GA 5IKBA 1B46A 2I49A 1EZPA 4Q0CA 5DYHA 2FYIA 2IEEA 4YKIA 3MP6A 2O69A 4IGTA 1BKAA 3TELA 1EH3A 4EQ7A 5IAIA 1IXCA 3BKIB 1N7WA 1VR5A 3CSBA 4XIGQ 3TTLA 5ICTA
chains in the Genus database with same CATH superfamily
3HHGA 5H8NA 4X1DA 3C34A 3PD9A 3DRJA 3EF7A 5FHNA 1H76A 4OTEA 3VDFA 4F19A 3KC0A 3OO7A 2PX1A 2VD2A 1O7TA 5IGAA 1FTLA 1B3FA 4PAIA 5L9SA 3IOTA 3PPQA 1B3GA 2QMWA 4OVPA 2XXVA 5DTBA 4BLAA 3FASA 4YKKA 4MLVA 1MY4A 1B0LA 4PAFA 3R26A 4P8BA 4YMBA 2XD2A 3LBSA 1ATGA 1NV3A 5I59A 5H8NB 3GXAA 1TT1A 1FPBA 2XXQA 2I0CA 2QVUA 4MLQA 1MQJA 5ET5A 3IORA 5ESYA 4HCWA 2X7QA 4PP0A 3U72A 2UXAA 3FJ7A 3UIFA 3CIJA 4HE1A 4BDQA 5I56A 5I84A 3OENA 3SERA 4R75A 3HO7A 1RDZA 2NXOA 3T22A 1OQHA 4U23A 3MPLA 2AYSA 5I59B 3RPLA 1MXUA 4RPOA 4RK9A 1IXHA 3OEKA 5BWJA 5H8FB 5AE4A 1FQCA 4H1XA 2CZKA 1MPDA 1PB9A 1FPGA 4ECFA 3BBRA 2HFBA 3QIMA 2HEUA 2P0SA 4RYAA 4IY6A 1URGA 1FPDA 4JVDA 1JVYA 1PBQA 4KCDA 3FXRA 4HXVA 4R73A 4NHBA 4QBAA 5I56B 4GBWA 1PC3A 4PBQA 4IO3A 1N7XA 2I3WA 5K2XA 5LOMA 1SI0A 3W9VA 3SETA 4H65A 2DWIA 2DS9A 4XXUA 2ZYOA 1K9YA 1FBPA 1LCFA 3RPLB 5B70A 1S50A 3O2AA 1INPA 3M8UA 4TQUQ 1SD3A 1SYIA 2XWKA 4GIZA 3K6XA 2OLBA 4NE4A 1RYOA 1RYXA 3RY3A 1NNFA 2RF1A 1IQ7A 3DELB 2XXIA 3MVXA 2VP1A 5CBRA 3AXFA 2DQVA 4GWUA 3R6UA 3PUZE 3KZGA 1Y4TA 3G3IA 3ISPA 1ZMGA 1B5JA 3HHFA 2A5SA 1MQGA 4PETA 4GD5A 5K2YA 3MWBA 1I6QA 4OEUA 2H99A 5J1DA 1GGGA 2F6PA 2Q74A 3ILTB 4DXBA 2QL3A 4QSEA 3O6IA 3TUSA 4HS7A 2WBDA 3LUZA 3QSLA 4BDOA 1SQYA 4U1OA 5AA2D 3MSTA 4RJZA 3N5LA 1VFEA 1M5EA 3V89B 3SDFA 2FNCA 3FV2A 4G77A 2IA4A 3LVUA 1YAEA 3C32A 4R6KA 1I69A 2WBBA 2VPNA 4OFOA 3KGCA 3LUYA 1LFHA 1FTJA 2GHBA 3GZGA 4GBVA 2WEFA 4FATA 1MH3A 2DE2A 1XS5A 1NV4A 4P0IA 4M1VA 4N07A 4EF1A 2F36A 3TAJA 3W9WA 4DIGA 1MRPA 4R9GA 5EQ8A 2A5TB 2P3NA 3PU5A 1NNKA 1AMFA 4GX3A 2O6AA 3RT8A 4F31B 3Q28A 2DXRA 3KOSA 2ZYNA 3FVKA 1MDP1 4QFLA 3PUWE 3CG1A 4JVCA 4R6YA 2MKZA 5ET6A 4JWOA 2G93A 2I3VA 4AB6A 4OFJA 3HSTA 2ZZXA 4MJOA 3N6TA 2WYPA 3TODA 4DZ1A 3G3FA 2F7CA 3PUVE 5DVIA 3O97A 1IUDA 3TFLA 3B8BA 3M3LA 4N8GA 3MZBA 1ANFA 3VXCA 3KBRA 4N6PA 3T66A 1QULA 1B0HA 1TWYA 3KEIA 2O68A 3H06B 4THIA 3H6VA 2DOJA 2G29A 1A99A 3TPAA 2O7UA 3B6TA 2V93A 1HSEA 3M3FA 3M3KA 3DP6A 5JTYA 1BTJA 3JV9A 1QJMA 2O1LA 1FQFA 1B3HA 3GYYA 2QS3A 4MNIA 5DVJA 4MCOA 1IMDA 1MG1A 4ZECA 3FGSA 1AH5A 3ZS6A 1NH7A 2I4CA 2QS2A 4C1UA 4C0RA 3NOHA 1LSTA 3P7IA 4OVJA 2WYKA 5M2VA 1NV6A 2F3DA 2QVRA 3PPRA 1PBPA 3S9NC 3CFZA 4PE5B 1UIVA 3DRKA 3SEUA 3EHSA 1NUZA 3C35A 1I6AA 1NUWA 4P56A 4AS5A 2Z8EA 4P1EA 4X8RA 2XWVA 4GXAA 3MPKA 1B2HA 2VD3A 2QPQA 4KR5A 4N6KA 1MXWA 3DLNA 3SEYA 3S9MC 2GQ1A 4XFEA 2OZZA 4KCCA 1B05A 4X1BA 1FTOA 3IOUA 1VDWA 4PFYA 1K9ZA 2PFYA 4NQ8A 1LAGE 3N94A 1QGXA 3U1OA 2F5XA 2D3IA 3ECRA 2HXWA 4IO6A 5TU0A 4H5GA 4OA4A 1B1XA 3Q26A 3LSWA 3CSGA 3EKIA 3EQ1A 4MH5A 4NF6A 3HV1A 3H6TA 4EQBA 1Y3QA 4GF8A 3C36A 2FIXA 5ITOA 2ZXTA 5DVFA 4XTCQ 3TTMA 4GXSB 5F7VA 3H6WA 2FBPA 2CZIA 3E4RA 1Y3PA 5I2KA 4F3GA 4JB7A 4JVIA 4QRZA 4WKMA 3PPPA 1ZTYA 4OMBA 4DXCA 2I48A 3BFUA 1QUJA 3N26A 1LBCA 3OO8A 3S2VA 5EQAA 2V3TA 2ZMBA 3R7XA 4DLDA 4MFIA 2RKMA 1WODA 1SVXB 4NF6B 3ZSFA 4F1UA 3TMGA 2HZKA 1JEVA 4BDMA 5I5PA 1POTA 4P3LA 4G68A 2F7BA 3K6WA 1LLSA 2RCAA 4OENA 2OCUA 3RT6B 3G3KA 2RC8A 1R9LA 3KN7A 4OHNA 4Q8RA 1UTBA 2HAUA 3EHTA 1B5IA 1P1OA 4MMPA 4G61A 1D4NA 1YXIA 1CNQA 4Z0IA 3S4UA 2NVUB 3EN3A 3D4CA 5IZ3A 1YCJA 3DRGA 2XHDA 2R71A 3S9EA 4NG7A 3T9UA 4G68B 4GOTA 3TZAA 1URDA 1B40A 3BFTA 3S9LC 1QKAA 3FATA 4LZ7A 5L9OA 4KHZE 1T0KA 1B7HA 3RUMA 1JNFA 3G7WA 5L8DA 1JQFA 5AA4A 3IR1A 1B3EA 1UTBB 2QJEA 1OVTA 1Z7ME 1NFTA 2ZNUA 1FQBA 5A5LA 1P1WA 1EZOA 1A7LA 2QSXA 3K6VA 4G8HA 5IZ3B 1FBEA 3OO6A 4NF0A 3MVYA 3ZKLA 5H8QA 2DWAA 3O6GA 1FQEA 3C33A 2ZZVA 4U1ZA 5ELVA 4R6HA 3LSXA 1AWBA 2DYXA 3TQWA 3C9HA 4QSCA 3IAZA 4YB6A 5AA4B 4UA8A 1B4HA 1ZIUA 1LBYA 4MNPA 4RK2A 4JWXA 2GHAA 1N3WA 2PYYA 2Y7KA 4OETA 3CVGA 4KPTA 4HE2A 5HM4B 2F6GA 2HXRA 2UVHA 2PCRA 3FD3A 5CBSA 2I0BA 1IMFA 3K01A 4PF8A 5H8QB 2ZNTA 4NN3A 2THIA 5H8FA 5LTCA 5DEXB 4ELRA 1NUYA 4N15A 1R9QA 4QF9A 1FSAA 1OLAA 3A09A 2Z8DA 3LSLA 4JSOA 4LP2B 3K02A 4MHFA 4OFLA 3THIA 1FQDA 1GR2A 2B65A 3KSJA 3QYTA 1NH8A 4R2BA 4I8CA 3SKPA 1L5TA 3Q29A 2Q88A 5AA3A 3FXQA 4MX6A 2VT5A 4LA9A 4H8IA 4KYDA 4HW8A 4P0GA 3IOWA 1M5FA 1EYIA 4NAPA 2V4CA 1ZBMA 1OIBA 3GBAA 2OBGA 4YAHX 1PDAA 2AIXA 5HPQA 1Q35A 3K0VA 2XX9A 3I6VA 2WOKA 5ET8A 2W7YA 3ROJA 2NUVA 4EF2A 3PTYA 4HE0A 2B4MA 4OVRA 3RGYA 4MEVA 3OMBA 3F11A 4ONYA 3KJ7A 2KLFA 4NF8A 1G0IA 3PMWA 1P1NA 1SYHA 2UVIA 3BIHA 4ZEKA 1II5A 1JW5A 4ISUA 4JXIA 4O7MA 4Q5TA 3LC8A 4AB5A 1SPIA 4FECA 3T93B 1USYE 4QFNA 2XA5A 1EYKA 1IXIA 2HQ0A 2Y84A 1NMUA 3Q25A 4GWSA 3IOVA 3QK6A 1D3KA 4Z7EA 3MBPA 5H8HB 1VE4A 4C1TA 1ELJA 4U4XA 4GWWA 4I40A 4JBZA 3H03A 4NF8B 4YKPA 4EXLA 1XOCA 4RA1A 2F78A 2PBWA 3VV5A 3PV0E 2OWTA 2HHMA 3RYDA 1QVSA 1MPCA 1B58A 2WOPA 3IFAA 3WAFA 1DTZA 4AS4A 3JZJA 1P1QA 4NMYA 1JEUA 2Q8JA 3U92A 2A5TA 3RTWB 4LZ5A 3FJMA 3FV1A 4IO7A 4KXPA 3LSFB 2OWZA 4GFRA 4RXLA 3FBPA 3G3HA 2F3BA 1S9TA 1N0TA 1FBFA 4G4PA 4N17A 3MUQA 3RLFE 4GL8A 4XKRA 4YZZA 3K1PA 3K6UA 4IR8A 1MXXA 3HPIA 1FTMA 3B6QA 3RQTA 1KWHA 4QXDA 1TXFA 3TKDA 1USYH 4MBPA 3T0JA 3DRFA 2DP8A 4E0XA 4BDLA 4ELQA 4DI3D 4F1VA 1P1UA 5I2NA 2XXRA 1FPEA 5FHMA 1SW5A 4H5FA 3E79A 4F2QA 2I4BA 4FE8A 4N8YA 1WVJA 3V8XB 4N91A 3SESA 4LN5A 4O94A 4HTGA 5H8SA 4O3BA 1VFDA 1O63A 1IZ1A 2HCAA 4NWCA 1LBBA 4FEDA 2DWJA 1MM6A 4GVOA 3PPNA 1N3XA 1UQWA 1IMAA 3IO4A 1RDYA 3H4ZA 1Y1ZA 1FJ9A 4F22A 1QKBA 3T9HB 5I2NB 3UGWA 3CRBA 3PMXA 4ESXA 2B3BA 2QS1A 3E9XA 1IMBA 4E0WA 4ZZAA 2Y7PA 2Q2CA 2XXUA 1PB7A 2YPNA 2REJA 1QUKA 3VXBA 3H3GA 1N84A 2E1SA 3RN8A 5CRYA 1US5A 4LQ2A 2V84A 4QSDA 4QFOA 4OXVA 4X48A 1YYZA 4KFQA 1TFDA 4POXA 1NV5A 1B1HA 3U65A 1R1NA 1MPBA 4DDDA 4U22A 2XXYA 2Q9TA 4ZEFA 2DSFA 2PFZA 4P1LA 2O1MA 3VVDA 1VSOA 1ZKBA 1BP5A 4LATA 4PDHA 3UK4A 4IO2A 1FBHA 3KJTA 4DE8A 3VLUA 4GX6A 4ZDMA 1WDNA 3MW0A 3A29A 3VVEA 4JWYA 1R6ZA 2DXYA 1KA1A 5CC2A 2XD3A 2VOZA 2XXTA 5CM6A 5FBPA 2F7AA 1FTAA 1BIYA 4OWDA 3QUJA 5IZ1A 2FVZA 4FORA 4NWDA 3CFXA 3O6PA 3EPEA 1NNTA 1MY3A 4FIMA 1OLCA 1MY1A 3IB2A 2Y7IA 2QMXA 2ONKE 3PAMA 4ESWA 4HCYA 1RDXA 4PFBA 5ISUA 3VLVA 4ELPA 1LFIA 5T3JA 3TQLA 3PUYE 1ZJLA 1H3DA 3O66A 2Y7RA 1Y4CA 1FW0A 1ZU0A 2R9JA 2V3QA 3IO6A 5TP9A 1CB6A 2Y5LA 3ZKKA 1POY1 3MVWA 1BLFA 4KYEA 4F18A 1RKMA 3USDA 2KQZA 4RY1A 1D9VA 1DCUA 3PUXE 5B7DA 4F29A 5EQ9A 3LR1A 4JDFA 2WOLA 3H7MA 4QFPA 3DP8A 4NF4B 1MQIA 3SEWA 4F3BA 1G0HA 3RTFB 3MAMA 1FQAA 2Z22A 1FCKA 2D21A 3VVFA 4AQ4A 2O84X 3OSRA 3PD8A 1AL3A 1EZ9A 4KYSA 3JYRA 3OOAA 5TP9B 1JW4A 1FPIA 1LBXA 4FEBA 4M4GA 1SBPA 4KI0E 1FPFA 5ITPA 4XKNA 3TCHA 1B7UA 4G8NA 2E0SA 3RYAA 1B9JA 2GH9A 2WX9A 5CMKA 4XF5A 1MH4A 3K00A 4MAGA 4P47A 2R6GE 3L6HA 1LB8A 4GRKA 1LFGA 1LGBC 4G8MA 4YB7A 4OEVA 4PFTA 4OZ9A 4WEPA 2JJKA 2CEYA 5KDTA 4MF3A 4I1DA 4L17A 3FUZA 3IX1A 3E78A 3O29A 3H6UA 3KG2A 3T9XB 2Z23A 4RNSA 3CG3A 2PT2A 2B4LA 4F3SA 2ZZWA 3CI8A 1N76A 4O3AA 3FIRA 5AA1A 5CI5A 3UN6A 4NEDA 5FTHA 4YKJA 1H43A 1YTVA 4IO4A 3SEXA 4PE3A 4PFIA 2PT1A 3O28A 1B32A 4R2FA 4P11A 4PC9A 3UA8A 3GLBA 3IJOB 2XWOA 2F35A 2Q8MA 2RC7A 3OEMA 5KDTB 2UVJA 1A55A 3K1MA 4GQOA 1NI9A 4GLIA 2BJJX 2CZLA 1LCTA 5DEXA 1B7ZA 4POWA 1LAFE 1XC1A 4PFRA 4EUOA 1YZ0A 1MQHA 4IGRA 3B7DA 1IMCA 2UYEA 4F39A 4U21A 3KOTA 2ALUA 4OANA 4ZEBA 5A5XA 2H4IA 1NUXA 3U94A 3EHUA 2BJIA 4U2RA 5EYGA 1PB8A 4F3PA 3PMVA 1FJ6A 4EXKA 4QFKA 2QRYA 3FXUA 5FTIA 5L9MA 4GWYA 2AL5A 4X04A 1FTKA 4H8JA 4BDRA 2CZHA 4N13A 3MP8A 2DVZA 2XXXA 1IMEA 4XKPA 4NGUA 4I3EA 1URSA 1FPLA 1A40A 2V25A 1A8EA 4O8MA 5A5XB 4UACA 2WKYA 3DM0A 4OESA 4GWXA 2VGQA 1BK4A 4U4SA 4N6DA 1DMBA 2ONRA 1B4ZA 4N81A 3IB1A 4FJPA 1IIWA 2QFLA 4LZ8A 1M5CA 4YMAA 1H45A 3DRIA 1NV1A 2DE4A 1PEBA 3SEVA 3MVZA 5DT6A 1Y20A 2H9BA 4TOZA 1LEVA 4N4UA 3ONMA 1SW2A 3FJGA 1SW1A 5H8HA 1IXGA 3UORA 5DW8A 4F2OA 3G3GA 3KN8A 1UIUA 2H25A 2D5WA 3E13X 4IB2A 1GVCA 3VLWA 4H46A 3TTRA 1XI6A 3QAXA 4ND9A 2F97A 2RINA 3MC2A 2RCBA 4BDNA 1NKXA 2ZNSA 3TCFA 1B3LA 1B51A 4XKQA 2NWJA 4PF6A 5KZTA 1NV7A 5EQ7A 3OXNA 3T96B 3VE1B 3MQ9A 4NX1A 5I7IA 4KD5A 3IJXB 3RYBA 2X26A 4OVTA 2F34A 1I6BA 1DBZA 3T9VA 3FZVA 5FHOA 1H44A 3FVNA 4TLMB 3CR9A 2YJPA 1CE2A 3A3CA 1LAHE 4NF5A 1NL5A 3KC1A 2QS4A 3KBZA 5IZZA 2REGA 4ZEIA 1FRPA 4PDDA 4I62A 3TCGA 2XWIA 2XXHA 4DXUA 1YPNA 4EDPA 4F1YA 2ANJA 2VHAA 2P1SA 4WXJA 2H5YA 1LBVA 2O51A 4TLLB 1EYJA 5CMCA 1B5HA 3ILUB 4IO5A 1DSNA 3Q27A 2V3UA 2CMOA 4GWZA 4FBPA 1M5BA 4NF5B 1EU8A 1MM7A 2FHYA 4YICA 1ZLQA 1KA0A 1TFAA 1A54A 2RC9A 4LONB 2XXPA 3E3KA 3MJNA 3K2DA 3KSXA 1XT8A 1LB9A 1Y9UA 1MY0A 2DWHA 2OX3A 1SI1A 2VPOA 2FIEA 4X9TA 3TTNA 2ZYMA 1XVYA 1QW0A 4ELOA 5AA2A 1FPKA 4GWOA 3RPWA 2M8CA 4PBHA 3VFJA 4DCXA 3QXMA 4LUBA 1DK4A 2L5VA 1DTGA 3MZ1A 5HBCA 4OQOA 4NTLA 1SDXA 4OVQA 4YB5A 5F1QA 4OERA 5ET7A 4ZEDA 1GV8A 1KZ8A 4YU0A 2ZYKA 4MNCA 2XXWA 3HFUA 5EHMA 4I3YA 3N6UA 4MIJA 2LAOA 4R72A 4PFWA 2Z8FA 4H67A 2R8TA 2HZLA 3HN0A 3G3JA 3OSQA 1D9QA 1B6HA 3TYHA 4K3FA 3FXBA 5AA2B 2HAVA 2NOOA 1DOTA 2ONSA 3MZ9A 2DDKA 1DPPA 1AIVA 2I6EA 3L6GA 3PPOA 1JVXA 2UVGA 2QVVA 2DVCA 5J16A 3CFLA 5CMMA 4R9FA 3CHGA 5BUUA 4P9KA 4I9DA 3C4MA 1HSJA 3DP4A 2AL4A 1US4A 2HPGA 3QUFA 4H45A 4JSDA 3O9PA 2O7IA 4WEDA 1NV0A 2Q89A 1LAXA 3QMFA 4H0WA 1FBDA 2OJTA 3FVGA 2XX7A 5EYHA 2F8DA 4IY5A 5LDZA 3DRHA 5I57A 3B6WA 2OWSA 1SW4A 1A8FA 3IFCA 2ABHA 1JP4A 3ODBA 4GL0A 5IM2A 4OYVA 5JTYB 3K1NA 4DCYA 4UABA 1LBWA 1B52A 1S7YA 2GRVA 1MXZA 5KCJA 2CEXA 5I58A 3KFMA 5JEIA 4PGPA 1D9YA 4NF4A 3V83A 4G68C 3U8QA 4QHQA 2GFEA 4FAJA 2OK2A 4RPNA 1XHYA 3KN3A 1LBZA 1OQGA 4PGNA 3RNNA 3K4UA 3UP9A 1N04A 3WAEA 4G2ZA 2PVUA 5I57B 3OD7A 1OVBA 1MQDA 2XX8A 4GX4A 2FA7A 1M5DA 2Y7WA 3D1RA 1MS7A 3A3UA 3T1BA 1Q1KA 2P2AA 2H98A 4LVQA 3GBBA 3OO9A 1XVXA 2YLNA 5KCJB 2Y5KA 3IK6B 5I58B 2ESNA 1P99A 1NNPA 1F9BA 3TEPA 3HCQA 1AOVA 4Q30B 3B50A 3IB0A 2X7PA 4OVSA 4LQ5A 5I3SA 1JETA 4KQPA 3TTKA 3I3VA 2PMSA 5JK4A 1MXVA 3BIGA 3V5AA 2DE3A 5TPAA 5F24A 4ZS9A 3OELA 4R74A 3PGFA 5CMBA 4XEQA 1DPEA 3O6HA 2Q2AA 5EYFA 4DI4B 4PQJA 1Q9DA 1UTHA 1QUIA 1MXYA 4ZE8A 4PCDA 3W15C 1O64A 2UYFA 1IEJA 1Y3NA 4ZZEA 1JW1A 3C31A 5EHSA 3U93A 4PFUA 1GTKA 3MP1A 1OMPA 3MYUA 5I2KB 1Y1MA 2B3FA 5TPAB 3FTOA 2KR0A 5ICQA 1HSLA 3LV0A 1J1NA 1IITA 3FVOA 1Z7NE 3IL1B 4O3CA 4PTKA 4EQ9A 1UTHB 3I5OA 3TDJA 1MY2A 4H6DA 2I58A 4ZE9A 1MDQA 3D4GA 5IKBA 1B46A 4O7IA 3SZPA 1FBCA 2I49A 1EZPA 4Q0CA 4PAKA 5DYHA 2FYIA 2IEEA 4YKIA 1FBGA 3MP6A 2O69A 4IGTA 1BKAA 3TELA 1EH3A 1NV2A 4EQ7A 2P3VA 5IAIA 1FPJA 1IXCA 3BKIB 1N7WA 1VR5A 3CSBA 4XIGQ 3TTLA 5ICTA 2XXKA
chains in the Genus database with same CATH topology
3HHGA 5H8NA 4X1DA 3C34A 3PD9A 3DRJA 3EF7A 5FHNA 1H76A 4OTEA 3VDFA 4F19A 3OO7A 2PX1A 2VD2A 1O7TA 1FTLA 1B3FA 5L9SA 3IOTA 3PPQA 1B3GA 2QMWA 2XXVA 5DTBA 4BLAA 3FASA 4YKKA 4MLVA 1MY4A 1B0LA 3R26A 4YMBA 2XD2A 3LBSA 1ATGA 5I59A 5H8NB 3GXAA 1TT1A 2XXQA 2I0CA 4MLQA 1MQJA 3IORA 4HCWA 2X7QA 4PP0A 3U72A 2UXAA 3FJ7A 3UIFA 3CIJA 4BDQA 5I56A 5I84A 3OENA 3SERA 4R75A 3HO7A 2NXOA 3T22A 1OQHA 4U23A 3MPLA 2AYSA 5I59B 1MXUA 4RPOA 4RK9A 1IXHA 3OEKA 5BWJA 5H8FB 5AE4A 1FQCA 4H1XA 1MPDA 1PB9A 4ECFA 3BBRA 2HFBA 3QIMA 2HEUA 2P0SA 4RYAA 4IY6A 1URGA 1JVYA 1PBQA 4KCDA 3FXRA 4R73A 5I56B 1PC3A 5K2XA 4IO3A 1N7XA 2I3WA 5LOMA 1SI0A 3W9VA 3SETA 4H65A 2DWIA 2DS9A 4XXUA 2ZYOA 1LCFA 5B70A 1S50A 3O2AA 3M8UA 4TQUQ 1SD3A 1SYIA 4GIZA 3K6XA 2OLBA 4NE4A 1RYOA 1RYXA 3RY3A 1NNFA 2RF1A 1IQ7A 3DELB 2XXIA 3MVXA 2VP1A 5CBRA 3AXFA 2DQVA 3R6UA 3PUZE 3KZGA 1Y4TA 3G3IA 1ZMGA 1B5JA 3HHFA 2A5SA 1MQGA 4PETA 4GD5A 5K2YA 3MWBA 1I6QA 4OEUA 2H99A 5J1DA 1GGGA 2F6PA 3ILTB 4DXBA 2QL3A 4QSEA 3O6IA 3TUSA 4HS7A 3QSLA 4BDOA 1SQYA 4U1OA 5AA2D 4RJZA 3N5LA 1VFEA 1M5EA 3V89B 3SDFA 2FNCA 3FV2A 4G77A 2IA4A 3LVUA 1YAEA 3C32A 4R6KA 1I69A 4OFOA 3KGCA 3LUYA 1LFHA 1FTJA 2GHBA 3GZGA 4FATA 1MH3A 2DE2A 1XS5A 4P0IA 4M1VA 4N07A 4EF1A 2F36A 3TAJA 3W9WA 4DIGA 1MRPA 4R9GA 2A5TB 3PU5A 1NNKA 1AMFA 2O6AA 3RT8A 4F31B 3Q28A 2DXRA 3KOSA 2ZYNA 3FVKA 1MDP1 4QFLA 3PUWE 3CG1A 4R6YA 4JWOA 2G93A 2I3VA 4AB6A 4OFJA 3HSTA 3N6TA 3TODA 4DZ1A 3G3FA 2F7CA 3PUVE 5DVIA 3O97A 1IUDA 3TFLA 3M3LA 3MZBA 1ANFA 3VXCA 3KBRA 4N6PA 3T66A 1QULA 1B0HA 1TWYA 3KEIA 2O68A 3H06B 4THIA 3H6VA 2DOJA 2G29A 1A99A 3TPAA 2O7UA 3B6TA 2V93A 1HSEA 3M3FA 3M3KA 3DP6A 5JTYA 1BTJA 3JV9A 1QJMA 2O1LA 1FQFA 1B3HA 2QS3A 5DVJA 1MG1A 4ZECA 3FGSA 1AH5A 3ZS6A 1NH7A 2I4CA 2QS2A 4C1UA 4C0RA 1LSTA 3P7IA 4OVJA 5M2VA 3PPRA 1PBPA 3S9NC 3CFZA 4PE5B 1UIVA 3DRKA 3SEUA 3EHSA 3C35A 1I6AA 2Z8EA 4GXAA 3MPKA 1B2HA 2VD3A 2QPQA 4KR5A 1MXWA 3DLNA 3SEYA 3S9MC 2OZZA 4KCCA 1B05A 4X1BA 1FTOA 3IOUA 4PFYA 1LAGE 3N94A 3U1OA 2F5XA 2D3IA 3ECRA 2HXWA 4IO6A 5TU0A 4H5GA 1B1XA 3Q26A 3LSWA 3CSGA 3EQ1A 4MH5A 4NF6A 3HV1A 3H6TA 4EQBA 1Y3QA 4GF8A 3C36A 5ITOA 2ZXTA 5DVFA 4XTCQ 3TTMA 4GXSB 5F7VA 3H6WA 3E4RA 1Y3PA 5I2KA 4F3GA 4JB7A 4QRZA 4WKMA 3PPPA 1ZTYA 4OMBA 4DXCA 2I48A 3BFUA 1QUJA 3N26A 1LBCA 3OO8A 3S2VA 2V3TA 2ZMBA 3R7XA 4DLDA 4MFIA 2RKMA 1WODA 1SVXB 4NF6B 3ZSFA 4F1UA 3TMGA 2HZKA 1JEVA 4BDMA 1POTA 4G68A 2F7BA 3K6WA 1LLSA 2RCAA 4OENA 2OCUA 3RT6B 3G3KA 2RC8A 1R9LA 3KN7A 4OHNA 4Q8RA 1UTBA 2HAUA 3EHTA 1B5IA 1P1OA 1D4NA 4Z0IA 3S4UA 2NVUB 3EN3A 3D4CA 1YCJA 3DRGA 2XHDA 2R71A 3S9EA 3T9UA 4G68B 4GOTA 3TZAA 1URDA 1B40A 3BFTA 3S9LC 1QKAA 3FATA 4LZ7A 5L9OA 4KHZE 1T0KA 1B7HA 3RUMA 1JNFA 3G7WA 5L8DA 1JQFA 5AA4A 3IR1A 1B3EA 1UTBB 2QJEA 1OVTA 1Z7ME 1NFTA 2ZNUA 1FQBA 1P1WA 1EZOA 1A7LA 2QSXA 3K6VA 4G8HA 3OO6A 3MVYA 3ZKLA 5H8QA 2DWAA 3O6GA 1FQEA 3C33A 4U1ZA 5ELVA 4R6HA 3LSXA 2DYXA 3TQWA 3C9HA 4QSCA 3IAZA 4YB6A 5AA4B 4UA8A 1B4HA 1ZIUA 4RK2A 4JWXA 2GHAA 1N3WA 2PYYA 2Y7KA 4OETA 3CVGA 4KPTA 5HM4B 2F6GA 2UVHA 3FD3A 5CBSA 2I0BA 3K01A 5H8QB 2ZNTA 2THIA 5H8FA 5DEXB 4ELRA 1R9QA 4QF9A 1OLAA 3A09A 2Z8DA 3LSLA 4JSOA 4LP2B 3K02A 4OFLA 3THIA 1FQDA 1GR2A 2B65A 3KSJA 3QYTA 1NH8A 4R2BA 4I8CA 3SKPA 1L5TA 3Q29A 2Q88A 5AA3A 3FXQA 4LA9A 4H8IA 4KYDA 4HW8A 4P0GA 3IOWA 1M5FA 1ZBMA 1OIBA 3GBAA 2OBGA 4YAHX 1PDAA 2AIXA 5HPQA 1Q35A 3K0VA 2XX9A 3I6VA 2WOKA 2W7YA 2NUVA 4EF2A 2B4MA 3RGYA 3OMBA 3F11A 4ONYA 3KJ7A 2KLFA 4NF8A 3PMWA 1P1NA 1SYHA 2UVIA 4ZEKA 1II5A 1JW5A 4ISUA 4JXIA 4Q5TA 3LC8A 4AB5A 4FECA 3T93B 1USYE 4QFNA 1IXIA 2HQ0A 2Y84A 1NMUA 3Q25A 3IOVA 3QK6A 1D3KA 4Z7EA 3MBPA 5H8HB 1VE4A 4C1TA 1ELJA 4U4XA 4JBZA 3H03A 4NF8B 4YKPA 4EXLA 1XOCA 4RA1A 2F78A 2PBWA 3VV5A 3PV0E 2OWTA 1QVSA 1MPCA 1B58A 2WOPA 3WAFA 1DTZA 3JZJA 1P1QA 4NMYA 1JEUA 2Q8JA 3U92A 2A5TA 3RTWB 4LZ5A 3FJMA 3FV1A 4IO7A 3LSFB 4GFRA 4RXLA 3G3HA 1S9TA 1N0TA 4G4PA 3MUQA 3RLFE 4GL8A 4XKRA 4YZZA 3K1PA 3K6UA 1MXXA 3HPIA 1FTMA 3B6QA 3RQTA 1KWHA 1TXFA 3TKDA 1USYH 4MBPA 3DRFA 2DP8A 4E0XA 4BDLA 4ELQA 4F1VA 1P1UA 5I2NA 2XXRA 5FHMA 1SW5A 4H5FA 4F2QA 2I4BA 4FE8A 1WVJA 3V8XB 3SESA 4HTGA 5H8SA 4O3BA 1VFDA 1O63A 1IZ1A 2HCAA 4NWCA 1LBBA 4FEDA 2DWJA 1MM6A 4GVOA 3PPNA 1N3XA 1UQWA 3IO4A 3H4ZA 1Y1ZA 4F22A 1QKBA 3T9HB 5I2NB 3UGWA 3CRBA 3PMXA 4ESXA 2B3BA 2QS1A 3E9XA 4E0WA 4ZZAA 2Y7PA 2Q2CA 2XXUA 1PB7A 2YPNA 2REJA 1QUKA 3VXBA 3H3GA 1N84A 2E1SA 3RN8A 5CRYA 1US5A 4LQ2A 2V84A 4QSDA 4QFOA 4OXVA 4X48A 4KFQA 1TFDA 4POXA 1B1HA 1R1NA 1MPBA 4DDDA 4U22A 2XXYA 2Q9TA 4ZEFA 2DSFA 2O1MA 3VVDA 1VSOA 1ZKBA 1BP5A 4LATA 3UK4A 4IO2A 3KJTA 4DE8A 3VLUA 4ZDMA 1WDNA 3MW0A 3VVEA 4JWYA 1R6ZA 2DXYA 5CC2A 2XD3A 2VOZA 2XXTA 5CM6A 2F7AA 1BIYA 4OWDA 3QUJA 4FORA 4NWDA 3CFXA 3O6PA 3EPEA 1NNTA 1MY3A 4FIMA 1OLCA 1MY1A 3IB2A 2Y7IA 2QMXA 2ONKE 3PAMA 4ESWA 4HCYA 5ISUA 3VLVA 4ELPA 1LFIA 3TQLA 3PUYE 1ZJLA 1H3DA 3O66A 2Y7RA 1Y4CA 1FW0A 1ZU0A 2R9JA 2V3QA 3IO6A 5TP9A 1CB6A 3ZKKA 1POY1 3MVWA 1BLFA 4KYEA 4F18A 1RKMA 3USDA 4RY1A 1D9VA 3PUXE 5B7DA 4F29A 3LR1A 4JDFA 2WOLA 3H7MA 4QFPA 3DP8A 4NF4B 1MQIA 3SEWA 4F3BA 3RTFB 3MAMA 1FQAA 2Z22A 1FCKA 2D21A 3VVFA 4AQ4A 2O84X 3OSRA 3PD8A 1AL3A 1EZ9A 4KYSA 3JYRA 3OOAA 5TP9B 1JW4A 4FEBA 4M4GA 1SBPA 4KI0E 5ITPA 4XKNA 3TCHA 1B7UA 4G8NA 2E0SA 3RYAA 1B9JA 2GH9A 5CMKA 1MH4A 3K00A 2R6GE 3L6HA 1LB8A 4GRKA 1LFGA 1LGBC 4G8MA 4YB7A 4OEVA 4PFTA 4OZ9A 4WEPA 5KDTA 4MF3A 4I1DA 4L17A 3FUZA 3IX1A 3O29A 3H6UA 3KG2A 3T9XB 2Z23A 4RNSA 3CG3A 2PT2A 2B4LA 4F3SA 3CI8A 1N76A 4O3AA 3FIRA 5AA1A 5CI5A 3UN6A 4NEDA 5FTHA 4YKJA 1H43A 1YTVA 4IO4A 3SEXA 2PT1A 3O28A 1B32A 4R2FA 4P11A 3UA8A 3GLBA 3IJOB 2F35A 2RC7A 3OEMA 5KDTB 2UVJA 1A55A 3K1MA 4GQOA 4GLIA 2BJJX 2CZLA 1LCTA 5DEXA 1B7ZA 4POWA 1LAFE 1XC1A 4EUOA 1MQHA 4IGRA 3B7DA 2UYEA 4F39A 4U21A 3KOTA 2ALUA 4ZEBA 5A5XA 2H4IA 3U94A 3EHUA 4U2RA 1PB8A 4F3PA 3PMVA 4EXKA 4QFKA 2QRYA 3FXUA 5FTIA 5L9MA 2AL5A 1FTKA 4H8JA 4BDRA 4N13A 3MP8A 2DVZA 2XXXA 4XKPA 1URSA 1A40A 2V25A 1A8EA 5A5XB 4UACA 2WKYA 3DM0A 4OESA 2VGQA 4U4SA 1DMBA 2ONRA 1B4ZA 3IB1A 4FJPA 1IIWA 4LZ8A 1M5CA 4YMAA 1H45A 3DRIA 2DE4A 1PEBA 3SEVA 3MVZA 5DT6A 1Y20A 2H9BA 4TOZA 3ONMA 1SW2A 3FJGA 1SW1A 5H8HA 1IXGA 3UORA 4F2OA 3G3GA 3KN8A 1UIUA 2H25A 2D5WA 3E13X 4IB2A 1GVCA 3VLWA 3TTRA 3QAXA 4ND9A 2F97A 2RINA 3MC2A 2RCBA 4BDNA 1NKXA 2ZNSA 3TCFA 1B3LA 1B51A 4XKQA 2NWJA 5KZTA 3T96B 3OXNA 3VE1B 3MQ9A 4KD5A 3IJXB 3RYBA 2X26A 2F34A 1I6BA 3T9VA 3FZVA 5FHOA 1H44A 3FVNA 4TLMB 3CR9A 2YJPA 1CE2A 3A3CA 1LAHE 4NF5A 1NL5A 2QS4A 2REGA 4ZEIA 4I62A 3TCGA 2XXHA 4DXUA 1YPNA 4EDPA 4F1YA 2ANJA 2VHAA 2P1SA 4WXJA 2H5YA 2O51A 4TLLB 5CMCA 1B5HA 3ILUB 4IO5A 1DSNA 3Q27A 2V3UA 2CMOA 1M5BA 4NF5B 1EU8A 1MM7A 4YICA 1ZLQA 1TFAA 1A54A 2RC9A 4LONB 2XXPA 3E3KA 3MJNA 3K2DA 3KSXA 1XT8A 1LB9A 1Y9UA 1MY0A 2DWHA 1SI1A 4X9TA 3TTNA 2ZYMA 1XVYA 1QW0A 4ELOA 5AA2A 4GWOA 3RPWA 2M8CA 3VFJA 4DCXA 3QXMA 4LUBA 1DTGA 3MZ1A 5HBCA 4OQOA 4NTLA 1SDXA 4YB5A 5F1QA 4OERA 4ZEDA 1GV8A 4YU0A 2ZYKA 2XXWA 5EHMA 3N6UA 2LAOA 4R72A 4PFWA 2Z8FA 4H67A 2HZLA 3HN0A 3G3JA 3OSQA 3TYHA 1B6HA 4K3FA 5AA2B 2HAVA 2NOOA 1DOTA 2ONSA 3MZ9A 1DPPA 1AIVA 2I6EA 3L6GA 3PPOA 1JVXA 2UVGA 2DVCA 3CFLA 5CMMA 4R9FA 3CHGA 5BUUA 4I9DA 3C4MA 1HSJA 3DP4A 2AL4A 1US4A 3QUFA 4JSDA 3O9PA 2O7IA 4WEDA 2Q89A 1LAXA 4H0WA 2OJTA 3FVGA 2XX7A 2F8DA 4IY5A 3DRHA 5I57A 3B6WA 2OWSA 1SW4A 1A8FA 2ABHA 3ODBA 4GL0A 4OYVA 5JTYB 3K1NA 4DCYA 1B52A 1S7YA 2GRVA 1MXZA 5KCJA 5I58A 3KFMA 5JEIA 1D9YA 4NF4A 3V83A 4G68C 3U8QA 4QHQA 2GFEA 4FAJA 2OK2A 4RPNA 1XHYA 3KN3A 1OQGA 3RNNA 3K4UA 3UP9A 1N04A 3WAEA 4G2ZA 2PVUA 5I57B 3OD7A 1OVBA 1MQDA 2XX8A 2FA7A 1M5DA 2Y7WA 1MS7A 3A3UA 1Q1KA 2P2AA 2H98A 4LVQA 3GBBA 3OO9A 1XVXA 2YLNA 5KCJB 3IK6B 5I58B 2ESNA 1P99A 1NNPA 1F9BA 3TEPA 3HCQA 1AOVA 4Q30B 3IB0A 2X7PA 4LQ5A 1JETA 4KQPA 3TTKA 3I3VA 2PMSA 5JK4A 1MXVA 3V5AA 2DE3A 5TPAA 4ZS9A 3OELA 4R74A 3PGFA 5CMBA 1DPEA 3O6HA 2Q2AA 5EYFA 4PQJA 1UTHA 1QUIA 1MXYA 4ZE8A 3W15C 1O64A 2UYFA 1IEJA 1Y3NA 4ZZEA 1JW1A 3C31A 5EHSA 3U93A 4PFUA 1GTKA 3MP1A 1OMPA 5I2KB 1Y1MA 2B3FA 5TPAB 3FTOA 5ICQA 1HSLA 1J1NA 1IITA 3FVOA 1Z7NE 3IL1B 4O3CA 4EQ9A 1UTHB 3I5OA 3TDJA 1MY2A 4H6DA 2I58A 4ZE9A 1MDQA 3D4GA 5IKBA 1B46A 2I49A 1EZPA 4Q0CA 5DYHA 2FYIA 2IEEA 4YKIA 3MP6A 2O69A 4IGTA 1BKAA 3TELA 1EH3A 4EQ7A 5IAIA 1IXCA 3BKIB 1N7WA 1VR5A 3CSBA 4XIGQ 3TTLA 5ICTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHG A;  5H8N A;  4X1D A;  3C34 A;  3PD9 A;  3DRJ A;  3EF7 A;  5FHN A;  1H76 A;  4OTE A;  3VDF A;  4F19 A;  3OO7 A;  2PX1 A;  2VD2 A;  1O7T A;  1FTL A;  1B3F A;  5L9S A;  3IOT A;  3PPQ A;  1B3G A;  2QMW A;  2XXV A;  5DTB A;  4BLA A;  3FAS A;  4YKK A;  4MLV A;  1MY4 A;  1B0L A;  3R26 A;  4YMB A;  2XD2 A;  3LBS A;  1ATG A;  5I59 A;  5H8N B;  3GXA A;  1TT1 A;  2XXQ A;  2I0C A;  4MLQ A;  1MQJ A;  3IOR A;  4HCW A;  2X7Q A;  4PP0 A;  3U72 A;  2UXA A;  3FJ7 A;  3UIF A;  3CIJ A;  4BDQ A;  5I56 A;  5I84 A;  3OEN A;  3SER A;  4R75 A;  3HO7 A;  2NXO A;  3T22 A;  1OQH A;  4U23 A;  3MPL A;  2AYS A;  5I59 B;  1MXU A;  4RPO A;  4RK9 A;  1IXH A;  3OEK A;  5BWJ A;  5H8F B;  5AE4 A;  1FQC A;  4H1X A;  1MPD A;  1PB9 A;  4ECF A;  3BBR A;  2HFB A;  3QIM A;  2HEU A;  2P0S A;  4RYA A;  4IY6 A;  1URG A;  1JVY A;  1PBQ A;  4KCD A;  3FXR A;  4R73 A;  5I56 B;  1PC3 A;  5K2X A;  4IO3 A;  1N7X A;  2I3W A;  5LOM A;  1SI0 A;  3W9V A;  3SET A;  4H65 A;  2DWI A;  2DS9 A;  4XXU A;  2ZYO A;  1LCF A;  5B70 A;  1S50 A;  3O2A A;  3M8U A;  4TQU Q;  1SD3 A;  1SYI A;  4GIZ A;  3K6X A;  2OLB A;  4NE4 A;  1RYO A;  1RYX A;  3RY3 A;  1NNF A;  2RF1 A;  1IQ7 A;  3DEL B;  2XXI A;  3MVX A;  2VP1 A;  5CBR A;  3AXF A;  2DQV A;  3R6U A;  3PUZ E;  3KZG A;  1Y4T A;  3G3I A;  1ZMG A;  1B5J A;  3HHF A;  2A5S A;  1MQG A;  4PET A;  4GD5 A;  5K2Y A;  3MWB A;  1I6Q A;  4OEU A;  2H99 A;  5J1D A;  1GGG A;  2F6P A;  3ILT B;  4DXB A;  2QL3 A;  4QSE A;  3O6I A;  3TUS A;  4HS7 A;  3QSL A;  4BDO A;  1SQY A;  4U1O A;  5AA2 D;  4RJZ A;  3N5L A;  1VFE A;  1M5E A;  3V89 B;  3SDF A;  2FNC A;  3FV2 A;  4G77 A;  2IA4 A;  3LVU A;  1YAE A;  3C32 A;  4R6K A;  1I69 A;  4OFO A;  3KGC A;  3LUY A;  1LFH A;  1FTJ A;  2GHB A;  3GZG A;  4FAT A;  1MH3 A;  2DE2 A;  1XS5 A;  4P0I A;  4M1V A;  4N07 A;  4EF1 A;  2F36 A;  3TAJ A;  3W9W A;  4DIG A;  1MRP A;  4R9G A;  2A5T B;  3PU5 A;  1NNK A;  1AMF A;  2O6A A;  3RT8 A;  4F31 B;  3Q28 A;  2DXR A;  3KOS A;  2ZYN A;  3FVK A;  1MDP 1;  4QFL A;  3PUW E;  3CG1 A;  4R6Y A;  4JWO A;  2G93 A;  2I3V A;  4AB6 A;  4OFJ A;  3HST A;  3N6T A;  3TOD A;  4DZ1 A;  3G3F A;  2F7C A;  3PUV E;  5DVI A;  3O97 A;  1IUD A;  3TFL A;  3M3L A;  3MZB A;  1ANF A;  3VXC A;  3KBR A;  4N6P A;  3T66 A;  1QUL A;  1B0H A;  1TWY A;  3KEI A;  2O68 A;  3H06 B;  4THI A;  3H6V A;  2DOJ A;  2G29 A;  1A99 A;  3TPA A;  2O7U A;  3B6T A;  2V93 A;  1HSE A;  3M3F A;  3M3K A;  3DP6 A;  5JTY A;  1BTJ A;  3JV9 A;  1QJM A;  2O1L A;  1FQF A;  1B3H A;  2QS3 A;  5DVJ A;  1MG1 A;  4ZEC A;  3FGS A;  1AH5 A;  3ZS6 A;  1NH7 A;  2I4C A;  2QS2 A;  4C1U A;  4C0R A;  1LST A;  3P7I A;  4OVJ A;  5M2V A;  3PPR A;  1PBP A;  3S9N C;  3CFZ A;  4PE5 B;  1UIV A;  3DRK A;  3SEU A;  3EHS A;  3C35 A;  1I6A A;  2Z8E A;  4GXA A;  3MPK A;  1B2H A;  2VD3 A;  2QPQ A;  4KR5 A;  1MXW A;  3DLN A;  3SEY A;  3S9M C;  2OZZ A;  4KCC A;  1B05 A;  4X1B A;  1FTO A;  3IOU A;  4PFY A;  1LAG E;  3N94 A;  3U1O A;  2F5X A;  2D3I A;  3ECR A;  2HXW A;  4IO6 A;  5TU0 A;  4H5G A;  1B1X A;  3Q26 A;  3LSW A;  3CSG A;  3EQ1 A;  4MH5 A;  4NF6 A;  3HV1 A;  3H6T A;  4EQB A;  1Y3Q A;  4GF8 A;  3C36 A;  5ITO A;  2ZXT A;  5DVF A;  4XTC Q;  3TTM A;  4GXS B;  5F7V A;  3H6W A;  3E4R A;  1Y3P A;  5I2K A;  4F3G A;  4JB7 A;  4QRZ A;  4WKM A;  3PPP A;  1ZTY A;  4OMB A;  4DXC A;  2I48 A;  3BFU A;  1QUJ A;  3N26 A;  1LBC A;  3OO8 A;  3S2V A;  2V3T A;  2ZMB A;  3R7X A;  4DLD A;  4MFI A;  2RKM A;  1WOD A;  1SVX B;  4NF6 B;  3ZSF A;  4F1U A;  3TMG A;  2HZK A;  1JEV A;  4BDM A;  1POT A;  4G68 A;  2F7B A;  3K6W A;  1LLS A;  2RCA A;  4OEN A;  2OCU A;  3RT6 B;  3G3K A;  2RC8 A;  1R9L A;  3KN7 A;  4OHN A;  4Q8R A;  1UTB A;  2HAU A;  3EHT A;  1B5I A;  1P1O A;  1D4N A;  4Z0I A;  3S4U A;  2NVU B;  3EN3 A;  3D4C A;  1YCJ A;  3DRG A;  2XHD A;  2R71 A;  3S9E A;  3T9U A;  4G68 B;  4GOT A;  3TZA A;  1URD A;  1B40 A;  3BFT A;  3S9L C;  1QKA A;  3FAT A;  4LZ7 A;  5L9O A;  4KHZ E;  1T0K A;  1B7H A;  3RUM A;  1JNF A;  3G7W A;  5L8D A;  1JQF A;  5AA4 A;  3IR1 A;  1B3E A;  1UTB B;  2QJE A;  1OVT A;  1Z7M E;  1NFT A;  2ZNU A;  1FQB A;  1P1W A;  1EZO A;  1A7L A;  2QSX A;  3K6V A;  4G8H A;  3OO6 A;  3MVY A;  3ZKL A;  5H8Q A;  2DWA A;  3O6G A;  1FQE A;  3C33 A;  4U1Z A;  5ELV A;  4R6H A;  3LSX A;  2DYX A;  3TQW A;  3C9H A;  4QSC A;  3IAZ A;  4YB6 A;  5AA4 B;  4UA8 A;  1B4H A;  1ZIU A;  4RK2 A;  4JWX A;  2GHA A;  1N3W A;  2PYY A;  2Y7K A;  4OET A;  3CVG A;  4KPT A;  5HM4 B;  2F6G A;  2UVH A;  3FD3 A;  5CBS A;  2I0B A;  3K01 A;  5H8Q B;  2ZNT A;  2THI A;  5H8F A;  5DEX B;  4ELR A;  1R9Q A;  4QF9 A;  1OLA A;  3A09 A;  2Z8D A;  3LSL A;  4JSO A;  4LP2 B;  3K02 A;  4OFL A;  3THI A;  1FQD A;  1GR2 A;  2B65 A;  3KSJ A;  3QYT A;  1NH8 A;  4R2B A;  4I8C A;  3SKP A;  1L5T A;  3Q29 A;  2Q88 A;  5AA3 A;  3FXQ A;  4LA9 A;  4H8I A;  4KYD A;  4HW8 A;  4P0G A;  3IOW A;  1M5F A;  1ZBM A;  1OIB A;  3GBA A;  2OBG A;  4YAH X;  1PDA A;  2AIX A;  5HPQ A;  1Q35 A;  3K0V A;  2XX9 A;  3I6V A;  2WOK A;  2W7Y A;  2NUV A;  4EF2 A;  2B4M A;  3RGY A;  3OMB A;  3F11 A;  4ONY A;  3KJ7 A;  2KLF A;  4NF8 A;  3PMW A;  1P1N A;  1SYH A;  2UVI A;  4ZEK A;  1II5 A;  1JW5 A;  4ISU A;  4JXI A;  4Q5T A;  3LC8 A;  4AB5 A;  4FEC A;  3T93 B;  1USY E;  4QFN A;  1IXI A;  2HQ0 A;  2Y84 A;  1NMU A;  3Q25 A;  3IOV A;  3QK6 A;  1D3K A;  4Z7E A;  3MBP A;  5H8H B;  1VE4 A;  4C1T A;  1ELJ A;  4U4X A;  4JBZ A;  3H03 A;  4NF8 B;  4YKP A;  4EXL A;  1XOC A;  4RA1 A;  2F78 A;  2PBW A;  3VV5 A;  3PV0 E;  2OWT A;  1QVS A;  1MPC A;  1B58 A;  2WOP A;  3WAF A;  1DTZ A;  3JZJ A;  1P1Q A;  4NMY A;  1JEU A;  2Q8J A;  3U92 A;  2A5T A;  3RTW B;  4LZ5 A;  3FJM A;  3FV1 A;  4IO7 A;  3LSF B;  4GFR A;  4RXL A;  3G3H A;  1S9T A;  1N0T A;  4G4P A;  3MUQ A;  3RLF E;  4GL8 A;  4XKR A;  4YZZ A;  3K1P A;  3K6U A;  1MXX A;  3HPI A;  1FTM A;  3B6Q A;  3RQT A;  1KWH A;  1TXF A;  3TKD A;  1USY H;  4MBP A;  3DRF A;  2DP8 A;  4E0X A;  4BDL A;  4ELQ A;  4F1V A;  1P1U A;  5I2N A;  2XXR A;  5FHM A;  1SW5 A;  4H5F A;  4F2Q A;  2I4B A;  4FE8 A;  1WVJ A;  3V8X B;  3SES A;  4HTG A;  5H8S A;  4O3B A;  1VFD A;  1O63 A;  1IZ1 A;  2HCA A;  4NWC A;  1LBB A;  4FED A;  2DWJ A;  1MM6 A;  4GVO A;  3PPN A;  1N3X A;  1UQW A;  3IO4 A;  3H4Z A;  1Y1Z A;  4F22 A;  1QKB A;  3T9H B;  5I2N B;  3UGW A;  3CRB A;  3PMX A;  4ESX A;  2B3B A;  2QS1 A;  3E9X A;  4E0W A;  4ZZA A;  2Y7P A;  2Q2C A;  2XXU A;  1PB7 A;  2YPN A;  2REJ A;  1QUK A;  3VXB A;  3H3G A;  1N84 A;  2E1S A;  3RN8 A;  5CRY A;  1US5 A;  4LQ2 A;  2V84 A;  4QSD A;  4QFO A;  4OXV A;  4X48 A;  4KFQ A;  1TFD A;  4POX A;  1B1H A;  1R1N A;  1MPB A;  4DDD A;  4U22 A;  2XXY A;  2Q9T A;  4ZEF A;  2DSF A;  2O1M A;  3VVD A;  1VSO A;  1ZKB A;  1BP5 A;  4LAT A;  3UK4 A;  4IO2 A;  3KJT A;  4DE8 A;  3VLU A;  4ZDM A;  1WDN A;  3MW0 A;  3VVE A;  4JWY A;  1R6Z A;  2DXY A;  5CC2 A;  2XD3 A;  2VOZ A;  2XXT A;  5CM6 A;  2F7A A;  1BIY A;  4OWD A;  3QUJ A;  4FOR A;  4NWD A;  3CFX A;  3O6P A;  3EPE A;  1NNT A;  1MY3 A;  4FIM A;  1OLC A;  1MY1 A;  3IB2 A;  2Y7I A;  2QMX A;  2ONK E;  3PAM A;  4ESW A;  4HCY A;  5ISU A;  3VLV A;  4ELP A;  1LFI A;  3TQL A;  3PUY E;  1ZJL A;  1H3D A;  3O66 A;  2Y7R A;  1Y4C A;  1FW0 A;  1ZU0 A;  2R9J A;  2V3Q A;  3IO6 A;  5TP9 A;  1CB6 A;  3ZKK A;  1POY 1;  3MVW A;  1BLF A;  4KYE A;  4F18 A;  1RKM A;  3USD A;  4RY1 A;  1D9V A;  3PUX E;  5B7D A;  4F29 A;  3LR1 A;  4JDF A;  2WOL A;  3H7M A;  4QFP A;  3DP8 A;  4NF4 B;  1MQI A;  3SEW A;  4F3B A;  3RTF B;  3MAM A;  1FQA A;  2Z22 A;  1FCK A;  2D21 A;  3VVF A;  4AQ4 A;  2O84 X;  3OSR A;  3PD8 A;  1AL3 A;  1EZ9 A;  4KYS A;  3JYR A;  3OOA A;  5TP9 B;  1JW4 A;  4FEB A;  4M4G A;  1SBP A;  4KI0 E;  5ITP A;  4XKN A;  3TCH A;  1B7U A;  4G8N A;  2E0S A;  3RYA A;  1B9J A;  2GH9 A;  5CMK A;  1MH4 A;  3K00 A;  2R6G E;  3L6H A;  1LB8 A;  4GRK A;  1LFG A;  1LGB C;  4G8M A;  4YB7 A;  4OEV A;  4PFT A;  4OZ9 A;  4WEP A;  5KDT A;  4MF3 A;  4I1D A;  4L17 A;  3FUZ A;  3IX1 A;  3O29 A;  3H6U A;  3KG2 A;  3T9X B;  2Z23 A;  4RNS A;  3CG3 A;  2PT2 A;  2B4L A;  4F3S A;  3CI8 A;  1N76 A;  4O3A A;  3FIR A;  5AA1 A;  5CI5 A;  3UN6 A;  4NED A;  5FTH A;  4YKJ A;  1H43 A;  1YTV A;  4IO4 A;  3SEX A;  2PT1 A;  3O28 A;  1B32 A;  4R2F A;  4P11 A;  3UA8 A;  3GLB A;  3IJO B;  2F35 A;  2RC7 A;  3OEM A;  5KDT B;  2UVJ A;  1A55 A;  3K1M A;  4GQO A;  4GLI A;  2BJJ X;  2CZL A;  1LCT A;  5DEX A;  1B7Z A;  4POW A;  1LAF E;  1XC1 A;  4EUO A;  1MQH A;  4IGR A;  3B7D A;  2UYE A;  4F39 A;  4U21 A;  3KOT A;  2ALU A;  4ZEB A;  5A5X A;  2H4I A;  3U94 A;  3EHU A;  4U2R A;  1PB8 A;  4F3P A;  3PMV A;  4EXK A;  4QFK A;  2QRY A;  3FXU A;  5FTI A;  5L9M A;  2AL5 A;  1FTK A;  4H8J A;  4BDR A;  4N13 A;  3MP8 A;  2DVZ A;  2XXX A;  4XKP A;  1URS A;  1A40 A;  2V25 A;  1A8E A;  5A5X B;  4UAC A;  2WKY A;  3DM0 A;  4OES A;  2VGQ A;  4U4S A;  1DMB A;  2ONR A;  1B4Z A;  3IB1 A;  4FJP A;  1IIW A;  4LZ8 A;  1M5C A;  4YMA A;  1H45 A;  3DRI A;  2DE4 A;  1PEB A;  3SEV A;  3MVZ A;  5DT6 A;  1Y20 A;  2H9B A;  4TOZ A;  3ONM A;  1SW2 A;  3FJG A;  1SW1 A;  5H8H A;  1IXG A;  3UOR A;  4F2O A;  3G3G A;  3KN8 A;  1UIU A;  2H25 A;  2D5W A;  3E13 X;  4IB2 A;  1GVC A;  3VLW A;  3TTR A;  3QAX A;  4ND9 A;  2F97 A;  2RIN A;  3MC2 A;  2RCB A;  4BDN A;  1NKX A;  2ZNS A;  3TCF A;  1B3L A;  1B51 A;  4XKQ A;  2NWJ A;  5KZT A;  3T96 B;  3OXN A;  3VE1 B;  3MQ9 A;  4KD5 A;  3IJX B;  3RYB A;  2X26 A;  2F34 A;  1I6B A;  3T9V A;  3FZV A;  5FHO A;  1H44 A;  3FVN A;  4TLM B;  3CR9 A;  2YJP A;  1CE2 A;  3A3C A;  1LAH E;  4NF5 A;  1NL5 A;  2QS4 A;  2REG A;  4ZEI A;  4I62 A;  3TCG A;  2XXH A;  4DXU A;  1YPN A;  4EDP A;  4F1Y A;  2ANJ A;  2VHA A;  2P1S A;  4WXJ A;  2H5Y A;  2O51 A;  4TLL B;  5CMC A;  1B5H A;  3ILU B;  4IO5 A;  1DSN A;  3Q27 A;  2V3U A;  2CMO A;  1M5B A;  4NF5 B;  1EU8 A;  1MM7 A;  4YIC A;  1ZLQ A;  1TFA A;  1A54 A;  2RC9 A;  4LON B;  2XXP A;  3E3K A;  3MJN A;  3K2D A;  3KSX A;  1XT8 A;  1LB9 A;  1Y9U A;  1MY0 A;  2DWH A;  1SI1 A;  4X9T A;  3TTN A;  2ZYM A;  1XVY A;  1QW0 A;  4ELO A;  5AA2 A;  4GWO A;  3RPW A;  2M8C A;  3VFJ A;  4DCX A;  3QXM A;  4LUB A;  1DTG A;  3MZ1 A;  5HBC A;  4OQO A;  4NTL A;  1SDX A;  4YB5 A;  5F1Q A;  4OER A;  4ZED A;  1GV8 A;  4YU0 A;  2ZYK A;  2XXW A;  5EHM A;  3N6U A;  2LAO A;  4R72 A;  4PFW A;  2Z8F A;  4H67 A;  2HZL A;  3HN0 A;  3G3J A;  3OSQ A;  3TYH A;  1B6H A;  4K3F A;  5AA2 B;  2HAV A;  2NOO A;  1DOT A;  2ONS A;  3MZ9 A;  1DPP A;  1AIV A;  2I6E A;  3L6G A;  3PPO A;  1JVX A;  2UVG A;  2DVC A;  3CFL A;  5CMM A;  4R9F A;  3CHG A;  5BUU A;  4I9D A;  3C4M A;  1HSJ A;  3DP4 A;  2AL4 A;  1US4 A;  3QUF A;  4JSD A;  3O9P A;  2O7I A;  4WED A;  2Q89 A;  1LAX A;  4H0W A;  2OJT A;  3FVG A;  2XX7 A;  2F8D A;  4IY5 A;  3DRH A;  5I57 A;  3B6W A;  2OWS A;  1SW4 A;  1A8F A;  2ABH A;  3ODB A;  4GL0 A;  4OYV A;  5JTY B;  3K1N A;  4DCY A;  1B52 A;  1S7Y A;  2GRV A;  1MXZ A;  5KCJ A;  5I58 A;  3KFM A;  5JEI A;  1D9Y A;  4NF4 A;  3V83 A;  4G68 C;  3U8Q A;  4QHQ A;  2GFE A;  4FAJ A;  2OK2 A;  4RPN A;  1XHY A;  3KN3 A;  1OQG A;  3RNN A;  3K4U A;  3UP9 A;  1N04 A;  3WAE A;  4G2Z A;  2PVU A;  5I57 B;  3OD7 A;  1OVB A;  1MQD A;  2XX8 A;  2FA7 A;  1M5D A;  2Y7W A;  1MS7 A;  3A3U A;  1Q1K A;  2P2A A;  2H98 A;  4LVQ A;  3GBB A;  3OO9 A;  1XVX A;  2YLN A;  5KCJ B;  3IK6 B;  5I58 B;  2ESN A;  1P99 A;  1NNP A;  1F9B A;  3TEP A;  3HCQ A;  1AOV A;  4Q30 B;  3IB0 A;  2X7P A;  4LQ5 A;  1JET A;  4KQP A;  3TTK A;  3I3V A;  2PMS A;  5JK4 A;  1MXV A;  3V5A A;  2DE3 A;  5TPA A;  4ZS9 A;  3OEL A;  4R74 A;  3PGF A;  5CMB A;  1DPE A;  3O6H A;  2Q2A A;  5EYF A;  4PQJ A;  1UTH A;  1QUI A;  1MXY A;  4ZE8 A;  3W15 C;  1O64 A;  2UYF A;  1IEJ A;  1Y3N A;  4ZZE A;  1JW1 A;  3C31 A;  5EHS A;  3U93 A;  4PFU A;  1GTK A;  3MP1 A;  1OMP A;  5I2K B;  1Y1M A;  2B3F A;  5TPA B;  3FTO A;  5ICQ A;  1HSL A;  1J1N A;  1IIT A;  3FVO A;  1Z7N E;  3IL1 B;  4O3C A;  4EQ9 A;  1UTH B;  3I5O A;  3TDJ A;  1MY2 A;  4H6D A;  2I58 A;  4ZE9 A;  1MDQ A;  3D4G A;  5IKB A;  1B46 A;  2I49 A;  1EZP A;  4Q0C A;  5DYH A;  2FYI A;  2IEE A;  4YKI A;  3MP6 A;  2O69 A;  4IGT A;  1BKA A;  3TEL A;  1EH3 A;  4EQ7 A;  5IAI A;  1IXC A;  3BKI B;  1N7W A;  1VR5 A;  3CSB A;  4XIG Q;  3TTL A;  5ICT A; 
#chains in the Genus database with same CATH topology
 3HHG A;  5H8N A;  4X1D A;  3C34 A;  3PD9 A;  3DRJ A;  3EF7 A;  5FHN A;  1H76 A;  4OTE A;  3VDF A;  4F19 A;  3KC0 A;  3OO7 A;  2PX1 A;  2VD2 A;  1O7T A;  5IGA A;  1FTL A;  1B3F A;  4PAI A;  5L9S A;  3IOT A;  3PPQ A;  1B3G A;  2QMW A;  4OVP A;  2XXV A;  5DTB A;  4BLA A;  3FAS A;  4YKK A;  4MLV A;  1MY4 A;  1B0L A;  4PAF A;  3R26 A;  4P8B A;  4YMB A;  2XD2 A;  3LBS A;  1ATG A;  1NV3 A;  5I59 A;  5H8N B;  3GXA A;  1TT1 A;  1FPB A;  2XXQ A;  2I0C A;  2QVU A;  4MLQ A;  1MQJ A;  5ET5 A;  3IOR A;  5ESY A;  4HCW A;  2X7Q A;  4PP0 A;  3U72 A;  2UXA A;  3FJ7 A;  3UIF A;  3CIJ A;  4HE1 A;  4BDQ A;  5I56 A;  5I84 A;  3OEN A;  3SER A;  4R75 A;  3HO7 A;  1RDZ A;  2NXO A;  3T22 A;  1OQH A;  4U23 A;  3MPL A;  2AYS A;  5I59 B;  3RPL A;  1MXU A;  4RPO A;  4RK9 A;  1IXH A;  3OEK A;  5BWJ A;  5H8F B;  5AE4 A;  1FQC A;  4H1X A;  2CZK A;  1MPD A;  1PB9 A;  1FPG A;  4ECF A;  3BBR A;  2HFB A;  3QIM A;  2HEU A;  2P0S A;  4RYA A;  4IY6 A;  1URG A;  1FPD A;  4JVD A;  1JVY A;  1PBQ A;  4KCD A;  3FXR A;  4HXV A;  4R73 A;  4NHB A;  4QBA A;  5I56 B;  4GBW A;  1PC3 A;  4PBQ A;  4IO3 A;  1N7X A;  2I3W A;  5K2X A;  5LOM A;  1SI0 A;  3W9V A;  3SET A;  4H65 A;  2DWI A;  2DS9 A;  4XXU A;  2ZYO A;  1K9Y A;  1FBP A;  1LCF A;  3RPL B;  5B70 A;  1S50 A;  3O2A A;  1INP A;  3M8U A;  4TQU Q;  1SD3 A;  1SYI A;  2XWK A;  4GIZ A;  3K6X A;  2OLB A;  4NE4 A;  1RYO A;  1RYX A;  3RY3 A;  1NNF A;  2RF1 A;  1IQ7 A;  3DEL B;  2XXI A;  3MVX A;  2VP1 A;  5CBR A;  3AXF A;  2DQV A;  4GWU A;  3R6U A;  3PUZ E;  3KZG A;  1Y4T A;  3G3I A;  3ISP A;  1ZMG A;  1B5J A;  3HHF A;  2A5S A;  1MQG A;  4PET A;  4GD5 A;  5K2Y A;  3MWB A;  1I6Q A;  4OEU A;  2H99 A;  5J1D A;  1GGG A;  2F6P A;  2Q74 A;  3ILT B;  4DXB A;  2QL3 A;  4QSE A;  3O6I A;  3TUS A;  4HS7 A;  2WBD A;  3LUZ A;  3QSL A;  4BDO A;  1SQY A;  4U1O A;  5AA2 D;  3MST A;  4RJZ A;  3N5L A;  1VFE A;  1M5E A;  3V89 B;  3SDF A;  2FNC A;  3FV2 A;  4G77 A;  2IA4 A;  3LVU A;  1YAE A;  3C32 A;  4R6K A;  1I69 A;  2WBB A;  2VPN A;  4OFO A;  3KGC A;  3LUY A;  1LFH A;  1FTJ A;  2GHB A;  3GZG A;  4GBV A;  2WEF A;  4FAT A;  1MH3 A;  2DE2 A;  1XS5 A;  1NV4 A;  4P0I A;  4M1V A;  4N07 A;  4EF1 A;  2F36 A;  3TAJ A;  3W9W A;  4DIG A;  1MRP A;  4R9G A;  5EQ8 A;  2A5T B;  2P3N A;  3PU5 A;  1NNK A;  1AMF A;  4GX3 A;  2O6A A;  3RT8 A;  4F31 B;  3Q28 A;  2DXR A;  3KOS A;  2ZYN A;  3FVK A;  1MDP 1;  4QFL A;  3PUW E;  3CG1 A;  4JVC A;  4R6Y A;  2MKZ A;  5ET6 A;  4JWO A;  2G93 A;  2I3V A;  4AB6 A;  4OFJ A;  3HST A;  2ZZX A;  4MJO A;  3N6T A;  2WYP A;  3TOD A;  4DZ1 A;  3G3F A;  2F7C A;  3PUV E;  5DVI A;  3O97 A;  1IUD A;  3TFL A;  3B8B A;  3M3L A;  4N8G A;  3MZB A;  1ANF A;  3VXC A;  3KBR A;  4N6P A;  3T66 A;  1QUL A;  1B0H A;  1TWY A;  3KEI A;  2O68 A;  3H06 B;  4THI A;  3H6V A;  2DOJ A;  2G29 A;  1A99 A;  3TPA A;  2O7U A;  3B6T A;  2V93 A;  1HSE A;  3M3F A;  3M3K A;  3DP6 A;  5JTY A;  1BTJ A;  3JV9 A;  1QJM A;  2O1L A;  1FQF A;  1B3H A;  3GYY A;  2QS3 A;  4MNI A;  5DVJ A;  4MCO A;  1IMD A;  1MG1 A;  4ZEC A;  3FGS A;  1AH5 A;  3ZS6 A;  1NH7 A;  2I4C A;  2QS2 A;  4C1U A;  4C0R A;  3NOH A;  1LST A;  3P7I A;  4OVJ A;  2WYK A;  5M2V A;  1NV6 A;  2F3D A;  2QVR A;  3PPR A;  1PBP A;  3S9N C;  3CFZ A;  4PE5 B;  1UIV A;  3DRK A;  3SEU A;  3EHS A;  1NUZ A;  3C35 A;  1I6A A;  1NUW A;  4P56 A;  4AS5 A;  2Z8E A;  4P1E A;  4X8R A;  2XWV A;  4GXA A;  3MPK A;  1B2H A;  2VD3 A;  2QPQ A;  4KR5 A;  4N6K A;  1MXW A;  3DLN A;  3SEY A;  3S9M C;  2GQ1 A;  4XFE A;  2OZZ A;  4KCC A;  1B05 A;  4X1B A;  1FTO A;  3IOU A;  1VDW A;  4PFY A;  1K9Z A;  2PFY A;  4NQ8 A;  1LAG E;  3N94 A;  1QGX A;  3U1O A;  2F5X A;  2D3I A;  3ECR A;  2HXW A;  4IO6 A;  5TU0 A;  4H5G A;  4OA4 A;  1B1X A;  3Q26 A;  3LSW A;  3CSG A;  3EKI A;  3EQ1 A;  4MH5 A;  4NF6 A;  3HV1 A;  3H6T A;  4EQB A;  1Y3Q A;  4GF8 A;  3C36 A;  2FIX A;  5ITO A;  2ZXT A;  5DVF A;  4XTC Q;  3TTM A;  4GXS B;  5F7V A;  3H6W A;  2FBP A;  2CZI A;  3E4R A;  1Y3P A;  5I2K A;  4F3G A;  4JB7 A;  4JVI A;  4QRZ A;  4WKM A;  3PPP A;  1ZTY A;  4OMB A;  4DXC A;  2I48 A;  3BFU A;  1QUJ A;  3N26 A;  1LBC A;  3OO8 A;  3S2V A;  5EQA A;  2V3T A;  2ZMB A;  3R7X A;  4DLD A;  4MFI A;  2RKM A;  1WOD A;  1SVX B;  4NF6 B;  3ZSF A;  4F1U A;  3TMG A;  2HZK A;  1JEV A;  4BDM A;  5I5P A;  1POT A;  4P3L A;  4G68 A;  2F7B A;  3K6W A;  1LLS A;  2RCA A;  4OEN A;  2OCU A;  3RT6 B;  3G3K A;  2RC8 A;  1R9L A;  3KN7 A;  4OHN A;  4Q8R A;  1UTB A;  2HAU A;  3EHT A;  1B5I A;  1P1O A;  4MMP A;  4G61 A;  1D4N A;  1YXI A;  1CNQ A;  4Z0I A;  3S4U A;  2NVU B;  3EN3 A;  3D4C A;  5IZ3 A;  1YCJ A;  3DRG A;  2XHD A;  2R71 A;  3S9E A;  4NG7 A;  3T9U A;  4G68 B;  4GOT A;  3TZA A;  1URD A;  1B40 A;  3BFT A;  3S9L C;  1QKA A;  3FAT A;  4LZ7 A;  5L9O A;  4KHZ E;  1T0K A;  1B7H A;  3RUM A;  1JNF A;  3G7W A;  5L8D A;  1JQF A;  5AA4 A;  3IR1 A;  1B3E A;  1UTB B;  2QJE A;  1OVT A;  1Z7M E;  1NFT A;  2ZNU A;  1FQB A;  5A5L A;  1P1W A;  1EZO A;  1A7L A;  2QSX A;  3K6V A;  4G8H A;  5IZ3 B;  1FBE A;  3OO6 A;  4NF0 A;  3MVY A;  3ZKL A;  5H8Q A;  2DWA A;  3O6G A;  1FQE A;  3C33 A;  2ZZV A;  4U1Z A;  5ELV A;  4R6H A;  3LSX A;  1AWB A;  2DYX A;  3TQW A;  3C9H A;  4QSC A;  3IAZ A;  4YB6 A;  5AA4 B;  4UA8 A;  1B4H A;  1ZIU A;  1LBY A;  4MNP A;  4RK2 A;  4JWX A;  2GHA A;  1N3W A;  2PYY A;  2Y7K A;  4OET A;  3CVG A;  4KPT A;  4HE2 A;  5HM4 B;  2F6G A;  2HXR A;  2UVH A;  2PCR A;  3FD3 A;  5CBS A;  2I0B A;  1IMF A;  3K01 A;  4PF8 A;  5H8Q B;  2ZNT A;  4NN3 A;  2THI A;  5H8F A;  5LTC A;  5DEX B;  4ELR A;  1NUY A;  4N15 A;  1R9Q A;  4QF9 A;  1FSA A;  1OLA A;  3A09 A;  2Z8D A;  3LSL A;  4JSO A;  4LP2 B;  3K02 A;  4MHF A;  4OFL A;  3THI A;  1FQD A;  1GR2 A;  2B65 A;  3KSJ A;  3QYT A;  1NH8 A;  4R2B A;  4I8C A;  3SKP A;  1L5T A;  3Q29 A;  2Q88 A;  5AA3 A;  3FXQ A;  4MX6 A;  2VT5 A;  4LA9 A;  4H8I A;  4KYD A;  4HW8 A;  4P0G A;  3IOW A;  1M5F A;  1EYI A;  4NAP A;  2V4C A;  1ZBM A;  1OIB A;  3GBA A;  2OBG A;  4YAH X;  1PDA A;  2AIX A;  5HPQ A;  1Q35 A;  3K0V A;  2XX9 A;  3I6V A;  2WOK A;  5ET8 A;  2W7Y A;  3ROJ A;  2NUV A;  4EF2 A;  3PTY A;  4HE0 A;  2B4M A;  4OVR A;  3RGY A;  4MEV A;  3OMB A;  3F11 A;  4ONY A;  3KJ7 A;  2KLF A;  4NF8 A;  1G0I A;  3PMW A;  1P1N A;  1SYH A;  2UVI A;  3BIH A;  4ZEK A;  1II5 A;  1JW5 A;  4ISU A;  4JXI A;  4O7M A;  4Q5T A;  3LC8 A;  4AB5 A;  1SPI A;  4FEC A;  3T93 B;  1USY E;  4QFN A;  2XA5 A;  1EYK A;  1IXI A;  2HQ0 A;  2Y84 A;  1NMU A;  3Q25 A;  4GWS A;  3IOV A;  3QK6 A;  1D3K A;  4Z7E A;  3MBP A;  5H8H B;  1VE4 A;  4C1T A;  1ELJ A;  4U4X A;  4GWW A;  4I40 A;  4JBZ A;  3H03 A;  4NF8 B;  4YKP A;  4EXL A;  1XOC A;  4RA1 A;  2F78 A;  2PBW A;  3VV5 A;  3PV0 E;  2OWT A;  2HHM A;  3RYD A;  1QVS A;  1MPC A;  1B58 A;  2WOP A;  3IFA A;  3WAF A;  1DTZ A;  4AS4 A;  3JZJ A;  1P1Q A;  4NMY A;  1JEU A;  2Q8J A;  3U92 A;  2A5T A;  3RTW B;  4LZ5 A;  3FJM A;  3FV1 A;  4IO7 A;  4KXP A;  3LSF B;  2OWZ A;  4GFR A;  4RXL A;  3FBP A;  3G3H A;  2F3B A;  1S9T A;  1N0T A;  1FBF A;  4G4P A;  4N17 A;  3MUQ A;  3RLF E;  4GL8 A;  4XKR A;  4YZZ A;  3K1P A;  3K6U A;  4IR8 A;  1MXX A;  3HPI A;  1FTM A;  3B6Q A;  3RQT A;  1KWH A;  4QXD A;  1TXF A;  3TKD A;  1USY H;  4MBP A;  3T0J A;  3DRF A;  2DP8 A;  4E0X A;  4BDL A;  4ELQ A;  4DI3 D;  4F1V A;  1P1U A;  5I2N A;  2XXR A;  1FPE A;  5FHM A;  1SW5 A;  4H5F A;  3E79 A;  4F2Q A;  2I4B A;  4FE8 A;  4N8Y A;  1WVJ A;  3V8X B;  4N91 A;  3SES A;  4LN5 A;  4O94 A;  4HTG A;  5H8S A;  4O3B A;  1VFD A;  1O63 A;  1IZ1 A;  2HCA A;  4NWC A;  1LBB A;  4FED A;  2DWJ A;  1MM6 A;  4GVO A;  3PPN A;  1N3X A;  1UQW A;  1IMA A;  3IO4 A;  1RDY A;  3H4Z A;  1Y1Z A;  1FJ9 A;  4F22 A;  1QKB A;  3T9H B;  5I2N B;  3UGW A;  3CRB A;  3PMX A;  4ESX A;  2B3B A;  2QS1 A;  3E9X A;  1IMB A;  4E0W A;  4ZZA A;  2Y7P A;  2Q2C A;  2XXU A;  1PB7 A;  2YPN A;  2REJ A;  1QUK A;  3VXB A;  3H3G A;  1N84 A;  2E1S A;  3RN8 A;  5CRY A;  1US5 A;  4LQ2 A;  2V84 A;  4QSD A;  4QFO A;  4OXV A;  4X48 A;  1YYZ A;  4KFQ A;  1TFD A;  4POX A;  1NV5 A;  1B1H A;  3U65 A;  1R1N A;  1MPB A;  4DDD A;  4U22 A;  2XXY A;  2Q9T A;  4ZEF A;  2DSF A;  2PFZ A;  4P1L A;  2O1M A;  3VVD A;  1VSO A;  1ZKB A;  1BP5 A;  4LAT A;  4PDH A;  3UK4 A;  4IO2 A;  1FBH A;  3KJT A;  4DE8 A;  3VLU A;  4GX6 A;  4ZDM A;  1WDN A;  3MW0 A;  3A29 A;  3VVE A;  4JWY A;  1R6Z A;  2DXY A;  1KA1 A;  5CC2 A;  2XD3 A;  2VOZ A;  2XXT A;  5CM6 A;  5FBP A;  2F7A A;  1FTA A;  1BIY A;  4OWD A;  3QUJ A;  5IZ1 A;  2FVZ A;  4FOR A;  4NWD A;  3CFX A;  3O6P A;  3EPE A;  1NNT A;  1MY3 A;  4FIM A;  1OLC A;  1MY1 A;  3IB2 A;  2Y7I A;  2QMX A;  2ONK E;  3PAM A;  4ESW A;  4HCY A;  1RDX A;  4PFB A;  5ISU A;  3VLV A;  4ELP A;  1LFI A;  5T3J A;  3TQL A;  3PUY E;  1ZJL A;  1H3D A;  3O66 A;  2Y7R A;  1Y4C A;  1FW0 A;  1ZU0 A;  2R9J A;  2V3Q A;  3IO6 A;  5TP9 A;  1CB6 A;  2Y5L A;  3ZKK A;  1POY 1;  3MVW A;  1BLF A;  4KYE A;  4F18 A;  1RKM A;  3USD A;  2KQZ A;  4RY1 A;  1D9V A;  1DCU A;  3PUX E;  5B7D A;  4F29 A;  5EQ9 A;  3LR1 A;  4JDF A;  2WOL A;  3H7M A;  4QFP A;  3DP8 A;  4NF4 B;  1MQI A;  3SEW A;  4F3B A;  1G0H A;  3RTF B;  3MAM A;  1FQA A;  2Z22 A;  1FCK A;  2D21 A;  3VVF A;  4AQ4 A;  2O84 X;  3OSR A;  3PD8 A;  1AL3 A;  1EZ9 A;  4KYS A;  3JYR A;  3OOA A;  5TP9 B;  1JW4 A;  1FPI A;  1LBX A;  4FEB A;  4M4G A;  1SBP A;  4KI0 E;  1FPF A;  5ITP A;  4XKN A;  3TCH A;  1B7U A;  4G8N A;  2E0S A;  3RYA A;  1B9J A;  2GH9 A;  2WX9 A;  5CMK A;  4XF5 A;  1MH4 A;  3K00 A;  4MAG A;  4P47 A;  2R6G E;  3L6H A;  1LB8 A;  4GRK A;  1LFG A;  1LGB C;  4G8M A;  4YB7 A;  4OEV A;  4PFT A;  4OZ9 A;  4WEP A;  2JJK A;  2CEY A;  5KDT A;  4MF3 A;  4I1D A;  4L17 A;  3FUZ A;  3IX1 A;  3E78 A;  3O29 A;  3H6U A;  3KG2 A;  3T9X B;  2Z23 A;  4RNS A;  3CG3 A;  2PT2 A;  2B4L A;  4F3S A;  2ZZW A;  3CI8 A;  1N76 A;  4O3A A;  3FIR A;  5AA1 A;  5CI5 A;  3UN6 A;  4NED A;  5FTH A;  4YKJ A;  1H43 A;  1YTV A;  4IO4 A;  3SEX A;  4PE3 A;  4PFI A;  2PT1 A;  3O28 A;  1B32 A;  4R2F A;  4P11 A;  4PC9 A;  3UA8 A;  3GLB A;  3IJO B;  2XWO A;  2F35 A;  2Q8M A;  2RC7 A;  3OEM A;  5KDT B;  2UVJ A;  1A55 A;  3K1M A;  4GQO A;  1NI9 A;  4GLI A;  2BJJ X;  2CZL A;  1LCT A;  5DEX A;  1B7Z A;  4POW A;  1LAF E;  1XC1 A;  4PFR A;  4EUO A;  1YZ0 A;  1MQH A;  4IGR A;  3B7D A;  1IMC A;  2UYE A;  4F39 A;  4U21 A;  3KOT A;  2ALU A;  4OAN A;  4ZEB A;  5A5X A;  2H4I A;  1NUX A;  3U94 A;  3EHU A;  2BJI A;  4U2R A;  5EYG A;  1PB8 A;  4F3P A;  3PMV A;  1FJ6 A;  4EXK A;  4QFK A;  2QRY A;  3FXU A;  5FTI A;  5L9M A;  4GWY A;  2AL5 A;  4X04 A;  1FTK A;  4H8J A;  4BDR A;  2CZH A;  4N13 A;  3MP8 A;  2DVZ A;  2XXX A;  1IME A;  4XKP A;  4NGU A;  4I3E A;  1URS A;  1FPL A;  1A40 A;  2V25 A;  1A8E A;  4O8M A;  5A5X B;  4UAC A;  2WKY A;  3DM0 A;  4OES A;  4GWX A;  2VGQ A;  1BK4 A;  4U4S A;  4N6D A;  1DMB A;  2ONR A;  1B4Z A;  4N81 A;  3IB1 A;  4FJP A;  1IIW A;  2QFL A;  4LZ8 A;  1M5C A;  4YMA A;  1H45 A;  3DRI A;  1NV1 A;  2DE4 A;  1PEB A;  3SEV A;  3MVZ A;  5DT6 A;  1Y20 A;  2H9B A;  4TOZ A;  1LEV A;  4N4U A;  3ONM A;  1SW2 A;  3FJG A;  1SW1 A;  5H8H A;  1IXG A;  3UOR A;  5DW8 A;  4F2O A;  3G3G A;  3KN8 A;  1UIU A;  2H25 A;  2D5W A;  3E13 X;  4IB2 A;  1GVC A;  3VLW A;  4H46 A;  3TTR A;  1XI6 A;  3QAX A;  4ND9 A;  2F97 A;  2RIN A;  3MC2 A;  2RCB A;  4BDN A;  1NKX A;  2ZNS A;  3TCF A;  1B3L A;  1B51 A;  4XKQ A;  2NWJ A;  4PF6 A;  5KZT A;  1NV7 A;  5EQ7 A;  3OXN A;  3T96 B;  3VE1 B;  3MQ9 A;  4NX1 A;  5I7I A;  4KD5 A;  3IJX B;  3RYB A;  2X26 A;  4OVT A;  2F34 A;  1I6B A;  1DBZ A;  3T9V A;  3FZV A;  5FHO A;  1H44 A;  3FVN A;  4TLM B;  3CR9 A;  2YJP A;  1CE2 A;  3A3C A;  1LAH E;  4NF5 A;  1NL5 A;  3KC1 A;  2QS4 A;  3KBZ A;  5IZZ A;  2REG A;  4ZEI A;  1FRP A;  4PDD A;  4I62 A;  3TCG A;  2XWI A;  2XXH A;  4DXU A;  1YPN A;  4EDP A;  4F1Y A;  2ANJ A;  2VHA A;  2P1S A;  4WXJ A;  2H5Y A;  1LBV A;  2O51 A;  4TLL B;  1EYJ A;  5CMC A;  1B5H A;  3ILU B;  4IO5 A;  1DSN A;  3Q27 A;  2V3U A;  2CMO A;  4GWZ A;  4FBP A;  1M5B A;  4NF5 B;  1EU8 A;  1MM7 A;  2FHY A;  4YIC A;  1ZLQ A;  1KA0 A;  1TFA A;  1A54 A;  2RC9 A;  4LON B;  2XXP A;  3E3K A;  3MJN A;  3K2D A;  3KSX A;  1XT8 A;  1LB9 A;  1Y9U A;  1MY0 A;  2DWH A;  2OX3 A;  1SI1 A;  2VPO A;  2FIE A;  4X9T A;  3TTN A;  2ZYM A;  1XVY A;  1QW0 A;  4ELO A;  5AA2 A;  1FPK A;  4GWO A;  3RPW A;  2M8C A;  4PBH A;  3VFJ A;  4DCX A;  3QXM A;  4LUB A;  1DK4 A;  2L5V A;  1DTG A;  3MZ1 A;  5HBC A;  4OQO A;  4NTL A;  1SDX A;  4OVQ A;  4YB5 A;  5F1Q A;  4OER A;  5ET7 A;  4ZED A;  1GV8 A;  1KZ8 A;  4YU0 A;  2ZYK A;  4MNC A;  2XXW A;  3HFU A;  5EHM A;  4I3Y A;  3N6U A;  4MIJ A;  2LAO A;  4R72 A;  4PFW A;  2Z8F A;  4H67 A;  2R8T A;  2HZL A;  3HN0 A;  3G3J A;  3OSQ A;  1D9Q A;  1B6H A;  3TYH A;  4K3F A;  3FXB A;  5AA2 B;  2HAV A;  2NOO A;  1DOT A;  2ONS A;  3MZ9 A;  2DDK A;  1DPP A;  1AIV A;  2I6E A;  3L6G A;  3PPO A;  1JVX A;  2UVG A;  2QVV A;  2DVC A;  5J16 A;  3CFL A;  5CMM A;  4R9F A;  3CHG A;  5BUU A;  4P9K A;  4I9D A;  3C4M A;  1HSJ A;  3DP4 A;  2AL4 A;  1US4 A;  2HPG A;  3QUF A;  4H45 A;  4JSD A;  3O9P A;  2O7I A;  4WED A;  1NV0 A;  2Q89 A;  1LAX A;  3QMF A;  4H0W A;  1FBD A;  2OJT A;  3FVG A;  2XX7 A;  5EYH A;  2F8D A;  4IY5 A;  5LDZ A;  3DRH A;  5I57 A;  3B6W A;  2OWS A;  1SW4 A;  1A8F A;  3IFC A;  2ABH A;  1JP4 A;  3ODB A;  4GL0 A;  5IM2 A;  4OYV A;  5JTY B;  3K1N A;  4DCY A;  4UAB A;  1LBW A;  1B52 A;  1S7Y A;  2GRV A;  1MXZ A;  5KCJ A;  2CEX A;  5I58 A;  3KFM A;  5JEI A;  4PGP A;  1D9Y A;  4NF4 A;  3V83 A;  4G68 C;  3U8Q A;  4QHQ A;  2GFE A;  4FAJ A;  2OK2 A;  4RPN A;  1XHY A;  3KN3 A;  1LBZ A;  1OQG A;  4PGN A;  3RNN A;  3K4U A;  3UP9 A;  1N04 A;  3WAE A;  4G2Z A;  2PVU A;  5I57 B;  3OD7 A;  1OVB A;  1MQD A;  2XX8 A;  4GX4 A;  2FA7 A;  1M5D A;  2Y7W A;  3D1R A;  1MS7 A;  3A3U A;  3T1B A;  1Q1K A;  2P2A A;  2H98 A;  4LVQ A;  3GBB A;  3OO9 A;  1XVX A;  2YLN A;  5KCJ B;  2Y5K A;  3IK6 B;  5I58 B;  2ESN A;  1P99 A;  1NNP A;  1F9B A;  3TEP A;  3HCQ A;  1AOV A;  4Q30 B;  3B50 A;  3IB0 A;  2X7P A;  4OVS A;  4LQ5 A;  5I3S A;  1JET A;  4KQP A;  3TTK A;  3I3V A;  2PMS A;  5JK4 A;  1MXV A;  3BIG A;  3V5A A;  2DE3 A;  5TPA A;  5F24 A;  4ZS9 A;  3OEL A;  4R74 A;  3PGF A;  5CMB A;  4XEQ A;  1DPE A;  3O6H A;  2Q2A A;  5EYF A;  4DI4 B;  4PQJ A;  1Q9D A;  1UTH A;  1QUI A;  1MXY A;  4ZE8 A;  4PCD A;  3W15 C;  1O64 A;  2UYF A;  1IEJ A;  1Y3N A;  4ZZE A;  1JW1 A;  3C31 A;  5EHS A;  3U93 A;  4PFU A;  1GTK A;  3MP1 A;  1OMP A;  3MYU A;  5I2K B;  1Y1M A;  2B3F A;  5TPA B;  3FTO A;  2KR0 A;  5ICQ A;  1HSL A;  3LV0 A;  1J1N A;  1IIT A;  3FVO A;  1Z7N E;  3IL1 B;  4O3C A;  4PTK A;  4EQ9 A;  1UTH B;  3I5O A;  3TDJ A;  1MY2 A;  4H6D A;  2I58 A;  4ZE9 A;  1MDQ A;  3D4G A;  5IKB A;  1B46 A;  4O7I A;  3SZP A;  1FBC A;  2I49 A;  1EZP A;  4Q0C A;  4PAK A;  5DYH A;  2FYI A;  2IEE A;  4YKI A;  1FBG A;  3MP6 A;  2O69 A;  4IGT A;  1BKA A;  3TEL A;  1EH3 A;  1NV2 A;  4EQ7 A;  2P3V A;  5IAI A;  1FPJ A;  1IXC A;  3BKI B;  1N7W A;  1VR5 A;  3CSB A;  4XIG Q;  3TTL A;  5ICT A;  2XXK A; 
#chains in the Genus database with same CATH homology
 3HHG A;  5H8N A;  4X1D A;  3C34 A;  3PD9 A;  3DRJ A;  3EF7 A;  5FHN A;  1H76 A;  4OTE A;  3VDF A;  4F19 A;  3OO7 A;  2PX1 A;  2VD2 A;  1O7T A;  1FTL A;  1B3F A;  5L9S A;  3IOT A;  3PPQ A;  1B3G A;  2QMW A;  2XXV A;  5DTB A;  4BLA A;  3FAS A;  4YKK A;  4MLV A;  1MY4 A;  1B0L A;  3R26 A;  4YMB A;  2XD2 A;  3LBS A;  1ATG A;  5I59 A;  5H8N B;  3GXA A;  1TT1 A;  2XXQ A;  2I0C A;  4MLQ A;  1MQJ A;  3IOR A;  4HCW A;  2X7Q A;  4PP0 A;  3U72 A;  2UXA A;  3FJ7 A;  3UIF A;  3CIJ A;  4BDQ A;  5I56 A;  5I84 A;  3OEN A;  3SER A;  4R75 A;  3HO7 A;  2NXO A;  3T22 A;  1OQH A;  4U23 A;  3MPL A;  2AYS A;  5I59 B;  1MXU A;  4RPO A;  4RK9 A;  1IXH A;  3OEK A;  5BWJ A;  5H8F B;  5AE4 A;  1FQC A;  4H1X A;  1MPD A;  1PB9 A;  4ECF A;  3BBR A;  2HFB A;  3QIM A;  2HEU A;  2P0S A;  4RYA A;  4IY6 A;  1URG A;  1JVY A;  1PBQ A;  4KCD A;  3FXR A;  4R73 A;  5I56 B;  1PC3 A;  5K2X A;  4IO3 A;  1N7X A;  2I3W A;  5LOM A;  1SI0 A;  3W9V A;  3SET A;  4H65 A;  2DWI A;  2DS9 A;  4XXU A;  2ZYO A;  1LCF A;  5B70 A;  1S50 A;  3O2A A;  3M8U A;  4TQU Q;  1SD3 A;  1SYI A;  4GIZ A;  3K6X A;  2OLB A;  4NE4 A;  1RYO A;  1RYX A;  3RY3 A;  1NNF A;  2RF1 A;  1IQ7 A;  3DEL B;  2XXI A;  3MVX A;  2VP1 A;  5CBR A;  3AXF A;  2DQV A;  3R6U A;  3PUZ E;  3KZG A;  1Y4T A;  3G3I A;  1ZMG A;  1B5J A;  3HHF A;  2A5S A;  1MQG A;  4PET A;  4GD5 A;  5K2Y A;  3MWB A;  1I6Q A;  4OEU A;  2H99 A;  5J1D A;  1GGG A;  2F6P A;  3ILT B;  4DXB A;  2QL3 A;  4QSE A;  3O6I A;  3TUS A;  4HS7 A;  3QSL A;  4BDO A;  1SQY A;  4U1O A;  5AA2 D;  4RJZ A;  3N5L A;  1VFE A;  1M5E A;  3V89 B;  3SDF A;  2FNC A;  3FV2 A;  4G77 A;  2IA4 A;  3LVU A;  1YAE A;  3C32 A;  4R6K A;  1I69 A;  4OFO A;  3KGC A;  3LUY A;  1LFH A;  1FTJ A;  2GHB A;  3GZG A;  4FAT A;  1MH3 A;  2DE2 A;  1XS5 A;  4P0I A;  4M1V A;  4N07 A;  4EF1 A;  2F36 A;  3TAJ A;  3W9W A;  4DIG A;  1MRP A;  4R9G A;  2A5T B;  3PU5 A;  1NNK A;  1AMF A;  2O6A A;  3RT8 A;  4F31 B;  3Q28 A;  2DXR A;  3KOS A;  2ZYN A;  3FVK A;  1MDP 1;  4QFL A;  3PUW E;  3CG1 A;  4R6Y A;  4JWO A;  2G93 A;  2I3V A;  4AB6 A;  4OFJ A;  3HST A;  3N6T A;  3TOD A;  4DZ1 A;  3G3F A;  2F7C A;  3PUV E;  5DVI A;  3O97 A;  1IUD A;  3TFL A;  3M3L A;  3MZB A;  1ANF A;  3VXC A;  3KBR A;  4N6P A;  3T66 A;  1QUL A;  1B0H A;  1TWY A;  3KEI A;  2O68 A;  3H06 B;  4THI A;  3H6V A;  2DOJ A;  2G29 A;  1A99 A;  3TPA A;  2O7U A;  3B6T A;  2V93 A;  1HSE A;  3M3F A;  3M3K A;  3DP6 A;  5JTY A;  1BTJ A;  3JV9 A;  1QJM A;  2O1L A;  1FQF A;  1B3H A;  2QS3 A;  5DVJ A;  1MG1 A;  4ZEC A;  3FGS A;  1AH5 A;  3ZS6 A;  1NH7 A;  2I4C A;  2QS2 A;  4C1U A;  4C0R A;  1LST A;  3P7I A;  4OVJ A;  5M2V A;  3PPR A;  1PBP A;  3S9N C;  3CFZ A;  4PE5 B;  1UIV A;  3DRK A;  3SEU A;  3EHS A;  3C35 A;  1I6A A;  2Z8E A;  4GXA A;  3MPK A;  1B2H A;  2VD3 A;  2QPQ A;  4KR5 A;  1MXW A;  3DLN A;  3SEY A;  3S9M C;  2OZZ A;  4KCC A;  1B05 A;  4X1B A;  1FTO A;  3IOU A;  4PFY A;  1LAG E;  3N94 A;  3U1O A;  2F5X A;  2D3I A;  3ECR A;  2HXW A;  4IO6 A;  5TU0 A;  4H5G A;  1B1X A;  3Q26 A;  3LSW A;  3CSG A;  3EQ1 A;  4MH5 A;  4NF6 A;  3HV1 A;  3H6T A;  4EQB A;  1Y3Q A;  4GF8 A;  3C36 A;  5ITO A;  2ZXT A;  5DVF A;  4XTC Q;  3TTM A;  4GXS B;  5F7V A;  3H6W A;  3E4R A;  1Y3P A;  5I2K A;  4F3G A;  4JB7 A;  4QRZ A;  4WKM A;  3PPP A;  1ZTY A;  4OMB A;  4DXC A;  2I48 A;  3BFU A;  1QUJ A;  3N26 A;  1LBC A;  3OO8 A;  3S2V A;  2V3T A;  2ZMB A;  3R7X A;  4DLD A;  4MFI A;  2RKM A;  1WOD A;  1SVX B;  4NF6 B;  3ZSF A;  4F1U A;  3TMG A;  2HZK A;  1JEV A;  4BDM A;  1POT A;  4G68 A;  2F7B A;  3K6W A;  1LLS A;  2RCA A;  4OEN A;  2OCU A;  3RT6 B;  3G3K A;  2RC8 A;  1R9L A;  3KN7 A;  4OHN A;  4Q8R A;  1UTB A;  2HAU A;  3EHT A;  1B5I A;  1P1O A;  1D4N A;  4Z0I A;  3S4U A;  2NVU B;  3EN3 A;  3D4C A;  1YCJ A;  3DRG A;  2XHD A;  2R71 A;  3S9E A;  3T9U A;  4G68 B;  4GOT A;  3TZA A;  1URD A;  1B40 A;  3BFT A;  3S9L C;  1QKA A;  3FAT A;  4LZ7 A;  5L9O A;  4KHZ E;  1T0K A;  1B7H A;  3RUM A;  1JNF A;  3G7W A;  5L8D A;  1JQF A;  5AA4 A;  3IR1 A;  1B3E A;  1UTB B;  2QJE A;  1OVT A;  1Z7M E;  1NFT A;  2ZNU A;  1FQB A;  1P1W A;  1EZO A;  1A7L A;  2QSX A;  3K6V A;  4G8H A;  3OO6 A;  3MVY A;  3ZKL A;  5H8Q A;  2DWA A;  3O6G A;  1FQE A;  3C33 A;  4U1Z A;  5ELV A;  4R6H A;  3LSX A;  2DYX A;  3TQW A;  3C9H A;  4QSC A;  3IAZ A;  4YB6 A;  5AA4 B;  4UA8 A;  1B4H A;  1ZIU A;  4RK2 A;  4JWX A;  2GHA A;  1N3W A;  2PYY A;  2Y7K A;  4OET A;  3CVG A;  4KPT A;  5HM4 B;  2F6G A;  2UVH A;  3FD3 A;  5CBS A;  2I0B A;  3K01 A;  5H8Q B;  2ZNT A;  2THI A;  5H8F A;  5DEX B;  4ELR A;  1R9Q A;  4QF9 A;  1OLA A;  3A09 A;  2Z8D A;  3LSL A;  4JSO A;  4LP2 B;  3K02 A;  4OFL A;  3THI A;  1FQD A;  1GR2 A;  2B65 A;  3KSJ A;  3QYT A;  1NH8 A;  4R2B A;  4I8C A;  3SKP A;  1L5T A;  3Q29 A;  2Q88 A;  5AA3 A;  3FXQ A;  4LA9 A;  4H8I A;  4KYD A;  4HW8 A;  4P0G A;  3IOW A;  1M5F A;  1ZBM A;  1OIB A;  3GBA A;  2OBG A;  4YAH X;  1PDA A;  2AIX A;  5HPQ A;  1Q35 A;  3K0V A;  2XX9 A;  3I6V A;  2WOK A;  2W7Y A;  2NUV A;  4EF2 A;  2B4M A;  3RGY A;  3OMB A;  3F11 A;  4ONY A;  3KJ7 A;  2KLF A;  4NF8 A;  3PMW A;  1P1N A;  1SYH A;  2UVI A;  4ZEK A;  1II5 A;  1JW5 A;  4ISU A;  4JXI A;  4Q5T A;  3LC8 A;  4AB5 A;  4FEC A;  3T93 B;  1USY E;  4QFN A;  1IXI A;  2HQ0 A;  2Y84 A;  1NMU A;  3Q25 A;  3IOV A;  3QK6 A;  1D3K A;  4Z7E A;  3MBP A;  5H8H B;  1VE4 A;  4C1T A;  1ELJ A;  4U4X A;  4JBZ A;  3H03 A;  4NF8 B;  4YKP A;  4EXL A;  1XOC A;  4RA1 A;  2F78 A;  2PBW A;  3VV5 A;  3PV0 E;  2OWT A;  1QVS A;  1MPC A;  1B58 A;  2WOP A;  3WAF A;  1DTZ A;  3JZJ A;  1P1Q A;  4NMY A;  1JEU A;  2Q8J A;  3U92 A;  2A5T A;  3RTW B;  4LZ5 A;  3FJM A;  3FV1 A;  4IO7 A;  3LSF B;  4GFR A;  4RXL A;  3G3H A;  1S9T A;  1N0T A;  4G4P A;  3MUQ A;  3RLF E;  4GL8 A;  4XKR A;  4YZZ A;  3K1P A;  3K6U A;  1MXX A;  3HPI A;  1FTM A;  3B6Q A;  3RQT A;  1KWH A;  1TXF A;  3TKD A;  1USY H;  4MBP A;  3DRF A;  2DP8 A;  4E0X A;  4BDL A;  4ELQ A;  4F1V A;  1P1U A;  5I2N A;  2XXR A;  5FHM A;  1SW5 A;  4H5F A;  4F2Q A;  2I4B A;  4FE8 A;  1WVJ A;  3V8X B;  3SES A;  4HTG A;  5H8S A;  4O3B A;  1VFD A;  1O63 A;  1IZ1 A;  2HCA A;  4NWC A;  1LBB A;  4FED A;  2DWJ A;  1MM6 A;  4GVO A;  3PPN A;  1N3X A;  1UQW A;  3IO4 A;  3H4Z A;  1Y1Z A;  4F22 A;  1QKB A;  3T9H B;  5I2N B;  3UGW A;  3CRB A;  3PMX A;  4ESX A;  2B3B A;  2QS1 A;  3E9X A;  4E0W A;  4ZZA A;  2Y7P A;  2Q2C A;  2XXU A;  1PB7 A;  2YPN A;  2REJ A;  1QUK A;  3VXB A;  3H3G A;  1N84 A;  2E1S A;  3RN8 A;  5CRY A;  1US5 A;  4LQ2 A;  2V84 A;  4QSD A;  4QFO A;  4OXV A;  4X48 A;  4KFQ A;  1TFD A;  4POX A;  1B1H A;  1R1N A;  1MPB A;  4DDD A;  4U22 A;  2XXY A;  2Q9T A;  4ZEF A;  2DSF A;  2O1M A;  3VVD A;  1VSO A;  1ZKB A;  1BP5 A;  4LAT A;  3UK4 A;  4IO2 A;  3KJT A;  4DE8 A;  3VLU A;  4ZDM A;  1WDN A;  3MW0 A;  3VVE A;  4JWY A;  1R6Z A;  2DXY A;  5CC2 A;  2XD3 A;  2VOZ A;  2XXT A;  5CM6 A;  2F7A A;  1BIY A;  4OWD A;  3QUJ A;  4FOR A;  4NWD A;  3CFX A;  3O6P A;  3EPE A;  1NNT A;  1MY3 A;  4FIM A;  1OLC A;  1MY1 A;  3IB2 A;  2Y7I A;  2QMX A;  2ONK E;  3PAM A;  4ESW A;  4HCY A;  5ISU A;  3VLV A;  4ELP A;  1LFI A;  3TQL A;  3PUY E;  1ZJL A;  1H3D A;  3O66 A;  2Y7R A;  1Y4C A;  1FW0 A;  1ZU0 A;  2R9J A;  2V3Q A;  3IO6 A;  5TP9 A;  1CB6 A;  3ZKK A;  1POY 1;  3MVW A;  1BLF A;  4KYE A;  4F18 A;  1RKM A;  3USD A;  4RY1 A;  1D9V A;  3PUX E;  5B7D A;  4F29 A;  3LR1 A;  4JDF A;  2WOL A;  3H7M A;  4QFP A;  3DP8 A;  4NF4 B;  1MQI A;  3SEW A;  4F3B A;  3RTF B;  3MAM A;  1FQA A;  2Z22 A;  1FCK A;  2D21 A;  3VVF A;  4AQ4 A;  2O84 X;  3OSR A;  3PD8 A;  1AL3 A;  1EZ9 A;  4KYS A;  3JYR A;  3OOA A;  5TP9 B;  1JW4 A;  4FEB A;  4M4G A;  1SBP A;  4KI0 E;  5ITP A;  4XKN A;  3TCH A;  1B7U A;  4G8N A;  2E0S A;  3RYA A;  1B9J A;  2GH9 A;  5CMK A;  1MH4 A;  3K00 A;  2R6G E;  3L6H A;  1LB8 A;  4GRK A;  1LFG A;  1LGB C;  4G8M A;  4YB7 A;  4OEV A;  4PFT A;  4OZ9 A;  4WEP A;  5KDT A;  4MF3 A;  4I1D A;  4L17 A;  3FUZ A;  3IX1 A;  3O29 A;  3H6U A;  3KG2 A;  3T9X B;  2Z23 A;  4RNS A;  3CG3 A;  2PT2 A;  2B4L A;  4F3S A;  3CI8 A;  1N76 A;  4O3A A;  3FIR A;  5AA1 A;  5CI5 A;  3UN6 A;  4NED A;  5FTH A;  4YKJ A;  1H43 A;  1YTV A;  4IO4 A;  3SEX A;  2PT1 A;  3O28 A;  1B32 A;  4R2F A;  4P11 A;  3UA8 A;  3GLB A;  3IJO B;  2F35 A;  2RC7 A;  3OEM A;  5KDT B;  2UVJ A;  1A55 A;  3K1M A;  4GQO A;  4GLI A;  2BJJ X;  2CZL A;  1LCT A;  5DEX A;  1B7Z A;  4POW A;  1LAF E;  1XC1 A;  4EUO A;  1MQH A;  4IGR A;  3B7D A;  2UYE A;  4F39 A;  4U21 A;  3KOT A;  2ALU A;  4ZEB A;  5A5X A;  2H4I A;  3U94 A;  3EHU A;  4U2R A;  1PB8 A;  4F3P A;  3PMV A;  4EXK A;  4QFK A;  2QRY A;  3FXU A;  5FTI A;  5L9M A;  2AL5 A;  1FTK A;  4H8J A;  4BDR A;  4N13 A;  3MP8 A;  2DVZ A;  2XXX A;  4XKP A;  1URS A;  1A40 A;  2V25 A;  1A8E A;  5A5X B;  4UAC A;  2WKY A;  3DM0 A;  4OES A;  2VGQ A;  4U4S A;  1DMB A;  2ONR A;  1B4Z A;  3IB1 A;  4FJP A;  1IIW A;  4LZ8 A;  1M5C A;  4YMA A;  1H45 A;  3DRI A;  2DE4 A;  1PEB A;  3SEV A;  3MVZ A;  5DT6 A;  1Y20 A;  2H9B A;  4TOZ A;  3ONM A;  1SW2 A;  3FJG A;  1SW1 A;  5H8H A;  1IXG A;  3UOR A;  4F2O A;  3G3G A;  3KN8 A;  1UIU A;  2H25 A;  2D5W A;  3E13 X;  4IB2 A;  1GVC A;  3VLW A;  3TTR A;  3QAX A;  4ND9 A;  2F97 A;  2RIN A;  3MC2 A;  2RCB A;  4BDN A;  1NKX A;  2ZNS A;  3TCF A;  1B3L A;  1B51 A;  4XKQ A;  2NWJ A;  5KZT A;  3T96 B;  3OXN A;  3VE1 B;  3MQ9 A;  4KD5 A;  3IJX B;  3RYB A;  2X26 A;  2F34 A;  1I6B A;  3T9V A;  3FZV A;  5FHO A;  1H44 A;  3FVN A;  4TLM B;  3CR9 A;  2YJP A;  1CE2 A;  3A3C A;  1LAH E;  4NF5 A;  1NL5 A;  2QS4 A;  2REG A;  4ZEI A;  4I62 A;  3TCG A;  2XXH A;  4DXU A;  1YPN A;  4EDP A;  4F1Y A;  2ANJ A;  2VHA A;  2P1S A;  4WXJ A;  2H5Y A;  2O51 A;  4TLL B;  5CMC A;  1B5H A;  3ILU B;  4IO5 A;  1DSN A;  3Q27 A;  2V3U A;  2CMO A;  1M5B A;  4NF5 B;  1EU8 A;  1MM7 A;  4YIC A;  1ZLQ A;  1TFA A;  1A54 A;  2RC9 A;  4LON B;  2XXP A;  3E3K A;  3MJN A;  3K2D A;  3KSX A;  1XT8 A;  1LB9 A;  1Y9U A;  1MY0 A;  2DWH A;  1SI1 A;  4X9T A;  3TTN A;  2ZYM A;  1XVY A;  1QW0 A;  4ELO A;  5AA2 A;  4GWO A;  3RPW A;  2M8C A;  3VFJ A;  4DCX A;  3QXM A;  4LUB A;  1DTG A;  3MZ1 A;  5HBC A;  4OQO A;  4NTL A;  1SDX A;  4YB5 A;  5F1Q A;  4OER A;  4ZED A;  1GV8 A;  4YU0 A;  2ZYK A;  2XXW A;  5EHM A;  3N6U A;  2LAO A;  4R72 A;  4PFW A;  2Z8F A;  4H67 A;  2HZL A;  3HN0 A;  3G3J A;  3OSQ A;  3TYH A;  1B6H A;  4K3F A;  5AA2 B;  2HAV A;  2NOO A;  1DOT A;  2ONS A;  3MZ9 A;  1DPP A;  1AIV A;  2I6E A;  3L6G A;  3PPO A;  1JVX A;  2UVG A;  2DVC A;  3CFL A;  5CMM A;  4R9F A;  3CHG A;  5BUU A;  4I9D A;  3C4M A;  1HSJ A;  3DP4 A;  2AL4 A;  1US4 A;  3QUF A;  4JSD A;  3O9P A;  2O7I A;  4WED A;  2Q89 A;  1LAX A;  4H0W A;  2OJT A;  3FVG A;  2XX7 A;  2F8D A;  4IY5 A;  3DRH A;  5I57 A;  3B6W A;  2OWS A;  1SW4 A;  1A8F A;  2ABH A;  3ODB A;  4GL0 A;  4OYV A;  5JTY B;  3K1N A;  4DCY A;  1B52 A;  1S7Y A;  2GRV A;  1MXZ A;  5KCJ A;  5I58 A;  3KFM A;  5JEI A;  1D9Y A;  4NF4 A;  3V83 A;  4G68 C;  3U8Q A;  4QHQ A;  2GFE A;  4FAJ A;  2OK2 A;  4RPN A;  1XHY A;  3KN3 A;  1OQG A;  3RNN A;  3K4U A;  3UP9 A;  1N04 A;  3WAE A;  4G2Z A;  2PVU A;  5I57 B;  3OD7 A;  1OVB A;  1MQD A;  2XX8 A;  2FA7 A;  1M5D A;  2Y7W A;  1MS7 A;  3A3U A;  1Q1K A;  2P2A A;  2H98 A;  4LVQ A;  3GBB A;  3OO9 A;  1XVX A;  2YLN A;  5KCJ B;  3IK6 B;  5I58 B;  2ESN A;  1P99 A;  1NNP A;  1F9B A;  3TEP A;  3HCQ A;  1AOV A;  4Q30 B;  3IB0 A;  2X7P A;  4LQ5 A;  1JET A;  4KQP A;  3TTK A;  3I3V A;  2PMS A;  5JK4 A;  1MXV A;  3V5A A;  2DE3 A;  5TPA A;  4ZS9 A;  3OEL A;  4R74 A;  3PGF A;  5CMB A;  1DPE A;  3O6H A;  2Q2A A;  5EYF A;  4PQJ A;  1UTH A;  1QUI A;  1MXY A;  4ZE8 A;  3W15 C;  1O64 A;  2UYF A;  1IEJ A;  1Y3N A;  4ZZE A;  1JW1 A;  3C31 A;  5EHS A;  3U93 A;  4PFU A;  1GTK A;  3MP1 A;  1OMP A;  5I2K B;  1Y1M A;  2B3F A;  5TPA B;  3FTO A;  5ICQ A;  1HSL A;  1J1N A;  1IIT A;  3FVO A;  1Z7N E;  3IL1 B;  4O3C A;  4EQ9 A;  1UTH B;  3I5O A;  3TDJ A;  1MY2 A;  4H6D A;  2I58 A;  4ZE9 A;  1MDQ A;  3D4G A;  5IKB A;  1B46 A;  2I49 A;  1EZP A;  4Q0C A;  5DYH A;  2FYI A;  2IEE A;  4YKI A;  3MP6 A;  2O69 A;  4IGT A;  1BKA A;  3TEL A;  1EH3 A;  4EQ7 A;  5IAI A;  1IXC A;  3BKI B;  1N7W A;  1VR5 A;  3CSB A;  4XIG Q;  3TTL A;  5ICT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...