1B2HA

Oligo-peptide binding protein complexed with lysyl-ornithyl-lysine
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 186
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b2hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b2hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b2hA02
4KCDA 1RKMA 4FE8A 2GFEA 4GXSB 1B3FA 3IL1B 4UACA 1MQDA 4KI0E 1AIVA 5EYFA 1FQAA 3IK6B 4IO4A 3ONMA 4ZDMA 2BJJX 1ATGA 5I84A 4IO2A 3SESA 3CSBA 3T22A 3MP6A 1D9YA 2QS2A 3K1PA 4MBPA 2DE3A 1B0HA 2IEEA 5HM4B 1B51A 3MJNA 1JVXA 2HFBA 3RN8A 3IB2A 4WXJA 1NFTA 1A7LA 3G3FA 4U1ZA 2I0BA 1MG1A 3DRFA 4XKNA 3O2AA 2XXIA 5L9MA 3G3IA 1OMPA 4PFWA 3TTLA 5IAIA 4IO3A 4YB5A 2ONRA 1B7UA 5L9OA 3IOTA 2F8DA 1TFAA 1LSTA 4FATA 1S50A 1AL3A 2XD3A 3OEKA 2ESNA 4GL0A 1QVSA 1B9JA 3USDA 4F22A 3MC2A 4N13A 1H43A 1I6BA 4F18A 4JXIA 4IY6A 4ELQA 4ELOA 4U1OA 3CG3A 3HO7A 3CFXA 4KYSA 2D21A 2RC8A 2F34A 1LB8A 3FASA 1IITA 1FQBA 3EHUA 2R6GE 2DVCA 4AB5A 4GL8A 5CMKA 1IQ7A 1N7WA 1Y3QA 1LBCA 4H8JA 5TP9B 3CI8A 4RY1A 1KWHA 3T96B 3PUZE 4MF3A 1Q1KA 1SW4A 4QFKA 4YICA 2DXYA 4QSEA 2M8CA 4OERA 4FIMA 2RCBA 4JWOA 3SETA 1YPNA 3U1OA 1AMFA 4H67A 1EZPA 2F6GA 3G3HA 1B4ZA 3CSGA 3O6GA 3PMVA 3VV5A 2ZNSA 3MAMA 1B1XA 1FTKA 4FEDA 1QKAA 1B2HA 2DSFA 1OQGA 4GD5A 1LAGE 1FQDA 1F9BA 1BKAA 1OVBA 2Q2AA 2ZYMA 2XXQA 5H8QA 4DIGA 5CBRA 3MZBA 1OQHA 2OZZA 4XTCQ 3C9HA 4IGTA 4NF8B 3LSLA 4H1XA 3EF7A 2F6PA 4EQBA 4LZ8A 3TDJA 3MPKA 1B5JA 4EQ9A 2XXTA 4G2ZA 1QULA 4ECFA 4H0WA 4R72A 4ZE8A 1UTHB 2AL4A 1BTJA 4XXUA 4EUOA 1XOCA 4GXAA 3FV2A 5JTYA 1H44A 5B7DA 4NF6A 4DCYA 3CFLA 1VSOA 4YAHX 2ALUA 1GTKA 4KCCA 5I56A 4I9DA 4NF4A 2FYIA 2DXRA 4ND9A 3RYBA 2NOOA 4LA9A 1MM6A 3FVNA 4RA1A 4G68A 2F7BA 4KHZE 2FA7A 3RT6B 5I59B 2NUVA 4F19A 3SDFA 1GGGA 1A8EA 5DT6A 5AE4A 1UTBA 1M5CA 1ZMGA 1MXUA 1XT8A 3RY3A 2QS1A 3HHFA 3HN0A 5BWJA 1URGA 3LSFB 2DOJA 4JB7A 3DP6A 1NNFA 3CVGA 4Z7EA 2OJTA 3FIRA 2XX7A 3V8XB 3ECRA 2RKMA 3VLUA 3O28A 1B32A 2HAVA 2OCUA 3MWBA 3VLVA 3IJOB 4UA8A 1PB8A 3LSWA 3PMWA 3SERA 3UP9A 2DS9A 1J1NA 1MXXA 3RTFB 1ANFA 4F31B 2XXWA 3B6QA 4YZZA 3G3KA 2O7UA 3CG1A 3FV1A 3FJGA 1SI1A 5A5XA 3GBBA 3IOWA 3W15C 3K0VA 2DYXA 3IOUA 4QSDA 1P1UA 1MDP1 4TOZA 1T0KA 2WKYA 1ELJA 1L5TA 1I6AA 1GV8A 1HSJA 1A8FA 5HBCA 4DDDA 1N3WA 3KJTA 4YB6A 3QUFA 4Q0CA 5H8FA 5KCJA 3K01A 4ESWA 4QF9A 4MLQA 4N07A 3M8UA 4G8MA 1R6ZA 3TMGA 1NNPA 3K1MA 3RLFE 4NMYA 2R71A 1LFGA 3OO7A 4HCWA 1FQFA 2WOKA 3O6PA 5F1QA 2F97A 2I3VA 4F29A 3TTKA 1IXCA 3IO6A 4IO6A 3C31A 1H76A 3PPOA 3B6WA 4DLDA 2V84A 4RJZA 5K2YA 2CMOA 4QFLA 4BDQA 1B40A 2Y7IA 2ZNUA 3S9NC 1P1NA 3MUQA 5DEXA 1FTLA 1ZKBA 3VDFA 2REJA 4Q5TA 5I2KB 1US4A 2Y84A 4H5FA 3MVYA 1DSNA 1NKXA 2XX8A 3UN6A 3PPPA 3JYRA 2ANJA 3FXRA 2Q89A 3JZJA 5CBSA 3KJ7A 4EXKA 3TTNA 4R6HA 4THIA 5AA3A 3GLBA 2FNCA 5ITPA 3N6UA 3PGFA 4F3BA 5K2XA 3DRIA 2O84X 4JSOA 1NH8A 2PMSA 4KYDA 4OYVA 4PETA 4NF5A 2HZKA 4R75A 2XXYA 3L6GA 1GVCA 3B7DA 1MXVA 3GXAA 2PBWA 4X9TA 5F7VA 3T9XB 3WAFA 2H99A 1SBPA 2XXVA 3EHTA 4YKJA 4RK2A 2Q2CA 1URSA 3BKIB 4F3PA 1B52A 4HS7A 4G77A 1P1WA 5KZTA 4IB2A 3FXQA 3K6XA 4NWDA 4H6DA 3H03A 3TODA 3IR1A 5H8HB 1QUIA 4PFYA 2DE4A 3D4CA 4BDOA 3A09A 1TT1A 3FGSA 3O6IA 4BDRA 4LVQA 1BLFA 4RNSA 1PDAA 2G29A 5I2NB 3IORA 4DE8A 2Q88A 2REGA 4OTEA 3IB1A 4NEDA 1P1QA 2DWHA 1SYIA 1B0LA 1IIWA 2I48A 2AYSA 2V25A 2LAOA 1N76A 3SKPA 4ISUA 2DWJA 3U92A 2Q8JA 2A5TA 1JEVA 2ZXTA 3Q26A 4P0GA 1Y9UA 1OVTA 4KYEA 4G4PA 2XXUA 2HQ0A 3RQTA 1MPBA 4F2QA 4ZZAA 3BBRA 3U8QA 3PUWE 3VE1B 3KZGA 3U94A 1MS7A 2THIA 2PT2A 1LLSA 5CC2A 4LONB 4EDPA 1M5BA 3G3GA 3S9MC 5ICQA 3UK4A 3FXUA 4GLIA 2I0CA 1IUDA 4E0WA 1LCTA 1MXZA 5FTHA 3T9HB 1IXHA 2HEUA 1SW2A 2I4CA 1Y4TA 5CMCA 4Z0IA 3DLNA 3KN7A 1JW4A 1MQGA 3C34A 1XS5A 5FHMA 2B4LA 1JQFA 3PU5A 1XVYA 4EXLA 3T66A 1B5HA 4G8NA 2O1MA 4GQOA 3VXBA 2O51A 4XKQA 2F36A 2UVHA 2DWIA 1UIVA 2UYEA 4O3CA 4OHNA 4OWDA 1PC3A 1LGBC 2QS3A 4GFRA 1ZBMA 2I58A 3KBRA 4QFNA 4YKPA 2Z8FA 4M4GA 1MH4A 5DYHA 4EF2A 4L17A 2ABHA 4U2RA 2B65A 4RPOA 3O9PA 3C4MA 3QAXA 1ZLQA 1SW5A 1IEJA 2X26A 1JEUA 5H8SA 1N7XA 4I8CA 1XC1A 2VP1A 1BIYA 4F39A 1A99A 2WOPA 2IA4A 1N84A 4N6PA 3TEPA 1R1NA 2RC9A 1R9QA 3LVUA 3M3FA 3CFZA 2O69A 3M3LA 3RNNA 1MH3A 2YJPA 4F1UA 4C1UA 2RINA 2ZYNA 1ZIUA 4U22A 3FZVA 4PE5B 1EZOA 1NMUA 4KPTA 2UVJA 3A3UA 4FORA 3K6VA 3RUMA 2QRYA 1Y1MA 3Q29A 3QK6A 2P1SA 2H25A 3FVGA 3WAEA 3KOSA 4LP2B 1LB9A 2XXPA 2B3FA 3TCHA 3KEIA 5H8QB 3DRGA 3SEWA 1CE2A 2HAUA 2QPQA 1Y3NA 4WKMA 3IB0A 5I57A 1CB6A 3K1NA 1EU8A 4R74A 1YCJA 2AL5A 3EHSA 5ISUA 5H8NA 5TPAA 3Q25A 4XIGQ 3OELA 4K3FA 5JTYB 2QL3A 2QMWA 1FTJA 3TCFA 4NF6B 5AA4A 4U4SA 3KOTA 5ELVA 4KD5A 3OMBA 3LUYA 2ZYOA 3E3KA 1POY1 3UORA 5I56B 2R9JA 4NF4B 4HCYA 3IOVA 1LBBA 3OSQA 4G68B 2UVGA 1PB7A 3RTWB 1JW5A 1JW1A 3IJXB 3KGCA 2NVUB 4MH5A 1M5DA 4OEVA 1UTBB 3OOAA 3N94A 3FATA 2PVUA 1B7ZA 3JV9A 2V93A 4PFUA 3TUSA 4KQPA 1MPDA 4OXVA 2HZLA 3W9WA 2AIXA 5DTBA 3KN8A 4H8IA 2UYFA 3K6UA 3N6TA 3K2DA 5CRYA 1MM7A 4NE4A 4POWA 4IO5A 2XHDA 1FTMA 2X7QA 2V3UA 3PD9A 3H7MA 1B46A 3C33A 2Y7RA 3G7WA 5L9SA 3S4UA 3CHGA 3SEYA 1DTGA 1P99A 5DVJA 1S9TA 3HSTA 4OFLA 3THIA 3H3GA 2Y7WA 4OZ9A 1HSEA 3RT8A 5AA2A 3EN3A 1MXYA 4GRKA 3SEUA 5A5XB 2VHAA 3MVWA 5FTIA 1VFDA 2VD2A 3AXFA 5ICTA 4JSDA 1B05A 1LAFE 4YMBA 5I58A 3MZ1A 2H5YA 3S9LC 4ONYA 3LC8A 3TAJA 2NWJA 1MY4A 3T9VA 2UXAA 3PAMA 1N3XA 2VD3A 3TKDA 1PBPA 2E0SA 1Z7ME 3PD8A 4H5GA 3H6VA 5H8FB 5KCJB 3OO6A 2DQVA 3DELB 3OO9A 3PPQA 5KDTA 2HCAA 3K4UA 2RF1A 1RYXA 1M5EA 2F35A 2Q9TA 1II5A 4DXUA 2GHAA 2ZMBA 2V3TA 4AB6A 1D3KA 3DRKA 3O29A 3TQLA 3UGWA 1YTVA 3VVDA 3HCQA 3IAZA 4EF1A 2B4MA 3PV0E 4ZEBA 3OD7A 1H3DA 3TPAA 4WEPA 4XKRA 3OSRA 3F11A 2VGQA 3OO8A 4KFQA 5DEXB 2ZNTA 1OLAA 2I6EA 4MFIA 4QHQA 3T9UA 2Z23A 3CRBA 1VR5A 2I4BA 3D4GA 4LZ5A 5CI5A 2ONKE 5CM6A 1MY0A 2OK2A 3ZS6A 1LAXA 2H9BA 2UVIA 4ZE9A 1LAHE 1P1OA 1BP5A 4X1BA 4F1VA 1D4NA 4OQOA 3R26A 4OVJA 3DRHA 1PB9A 3ZSFA 1N0TA 4IGRA 1TWYA 3M3KA 5AA1A 1A40A 4GIZA 1ZJLA 4F3SA 1MRPA 3HHGA 3O97A 4NF5B 1FQEA 3KN3A 3MZ9A 4R6KA 4ELRA 3DRJA 4RYAA 2F7CA 4X1DA 4F1YA 4LQ2A 4BDMA 2O1LA 3CIJA 4TQUQ 2P0SA 1SW1A 4LATA 3T93B 1B3HA 4ZEDA 1LCFA 5FHOA 4QSCA 4NTLA 4LUBA 4LZ7A 1FQCA 4BDNA 3H6UA 3EQ1A 1N04A 3PPRA 5TP9A 3MP1A 2WOLA 4BLAA 3K6WA 2OWSA 2D5WA 1JVYA 3FUZA 3N5LA 2NXOA 1QUKA 1MY2A 2ZYKA 2O7IA 1I6QA 1IXGA 2I49A 3K00A 3OENA 1Y20A 2F5XA 3P7IA 1ZU0A 4PP0A 4ZS9A 1SDXA 4DXCA 1HSLA 2P2AA 3S9EA 3ODBA 3GBAA 4R9GA 3QXMA 3E4RA 3R6UA 5J1DA 1WODA 2H4IA 3LR1A 2X7PA 2A5TB 1VFEA 3H6WA 5DVFA 1IXIA 3TQWA 3QUJA 1A55A 3C36A 3V89B 3PUVE 4NF8A 1FW0A 2XXXA 3V83A 5M2VA 3O6HA 2YLNA 1ZTYA 1B3LA 3DP8A 3RYAA 2OWTA 1VE4A 1Q35A 1MDQA 3W9VA 3FTOA 1UQWA 1UTHA 1DPPA 3FJ7A 1QUJA 4X48A 2GRVA 1MQHA 3H6TA 4FJPA 4EQ7A 4QFOA 3DP4A 1B4HA 1O7TA 2VOZA 2D3IA 4Q8RA 2XX9A 4OMBA 2ONSA 3C35A 1GR2A 4DXBA 2DP8A 2QS4A 2Y7PA 4YB7A 1SI0A 4TLLB 3HPIA 2A5SA 2OBGA 3U93A 4PQJA 1LFIA 2H98A 4JWYA 1TFDA 4PFTA 1MY3A 3C32A 4RK9A 2XXRA 3EPEA 3I5OA 1EH3A 5I59A 1B7HA 3GZGA 5JEIA 4GWOA 1DTZA 2KLFA 3G3JA 3MQ9A 2E1SA 5CMMA 4U21A 1YAEA 2PYYA 2Z8DA 4F2OA 4F3GA 1SQYA 3IO4A 4ZZEA 3RPWA 4FEBA 4YKKA 4DCXA 3FVOA 4XKPA 4ELPA 1EZ9A 4R2FA 4R2BA 1SVXB 5B70A 2Y7KA 1OLCA 1WVJA 3SEVA 1LFHA 4C0RA 2XD2A 3OEMA 2HXWA 1QW0A 2RCAA 3ZKKA 5AA2D 1USYE 3U72A 1POTA 1AOVA 4C1TA 4M1VA 1B3EA 4POXA 1M5FA 1Y4CA 2OLBA 4GF8A 2DWAA 2O68A 3K02A 3OXNA 2I3WA 1DMBA 5DVIA 3RGYA 4Q30B 4OESA 1AH5A 1NH7A 1QKBA 4AQ4A 1MXWA 3MP8A 2W7YA 1UIUA 4HTGA 5EHMA 4U23A 1SD3A 4JBZA 1NL5A 5HPQA 3KSJA 4OEUA 3DM0A 4JDFA 1Z7NE 3TTRA 1XHYA 3PMXA 1FCKA 1D9VA 3O66A 4R6YA 4ZECA 3SEXA 3H06B 1URDA 4YU0A 1O63A 4JWXA 4RXLA 3QIMA 3VVFA 4FAJA 4ZEFA 1JETA 3FVKA 2QJEA 2F7AA 1MQJA 1RYOA 1PBQA 4R73A 3ZKLA 2QMXA 2Z8EA 5I57B 3MVXA 3S2VA 1B6HA 3TCGA 1Y3PA 3TTMA 4H65A 2YPNA 4ZEIA 5H8NB 1JNFA 5TPAB 3VFJA 4OETA 3IX1A 1B5IA 5FHNA 5AA4B 1I69A 4R9FA 1DOTA 3L6HA 4OFOA 5I2KA 4OENA 3I6VA 3ILUB 3BFUA 3A3CA 3I3VA 4FECA 4LQ5A 4QRZA 4DZ1A 3QYTA 3PUXE 1TXFA 4G8HA 3PPNA 3LSXA 3UIFA 4ZEKA 1DPEA 4IY5A 5BUUA 1OIBA 3VLWA 3ILTB 3KSXA 1R9LA 4P0IA 4TLMB 2QSXA 4NWCA 4BDLA 2GH9A 1PEBA 2DE2A 2RC7A 3PUYE 3TELA 2F78A 4YMAA 5EHSA 1MY1A 3E9XA 4GVOA 4U4XA 2O6AA 3LBSA 3Q27A 3E13X 3FJMA 1S7YA 4ESXA 3TFLA 3TZAA 1H45A 4O3AA 3B6TA 3MPLA 1O64A 2CZLA 3KG2A 3V5AA 3HV1A 3VXCA 3QSLA 4I62A 3N26A 4YKIA 5LOMA 1NNTA 3CR9A 4WEDA 4P11A 4O3BA 5AA2B 1QJMA 3MW0A 5H8HA 5CMBA 4E0XA 2Z22A 5TU0A 1B3GA 3R7XA 1XVXA 3Q28A 3UA8A 1US5A 4G68C 5I58B 5I2NA 4MLVA 3H4ZA 4HW8A 1IZ1A 5IKBA 5ITOA 4QFPA 2GHBA 1WDNA 1MPCA 1A54A 2PX1A 3KFMA 1SYHA 4IO7A 1Y1ZA 5L8DA 1MQIA 2XXHA 3TYHA 3MVZA 4I1DA 4OFJA 1NNKA 3FD3A 5KDTB 1USYH 2PT1A 3BFTA 1B1HA 3VVEA 4GOTA 5JK4A 4KR5A 3MBPA 1FTOA 1B58A 2DVZA 2G93A 2V3QA 2B3BA 4RPNA
chains in the Genus database with same CATH superfamily
1EYKA 4KCDA 1RKMA 4FE8A 2GFEA 4GXSB 1B3FA 3IL1B 4UACA 1MQDA 4N17A 4KI0E 1AIVA 3PTYA 5EYFA 1FQAA 3IK6B 4IO4A 3GYYA 3ONMA 4ZDMA 2BJJX 1ATGA 3ISPA 5I84A 4IO2A 3SESA 3CSBA 1LBWA 3T22A 3MP6A 1D9YA 2QS2A 3K1PA 4MBPA 2DE3A 1B0HA 2IEEA 5HM4B 1B51A 3MJNA 5FBPA 1JVXA 2HFBA 3RN8A 3IB2A 4WXJA 1NFTA 1A7LA 3G3FA 4U1ZA 1FTAA 2I0BA 1MG1A 3DRFA 4XKNA 3O2AA 2XXIA 5L9MA 3G3IA 1OMPA 4PFWA 3TTLA 5IAIA 4IO3A 4YB5A 2ONRA 1B7UA 5L9OA 3IOTA 5I3SA 1FPDA 2F8DA 1TFAA 1LSTA 2WEFA 4FATA 1S50A 1AL3A 2XD3A 3OEKA 2ESNA 4GL0A 1QVSA 1B9JA 3USDA 4F22A 3MC2A 4N13A 1H43A 1I6BA 4F18A 4JXIA 4MMPA 4IY6A 4ELQA 4ELOA 4U1OA 3CG3A 3HO7A 3CFXA 4JVDA 4KYSA 2D21A 2RC8A 2F34A 1LB8A 3FASA 1IITA 3BIHA 1FQBA 2WX9A 3EHUA 2R6GE 4NQ8A 2DVCA 4AB5A 4GL8A 5CMKA 1IQ7A 1AWBA 1RDZA 1N7WA 1Y3QA 1LBCA 4O8MA 4H8JA 5TP9B 3CI8A 4RY1A 1KWHA 3T96B 3PUZE 4MF3A 1Q1KA 1SW4A 4QFKA 4YICA 2DXYA 4QSEA 2M8CA 4OERA 4MEVA 4FIMA 1RDXA 1FPJA 2RCBA 4JWOA 3SETA 1YPNA 3U1OA 1AMFA 4H67A 1EZPA 1NV5A 2F6GA 3G3HA 1B4ZA 2BJIA 4NX1A 1IMBA 4GX3A 3CSGA 3O6GA 3PMVA 1FJ9A 3VV5A 2ZNSA 3MAMA 1B1XA 1FTKA 2VPNA 4FEDA 1QKAA 1B2HA 2DSFA 1OQGA 4GD5A 1LAGE 2QVRA 2Y5LA 1K9ZA 1FQDA 1F9BA 1BKAA 1OVBA 2Q2AA 2ZYMA 2XXQA 5H8QA 4MHFA 4DIGA 5CBRA 3MZBA 1OQHA 2OZZA 4XTCQ 3C9HA 1VDWA 4IGTA 4P8BA 4NF8B 3LSLA 4H1XA 3EF7A 2F6PA 4EQBA 4LZ8A 3TDJA 3MPKA 1B5JA 4EQ9A 2XXTA 4G2ZA 1QULA 4ECFA 4H0WA 4R72A 4ZE8A 1UTHB 4P56A 2AL4A 1BTJA 4XXUA 4EUOA 1XOCA 4GXAA 3FV2A 5JTYA 1H44A 5B7DA 4H45A 4NF6A 4DCYA 3FXBA 1YXIA 3CFLA 1CNQA 2Y5KA 1VSOA 4YAHX 3EKIA 2ALUA 1GTKA 4KCCA 5I56A 4I9DA 2XWVA 4NF4A 2FYIA 2DXRA 4ND9A 3RYBA 2NOOA 4LA9A 1MM6A 3FVNA 4RA1A 4G68A 2F7BA 4P3LA 4KHZE 2FA7A 3RT6B 3HFUA 4GWWA 5I59B 2NUVA 4F19A 3SDFA 1GGGA 1A8EA 5DT6A 5AE4A 1UTBA 1M5CA 1ZMGA 4PAFA 5IGAA 1MXUA 1XT8A 5IZ3B 2PFYA 3RY3A 2QS1A 3HHFA 1D9QA 3HN0A 5BWJA 1URGA 3LSFB 2DOJA 4JB7A 3DP6A 1NNFA 3CVGA 2CZHA 4RPNA 1BK4A 4Z7EA 5LDZA 2OJTA 3FIRA 2XX7A 3V8XB 3ECRA 4MIJA 2CEXA 2RKMA 3VLUA 3IFAA 3O28A 1B32A 2HAVA 2OCUA 3MWBA 3VLVA 4PF6A 1FBHA 5ET6A 3IJOB 2WBBA 4UA8A 1JP4A 1PB8A 3LSWA 3PMWA 2Q74A 3SERA 3UP9A 2DS9A 1J1NA 1MXXA 1FBGA 3RTFB 2OWZA 1ANFA 4F31B 2XXWA 3B6QA 4YZZA 3G3KA 1XI6A 2O7UA 3CG1A 3FV1A 3FJGA 1SI1A 5A5XA 3GBBA 4NN3A 3IOWA 3W15C 3K0VA 2DYXA 3IOUA 4QSDA 1P1UA 1MDP1 4TOZA 2P3VA 1T0KA 2WKYA 1ELJA 1L5TA 4X8RA 1I6AA 1GV8A 1HSJA 1A8FA 5HBCA 4DDDA 1N3WA 3KJTA 4YB6A 3QUFA 4Q0CA 5H8FA 5KCJA 3K01A 4ESWA 4QF9A 4MLQA 4N07A 3M8UA 4G8MA 2V4CA 1R6ZA 1LBVA 3TMGA 1NNPA 2KQZA 1NV0A 3K1MA 3RLFE 1RDYA 4NMYA 2R71A 1LFGA 3OO7A 4AS4A 4HCWA 1FQFA 1LEVA 2WOKA 3O6PA 5F1QA 2F97A 2I3VA 4HE1A 3TTKA 4F29A 1IXCA 3IO6A 4IO6A 3C31A 1H76A 3PPOA 3B6WA 4DLDA 2V84A 4N6DA 4RJZA 5K2YA 2CMOA 4NAPA 4QFLA 4BDQA 1B40A 1FPBA 2Y7IA 2ZNUA 4MNCA 3S9NC 1P1NA 3MUQA 4OVTA 5DEXA 1FTLA 1ZKBA 3VDFA 2REJA 4Q5TA 5I2KB 1US4A 2Y84A 4H5FA 3MVYA 1NV6A 3T0JA 1DSNA 4GBVA 1NKXA 2XX8A 3UN6A 3PPPA 3JYRA 1NUXA 2ANJA 3FXRA 2Q89A 3JZJA 5CBSA 3KJ7A 4EXKA 3TTNA 4R6HA 2PCRA 4THIA 4PFBA 5AA3A 3GLBA 2FNCA 5ITPA 3N6UA 3PGFA 4F3BA 5K2XA 3DRIA 5A5LA 2O84X 4JSOA 1NH8A 2PMSA 5EQ8A 4KYDA 4OYVA 4PETA 4NF5A 2HZKA 4R75A 2XXYA 3L6GA 1GVCA 3B7DA 1MXVA 3GXAA 5F24A 2PBWA 4X9TA 5F7VA 3T9XB 3WAFA 2H99A 1NUZA 1FSAA 1SBPA 2XXVA 3EHTA 1FBPA 4NF0A 4YKJA 4RK2A 1KZ8A 4JVCA 5DW8A 2Q2CA 1URSA 3BKIB 4F3PA 1B52A 5IZ1A 4HS7A 2PFZA 1FPEA 4G77A 1P1WA 1FBFA 5EQ9A 5KZTA 4IB2A 3FXQA 3B8BA 4OVRA 3K6XA 4NWDA 4H6DA 3H03A 2KR0A 3TODA 3IR1A 5H8HB 1QUIA 4PFYA 2DE4A 3D4CA 4BDOA 4GX6A 3A09A 1FPLA 1TT1A 3FGSA 3O6IA 4BDRA 4LVQA 1BLFA 4RNSA 4MJOA 1PDAA 2G29A 5I2NB 4QXDA 1Q9DA 1NI9A 3IORA 4DE8A 2Q88A 2REGA 4OTEA 3IB1A 4NEDA 1P1QA 3B50A 2DWHA 1SYIA 1B0LA 1IIWA 2I48A 4GWXA 2AYSA 2V25A 2LAOA 3A29A 1FBDA 1N76A 3SKPA 4ISUA 2DWJA 3U92A 2Q8JA 2A5TA 1JEVA 2ZXTA 3Q26A 4P0GA 1Y9UA 1OVTA 4KYEA 4G4PA 2HQ0A 3RQTA 1MPBA 4F2QA 4ZZAA 3BBRA 3RYDA 3U8QA 1IMEA 3PUWE 3VE1B 3KZGA 3U94A 1YZ0A 1MS7A 2THIA 2XA5A 4P1EA 1G0IA 2PT2A 1LLSA 5CC2A 4LONB 4EDPA 1M5BA 2F3DA 3G3GA 3S9MC 5ICQA 1QGXA 3UK4A 3FXUA 4GLIA 2I0CA 1IUDA 4E0WA 1LCTA 1MXZA 5FTHA 3T9HB 4LN5A 1IXHA 2HEUA 1SW2A 2I4CA 1Y4TA 5CMCA 4Z0IA 3DLNA 3KN7A 1JW4A 1MQGA 3C34A 1XS5A 5FHMA 2B4LA 1JQFA 3PU5A 1XVYA 4EXLA 3T66A 1B5HA 4G8NA 2O1MA 4PFRA 4GQOA 4MAGA 3VXBA 2O51A 4XKQA 2F36A 2UVHA 3T1BA 1FBCA 4N6KA 2DWIA 2XWKA 1UIVA 2UYEA 4UABA 4O3CA 4OHNA 4OWDA 1PC3A 1LGBC 2QS3A 4GFRA 1ZBMA 2I58A 3KBRA 4QFNA 4YKPA 2Z8FA 4M4GA 1MH4A 5DYHA 4EF2A 4L17A 2ABHA 4U2RA 2B65A 4RPOA 3O9PA 3C4MA 3QAXA 1ZLQA 1SW5A 1IEJA 2X26A 4MX6A 1JEUA 5H8SA 1N7XA 4PCDA 4I8CA 1XC1A 2VP1A 1BIYA 4F39A 1INPA 1A99A 2WOPA 4I3EA 2IA4A 5J16A 1N84A 4O7MA 4N6PA 1FJ6A 3TEPA 1R1NA 2RC9A 1R9QA 4OVQA 3LVUA 3M3FA 3CFZA 2O69A 3M3LA 3RNNA 1MH3A 1FBEA 2YJPA 4F1UA 5ET7A 4C1UA 2RINA 4XF5A 2ZYNA 1ZIUA 4U22A 3FZVA 4PE5B 1EZOA 1NMUA 4KPTA 2UVJA 3A3UA 4GWYA 4FORA 3K6VA 3RUMA 2QRYA 1Y1MA 3Q29A 3QK6A 2P1SA 2H25A 4N8YA 2WYPA 3E79A 3FVGA 3WAEA 3KOSA 4LP2B 1LB9A 2XXPA 2B3FA 3TCHA 3KEIA 5H8QB 2HXRA 3DRGA 3SEWA 1CE2A 2HAUA 2QPQA 1Y3NA 4WKMA 3RPLA 3IB0A 5I57A 5EQAA 1CB6A 3K1NA 1EU8A 4R74A 1YCJA 2AL5A 3EHSA 5ISUA 5H8NA 5TPAA 3Q25A 4XIGQ 3OELA 4K3FA 3SZPA 1LBYA 2QL3A 5JTYB 2QMWA 2HHMA 1FTJA 3TCFA 4NF6B 5AA4A 4U4SA 3KOTA 5ELVA 4KD5A 3OMBA 3LUYA 2ZYOA 2R8TA 3KC0A 3E3KA 1POY1 3UORA 5I56B 2R9JA 5ESYA 4NF4B 4HCYA 3IOVA 1LBBA 3OSQA 3BIGA 1IMFA 2WBDA 2ZZWA 4G68B 2UVGA 1PB7A 3RTWB 1JW5A 1JW1A 3IJXB 3KGCA 2NVUB 2HPGA 4MH5A 1M5DA 4OEVA 1UTBB 1IMDA 3OOAA 3N94A 3FATA 2PVUA 1B7ZA 3JV9A 2V93A 4PFUA 3TUSA 4KQPA 1MPDA 4OXVA 2MKZA 2HZLA 3W9WA 2AIXA 5DTBA 4XEQA 3U65A 3KN8A 4H8IA 2UYFA 3K6UA 4PE3A 3N6TA 3K2DA 5CRYA 1MM7A 4NE4A 4POWA 4IO5A 2XHDA 1FTMA 2X7QA 2V3UA 3PD9A 3H7MA 1B46A 3C33A 2Y7RA 3G7WA 5L9SA 3S4UA 3CHGA 3SEYA 4G61A 1DTGA 1P99A 1FPGA 4PDDA 5DVJA 1S9TA 4QBAA 3HSTA 4OFLA 3THIA 3H3GA 2Y7WA 4OZ9A 1HSEA 4HXVA 3RT8A 2Q8MA 5AA2A 3EN3A 1MXYA 4NHBA 4GRKA 1G0HA 3SEUA 5A5XB 2VHAA 3MVWA 5FTIA 1VFDA 2VD2A 2FIEA 4MNPA 4PFIA 3AXFA 5ICTA 4JSDA 1B05A 1LAFE 4YMBA 5I58A 3MZ1A 1FPKA 5LTCA 4O7IA 2H5YA 3S9LC 4O94A 4ONYA 3KBZA 3LC8A 3TAJA 2NWJA 1MY4A 4GWZA 1DBZA 3T9VA 2UXAA 3PAMA 1N3XA 2VD3A 3TKDA 1PBPA 3MYUA 2E0SA 1Z7ME 3IFCA 3PD8A 4H5GA 3H6VA 5H8FB 5KCJB 3OO6A 2DQVA 3DELB 3OO9A 3PPQA 5KDTA 2HCAA 5EQ7A 3K4UA 2RF1A 3ROJA 1RYXA 1M5EA 2F35A 2Q9TA 1II5A 4DXUA 2GHAA 2ZMBA 2V3TA 4AB6A 1D3KA 3DRKA 3O29A 5EYGA 3TQLA 3UGWA 1YTVA 3VVDA 3HCQA 1YYZA 3IAZA 4EF1A 2B4MA 3PV0E 4ZEBA 1LBZA 3OD7A 1H3DA 5T3JA 3TPAA 4WEPA 4XKRA 3OSRA 3F11A 2VGQA 3OO8A 4KFQA 5DEXB 2ZNTA 1OLAA 2I6EA 4FBPA 4MFIA 4QHQA 3T9UA 2Z23A 3CRBA 4N4UA 1VR5A 4GX4A 2I4BA 2XWOA 3D4GA 4LZ5A 5CI5A 2ONKE 5CM6A 1KA1A 1MY0A 2OK2A 3ZS6A 1LAXA 2FVZA 4PGNA 2H9BA 2XXKA 2UVIA 4ZE9A 4GBWA 1LAHE 1P1OA 1BP5A 4X1BA 4F1VA 1D4NA 4OQOA 3R26A 4OVJA 3DRHA 1PB9A 3ZSFA 1N0TA 4IGRA 1TWYA 4OVSA 3M3KA 5AA1A 1A40A 4GIZA 1ZJLA 4X04A 4F3SA 1MRPA 3HHGA 3O97A 4NF5B 5IM2A 2FBPA 1FQEA 3KN3A 3MZ9A 4DI3D 1FPIA 4R6KA 4ELRA 3DRJA 4RYAA 2F7CA 4X1DA 4F1YA 4LQ2A 4BDMA 1IMCA 2O1LA 3CIJA 4TQUQ 2P0SA 1SW1A 4LATA 2FIXA 3T93B 1B3HA 4ZEDA 1LCFA 5FHOA 4QSCA 4NTLA 2CZIA 4LUBA 4LZ7A 1FQCA 4BDNA 3H6UA 3EQ1A 1N04A 1IMAA 3PPRA 1DCUA 5TP9A 3MP1A 2WOLA 4BLAA 3K6WA 2OWSA 2D5WA 1JVYA 3FUZA 3N5LA 2NXOA 4MNIA 1QUKA 1MY2A 4GWUA 2ZYKA 1SPIA 2GQ1A 2O7IA 2DDKA 1I6QA 1IXGA 2I49A 4NGUA 3K00A 3OENA 1Y20A 2F5XA 3P7IA 1K9YA 1ZU0A 4PP0A 4ZS9A 1SDXA 4DXCA 1LBXA 1HSLA 2P2AA 3S9EA 3ODBA 3GBAA 4R9GA 3QXMA 3E4RA 3R6UA 5J1DA 1WODA 2H4IA 3LR1A 2X7PA 2A5TB 1VFEA 3H6WA 5DVFA 1IXIA 3TQWA 3LUZA 4NG7A 4PF8A 2XWIA 3QUJA 4PGPA 1A55A 3C36A 2ZZXA 3V89B 3PUVE 4NF8A 1FW0A 2XXXA 3V83A 5M2VA 2FHYA 3O6HA 2YLNA 1ZTYA 1B3LA 3DP8A 3RYAA 2OWTA 1VE4A 1Q35A 2L5VA 1MDQA 3W9VA 3FTOA 1UQWA 1UTHA 1DPPA 3FJ7A 1QUJA 4X48A 2GRVA 1MQHA 3H6TA 4FJPA 4EQ7A 4QFOA 3DP4A 1B4HA 1O7TA 2VOZA 4PTKA 2D3IA 4Q8RA 2XX9A 4OMBA 1NV1A 2ONSA 3C35A 1GR2A 4DXBA 2DP8A 2QS4A 2Y7PA 4YB7A 1SI0A 4TLLB 3HPIA 2A5SA 2OBGA 3U93A 4PQJA 1LFIA 2H98A 4JWYA 1TFDA 4PFTA 1MY3A 3C32A 4RK9A 2XXRA 3EPEA 3I5OA 1EH3A 5I59A 1B7HA 3GZGA 4GWSA 5JEIA 4GWOA 4OANA 2JJKA 1DTZA 2KLFA 3G3JA 3KC1A 3MQ9A 4P9KA 4I3YA 2E1SA 5CMMA 2CEYA 4U21A 4PAKA 4HE2A 1YAEA 2PYYA 2Z8DA 4F2OA 5IZ3A 4F3GA 4P1LA 1SQYA 3IO4A 4ZZEA 3RPWA 3QMFA 4FEBA 4MCOA 4YKKA 4DCXA 3FVOA 4XKPA 4ELPA 1EZ9A 4R2FA 4R2BA 1SVXB 1KA0A 5B70A 2Y7KA 1OLCA 1WVJA 3SEVA 1LFHA 4C0RA 4PC9A 2XD2A 3OEMA 2HXWA 1QW0A 2CZKA 2RCAA 3ZKKA 5AA2D 1USYE 3U72A 1POTA 1AOVA 4C1TA 4M1VA 1B3EA 4POXA 1M5FA 1Y4CA 2VT5A 2OLBA 4N81A 4GF8A 2DWAA 2O68A 3K02A 3OXNA 2I3WA 1DMBA 5DVIA 3RGYA 4Q30B 4OESA 1AH5A 5ET8A 1NH7A 1QKBA 2P3NA 4AQ4A 1MXWA 3MP8A 2W7YA 1UIUA 1NV3A 4HTGA 5EHMA 4U23A 1SD3A 4JBZA 1NL5A 5HPQA 2ZZVA 4OEUA 3KSJA 3DM0A 4JDFA 1Z7NE 3TTRA 1XHYA 3PMXA 1FCKA 1D9VA 3O66A 4R6YA 4ZECA 3SEXA 2QVVA 3H06B 1URDA 4DI4B 4YU0A 1O63A 4JWXA 4RXLA 3QIMA 3VVFA 4FAJA 4ZEFA 3LV0A 1JETA 3FVKA 3FBPA 2QJEA 2F7AA 1MQJA 1RYOA 1PBQA 4R73A 3RPLB 1DK4A 3ZKLA 2QMXA 2Z8EA 5I57B 3MVXA 3S2VA 1B6HA 2OX3A 3TCGA 1Y3PA 2QFLA 3TTMA 4H65A 2YPNA 4ZEIA 5H8NB 1JNFA 5TPAB 3VFJA 4OETA 4PDHA 3IX1A 3E78A 1B5IA 5FHNA 5AA4B 1I69A 4R9FA 5I7IA 1DOTA 3L6HA 4OFOA 5I2KA 4OENA 3I6VA 3ILUB 3BFUA 4PBQA 5EYHA 5ET5A 3A3CA 3I3VA 4FECA 4OVPA 4LQ5A 4QRZA 4DZ1A 3QYTA 3PUXE 1TXFA 4G8HA 1NV4A 3PPNA 3LSXA 3UIFA 4ZEKA 1DPEA 4KXPA 3MSTA 4PAIA 5I5PA 4IY5A 5BUUA 1OIBA 3VLWA 3ILTB 3KSXA 4OA4A 1R9LA 4P0IA 4TLMB 2QSXA 4NWCA 4BDLA 4JVIA 2GH9A 1PEBA 2DE2A 2RC7A 3PUYE 3TELA 4PBHA 2F78A 4I40A 1FPFA 4YMAA 5EHSA 1MY1A 3E9XA 4GVOA 4U4XA 2O6AA 3LBSA 3Q27A 3E13X 4AS5A 3FJMA 1S7YA 4ESXA 1EYIA 1NV2A 3TFLA 3TZAA 1NUYA 1NV7A 1H45A 5IZZA 4O3AA 3B6TA 4N8GA 3MPLA 1O64A 4IR8A 2CZLA 3KG2A 2F3BA 3V5AA 3HV1A 1EYJA 3VXCA 4H46A 3QSLA 4I62A 3N26A 4YKIA 5LOMA 1NNTA 3CR9A 4WEDA 3D1RA 4P11A 4N15A 2WYKA 4N91A 4O3BA 5AA2B 1QJMA 3MW0A 5H8HA 5CMBA 4E0XA 2Z22A 5TU0A 1B3GA 3R7XA 3NOHA 1XVXA 3Q28A 3UA8A 1US5A 4G68C 4P47A 5I58B 5I2NA 4MLVA 3H4ZA 4HW8A 1IZ1A 5IKBA 5ITOA 4XFEA 4QFPA 2GHBA 1WDNA 1MPCA 1A54A 2PX1A 3KFMA 1SYHA 4IO7A 1Y1ZA 5L8DA 2VPOA 1MQIA 2XXHA 3TYHA 3MVZA 4I1DA 4OFJA 1NNKA 3FD3A 5KDTB 1USYH 2PT1A 3BFTA 2QVUA 1B1HA 4HE0A 3VVEA 4GOTA 1NUWA 1FRPA 5JK4A 4KR5A 3MBPA 1FTOA 1B58A 2DVZA 2G93A 2V3QA 2B3BA 2XXUA
chains in the Genus database with same CATH topology
4KCDA 1RKMA 4FE8A 2GFEA 4GXSB 1B3FA 3IL1B 4UACA 1MQDA 4KI0E 1AIVA 5EYFA 1FQAA 3IK6B 4IO4A 3ONMA 4ZDMA 2BJJX 1ATGA 5I84A 4IO2A 3SESA 3CSBA 3T22A 3MP6A 1D9YA 2QS2A 3K1PA 4MBPA 2DE3A 1B0HA 2IEEA 5HM4B 1B51A 3MJNA 1JVXA 2HFBA 3RN8A 3IB2A 4WXJA 1NFTA 1A7LA 3G3FA 4U1ZA 2I0BA 1MG1A 3DRFA 4XKNA 3O2AA 2XXIA 5L9MA 3G3IA 1OMPA 4PFWA 3TTLA 5IAIA 4IO3A 4YB5A 2ONRA 1B7UA 5L9OA 3IOTA 2F8DA 1TFAA 1LSTA 4FATA 1S50A 1AL3A 2XD3A 3OEKA 2ESNA 4GL0A 1QVSA 1B9JA 3USDA 4F22A 3MC2A 4N13A 1H43A 1I6BA 4F18A 4JXIA 4IY6A 4ELQA 4ELOA 4U1OA 3CG3A 3HO7A 3CFXA 4KYSA 2D21A 2RC8A 2F34A 1LB8A 3FASA 1IITA 1FQBA 3EHUA 2R6GE 2DVCA 4AB5A 4GL8A 5CMKA 1IQ7A 1N7WA 1Y3QA 1LBCA 4H8JA 5TP9B 3CI8A 4RY1A 1KWHA 3T96B 3PUZE 4MF3A 1Q1KA 1SW4A 4QFKA 4YICA 2DXYA 4QSEA 2M8CA 4OERA 4FIMA 2RCBA 4JWOA 3SETA 1YPNA 3U1OA 1AMFA 4H67A 1EZPA 2F6GA 3G3HA 1B4ZA 3CSGA 3O6GA 3PMVA 3VV5A 2ZNSA 3MAMA 1B1XA 1FTKA 4FEDA 1QKAA 1B2HA 2DSFA 1OQGA 4GD5A 1LAGE 1FQDA 1F9BA 1BKAA 1OVBA 2Q2AA 2ZYMA 2XXQA 5H8QA 4DIGA 5CBRA 3MZBA 1OQHA 2OZZA 4XTCQ 3C9HA 4IGTA 4NF8B 3LSLA 4H1XA 3EF7A 2F6PA 4EQBA 4LZ8A 3TDJA 3MPKA 1B5JA 4EQ9A 2XXTA 4G2ZA 1QULA 4ECFA 4H0WA 4R72A 4ZE8A 1UTHB 2AL4A 1BTJA 4XXUA 4EUOA 1XOCA 4GXAA 3FV2A 5JTYA 1H44A 5B7DA 4NF6A 4DCYA 3CFLA 1VSOA 4YAHX 2ALUA 1GTKA 4KCCA 5I56A 4I9DA 4NF4A 2FYIA 2DXRA 4ND9A 3RYBA 2NOOA 4LA9A 1MM6A 3FVNA 4RA1A 4G68A 2F7BA 4KHZE 2FA7A 3RT6B 5I59B 2NUVA 4F19A 3SDFA 1GGGA 1A8EA 5DT6A 5AE4A 1UTBA 1M5CA 1ZMGA 1MXUA 1XT8A 3RY3A 2QS1A 3HHFA 3HN0A 5BWJA 1URGA 3LSFB 2DOJA 4JB7A 3DP6A 1NNFA 3CVGA 4Z7EA 2OJTA 3FIRA 2XX7A 3V8XB 3ECRA 2RKMA 3VLUA 3O28A 1B32A 2HAVA 2OCUA 3MWBA 3VLVA 3IJOB 4UA8A 1PB8A 3LSWA 3PMWA 3SERA 3UP9A 2DS9A 1J1NA 1MXXA 3RTFB 1ANFA 4F31B 2XXWA 3B6QA 4YZZA 3G3KA 2O7UA 3CG1A 3FV1A 3FJGA 1SI1A 5A5XA 3GBBA 3IOWA 3W15C 3K0VA 2DYXA 3IOUA 4QSDA 1P1UA 1MDP1 4TOZA 1T0KA 2WKYA 1ELJA 1L5TA 1I6AA 1GV8A 1HSJA 1A8FA 5HBCA 4DDDA 1N3WA 3KJTA 4YB6A 3QUFA 4Q0CA 5H8FA 5KCJA 3K01A 4ESWA 4QF9A 4MLQA 4N07A 3M8UA 4G8MA 1R6ZA 3TMGA 1NNPA 3K1MA 3RLFE 4NMYA 2R71A 1LFGA 3OO7A 4HCWA 1FQFA 2WOKA 3O6PA 5F1QA 2F97A 2I3VA 4F29A 3TTKA 1IXCA 3IO6A 4IO6A 3C31A 1H76A 3PPOA 3B6WA 4DLDA 2V84A 4RJZA 5K2YA 2CMOA 4QFLA 4BDQA 1B40A 2Y7IA 2ZNUA 3S9NC 1P1NA 3MUQA 5DEXA 1FTLA 1ZKBA 3VDFA 2REJA 4Q5TA 5I2KB 1US4A 2Y84A 4H5FA 3MVYA 1DSNA 1NKXA 2XX8A 3UN6A 3PPPA 3JYRA 2ANJA 3FXRA 2Q89A 3JZJA 5CBSA 3KJ7A 4EXKA 3TTNA 4R6HA 4THIA 5AA3A 3GLBA 2FNCA 5ITPA 3N6UA 3PGFA 4F3BA 5K2XA 3DRIA 2O84X 4JSOA 1NH8A 2PMSA 4KYDA 4OYVA 4PETA 4NF5A 2HZKA 4R75A 2XXYA 3L6GA 1GVCA 3B7DA 1MXVA 3GXAA 2PBWA 4X9TA 5F7VA 3T9XB 3WAFA 2H99A 1SBPA 2XXVA 3EHTA 4YKJA 4RK2A 2Q2CA 1URSA 3BKIB 4F3PA 1B52A 4HS7A 4G77A 1P1WA 5KZTA 4IB2A 3FXQA 3K6XA 4NWDA 4H6DA 3H03A 3TODA 3IR1A 5H8HB 1QUIA 4PFYA 2DE4A 3D4CA 4BDOA 3A09A 1TT1A 3FGSA 3O6IA 4BDRA 4LVQA 1BLFA 4RNSA 1PDAA 2G29A 5I2NB 3IORA 4DE8A 2Q88A 2REGA 4OTEA 3IB1A 4NEDA 1P1QA 2DWHA 1SYIA 1B0LA 1IIWA 2I48A 2AYSA 2V25A 2LAOA 1N76A 3SKPA 4ISUA 2DWJA 3U92A 2Q8JA 2A5TA 1JEVA 2ZXTA 3Q26A 4P0GA 1Y9UA 1OVTA 4KYEA 4G4PA 2XXUA 2HQ0A 3RQTA 1MPBA 4F2QA 4ZZAA 3BBRA 3U8QA 3PUWE 3VE1B 3KZGA 3U94A 1MS7A 2THIA 2PT2A 1LLSA 5CC2A 4LONB 4EDPA 1M5BA 3G3GA 3S9MC 5ICQA 3UK4A 3FXUA 4GLIA 2I0CA 1IUDA 4E0WA 1LCTA 1MXZA 5FTHA 3T9HB 1IXHA 2HEUA 1SW2A 2I4CA 1Y4TA 5CMCA 4Z0IA 3DLNA 3KN7A 1JW4A 1MQGA 3C34A 1XS5A 5FHMA 2B4LA 1JQFA 3PU5A 1XVYA 4EXLA 3T66A 1B5HA 4G8NA 2O1MA 4GQOA 3VXBA 2O51A 4XKQA 2F36A 2UVHA 2DWIA 1UIVA 2UYEA 4O3CA 4OHNA 4OWDA 1PC3A 1LGBC 2QS3A 4GFRA 1ZBMA 2I58A 3KBRA 4QFNA 4YKPA 2Z8FA 4M4GA 1MH4A 5DYHA 4EF2A 4L17A 2ABHA 4U2RA 2B65A 4RPOA 3O9PA 3C4MA 3QAXA 1ZLQA 1SW5A 1IEJA 2X26A 1JEUA 5H8SA 1N7XA 4I8CA 1XC1A 2VP1A 1BIYA 4F39A 1A99A 2WOPA 2IA4A 1N84A 4N6PA 3TEPA 1R1NA 2RC9A 1R9QA 3LVUA 3M3FA 3CFZA 2O69A 3M3LA 3RNNA 1MH3A 2YJPA 4F1UA 4C1UA 2RINA 2ZYNA 1ZIUA 4U22A 3FZVA 4PE5B 1EZOA 1NMUA 4KPTA 2UVJA 3A3UA 4FORA 3K6VA 3RUMA 2QRYA 1Y1MA 3Q29A 3QK6A 2P1SA 2H25A 3FVGA 3WAEA 3KOSA 4LP2B 1LB9A 2XXPA 2B3FA 3TCHA 3KEIA 5H8QB 3DRGA 3SEWA 1CE2A 2HAUA 2QPQA 1Y3NA 4WKMA 3IB0A 5I57A 1CB6A 3K1NA 1EU8A 4R74A 1YCJA 2AL5A 3EHSA 5ISUA 5H8NA 5TPAA 3Q25A 4XIGQ 3OELA 4K3FA 5JTYB 2QL3A 2QMWA 1FTJA 3TCFA 4NF6B 5AA4A 4U4SA 3KOTA 5ELVA 4KD5A 3OMBA 3LUYA 2ZYOA 3E3KA 1POY1 3UORA 5I56B 2R9JA 4NF4B 4HCYA 3IOVA 1LBBA 3OSQA 4G68B 2UVGA 1PB7A 3RTWB 1JW5A 1JW1A 3IJXB 3KGCA 2NVUB 4MH5A 1M5DA 4OEVA 1UTBB 3OOAA 3N94A 3FATA 2PVUA 1B7ZA 3JV9A 2V93A 4PFUA 3TUSA 4KQPA 1MPDA 4OXVA 2HZLA 3W9WA 2AIXA 5DTBA 3KN8A 4H8IA 2UYFA 3K6UA 3N6TA 3K2DA 5CRYA 1MM7A 4NE4A 4POWA 4IO5A 2XHDA 1FTMA 2X7QA 2V3UA 3PD9A 3H7MA 1B46A 3C33A 2Y7RA 3G7WA 5L9SA 3S4UA 3CHGA 3SEYA 1DTGA 1P99A 5DVJA 1S9TA 3HSTA 4OFLA 3THIA 3H3GA 2Y7WA 4OZ9A 1HSEA 3RT8A 5AA2A 3EN3A 1MXYA 4GRKA 3SEUA 5A5XB 2VHAA 3MVWA 5FTIA 1VFDA 2VD2A 3AXFA 5ICTA 4JSDA 1B05A 1LAFE 4YMBA 5I58A 3MZ1A 2H5YA 3S9LC 4ONYA 3LC8A 3TAJA 2NWJA 1MY4A 3T9VA 2UXAA 3PAMA 1N3XA 2VD3A 3TKDA 1PBPA 2E0SA 1Z7ME 3PD8A 4H5GA 3H6VA 5H8FB 5KCJB 3OO6A 2DQVA 3DELB 3OO9A 3PPQA 5KDTA 2HCAA 3K4UA 2RF1A 1RYXA 1M5EA 2F35A 2Q9TA 1II5A 4DXUA 2GHAA 2ZMBA 2V3TA 4AB6A 1D3KA 3DRKA 3O29A 3TQLA 3UGWA 1YTVA 3VVDA 3HCQA 3IAZA 4EF1A 2B4MA 3PV0E 4ZEBA 3OD7A 1H3DA 3TPAA 4WEPA 4XKRA 3OSRA 3F11A 2VGQA 3OO8A 4KFQA 5DEXB 2ZNTA 1OLAA 2I6EA 4MFIA 4QHQA 3T9UA 2Z23A 3CRBA 1VR5A 2I4BA 3D4GA 4LZ5A 5CI5A 2ONKE 5CM6A 1MY0A 2OK2A 3ZS6A 1LAXA 2H9BA 2UVIA 4ZE9A 1LAHE 1P1OA 1BP5A 4X1BA 4F1VA 1D4NA 4OQOA 3R26A 4OVJA 3DRHA 1PB9A 3ZSFA 1N0TA 4IGRA 1TWYA 3M3KA 5AA1A 1A40A 4GIZA 1ZJLA 4F3SA 1MRPA 3HHGA 3O97A 4NF5B 1FQEA 3KN3A 3MZ9A 4R6KA 4ELRA 3DRJA 4RYAA 2F7CA 4X1DA 4F1YA 4LQ2A 4BDMA 2O1LA 3CIJA 4TQUQ 2P0SA 1SW1A 4LATA 3T93B 1B3HA 4ZEDA 1LCFA 5FHOA 4QSCA 4NTLA 4LUBA 4LZ7A 1FQCA 4BDNA 3H6UA 3EQ1A 1N04A 3PPRA 5TP9A 3MP1A 2WOLA 4BLAA 3K6WA 2OWSA 2D5WA 1JVYA 3FUZA 3N5LA 2NXOA 1QUKA 1MY2A 2ZYKA 2O7IA 1I6QA 1IXGA 2I49A 3K00A 3OENA 1Y20A 2F5XA 3P7IA 1ZU0A 4PP0A 4ZS9A 1SDXA 4DXCA 1HSLA 2P2AA 3S9EA 3ODBA 3GBAA 4R9GA 3QXMA 3E4RA 3R6UA 5J1DA 1WODA 2H4IA 3LR1A 2X7PA 2A5TB 1VFEA 3H6WA 5DVFA 1IXIA 3TQWA 3QUJA 1A55A 3C36A 3V89B 3PUVE 4NF8A 1FW0A 2XXXA 3V83A 5M2VA 3O6HA 2YLNA 1ZTYA 1B3LA 3DP8A 3RYAA 2OWTA 1VE4A 1Q35A 1MDQA 3W9VA 3FTOA 1UQWA 1UTHA 1DPPA 3FJ7A 1QUJA 4X48A 2GRVA 1MQHA 3H6TA 4FJPA 4EQ7A 4QFOA 3DP4A 1B4HA 1O7TA 2VOZA 2D3IA 4Q8RA 2XX9A 4OMBA 2ONSA 3C35A 1GR2A 4DXBA 2DP8A 2QS4A 2Y7PA 4YB7A 1SI0A 4TLLB 3HPIA 2A5SA 2OBGA 3U93A 4PQJA 1LFIA 2H98A 4JWYA 1TFDA 4PFTA 1MY3A 3C32A 4RK9A 2XXRA 3EPEA 3I5OA 1EH3A 5I59A 1B7HA 3GZGA 5JEIA 4GWOA 1DTZA 2KLFA 3G3JA 3MQ9A 2E1SA 5CMMA 4U21A 1YAEA 2PYYA 2Z8DA 4F2OA 4F3GA 1SQYA 3IO4A 4ZZEA 3RPWA 4FEBA 4YKKA 4DCXA 3FVOA 4XKPA 4ELPA 1EZ9A 4R2FA 4R2BA 1SVXB 5B70A 2Y7KA 1OLCA 1WVJA 3SEVA 1LFHA 4C0RA 2XD2A 3OEMA 2HXWA 1QW0A 2RCAA 3ZKKA 5AA2D 1USYE 3U72A 1POTA 1AOVA 4C1TA 4M1VA 1B3EA 4POXA 1M5FA 1Y4CA 2OLBA 4GF8A 2DWAA 2O68A 3K02A 3OXNA 2I3WA 1DMBA 5DVIA 3RGYA 4Q30B 4OESA 1AH5A 1NH7A 1QKBA 4AQ4A 1MXWA 3MP8A 2W7YA 1UIUA 4HTGA 5EHMA 4U23A 1SD3A 4JBZA 1NL5A 5HPQA 3KSJA 4OEUA 3DM0A 4JDFA 1Z7NE 3TTRA 1XHYA 3PMXA 1FCKA 1D9VA 3O66A 4R6YA 4ZECA 3SEXA 3H06B 1URDA 4YU0A 1O63A 4JWXA 4RXLA 3QIMA 3VVFA 4FAJA 4ZEFA 1JETA 3FVKA 2QJEA 2F7AA 1MQJA 1RYOA 1PBQA 4R73A 3ZKLA 2QMXA 2Z8EA 5I57B 3MVXA 3S2VA 1B6HA 3TCGA 1Y3PA 3TTMA 4H65A 2YPNA 4ZEIA 5H8NB 1JNFA 5TPAB 3VFJA 4OETA 3IX1A 1B5IA 5FHNA 5AA4B 1I69A 4R9FA 1DOTA 3L6HA 4OFOA 5I2KA 4OENA 3I6VA 3ILUB 3BFUA 3A3CA 3I3VA 4FECA 4LQ5A 4QRZA 4DZ1A 3QYTA 3PUXE 1TXFA 4G8HA 3PPNA 3LSXA 3UIFA 4ZEKA 1DPEA 4IY5A 5BUUA 1OIBA 3VLWA 3ILTB 3KSXA 1R9LA 4P0IA 4TLMB 2QSXA 4NWCA 4BDLA 2GH9A 1PEBA 2DE2A 2RC7A 3PUYE 3TELA 2F78A 4YMAA 5EHSA 1MY1A 3E9XA 4GVOA 4U4XA 2O6AA 3LBSA 3Q27A 3E13X 3FJMA 1S7YA 4ESXA 3TFLA 3TZAA 1H45A 4O3AA 3B6TA 3MPLA 1O64A 2CZLA 3KG2A 3V5AA 3HV1A 3VXCA 3QSLA 4I62A 3N26A 4YKIA 5LOMA 1NNTA 3CR9A 4WEDA 4P11A 4O3BA 5AA2B 1QJMA 3MW0A 5H8HA 5CMBA 4E0XA 2Z22A 5TU0A 1B3GA 3R7XA 1XVXA 3Q28A 3UA8A 1US5A 4G68C 5I58B 5I2NA 4MLVA 3H4ZA 4HW8A 1IZ1A 5IKBA 5ITOA 4QFPA 2GHBA 1WDNA 1MPCA 1A54A 2PX1A 3KFMA 1SYHA 4IO7A 1Y1ZA 5L8DA 1MQIA 2XXHA 3TYHA 3MVZA 4I1DA 4OFJA 1NNKA 3FD3A 5KDTB 1USYH 2PT1A 3BFTA 1B1HA 3VVEA 4GOTA 5JK4A 4KR5A 3MBPA 1FTOA 1B58A 2DVZA 2G93A 2V3QA 2B3BA 4RPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCD A;  1RKM A;  4FE8 A;  2GFE A;  4GXS B;  1B3F A;  3IL1 B;  4UAC A;  1MQD A;  4KI0 E;  1AIV A;  5EYF A;  1FQA A;  3IK6 B;  4IO4 A;  3ONM A;  4ZDM A;  2BJJ X;  1ATG A;  5I84 A;  4IO2 A;  3SES A;  3CSB A;  3T22 A;  3MP6 A;  1D9Y A;  2QS2 A;  3K1P A;  4MBP A;  2DE3 A;  1B0H A;  2IEE A;  5HM4 B;  1B51 A;  3MJN A;  1JVX A;  2HFB A;  3RN8 A;  3IB2 A;  4WXJ A;  1NFT A;  1A7L A;  3G3F A;  4U1Z A;  2I0B A;  1MG1 A;  3DRF A;  4XKN A;  3O2A A;  2XXI A;  5L9M A;  3G3I A;  1OMP A;  4PFW A;  3TTL A;  5IAI A;  4IO3 A;  4YB5 A;  2ONR A;  1B7U A;  5L9O A;  3IOT A;  2F8D A;  1TFA A;  1LST A;  4FAT A;  1S50 A;  1AL3 A;  2XD3 A;  3OEK A;  2ESN A;  4GL0 A;  1QVS A;  1B9J A;  3USD A;  4F22 A;  3MC2 A;  4N13 A;  1H43 A;  1I6B A;  4F18 A;  4JXI A;  4IY6 A;  4ELQ A;  4ELO A;  4U1O A;  3CG3 A;  3HO7 A;  3CFX A;  4KYS A;  2D21 A;  2RC8 A;  2F34 A;  1LB8 A;  3FAS A;  1IIT A;  1FQB A;  3EHU A;  2R6G E;  2DVC A;  4AB5 A;  4GL8 A;  5CMK A;  1IQ7 A;  1N7W A;  1Y3Q A;  1LBC A;  4H8J A;  5TP9 B;  3CI8 A;  4RY1 A;  1KWH A;  3T96 B;  3PUZ E;  4MF3 A;  1Q1K A;  1SW4 A;  4QFK A;  4YIC A;  2DXY A;  4QSE A;  2M8C A;  4OER A;  4FIM A;  2RCB A;  4JWO A;  3SET A;  1YPN A;  3U1O A;  1AMF A;  4H67 A;  1EZP A;  2F6G A;  3G3H A;  1B4Z A;  3CSG A;  3O6G A;  3PMV A;  3VV5 A;  2ZNS A;  3MAM A;  1B1X A;  1FTK A;  4FED A;  1QKA A;  1B2H A;  2DSF A;  1OQG A;  4GD5 A;  1LAG E;  1FQD A;  1F9B A;  1BKA A;  1OVB A;  2Q2A A;  2ZYM A;  2XXQ A;  5H8Q A;  4DIG A;  5CBR A;  3MZB A;  1OQH A;  2OZZ A;  4XTC Q;  3C9H A;  4IGT A;  4NF8 B;  3LSL A;  4H1X A;  3EF7 A;  2F6P A;  4EQB A;  4LZ8 A;  3TDJ A;  3MPK A;  1B5J A;  4EQ9 A;  2XXT A;  4G2Z A;  1QUL A;  4ECF A;  4H0W A;  4R72 A;  4ZE8 A;  1UTH B;  2AL4 A;  1BTJ A;  4XXU A;  4EUO A;  1XOC A;  4GXA A;  3FV2 A;  5JTY A;  1H44 A;  5B7D A;  4NF6 A;  4DCY A;  3CFL A;  1VSO A;  4YAH X;  2ALU A;  1GTK A;  4KCC A;  5I56 A;  4I9D A;  4NF4 A;  2FYI A;  2DXR A;  4ND9 A;  3RYB A;  2NOO A;  4LA9 A;  1MM6 A;  3FVN A;  4RA1 A;  4G68 A;  2F7B A;  4KHZ E;  2FA7 A;  3RT6 B;  5I59 B;  2NUV A;  4F19 A;  3SDF A;  1GGG A;  1A8E A;  5DT6 A;  5AE4 A;  1UTB A;  1M5C A;  1ZMG A;  1MXU A;  1XT8 A;  3RY3 A;  2QS1 A;  3HHF A;  3HN0 A;  5BWJ A;  1URG A;  3LSF B;  2DOJ A;  4JB7 A;  3DP6 A;  1NNF A;  3CVG A;  4Z7E A;  2OJT A;  3FIR A;  2XX7 A;  3V8X B;  3ECR A;  2RKM A;  3VLU A;  3O28 A;  1B32 A;  2HAV A;  2OCU A;  3MWB A;  3VLV A;  3IJO B;  4UA8 A;  1PB8 A;  3LSW A;  3PMW A;  3SER A;  3UP9 A;  2DS9 A;  1J1N A;  1MXX A;  3RTF B;  1ANF A;  4F31 B;  2XXW A;  3B6Q A;  4YZZ A;  3G3K A;  2O7U A;  3CG1 A;  3FV1 A;  3FJG A;  1SI1 A;  5A5X A;  3GBB A;  3IOW A;  3W15 C;  3K0V A;  2DYX A;  3IOU A;  4QSD A;  1P1U A;  1MDP 1;  4TOZ A;  1T0K A;  2WKY A;  1ELJ A;  1L5T A;  1I6A A;  1GV8 A;  1HSJ A;  1A8F A;  5HBC A;  4DDD A;  1N3W A;  3KJT A;  4YB6 A;  3QUF A;  4Q0C A;  5H8F A;  5KCJ A;  3K01 A;  4ESW A;  4QF9 A;  4MLQ A;  4N07 A;  3M8U A;  4G8M A;  1R6Z A;  3TMG A;  1NNP A;  3K1M A;  3RLF E;  4NMY A;  2R71 A;  1LFG A;  3OO7 A;  4HCW A;  1FQF A;  2WOK A;  3O6P A;  5F1Q A;  2F97 A;  2I3V A;  4F29 A;  3TTK A;  1IXC A;  3IO6 A;  4IO6 A;  3C31 A;  1H76 A;  3PPO A;  3B6W A;  4DLD A;  2V84 A;  4RJZ A;  5K2Y A;  2CMO A;  4QFL A;  4BDQ A;  1B40 A;  2Y7I A;  2ZNU A;  3S9N C;  1P1N A;  3MUQ A;  5DEX A;  1FTL A;  1ZKB A;  3VDF A;  2REJ A;  4Q5T A;  5I2K B;  1US4 A;  2Y84 A;  4H5F A;  3MVY A;  1DSN A;  1NKX A;  2XX8 A;  3UN6 A;  3PPP A;  3JYR A;  2ANJ A;  3FXR A;  2Q89 A;  3JZJ A;  5CBS A;  3KJ7 A;  4EXK A;  3TTN A;  4R6H A;  4THI A;  5AA3 A;  3GLB A;  2FNC A;  5ITP A;  3N6U A;  3PGF A;  4F3B A;  5K2X A;  3DRI A;  2O84 X;  4JSO A;  1NH8 A;  2PMS A;  4KYD A;  4OYV A;  4PET A;  4NF5 A;  2HZK A;  4R75 A;  2XXY A;  3L6G A;  1GVC A;  3B7D A;  1MXV A;  3GXA A;  2PBW A;  4X9T A;  5F7V A;  3T9X B;  3WAF A;  2H99 A;  1SBP A;  2XXV A;  3EHT A;  4YKJ A;  4RK2 A;  2Q2C A;  1URS A;  3BKI B;  4F3P A;  1B52 A;  4HS7 A;  4G77 A;  1P1W A;  5KZT A;  4IB2 A;  3FXQ A;  3K6X A;  4NWD A;  4H6D A;  3H03 A;  3TOD A;  3IR1 A;  5H8H B;  1QUI A;  4PFY A;  2DE4 A;  3D4C A;  4BDO A;  3A09 A;  1TT1 A;  3FGS A;  3O6I A;  4BDR A;  4LVQ A;  1BLF A;  4RNS A;  1PDA A;  2G29 A;  5I2N B;  3IOR A;  4DE8 A;  2Q88 A;  2REG A;  4OTE A;  3IB1 A;  4NED A;  1P1Q A;  2DWH A;  1SYI A;  1B0L A;  1IIW A;  2I48 A;  2AYS A;  2V25 A;  2LAO A;  1N76 A;  3SKP A;  4ISU A;  2DWJ A;  3U92 A;  2Q8J A;  2A5T A;  1JEV A;  2ZXT A;  3Q26 A;  4P0G A;  1Y9U A;  1OVT A;  4KYE A;  4G4P A;  2XXU A;  2HQ0 A;  3RQT A;  1MPB A;  4F2Q A;  4ZZA A;  3BBR A;  3U8Q A;  3PUW E;  3VE1 B;  3KZG A;  3U94 A;  1MS7 A;  2THI A;  2PT2 A;  1LLS A;  5CC2 A;  4LON B;  4EDP A;  1M5B A;  3G3G A;  3S9M C;  5ICQ A;  3UK4 A;  3FXU A;  4GLI A;  2I0C A;  1IUD A;  4E0W A;  1LCT A;  1MXZ A;  5FTH A;  3T9H B;  1IXH A;  2HEU A;  1SW2 A;  2I4C A;  1Y4T A;  5CMC A;  4Z0I A;  3DLN A;  3KN7 A;  1JW4 A;  1MQG A;  3C34 A;  1XS5 A;  5FHM A;  2B4L A;  1JQF A;  3PU5 A;  1XVY A;  4EXL A;  3T66 A;  1B5H A;  4G8N A;  2O1M A;  4GQO A;  3VXB A;  2O51 A;  4XKQ A;  2F36 A;  2UVH A;  2DWI A;  1UIV A;  2UYE A;  4O3C A;  4OHN A;  4OWD A;  1PC3 A;  1LGB C;  2QS3 A;  4GFR A;  1ZBM A;  2I58 A;  3KBR A;  4QFN A;  4YKP A;  2Z8F A;  4M4G A;  1MH4 A;  5DYH A;  4EF2 A;  4L17 A;  2ABH A;  4U2R A;  2B65 A;  4RPO A;  3O9P A;  3C4M A;  3QAX A;  1ZLQ A;  1SW5 A;  1IEJ A;  2X26 A;  1JEU A;  5H8S A;  1N7X A;  4I8C A;  1XC1 A;  2VP1 A;  1BIY A;  4F39 A;  1A99 A;  2WOP A;  2IA4 A;  1N84 A;  4N6P A;  3TEP A;  1R1N A;  2RC9 A;  1R9Q A;  3LVU A;  3M3F A;  3CFZ A;  2O69 A;  3M3L A;  3RNN A;  1MH3 A;  2YJP A;  4F1U A;  4C1U A;  2RIN A;  2ZYN A;  1ZIU A;  4U22 A;  3FZV A;  4PE5 B;  1EZO A;  1NMU A;  4KPT A;  2UVJ A;  3A3U A;  4FOR A;  3K6V A;  3RUM A;  2QRY A;  1Y1M A;  3Q29 A;  3QK6 A;  2P1S A;  2H25 A;  3FVG A;  3WAE A;  3KOS A;  4LP2 B;  1LB9 A;  2XXP A;  2B3F A;  3TCH A;  3KEI A;  5H8Q B;  3DRG A;  3SEW A;  1CE2 A;  2HAU A;  2QPQ A;  1Y3N A;  4WKM A;  3IB0 A;  5I57 A;  1CB6 A;  3K1N A;  1EU8 A;  4R74 A;  1YCJ A;  2AL5 A;  3EHS A;  5ISU A;  5H8N A;  5TPA A;  3Q25 A;  4XIG Q;  3OEL A;  4K3F A;  5JTY B;  2QL3 A;  2QMW A;  1FTJ A;  3TCF A;  4NF6 B;  5AA4 A;  4U4S A;  3KOT A;  5ELV A;  4KD5 A;  3OMB A;  3LUY A;  2ZYO A;  3E3K A;  1POY 1;  3UOR A;  5I56 B;  2R9J A;  4NF4 B;  4HCY A;  3IOV A;  1LBB A;  3OSQ A;  4G68 B;  2UVG A;  1PB7 A;  3RTW B;  1JW5 A;  1JW1 A;  3IJX B;  3KGC A;  2NVU B;  4MH5 A;  1M5D A;  4OEV A;  1UTB B;  3OOA A;  3N94 A;  3FAT A;  2PVU A;  1B7Z A;  3JV9 A;  2V93 A;  4PFU A;  3TUS A;  4KQP A;  1MPD A;  4OXV A;  2HZL A;  3W9W A;  2AIX A;  5DTB A;  3KN8 A;  4H8I A;  2UYF A;  3K6U A;  3N6T A;  3K2D A;  5CRY A;  1MM7 A;  4NE4 A;  4POW A;  4IO5 A;  2XHD A;  1FTM A;  2X7Q A;  2V3U A;  3PD9 A;  3H7M A;  1B46 A;  3C33 A;  2Y7R A;  3G7W A;  5L9S A;  3S4U A;  3CHG A;  3SEY A;  1DTG A;  1P99 A;  5DVJ A;  1S9T A;  3HST A;  4OFL A;  3THI A;  3H3G A;  2Y7W A;  4OZ9 A;  1HSE A;  3RT8 A;  5AA2 A;  3EN3 A;  1MXY A;  4GRK A;  3SEU A;  5A5X B;  2VHA A;  3MVW A;  5FTI A;  1VFD A;  2VD2 A;  3AXF A;  5ICT A;  4JSD A;  1B05 A;  1LAF E;  4YMB A;  5I58 A;  3MZ1 A;  2H5Y A;  3S9L C;  4ONY A;  3LC8 A;  3TAJ A;  2NWJ A;  1MY4 A;  3T9V A;  2UXA A;  3PAM A;  1N3X A;  2VD3 A;  3TKD A;  1PBP A;  2E0S A;  1Z7M E;  3PD8 A;  4H5G A;  3H6V A;  5H8F B;  5KCJ B;  3OO6 A;  2DQV A;  3DEL B;  3OO9 A;  3PPQ A;  5KDT A;  2HCA A;  3K4U A;  2RF1 A;  1RYX A;  1M5E A;  2F35 A;  2Q9T A;  1II5 A;  4DXU A;  2GHA A;  2ZMB A;  2V3T A;  4AB6 A;  1D3K A;  3DRK A;  3O29 A;  3TQL A;  3UGW A;  1YTV A;  3VVD A;  3HCQ A;  3IAZ A;  4EF1 A;  2B4M A;  3PV0 E;  4ZEB A;  3OD7 A;  1H3D A;  3TPA A;  4WEP A;  4XKR A;  3OSR A;  3F11 A;  2VGQ A;  3OO8 A;  4KFQ A;  5DEX B;  2ZNT A;  1OLA A;  2I6E A;  4MFI A;  4QHQ A;  3T9U A;  2Z23 A;  3CRB A;  1VR5 A;  2I4B A;  3D4G A;  4LZ5 A;  5CI5 A;  2ONK E;  5CM6 A;  1MY0 A;  2OK2 A;  3ZS6 A;  1LAX A;  2H9B A;  2UVI A;  4ZE9 A;  1LAH E;  1P1O A;  1BP5 A;  4X1B A;  4F1V A;  1D4N A;  4OQO A;  3R26 A;  4OVJ A;  3DRH A;  1PB9 A;  3ZSF A;  1N0T A;  4IGR A;  1TWY A;  3M3K A;  5AA1 A;  1A40 A;  4GIZ A;  1ZJL A;  4F3S A;  1MRP A;  3HHG A;  3O97 A;  4NF5 B;  1FQE A;  3KN3 A;  3MZ9 A;  4R6K A;  4ELR A;  3DRJ A;  4RYA A;  2F7C A;  4X1D A;  4F1Y A;  4LQ2 A;  4BDM A;  2O1L A;  3CIJ A;  4TQU Q;  2P0S A;  1SW1 A;  4LAT A;  3T93 B;  1B3H A;  4ZED A;  1LCF A;  5FHO A;  4QSC A;  4NTL A;  4LUB A;  4LZ7 A;  1FQC A;  4BDN A;  3H6U A;  3EQ1 A;  1N04 A;  3PPR A;  5TP9 A;  3MP1 A;  2WOL A;  4BLA A;  3K6W A;  2OWS A;  2D5W A;  1JVY A;  3FUZ A;  3N5L A;  2NXO A;  1QUK A;  1MY2 A;  2ZYK A;  2O7I A;  1I6Q A;  1IXG A;  2I49 A;  3K00 A;  3OEN A;  1Y20 A;  2F5X A;  3P7I A;  1ZU0 A;  4PP0 A;  4ZS9 A;  1SDX A;  4DXC A;  1HSL A;  2P2A A;  3S9E A;  3ODB A;  3GBA A;  4R9G A;  3QXM A;  3E4R A;  3R6U A;  5J1D A;  1WOD A;  2H4I A;  3LR1 A;  2X7P A;  2A5T B;  1VFE A;  3H6W A;  5DVF A;  1IXI A;  3TQW A;  3QUJ A;  1A55 A;  3C36 A;  3V89 B;  3PUV E;  4NF8 A;  1FW0 A;  2XXX A;  3V83 A;  5M2V A;  3O6H A;  2YLN A;  1ZTY A;  1B3L A;  3DP8 A;  3RYA A;  2OWT A;  1VE4 A;  1Q35 A;  1MDQ A;  3W9V A;  3FTO A;  1UQW A;  1UTH A;  1DPP A;  3FJ7 A;  1QUJ A;  4X48 A;  2GRV A;  1MQH A;  3H6T A;  4FJP A;  4EQ7 A;  4QFO A;  3DP4 A;  1B4H A;  1O7T A;  2VOZ A;  2D3I A;  4Q8R A;  2XX9 A;  4OMB A;  2ONS A;  3C35 A;  1GR2 A;  4DXB A;  2DP8 A;  2QS4 A;  2Y7P A;  4YB7 A;  1SI0 A;  4TLL B;  3HPI A;  2A5S A;  2OBG A;  3U93 A;  4PQJ A;  1LFI A;  2H98 A;  4JWY A;  1TFD A;  4PFT A;  1MY3 A;  3C32 A;  4RK9 A;  2XXR A;  3EPE A;  3I5O A;  1EH3 A;  5I59 A;  1B7H A;  3GZG A;  5JEI A;  4GWO A;  1DTZ A;  2KLF A;  3G3J A;  3MQ9 A;  2E1S A;  5CMM A;  4U21 A;  1YAE A;  2PYY A;  2Z8D A;  4F2O A;  4F3G A;  1SQY A;  3IO4 A;  4ZZE A;  3RPW A;  4FEB A;  4YKK A;  4DCX A;  3FVO A;  4XKP A;  4ELP A;  1EZ9 A;  4R2F A;  4R2B A;  1SVX B;  5B70 A;  2Y7K A;  1OLC A;  1WVJ A;  3SEV A;  1LFH A;  4C0R A;  2XD2 A;  3OEM A;  2HXW A;  1QW0 A;  2RCA A;  3ZKK A;  5AA2 D;  1USY E;  3U72 A;  1POT A;  1AOV A;  4C1T A;  4M1V A;  1B3E A;  4POX A;  1M5F A;  1Y4C A;  2OLB A;  4GF8 A;  2DWA A;  2O68 A;  3K02 A;  3OXN A;  2I3W A;  1DMB A;  5DVI A;  3RGY A;  4Q30 B;  4OES A;  1AH5 A;  1NH7 A;  1QKB A;  4AQ4 A;  1MXW A;  3MP8 A;  2W7Y A;  1UIU A;  4HTG A;  5EHM A;  4U23 A;  1SD3 A;  4JBZ A;  1NL5 A;  5HPQ A;  3KSJ A;  4OEU A;  3DM0 A;  4JDF A;  1Z7N E;  3TTR A;  1XHY A;  3PMX A;  1FCK A;  1D9V A;  3O66 A;  4R6Y A;  4ZEC A;  3SEX A;  3H06 B;  1URD A;  4YU0 A;  1O63 A;  4JWX A;  4RXL A;  3QIM A;  3VVF A;  4FAJ A;  4ZEF A;  1JET A;  3FVK A;  2QJE A;  2F7A A;  1MQJ A;  1RYO A;  1PBQ A;  4R73 A;  3ZKL A;  2QMX A;  2Z8E A;  5I57 B;  3MVX A;  3S2V A;  1B6H A;  3TCG A;  1Y3P A;  3TTM A;  4H65 A;  2YPN A;  4ZEI A;  5H8N B;  1JNF A;  5TPA B;  3VFJ A;  4OET A;  3IX1 A;  1B5I A;  5FHN A;  5AA4 B;  1I69 A;  4R9F A;  1DOT A;  3L6H A;  4OFO A;  5I2K A;  4OEN A;  3I6V A;  3ILU B;  3BFU A;  3A3C A;  3I3V A;  4FEC A;  4LQ5 A;  4QRZ A;  4DZ1 A;  3QYT A;  3PUX E;  1TXF A;  4G8H A;  3PPN A;  3LSX A;  3UIF A;  4ZEK A;  1DPE A;  4IY5 A;  5BUU A;  1OIB A;  3VLW A;  3ILT B;  3KSX A;  1R9L A;  4P0I A;  4TLM B;  2QSX A;  4NWC A;  4BDL A;  2GH9 A;  1PEB A;  2DE2 A;  2RC7 A;  3PUY E;  3TEL A;  2F78 A;  4YMA A;  5EHS A;  1MY1 A;  3E9X A;  4GVO A;  4U4X A;  2O6A A;  3LBS A;  3Q27 A;  3E13 X;  3FJM A;  1S7Y A;  4ESX A;  3TFL A;  3TZA A;  1H45 A;  4O3A A;  3B6T A;  3MPL A;  1O64 A;  2CZL A;  3KG2 A;  3V5A A;  3HV1 A;  3VXC A;  3QSL A;  4I62 A;  3N26 A;  4YKI A;  5LOM A;  1NNT A;  3CR9 A;  4WED A;  4P11 A;  4O3B A;  5AA2 B;  1QJM A;  3MW0 A;  5H8H A;  5CMB A;  4E0X A;  2Z22 A;  5TU0 A;  1B3G A;  3R7X A;  1XVX A;  3Q28 A;  3UA8 A;  1US5 A;  4G68 C;  5I58 B;  5I2N A;  4MLV A;  3H4Z A;  4HW8 A;  1IZ1 A;  5IKB A;  5ITO A;  4QFP A;  2GHB A;  1WDN A;  1MPC A;  1A54 A;  2PX1 A;  3KFM A;  1SYH A;  4IO7 A;  1Y1Z A;  5L8D A;  1MQI A;  2XXH A;  3TYH A;  3MVZ A;  4I1D A;  4OFJ A;  1NNK A;  3FD3 A;  5KDT B;  1USY H;  2PT1 A;  3BFT A;  1B1H A;  3VVE A;  4GOT A;  5JK4 A;  4KR5 A;  3MBP A;  1FTO A;  1B58 A;  2DVZ A;  2G93 A;  2V3Q A;  2B3B A;  4RPN A; 
#chains in the Genus database with same CATH topology
 1EYK A;  4KCD A;  1RKM A;  4FE8 A;  2GFE A;  4GXS B;  1B3F A;  3IL1 B;  4UAC A;  1MQD A;  4N17 A;  4KI0 E;  1AIV A;  3PTY A;  5EYF A;  1FQA A;  3IK6 B;  4IO4 A;  3GYY A;  3ONM A;  4ZDM A;  2BJJ X;  1ATG A;  3ISP A;  5I84 A;  4IO2 A;  3SES A;  3CSB A;  1LBW A;  3T22 A;  3MP6 A;  1D9Y A;  2QS2 A;  3K1P A;  4MBP A;  2DE3 A;  1B0H A;  2IEE A;  5HM4 B;  1B51 A;  3MJN A;  5FBP A;  1JVX A;  2HFB A;  3RN8 A;  3IB2 A;  4WXJ A;  1NFT A;  1A7L A;  3G3F A;  4U1Z A;  1FTA A;  2I0B A;  1MG1 A;  3DRF A;  4XKN A;  3O2A A;  2XXI A;  5L9M A;  3G3I A;  1OMP A;  4PFW A;  3TTL A;  5IAI A;  4IO3 A;  4YB5 A;  2ONR A;  1B7U A;  5L9O A;  3IOT A;  5I3S A;  1FPD A;  2F8D A;  1TFA A;  1LST A;  2WEF A;  4FAT A;  1S50 A;  1AL3 A;  2XD3 A;  3OEK A;  2ESN A;  4GL0 A;  1QVS A;  1B9J A;  3USD A;  4F22 A;  3MC2 A;  4N13 A;  1H43 A;  1I6B A;  4F18 A;  4JXI A;  4MMP A;  4IY6 A;  4ELQ A;  4ELO A;  4U1O A;  3CG3 A;  3HO7 A;  3CFX A;  4JVD A;  4KYS A;  2D21 A;  2RC8 A;  2F34 A;  1LB8 A;  3FAS A;  1IIT A;  3BIH A;  1FQB A;  2WX9 A;  3EHU A;  2R6G E;  4NQ8 A;  2DVC A;  4AB5 A;  4GL8 A;  5CMK A;  1IQ7 A;  1AWB A;  1RDZ A;  1N7W A;  1Y3Q A;  1LBC A;  4O8M A;  4H8J A;  5TP9 B;  3CI8 A;  4RY1 A;  1KWH A;  3T96 B;  3PUZ E;  4MF3 A;  1Q1K A;  1SW4 A;  4QFK A;  4YIC A;  2DXY A;  4QSE A;  2M8C A;  4OER A;  4MEV A;  4FIM A;  1RDX A;  1FPJ A;  2RCB A;  4JWO A;  3SET A;  1YPN A;  3U1O A;  1AMF A;  4H67 A;  1EZP A;  1NV5 A;  2F6G A;  3G3H A;  1B4Z A;  2BJI A;  4NX1 A;  1IMB A;  4GX3 A;  3CSG A;  3O6G A;  3PMV A;  1FJ9 A;  3VV5 A;  2ZNS A;  3MAM A;  1B1X A;  1FTK A;  2VPN A;  4FED A;  1QKA A;  1B2H A;  2DSF A;  1OQG A;  4GD5 A;  1LAG E;  2QVR A;  2Y5L A;  1K9Z A;  1FQD A;  1F9B A;  1BKA A;  1OVB A;  2Q2A A;  2ZYM A;  2XXQ A;  5H8Q A;  4MHF A;  4DIG A;  5CBR A;  3MZB A;  1OQH A;  2OZZ A;  4XTC Q;  3C9H A;  1VDW A;  4IGT A;  4P8B A;  4NF8 B;  3LSL A;  4H1X A;  3EF7 A;  2F6P A;  4EQB A;  4LZ8 A;  3TDJ A;  3MPK A;  1B5J A;  4EQ9 A;  2XXT A;  4G2Z A;  1QUL A;  4ECF A;  4H0W A;  4R72 A;  4ZE8 A;  1UTH B;  4P56 A;  2AL4 A;  1BTJ A;  4XXU A;  4EUO A;  1XOC A;  4GXA A;  3FV2 A;  5JTY A;  1H44 A;  5B7D A;  4H45 A;  4NF6 A;  4DCY A;  3FXB A;  1YXI A;  3CFL A;  1CNQ A;  2Y5K A;  1VSO A;  4YAH X;  3EKI A;  2ALU A;  1GTK A;  4KCC A;  5I56 A;  4I9D A;  2XWV A;  4NF4 A;  2FYI A;  2DXR A;  4ND9 A;  3RYB A;  2NOO A;  4LA9 A;  1MM6 A;  3FVN A;  4RA1 A;  4G68 A;  2F7B A;  4P3L A;  4KHZ E;  2FA7 A;  3RT6 B;  3HFU A;  4GWW A;  5I59 B;  2NUV A;  4F19 A;  3SDF A;  1GGG A;  1A8E A;  5DT6 A;  5AE4 A;  1UTB A;  1M5C A;  1ZMG A;  4PAF A;  5IGA A;  1MXU A;  1XT8 A;  5IZ3 B;  2PFY A;  3RY3 A;  2QS1 A;  3HHF A;  1D9Q A;  3HN0 A;  5BWJ A;  1URG A;  3LSF B;  2DOJ A;  4JB7 A;  3DP6 A;  1NNF A;  3CVG A;  2CZH A;  4RPN A;  1BK4 A;  4Z7E A;  5LDZ A;  2OJT A;  3FIR A;  2XX7 A;  3V8X B;  3ECR A;  4MIJ A;  2CEX A;  2RKM A;  3VLU A;  3IFA A;  3O28 A;  1B32 A;  2HAV A;  2OCU A;  3MWB A;  3VLV A;  4PF6 A;  1FBH A;  5ET6 A;  3IJO B;  2WBB A;  4UA8 A;  1JP4 A;  1PB8 A;  3LSW A;  3PMW A;  2Q74 A;  3SER A;  3UP9 A;  2DS9 A;  1J1N A;  1MXX A;  1FBG A;  3RTF B;  2OWZ A;  1ANF A;  4F31 B;  2XXW A;  3B6Q A;  4YZZ A;  3G3K A;  1XI6 A;  2O7U A;  3CG1 A;  3FV1 A;  3FJG A;  1SI1 A;  5A5X A;  3GBB A;  4NN3 A;  3IOW A;  3W15 C;  3K0V A;  2DYX A;  3IOU A;  4QSD A;  1P1U A;  1MDP 1;  4TOZ A;  2P3V A;  1T0K A;  2WKY A;  1ELJ A;  1L5T A;  4X8R A;  1I6A A;  1GV8 A;  1HSJ A;  1A8F A;  5HBC A;  4DDD A;  1N3W A;  3KJT A;  4YB6 A;  3QUF A;  4Q0C A;  5H8F A;  5KCJ A;  3K01 A;  4ESW A;  4QF9 A;  4MLQ A;  4N07 A;  3M8U A;  4G8M A;  2V4C A;  1R6Z A;  1LBV A;  3TMG A;  1NNP A;  2KQZ A;  1NV0 A;  3K1M A;  3RLF E;  1RDY A;  4NMY A;  2R71 A;  1LFG A;  3OO7 A;  4AS4 A;  4HCW A;  1FQF A;  1LEV A;  2WOK A;  3O6P A;  5F1Q A;  2F97 A;  2I3V A;  4HE1 A;  3TTK A;  4F29 A;  1IXC A;  3IO6 A;  4IO6 A;  3C31 A;  1H76 A;  3PPO A;  3B6W A;  4DLD A;  2V84 A;  4N6D A;  4RJZ A;  5K2Y A;  2CMO A;  4NAP A;  4QFL A;  4BDQ A;  1B40 A;  1FPB A;  2Y7I A;  2ZNU A;  4MNC A;  3S9N C;  1P1N A;  3MUQ A;  4OVT A;  5DEX A;  1FTL A;  1ZKB A;  3VDF A;  2REJ A;  4Q5T A;  5I2K B;  1US4 A;  2Y84 A;  4H5F A;  3MVY A;  1NV6 A;  3T0J A;  1DSN A;  4GBV A;  1NKX A;  2XX8 A;  3UN6 A;  3PPP A;  3JYR A;  1NUX A;  2ANJ A;  3FXR A;  2Q89 A;  3JZJ A;  5CBS A;  3KJ7 A;  4EXK A;  3TTN A;  4R6H A;  2PCR A;  4THI A;  4PFB A;  5AA3 A;  3GLB A;  2FNC A;  5ITP A;  3N6U A;  3PGF A;  4F3B A;  5K2X A;  3DRI A;  5A5L A;  2O84 X;  4JSO A;  1NH8 A;  2PMS A;  5EQ8 A;  4KYD A;  4OYV A;  4PET A;  4NF5 A;  2HZK A;  4R75 A;  2XXY A;  3L6G A;  1GVC A;  3B7D A;  1MXV A;  3GXA A;  5F24 A;  2PBW A;  4X9T A;  5F7V A;  3T9X B;  3WAF A;  2H99 A;  1NUZ A;  1FSA A;  1SBP A;  2XXV A;  3EHT A;  1FBP A;  4NF0 A;  4YKJ A;  4RK2 A;  1KZ8 A;  4JVC A;  5DW8 A;  2Q2C A;  1URS A;  3BKI B;  4F3P A;  1B52 A;  5IZ1 A;  4HS7 A;  2PFZ A;  1FPE A;  4G77 A;  1P1W A;  1FBF A;  5EQ9 A;  5KZT A;  4IB2 A;  3FXQ A;  3B8B A;  4OVR A;  3K6X A;  4NWD A;  4H6D A;  3H03 A;  2KR0 A;  3TOD A;  3IR1 A;  5H8H B;  1QUI A;  4PFY A;  2DE4 A;  3D4C A;  4BDO A;  4GX6 A;  3A09 A;  1FPL A;  1TT1 A;  3FGS A;  3O6I A;  4BDR A;  4LVQ A;  1BLF A;  4RNS A;  4MJO A;  1PDA A;  2G29 A;  5I2N B;  4QXD A;  1Q9D A;  1NI9 A;  3IOR A;  4DE8 A;  2Q88 A;  2REG A;  4OTE A;  3IB1 A;  4NED A;  1P1Q A;  3B50 A;  2DWH A;  1SYI A;  1B0L A;  1IIW A;  2I48 A;  4GWX A;  2AYS A;  2V25 A;  2LAO A;  3A29 A;  1FBD A;  1N76 A;  3SKP A;  4ISU A;  2DWJ A;  3U92 A;  2Q8J A;  2A5T A;  1JEV A;  2ZXT A;  3Q26 A;  4P0G A;  1Y9U A;  1OVT A;  4KYE A;  4G4P A;  2HQ0 A;  3RQT A;  1MPB A;  4F2Q A;  4ZZA A;  3BBR A;  3RYD A;  3U8Q A;  1IME A;  3PUW E;  3VE1 B;  3KZG A;  3U94 A;  1YZ0 A;  1MS7 A;  2THI A;  2XA5 A;  4P1E A;  1G0I A;  2PT2 A;  1LLS A;  5CC2 A;  4LON B;  4EDP A;  1M5B A;  2F3D A;  3G3G A;  3S9M C;  5ICQ A;  1QGX A;  3UK4 A;  3FXU A;  4GLI A;  2I0C A;  1IUD A;  4E0W A;  1LCT A;  1MXZ A;  5FTH A;  3T9H B;  4LN5 A;  1IXH A;  2HEU A;  1SW2 A;  2I4C A;  1Y4T A;  5CMC A;  4Z0I A;  3DLN A;  3KN7 A;  1JW4 A;  1MQG A;  3C34 A;  1XS5 A;  5FHM A;  2B4L A;  1JQF A;  3PU5 A;  1XVY A;  4EXL A;  3T66 A;  1B5H A;  4G8N A;  2O1M A;  4PFR A;  4GQO A;  4MAG A;  3VXB A;  2O51 A;  4XKQ A;  2F36 A;  2UVH A;  3T1B A;  1FBC A;  4N6K A;  2DWI A;  2XWK A;  1UIV A;  2UYE A;  4UAB A;  4O3C A;  4OHN A;  4OWD A;  1PC3 A;  1LGB C;  2QS3 A;  4GFR A;  1ZBM A;  2I58 A;  3KBR A;  4QFN A;  4YKP A;  2Z8F A;  4M4G A;  1MH4 A;  5DYH A;  4EF2 A;  4L17 A;  2ABH A;  4U2R A;  2B65 A;  4RPO A;  3O9P A;  3C4M A;  3QAX A;  1ZLQ A;  1SW5 A;  1IEJ A;  2X26 A;  4MX6 A;  1JEU A;  5H8S A;  1N7X A;  4PCD A;  4I8C A;  1XC1 A;  2VP1 A;  1BIY A;  4F39 A;  1INP A;  1A99 A;  2WOP A;  4I3E A;  2IA4 A;  5J16 A;  1N84 A;  4O7M A;  4N6P A;  1FJ6 A;  3TEP A;  1R1N A;  2RC9 A;  1R9Q A;  4OVQ A;  3LVU A;  3M3F A;  3CFZ A;  2O69 A;  3M3L A;  3RNN A;  1MH3 A;  1FBE A;  2YJP A;  4F1U A;  5ET7 A;  4C1U A;  2RIN A;  4XF5 A;  2ZYN A;  1ZIU A;  4U22 A;  3FZV A;  4PE5 B;  1EZO A;  1NMU A;  4KPT A;  2UVJ A;  3A3U A;  4GWY A;  4FOR A;  3K6V A;  3RUM A;  2QRY A;  1Y1M A;  3Q29 A;  3QK6 A;  2P1S A;  2H25 A;  4N8Y A;  2WYP A;  3E79 A;  3FVG A;  3WAE A;  3KOS A;  4LP2 B;  1LB9 A;  2XXP A;  2B3F A;  3TCH A;  3KEI A;  5H8Q B;  2HXR A;  3DRG A;  3SEW A;  1CE2 A;  2HAU A;  2QPQ A;  1Y3N A;  4WKM A;  3RPL A;  3IB0 A;  5I57 A;  5EQA A;  1CB6 A;  3K1N A;  1EU8 A;  4R74 A;  1YCJ A;  2AL5 A;  3EHS A;  5ISU A;  5H8N A;  5TPA A;  3Q25 A;  4XIG Q;  3OEL A;  4K3F A;  3SZP A;  1LBY A;  2QL3 A;  5JTY B;  2QMW A;  2HHM A;  1FTJ A;  3TCF A;  4NF6 B;  5AA4 A;  4U4S A;  3KOT A;  5ELV A;  4KD5 A;  3OMB A;  3LUY A;  2ZYO A;  2R8T A;  3KC0 A;  3E3K A;  1POY 1;  3UOR A;  5I56 B;  2R9J A;  5ESY A;  4NF4 B;  4HCY A;  3IOV A;  1LBB A;  3OSQ A;  3BIG A;  1IMF A;  2WBD A;  2ZZW A;  4G68 B;  2UVG A;  1PB7 A;  3RTW B;  1JW5 A;  1JW1 A;  3IJX B;  3KGC A;  2NVU B;  2HPG A;  4MH5 A;  1M5D A;  4OEV A;  1UTB B;  1IMD A;  3OOA A;  3N94 A;  3FAT A;  2PVU A;  1B7Z A;  3JV9 A;  2V93 A;  4PFU A;  3TUS A;  4KQP A;  1MPD A;  4OXV A;  2MKZ A;  2HZL A;  3W9W A;  2AIX A;  5DTB A;  4XEQ A;  3U65 A;  3KN8 A;  4H8I A;  2UYF A;  3K6U A;  4PE3 A;  3N6T A;  3K2D A;  5CRY A;  1MM7 A;  4NE4 A;  4POW A;  4IO5 A;  2XHD A;  1FTM A;  2X7Q A;  2V3U A;  3PD9 A;  3H7M A;  1B46 A;  3C33 A;  2Y7R A;  3G7W A;  5L9S A;  3S4U A;  3CHG A;  3SEY A;  4G61 A;  1DTG A;  1P99 A;  1FPG A;  4PDD A;  5DVJ A;  1S9T A;  4QBA A;  3HST A;  4OFL A;  3THI A;  3H3G A;  2Y7W A;  4OZ9 A;  1HSE A;  4HXV A;  3RT8 A;  2Q8M A;  5AA2 A;  3EN3 A;  1MXY A;  4NHB A;  4GRK A;  1G0H A;  3SEU A;  5A5X B;  2VHA A;  3MVW A;  5FTI A;  1VFD A;  2VD2 A;  2FIE A;  4MNP A;  4PFI A;  3AXF A;  5ICT A;  4JSD A;  1B05 A;  1LAF E;  4YMB A;  5I58 A;  3MZ1 A;  1FPK A;  5LTC A;  4O7I A;  2H5Y A;  3S9L C;  4O94 A;  4ONY A;  3KBZ A;  3LC8 A;  3TAJ A;  2NWJ A;  1MY4 A;  4GWZ A;  1DBZ A;  3T9V A;  2UXA A;  3PAM A;  1N3X A;  2VD3 A;  3TKD A;  1PBP A;  3MYU A;  2E0S A;  1Z7M E;  3IFC A;  3PD8 A;  4H5G A;  3H6V A;  5H8F B;  5KCJ B;  3OO6 A;  2DQV A;  3DEL B;  3OO9 A;  3PPQ A;  5KDT A;  2HCA A;  5EQ7 A;  3K4U A;  2RF1 A;  3ROJ A;  1RYX A;  1M5E A;  2F35 A;  2Q9T A;  1II5 A;  4DXU A;  2GHA A;  2ZMB A;  2V3T A;  4AB6 A;  1D3K A;  3DRK A;  3O29 A;  5EYG A;  3TQL A;  3UGW A;  1YTV A;  3VVD A;  3HCQ A;  1YYZ A;  3IAZ A;  4EF1 A;  2B4M A;  3PV0 E;  4ZEB A;  1LBZ A;  3OD7 A;  1H3D A;  5T3J A;  3TPA A;  4WEP A;  4XKR A;  3OSR A;  3F11 A;  2VGQ A;  3OO8 A;  4KFQ A;  5DEX B;  2ZNT A;  1OLA A;  2I6E A;  4FBP A;  4MFI A;  4QHQ A;  3T9U A;  2Z23 A;  3CRB A;  4N4U A;  1VR5 A;  4GX4 A;  2I4B A;  2XWO A;  3D4G A;  4LZ5 A;  5CI5 A;  2ONK E;  5CM6 A;  1KA1 A;  1MY0 A;  2OK2 A;  3ZS6 A;  1LAX A;  2FVZ A;  4PGN A;  2H9B A;  2XXK A;  2UVI A;  4ZE9 A;  4GBW A;  1LAH E;  1P1O A;  1BP5 A;  4X1B A;  4F1V A;  1D4N A;  4OQO A;  3R26 A;  4OVJ A;  3DRH A;  1PB9 A;  3ZSF A;  1N0T A;  4IGR A;  1TWY A;  4OVS A;  3M3K A;  5AA1 A;  1A40 A;  4GIZ A;  1ZJL A;  4X04 A;  4F3S A;  1MRP A;  3HHG A;  3O97 A;  4NF5 B;  5IM2 A;  2FBP A;  1FQE A;  3KN3 A;  3MZ9 A;  4DI3 D;  1FPI A;  4R6K A;  4ELR A;  3DRJ A;  4RYA A;  2F7C A;  4X1D A;  4F1Y A;  4LQ2 A;  4BDM A;  1IMC A;  2O1L A;  3CIJ A;  4TQU Q;  2P0S A;  1SW1 A;  4LAT A;  2FIX A;  3T93 B;  1B3H A;  4ZED A;  1LCF A;  5FHO A;  4QSC A;  4NTL A;  2CZI A;  4LUB A;  4LZ7 A;  1FQC A;  4BDN A;  3H6U A;  3EQ1 A;  1N04 A;  1IMA A;  3PPR A;  1DCU A;  5TP9 A;  3MP1 A;  2WOL A;  4BLA A;  3K6W A;  2OWS A;  2D5W A;  1JVY A;  3FUZ A;  3N5L A;  2NXO A;  4MNI A;  1QUK A;  1MY2 A;  4GWU A;  2ZYK A;  1SPI A;  2GQ1 A;  2O7I A;  2DDK A;  1I6Q A;  1IXG A;  2I49 A;  4NGU A;  3K00 A;  3OEN A;  1Y20 A;  2F5X A;  3P7I A;  1K9Y A;  1ZU0 A;  4PP0 A;  4ZS9 A;  1SDX A;  4DXC A;  1LBX A;  1HSL A;  2P2A A;  3S9E A;  3ODB A;  3GBA A;  4R9G A;  3QXM A;  3E4R A;  3R6U A;  5J1D A;  1WOD A;  2H4I A;  3LR1 A;  2X7P A;  2A5T B;  1VFE A;  3H6W A;  5DVF A;  1IXI A;  3TQW A;  3LUZ A;  4NG7 A;  4PF8 A;  2XWI A;  3QUJ A;  4PGP A;  1A55 A;  3C36 A;  2ZZX A;  3V89 B;  3PUV E;  4NF8 A;  1FW0 A;  2XXX A;  3V83 A;  5M2V A;  2FHY A;  3O6H A;  2YLN A;  1ZTY A;  1B3L A;  3DP8 A;  3RYA A;  2OWT A;  1VE4 A;  1Q35 A;  2L5V A;  1MDQ A;  3W9V A;  3FTO A;  1UQW A;  1UTH A;  1DPP A;  3FJ7 A;  1QUJ A;  4X48 A;  2GRV A;  1MQH A;  3H6T A;  4FJP A;  4EQ7 A;  4QFO A;  3DP4 A;  1B4H A;  1O7T A;  2VOZ A;  4PTK A;  2D3I A;  4Q8R A;  2XX9 A;  4OMB A;  1NV1 A;  2ONS A;  3C35 A;  1GR2 A;  4DXB A;  2DP8 A;  2QS4 A;  2Y7P A;  4YB7 A;  1SI0 A;  4TLL B;  3HPI A;  2A5S A;  2OBG A;  3U93 A;  4PQJ A;  1LFI A;  2H98 A;  4JWY A;  1TFD A;  4PFT A;  1MY3 A;  3C32 A;  4RK9 A;  2XXR A;  3EPE A;  3I5O A;  1EH3 A;  5I59 A;  1B7H A;  3GZG A;  4GWS A;  5JEI A;  4GWO A;  4OAN A;  2JJK A;  1DTZ A;  2KLF A;  3G3J A;  3KC1 A;  3MQ9 A;  4P9K A;  4I3Y A;  2E1S A;  5CMM A;  2CEY A;  4U21 A;  4PAK A;  4HE2 A;  1YAE A;  2PYY A;  2Z8D A;  4F2O A;  5IZ3 A;  4F3G A;  4P1L A;  1SQY A;  3IO4 A;  4ZZE A;  3RPW A;  3QMF A;  4FEB A;  4MCO A;  4YKK A;  4DCX A;  3FVO A;  4XKP A;  4ELP A;  1EZ9 A;  4R2F A;  4R2B A;  1SVX B;  1KA0 A;  5B70 A;  2Y7K A;  1OLC A;  1WVJ A;  3SEV A;  1LFH A;  4C0R A;  4PC9 A;  2XD2 A;  3OEM A;  2HXW A;  1QW0 A;  2CZK A;  2RCA A;  3ZKK A;  5AA2 D;  1USY E;  3U72 A;  1POT A;  1AOV A;  4C1T A;  4M1V A;  1B3E A;  4POX A;  1M5F A;  1Y4C A;  2VT5 A;  2OLB A;  4N81 A;  4GF8 A;  2DWA A;  2O68 A;  3K02 A;  3OXN A;  2I3W A;  1DMB A;  5DVI A;  3RGY A;  4Q30 B;  4OES A;  1AH5 A;  5ET8 A;  1NH7 A;  1QKB A;  2P3N A;  4AQ4 A;  1MXW A;  3MP8 A;  2W7Y A;  1UIU A;  1NV3 A;  4HTG A;  5EHM A;  4U23 A;  1SD3 A;  4JBZ A;  1NL5 A;  5HPQ A;  2ZZV A;  4OEU A;  3KSJ A;  3DM0 A;  4JDF A;  1Z7N E;  3TTR A;  1XHY A;  3PMX A;  1FCK A;  1D9V A;  3O66 A;  4R6Y A;  4ZEC A;  3SEX A;  2QVV A;  3H06 B;  1URD A;  4DI4 B;  4YU0 A;  1O63 A;  4JWX A;  4RXL A;  3QIM A;  3VVF A;  4FAJ A;  4ZEF A;  3LV0 A;  1JET A;  3FVK A;  3FBP A;  2QJE A;  2F7A A;  1MQJ A;  1RYO A;  1PBQ A;  4R73 A;  3RPL B;  1DK4 A;  3ZKL A;  2QMX A;  2Z8E A;  5I57 B;  3MVX A;  3S2V A;  1B6H A;  2OX3 A;  3TCG A;  1Y3P A;  2QFL A;  3TTM A;  4H65 A;  2YPN A;  4ZEI A;  5H8N B;  1JNF A;  5TPA B;  3VFJ A;  4OET A;  4PDH A;  3IX1 A;  3E78 A;  1B5I A;  5FHN A;  5AA4 B;  1I69 A;  4R9F A;  5I7I A;  1DOT A;  3L6H A;  4OFO A;  5I2K A;  4OEN A;  3I6V A;  3ILU B;  3BFU A;  4PBQ A;  5EYH A;  5ET5 A;  3A3C A;  3I3V A;  4FEC A;  4OVP A;  4LQ5 A;  4QRZ A;  4DZ1 A;  3QYT A;  3PUX E;  1TXF A;  4G8H A;  1NV4 A;  3PPN A;  3LSX A;  3UIF A;  4ZEK A;  1DPE A;  4KXP A;  3MST A;  4PAI A;  5I5P A;  4IY5 A;  5BUU A;  1OIB A;  3VLW A;  3ILT B;  3KSX A;  4OA4 A;  1R9L A;  4P0I A;  4TLM B;  2QSX A;  4NWC A;  4BDL A;  4JVI A;  2GH9 A;  1PEB A;  2DE2 A;  2RC7 A;  3PUY E;  3TEL A;  4PBH A;  2F78 A;  4I40 A;  1FPF A;  4YMA A;  5EHS A;  1MY1 A;  3E9X A;  4GVO A;  4U4X A;  2O6A A;  3LBS A;  3Q27 A;  3E13 X;  4AS5 A;  3FJM A;  1S7Y A;  4ESX A;  1EYI A;  1NV2 A;  3TFL A;  3TZA A;  1NUY A;  1NV7 A;  1H45 A;  5IZZ A;  4O3A A;  3B6T A;  4N8G A;  3MPL A;  1O64 A;  4IR8 A;  2CZL A;  3KG2 A;  2F3B A;  3V5A A;  3HV1 A;  1EYJ A;  3VXC A;  4H46 A;  3QSL A;  4I62 A;  3N26 A;  4YKI A;  5LOM A;  1NNT A;  3CR9 A;  4WED A;  3D1R A;  4P11 A;  4N15 A;  2WYK A;  4N91 A;  4O3B A;  5AA2 B;  1QJM A;  3MW0 A;  5H8H A;  5CMB A;  4E0X A;  2Z22 A;  5TU0 A;  1B3G A;  3R7X A;  3NOH A;  1XVX A;  3Q28 A;  3UA8 A;  1US5 A;  4G68 C;  4P47 A;  5I58 B;  5I2N A;  4MLV A;  3H4Z A;  4HW8 A;  1IZ1 A;  5IKB A;  5ITO A;  4XFE A;  4QFP A;  2GHB A;  1WDN A;  1MPC A;  1A54 A;  2PX1 A;  3KFM A;  1SYH A;  4IO7 A;  1Y1Z A;  5L8D A;  2VPO A;  1MQI A;  2XXH A;  3TYH A;  3MVZ A;  4I1D A;  4OFJ A;  1NNK A;  3FD3 A;  5KDT B;  1USY H;  2PT1 A;  3BFT A;  2QVU A;  1B1H A;  4HE0 A;  3VVE A;  4GOT A;  1NUW A;  1FRP A;  5JK4 A;  4KR5 A;  3MBP A;  1FTO A;  1B58 A;  2DVZ A;  2G93 A;  2V3Q A;  2B3B A;  2XXU A; 
#chains in the Genus database with same CATH homology
 4KCD A;  1RKM A;  4FE8 A;  2GFE A;  4GXS B;  1B3F A;  3IL1 B;  4UAC A;  1MQD A;  4KI0 E;  1AIV A;  5EYF A;  1FQA A;  3IK6 B;  4IO4 A;  3ONM A;  4ZDM A;  2BJJ X;  1ATG A;  5I84 A;  4IO2 A;  3SES A;  3CSB A;  3T22 A;  3MP6 A;  1D9Y A;  2QS2 A;  3K1P A;  4MBP A;  2DE3 A;  1B0H A;  2IEE A;  5HM4 B;  1B51 A;  3MJN A;  1JVX A;  2HFB A;  3RN8 A;  3IB2 A;  4WXJ A;  1NFT A;  1A7L A;  3G3F A;  4U1Z A;  2I0B A;  1MG1 A;  3DRF A;  4XKN A;  3O2A A;  2XXI A;  5L9M A;  3G3I A;  1OMP A;  4PFW A;  3TTL A;  5IAI A;  4IO3 A;  4YB5 A;  2ONR A;  1B7U A;  5L9O A;  3IOT A;  2F8D A;  1TFA A;  1LST A;  4FAT A;  1S50 A;  1AL3 A;  2XD3 A;  3OEK A;  2ESN A;  4GL0 A;  1QVS A;  1B9J A;  3USD A;  4F22 A;  3MC2 A;  4N13 A;  1H43 A;  1I6B A;  4F18 A;  4JXI A;  4IY6 A;  4ELQ A;  4ELO A;  4U1O A;  3CG3 A;  3HO7 A;  3CFX A;  4KYS A;  2D21 A;  2RC8 A;  2F34 A;  1LB8 A;  3FAS A;  1IIT A;  1FQB A;  3EHU A;  2R6G E;  2DVC A;  4AB5 A;  4GL8 A;  5CMK A;  1IQ7 A;  1N7W A;  1Y3Q A;  1LBC A;  4H8J A;  5TP9 B;  3CI8 A;  4RY1 A;  1KWH A;  3T96 B;  3PUZ E;  4MF3 A;  1Q1K A;  1SW4 A;  4QFK A;  4YIC A;  2DXY A;  4QSE A;  2M8C A;  4OER A;  4FIM A;  2RCB A;  4JWO A;  3SET A;  1YPN A;  3U1O A;  1AMF A;  4H67 A;  1EZP A;  2F6G A;  3G3H A;  1B4Z A;  3CSG A;  3O6G A;  3PMV A;  3VV5 A;  2ZNS A;  3MAM A;  1B1X A;  1FTK A;  4FED A;  1QKA A;  1B2H A;  2DSF A;  1OQG A;  4GD5 A;  1LAG E;  1FQD A;  1F9B A;  1BKA A;  1OVB A;  2Q2A A;  2ZYM A;  2XXQ A;  5H8Q A;  4DIG A;  5CBR A;  3MZB A;  1OQH A;  2OZZ A;  4XTC Q;  3C9H A;  4IGT A;  4NF8 B;  3LSL A;  4H1X A;  3EF7 A;  2F6P A;  4EQB A;  4LZ8 A;  3TDJ A;  3MPK A;  1B5J A;  4EQ9 A;  2XXT A;  4G2Z A;  1QUL A;  4ECF A;  4H0W A;  4R72 A;  4ZE8 A;  1UTH B;  2AL4 A;  1BTJ A;  4XXU A;  4EUO A;  1XOC A;  4GXA A;  3FV2 A;  5JTY A;  1H44 A;  5B7D A;  4NF6 A;  4DCY A;  3CFL A;  1VSO A;  4YAH X;  2ALU A;  1GTK A;  4KCC A;  5I56 A;  4I9D A;  4NF4 A;  2FYI A;  2DXR A;  4ND9 A;  3RYB A;  2NOO A;  4LA9 A;  1MM6 A;  3FVN A;  4RA1 A;  4G68 A;  2F7B A;  4KHZ E;  2FA7 A;  3RT6 B;  5I59 B;  2NUV A;  4F19 A;  3SDF A;  1GGG A;  1A8E A;  5DT6 A;  5AE4 A;  1UTB A;  1M5C A;  1ZMG A;  1MXU A;  1XT8 A;  3RY3 A;  2QS1 A;  3HHF A;  3HN0 A;  5BWJ A;  1URG A;  3LSF B;  2DOJ A;  4JB7 A;  3DP6 A;  1NNF A;  3CVG A;  4Z7E A;  2OJT A;  3FIR A;  2XX7 A;  3V8X B;  3ECR A;  2RKM A;  3VLU A;  3O28 A;  1B32 A;  2HAV A;  2OCU A;  3MWB A;  3VLV A;  3IJO B;  4UA8 A;  1PB8 A;  3LSW A;  3PMW A;  3SER A;  3UP9 A;  2DS9 A;  1J1N A;  1MXX A;  3RTF B;  1ANF A;  4F31 B;  2XXW A;  3B6Q A;  4YZZ A;  3G3K A;  2O7U A;  3CG1 A;  3FV1 A;  3FJG A;  1SI1 A;  5A5X A;  3GBB A;  3IOW A;  3W15 C;  3K0V A;  2DYX A;  3IOU A;  4QSD A;  1P1U A;  1MDP 1;  4TOZ A;  1T0K A;  2WKY A;  1ELJ A;  1L5T A;  1I6A A;  1GV8 A;  1HSJ A;  1A8F A;  5HBC A;  4DDD A;  1N3W A;  3KJT A;  4YB6 A;  3QUF A;  4Q0C A;  5H8F A;  5KCJ A;  3K01 A;  4ESW A;  4QF9 A;  4MLQ A;  4N07 A;  3M8U A;  4G8M A;  1R6Z A;  3TMG A;  1NNP A;  3K1M A;  3RLF E;  4NMY A;  2R71 A;  1LFG A;  3OO7 A;  4HCW A;  1FQF A;  2WOK A;  3O6P A;  5F1Q A;  2F97 A;  2I3V A;  4F29 A;  3TTK A;  1IXC A;  3IO6 A;  4IO6 A;  3C31 A;  1H76 A;  3PPO A;  3B6W A;  4DLD A;  2V84 A;  4RJZ A;  5K2Y A;  2CMO A;  4QFL A;  4BDQ A;  1B40 A;  2Y7I A;  2ZNU A;  3S9N C;  1P1N A;  3MUQ A;  5DEX A;  1FTL A;  1ZKB A;  3VDF A;  2REJ A;  4Q5T A;  5I2K B;  1US4 A;  2Y84 A;  4H5F A;  3MVY A;  1DSN A;  1NKX A;  2XX8 A;  3UN6 A;  3PPP A;  3JYR A;  2ANJ A;  3FXR A;  2Q89 A;  3JZJ A;  5CBS A;  3KJ7 A;  4EXK A;  3TTN A;  4R6H A;  4THI A;  5AA3 A;  3GLB A;  2FNC A;  5ITP A;  3N6U A;  3PGF A;  4F3B A;  5K2X A;  3DRI A;  2O84 X;  4JSO A;  1NH8 A;  2PMS A;  4KYD A;  4OYV A;  4PET A;  4NF5 A;  2HZK A;  4R75 A;  2XXY A;  3L6G A;  1GVC A;  3B7D A;  1MXV A;  3GXA A;  2PBW A;  4X9T A;  5F7V A;  3T9X B;  3WAF A;  2H99 A;  1SBP A;  2XXV A;  3EHT A;  4YKJ A;  4RK2 A;  2Q2C A;  1URS A;  3BKI B;  4F3P A;  1B52 A;  4HS7 A;  4G77 A;  1P1W A;  5KZT A;  4IB2 A;  3FXQ A;  3K6X A;  4NWD A;  4H6D A;  3H03 A;  3TOD A;  3IR1 A;  5H8H B;  1QUI A;  4PFY A;  2DE4 A;  3D4C A;  4BDO A;  3A09 A;  1TT1 A;  3FGS A;  3O6I A;  4BDR A;  4LVQ A;  1BLF A;  4RNS A;  1PDA A;  2G29 A;  5I2N B;  3IOR A;  4DE8 A;  2Q88 A;  2REG A;  4OTE A;  3IB1 A;  4NED A;  1P1Q A;  2DWH A;  1SYI A;  1B0L A;  1IIW A;  2I48 A;  2AYS A;  2V25 A;  2LAO A;  1N76 A;  3SKP A;  4ISU A;  2DWJ A;  3U92 A;  2Q8J A;  2A5T A;  1JEV A;  2ZXT A;  3Q26 A;  4P0G A;  1Y9U A;  1OVT A;  4KYE A;  4G4P A;  2XXU A;  2HQ0 A;  3RQT A;  1MPB A;  4F2Q A;  4ZZA A;  3BBR A;  3U8Q A;  3PUW E;  3VE1 B;  3KZG A;  3U94 A;  1MS7 A;  2THI A;  2PT2 A;  1LLS A;  5CC2 A;  4LON B;  4EDP A;  1M5B A;  3G3G A;  3S9M C;  5ICQ A;  3UK4 A;  3FXU A;  4GLI A;  2I0C A;  1IUD A;  4E0W A;  1LCT A;  1MXZ A;  5FTH A;  3T9H B;  1IXH A;  2HEU A;  1SW2 A;  2I4C A;  1Y4T A;  5CMC A;  4Z0I A;  3DLN A;  3KN7 A;  1JW4 A;  1MQG A;  3C34 A;  1XS5 A;  5FHM A;  2B4L A;  1JQF A;  3PU5 A;  1XVY A;  4EXL A;  3T66 A;  1B5H A;  4G8N A;  2O1M A;  4GQO A;  3VXB A;  2O51 A;  4XKQ A;  2F36 A;  2UVH A;  2DWI A;  1UIV A;  2UYE A;  4O3C A;  4OHN A;  4OWD A;  1PC3 A;  1LGB C;  2QS3 A;  4GFR A;  1ZBM A;  2I58 A;  3KBR A;  4QFN A;  4YKP A;  2Z8F A;  4M4G A;  1MH4 A;  5DYH A;  4EF2 A;  4L17 A;  2ABH A;  4U2R A;  2B65 A;  4RPO A;  3O9P A;  3C4M A;  3QAX A;  1ZLQ A;  1SW5 A;  1IEJ A;  2X26 A;  1JEU A;  5H8S A;  1N7X A;  4I8C A;  1XC1 A;  2VP1 A;  1BIY A;  4F39 A;  1A99 A;  2WOP A;  2IA4 A;  1N84 A;  4N6P A;  3TEP A;  1R1N A;  2RC9 A;  1R9Q A;  3LVU A;  3M3F A;  3CFZ A;  2O69 A;  3M3L A;  3RNN A;  1MH3 A;  2YJP A;  4F1U A;  4C1U A;  2RIN A;  2ZYN A;  1ZIU A;  4U22 A;  3FZV A;  4PE5 B;  1EZO A;  1NMU A;  4KPT A;  2UVJ A;  3A3U A;  4FOR A;  3K6V A;  3RUM A;  2QRY A;  1Y1M A;  3Q29 A;  3QK6 A;  2P1S A;  2H25 A;  3FVG A;  3WAE A;  3KOS A;  4LP2 B;  1LB9 A;  2XXP A;  2B3F A;  3TCH A;  3KEI A;  5H8Q B;  3DRG A;  3SEW A;  1CE2 A;  2HAU A;  2QPQ A;  1Y3N A;  4WKM A;  3IB0 A;  5I57 A;  1CB6 A;  3K1N A;  1EU8 A;  4R74 A;  1YCJ A;  2AL5 A;  3EHS A;  5ISU A;  5H8N A;  5TPA A;  3Q25 A;  4XIG Q;  3OEL A;  4K3F A;  5JTY B;  2QL3 A;  2QMW A;  1FTJ A;  3TCF A;  4NF6 B;  5AA4 A;  4U4S A;  3KOT A;  5ELV A;  4KD5 A;  3OMB A;  3LUY A;  2ZYO A;  3E3K A;  1POY 1;  3UOR A;  5I56 B;  2R9J A;  4NF4 B;  4HCY A;  3IOV A;  1LBB A;  3OSQ A;  4G68 B;  2UVG A;  1PB7 A;  3RTW B;  1JW5 A;  1JW1 A;  3IJX B;  3KGC A;  2NVU B;  4MH5 A;  1M5D A;  4OEV A;  1UTB B;  3OOA A;  3N94 A;  3FAT A;  2PVU A;  1B7Z A;  3JV9 A;  2V93 A;  4PFU A;  3TUS A;  4KQP A;  1MPD A;  4OXV A;  2HZL A;  3W9W A;  2AIX A;  5DTB A;  3KN8 A;  4H8I A;  2UYF A;  3K6U A;  3N6T A;  3K2D A;  5CRY A;  1MM7 A;  4NE4 A;  4POW A;  4IO5 A;  2XHD A;  1FTM A;  2X7Q A;  2V3U A;  3PD9 A;  3H7M A;  1B46 A;  3C33 A;  2Y7R A;  3G7W A;  5L9S A;  3S4U A;  3CHG A;  3SEY A;  1DTG A;  1P99 A;  5DVJ A;  1S9T A;  3HST A;  4OFL A;  3THI A;  3H3G A;  2Y7W A;  4OZ9 A;  1HSE A;  3RT8 A;  5AA2 A;  3EN3 A;  1MXY A;  4GRK A;  3SEU A;  5A5X B;  2VHA A;  3MVW A;  5FTI A;  1VFD A;  2VD2 A;  3AXF A;  5ICT A;  4JSD A;  1B05 A;  1LAF E;  4YMB A;  5I58 A;  3MZ1 A;  2H5Y A;  3S9L C;  4ONY A;  3LC8 A;  3TAJ A;  2NWJ A;  1MY4 A;  3T9V A;  2UXA A;  3PAM A;  1N3X A;  2VD3 A;  3TKD A;  1PBP A;  2E0S A;  1Z7M E;  3PD8 A;  4H5G A;  3H6V A;  5H8F B;  5KCJ B;  3OO6 A;  2DQV A;  3DEL B;  3OO9 A;  3PPQ A;  5KDT A;  2HCA A;  3K4U A;  2RF1 A;  1RYX A;  1M5E A;  2F35 A;  2Q9T A;  1II5 A;  4DXU A;  2GHA A;  2ZMB A;  2V3T A;  4AB6 A;  1D3K A;  3DRK A;  3O29 A;  3TQL A;  3UGW A;  1YTV A;  3VVD A;  3HCQ A;  3IAZ A;  4EF1 A;  2B4M A;  3PV0 E;  4ZEB A;  3OD7 A;  1H3D A;  3TPA A;  4WEP A;  4XKR A;  3OSR A;  3F11 A;  2VGQ A;  3OO8 A;  4KFQ A;  5DEX B;  2ZNT A;  1OLA A;  2I6E A;  4MFI A;  4QHQ A;  3T9U A;  2Z23 A;  3CRB A;  1VR5 A;  2I4B A;  3D4G A;  4LZ5 A;  5CI5 A;  2ONK E;  5CM6 A;  1MY0 A;  2OK2 A;  3ZS6 A;  1LAX A;  2H9B A;  2UVI A;  4ZE9 A;  1LAH E;  1P1O A;  1BP5 A;  4X1B A;  4F1V A;  1D4N A;  4OQO A;  3R26 A;  4OVJ A;  3DRH A;  1PB9 A;  3ZSF A;  1N0T A;  4IGR A;  1TWY A;  3M3K A;  5AA1 A;  1A40 A;  4GIZ A;  1ZJL A;  4F3S A;  1MRP A;  3HHG A;  3O97 A;  4NF5 B;  1FQE A;  3KN3 A;  3MZ9 A;  4R6K A;  4ELR A;  3DRJ A;  4RYA A;  2F7C A;  4X1D A;  4F1Y A;  4LQ2 A;  4BDM A;  2O1L A;  3CIJ A;  4TQU Q;  2P0S A;  1SW1 A;  4LAT A;  3T93 B;  1B3H A;  4ZED A;  1LCF A;  5FHO A;  4QSC A;  4NTL A;  4LUB A;  4LZ7 A;  1FQC A;  4BDN A;  3H6U A;  3EQ1 A;  1N04 A;  3PPR A;  5TP9 A;  3MP1 A;  2WOL A;  4BLA A;  3K6W A;  2OWS A;  2D5W A;  1JVY A;  3FUZ A;  3N5L A;  2NXO A;  1QUK A;  1MY2 A;  2ZYK A;  2O7I A;  1I6Q A;  1IXG A;  2I49 A;  3K00 A;  3OEN A;  1Y20 A;  2F5X A;  3P7I A;  1ZU0 A;  4PP0 A;  4ZS9 A;  1SDX A;  4DXC A;  1HSL A;  2P2A A;  3S9E A;  3ODB A;  3GBA A;  4R9G A;  3QXM A;  3E4R A;  3R6U A;  5J1D A;  1WOD A;  2H4I A;  3LR1 A;  2X7P A;  2A5T B;  1VFE A;  3H6W A;  5DVF A;  1IXI A;  3TQW A;  3QUJ A;  1A55 A;  3C36 A;  3V89 B;  3PUV E;  4NF8 A;  1FW0 A;  2XXX A;  3V83 A;  5M2V A;  3O6H A;  2YLN A;  1ZTY A;  1B3L A;  3DP8 A;  3RYA A;  2OWT A;  1VE4 A;  1Q35 A;  1MDQ A;  3W9V A;  3FTO A;  1UQW A;  1UTH A;  1DPP A;  3FJ7 A;  1QUJ A;  4X48 A;  2GRV A;  1MQH A;  3H6T A;  4FJP A;  4EQ7 A;  4QFO A;  3DP4 A;  1B4H A;  1O7T A;  2VOZ A;  2D3I A;  4Q8R A;  2XX9 A;  4OMB A;  2ONS A;  3C35 A;  1GR2 A;  4DXB A;  2DP8 A;  2QS4 A;  2Y7P A;  4YB7 A;  1SI0 A;  4TLL B;  3HPI A;  2A5S A;  2OBG A;  3U93 A;  4PQJ A;  1LFI A;  2H98 A;  4JWY A;  1TFD A;  4PFT A;  1MY3 A;  3C32 A;  4RK9 A;  2XXR A;  3EPE A;  3I5O A;  1EH3 A;  5I59 A;  1B7H A;  3GZG A;  5JEI A;  4GWO A;  1DTZ A;  2KLF A;  3G3J A;  3MQ9 A;  2E1S A;  5CMM A;  4U21 A;  1YAE A;  2PYY A;  2Z8D A;  4F2O A;  4F3G A;  1SQY A;  3IO4 A;  4ZZE A;  3RPW A;  4FEB A;  4YKK A;  4DCX A;  3FVO A;  4XKP A;  4ELP A;  1EZ9 A;  4R2F A;  4R2B A;  1SVX B;  5B70 A;  2Y7K A;  1OLC A;  1WVJ A;  3SEV A;  1LFH A;  4C0R A;  2XD2 A;  3OEM A;  2HXW A;  1QW0 A;  2RCA A;  3ZKK A;  5AA2 D;  1USY E;  3U72 A;  1POT A;  1AOV A;  4C1T A;  4M1V A;  1B3E A;  4POX A;  1M5F A;  1Y4C A;  2OLB A;  4GF8 A;  2DWA A;  2O68 A;  3K02 A;  3OXN A;  2I3W A;  1DMB A;  5DVI A;  3RGY A;  4Q30 B;  4OES A;  1AH5 A;  1NH7 A;  1QKB A;  4AQ4 A;  1MXW A;  3MP8 A;  2W7Y A;  1UIU A;  4HTG A;  5EHM A;  4U23 A;  1SD3 A;  4JBZ A;  1NL5 A;  5HPQ A;  3KSJ A;  4OEU A;  3DM0 A;  4JDF A;  1Z7N E;  3TTR A;  1XHY A;  3PMX A;  1FCK A;  1D9V A;  3O66 A;  4R6Y A;  4ZEC A;  3SEX A;  3H06 B;  1URD A;  4YU0 A;  1O63 A;  4JWX A;  4RXL A;  3QIM A;  3VVF A;  4FAJ A;  4ZEF A;  1JET A;  3FVK A;  2QJE A;  2F7A A;  1MQJ A;  1RYO A;  1PBQ A;  4R73 A;  3ZKL A;  2QMX A;  2Z8E A;  5I57 B;  3MVX A;  3S2V A;  1B6H A;  3TCG A;  1Y3P A;  3TTM A;  4H65 A;  2YPN A;  4ZEI A;  5H8N B;  1JNF A;  5TPA B;  3VFJ A;  4OET A;  3IX1 A;  1B5I A;  5FHN A;  5AA4 B;  1I69 A;  4R9F A;  1DOT A;  3L6H A;  4OFO A;  5I2K A;  4OEN A;  3I6V A;  3ILU B;  3BFU A;  3A3C A;  3I3V A;  4FEC A;  4LQ5 A;  4QRZ A;  4DZ1 A;  3QYT A;  3PUX E;  1TXF A;  4G8H A;  3PPN A;  3LSX A;  3UIF A;  4ZEK A;  1DPE A;  4IY5 A;  5BUU A;  1OIB A;  3VLW A;  3ILT B;  3KSX A;  1R9L A;  4P0I A;  4TLM B;  2QSX A;  4NWC A;  4BDL A;  2GH9 A;  1PEB A;  2DE2 A;  2RC7 A;  3PUY E;  3TEL A;  2F78 A;  4YMA A;  5EHS A;  1MY1 A;  3E9X A;  4GVO A;  4U4X A;  2O6A A;  3LBS A;  3Q27 A;  3E13 X;  3FJM A;  1S7Y A;  4ESX A;  3TFL A;  3TZA A;  1H45 A;  4O3A A;  3B6T A;  3MPL A;  1O64 A;  2CZL A;  3KG2 A;  3V5A A;  3HV1 A;  3VXC A;  3QSL A;  4I62 A;  3N26 A;  4YKI A;  5LOM A;  1NNT A;  3CR9 A;  4WED A;  4P11 A;  4O3B A;  5AA2 B;  1QJM A;  3MW0 A;  5H8H A;  5CMB A;  4E0X A;  2Z22 A;  5TU0 A;  1B3G A;  3R7X A;  1XVX A;  3Q28 A;  3UA8 A;  1US5 A;  4G68 C;  5I58 B;  5I2N A;  4MLV A;  3H4Z A;  4HW8 A;  1IZ1 A;  5IKB A;  5ITO A;  4QFP A;  2GHB A;  1WDN A;  1MPC A;  1A54 A;  2PX1 A;  3KFM A;  1SYH A;  4IO7 A;  1Y1Z A;  5L8D A;  1MQI A;  2XXH A;  3TYH A;  3MVZ A;  4I1D A;  4OFJ A;  1NNK A;  3FD3 A;  5KDT B;  1USY H;  2PT1 A;  3BFT A;  1B1H A;  3VVE A;  4GOT A;  5JK4 A;  4KR5 A;  3MBP A;  1FTO A;  1B58 A;  2DVZ A;  2G93 A;  2V3Q A;  2B3B A;  4RPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...