1B2HA

Oligo-peptide binding protein complexed with lysyl-ornithyl-lysine
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
total genus 186
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b2hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b2hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b2hA02
4LZ7A 2YPNA 4XKPA 1BKAA 1F9BA 3MVWA 2F8DA 4EXLA 3IOTA 5FTHA 4F18A 3IX1A 3U94A 1Y3QA 3OO7A 3T9HB 3H6WA 1MXXA 4QRZA 3GZGA 2HFBA 1Y4CA 4EQ9A 2I6EA 3SEUA 1PB7A 3PGFA 1O7TA 2NXOA 4BDRA 4F22A 3Q28A 4G68A 4ELOA 2F36A 4Z0IA 5KCJB 3M3KA 4UA8A 3TCHA 4KYEA 4YKIA 2QMWA 3ODBA 1XHYA 3IORA 4KPTA 4MLVA 4O3CA 1R9LA 4PE5B 4GXAA 5EHMA 3PD9A 1M5FA 4PFUA 3ZS6A 4Q8RA 5JTYB 4DE8A 1XS5A 3HV1A 2QS1A 3IJOB 5CMBA 4ELQA 5JTYA 1OQGA 3MC2A 3QUFA 3CFZA 4R6KA 1B05A 4GL8A 2I48A 3MZBA 4WEPA 5H8SA 4K3FA 1N7WA 3KN8A 4KYSA 4GIZA 4YB7A 3LUYA 2H98A 5JK4A 1MPBA 2E1SA 3CI8A 2IEEA 2W7YA 1FTMA 1UTHB 3MVYA 1Z7ME 1MXVA 3T9XB 3SETA 4ECFA 2A5TB 4NWDA 3TUSA 5CBSA 1VSOA 1B1XA 1ZJLA 3VLUA 1MDP1 1RKMA 3MUQA 1ZBMA 3ILUB 5EYFA 3IK6B 1EZOA 4OETA 3Q25A 3TTKA 3N5LA 4R74A 4OENA 2F78A 5I56B 1US4A 2PT2A 3D4CA 4GOTA 2ZMBA 5CI5A 2RC7A 3CG1A 4TOZA 4F39A 3BFUA 4ZEIA 4OFOA 4RK2A 4H8IA 4BDOA 3CIJA 3R26A 2VP1A 1VR5A 4FIMA 2DVCA 3TFLA 3I6VA 3PPNA 2Q89A 4H8JA 1FCKA 3LSLA 2XX9A 3VVFA 1QJMA 4RY1A 2LAOA 4QFKA 3K02A 2UYEA 3H6VA 3MQ9A 3L6HA 3RT8A 3PUYE 1LAGE 1FTJA 2P2AA 5ICQA 2FYIA 2VGQA 2V3TA 2RC8A 1MH3A 3FZVA 3MVXA 2I49A 4BDQA 2H9BA 2Q2AA 2ONSA 1FQAA 5I57B 3DLNA 4KI0E 4N13A 3FJGA 1FQBA 3C36A 1ELJA 3C9HA 4JBZA 5H8NB 4DXUA 4R75A 4OTEA 4OHNA 4X9TA 3KN3A 3V5AA 4U2RA 1MDQA 4KFQA 2X7QA 2F7BA 1DTGA 1USYE 1UTBB 4POXA 3IOUA 2RF1A 4I9DA 3EHTA 4OYVA 3IJXB 2FNCA 2HQ0A 1ZU0A 4TLLB 1PBPA 1UTBA 3VLWA 1CB6A 1NH8A 2XXVA 2XXIA 1H76A 2R6GE 3JV9A 4PP0A 3EQ1A 3S9LC 1B7UA 4PFWA 5I58B 4MLQA 4BDNA 4LA9A 4QSDA 2VD2A 4H5FA 1B4ZA 3H6TA 3TTMA 3PPPA 2Z8DA 4F19A 2HAUA 4L17A 4NF4B 5L9SA 3QK6A 4MF3A 3FXQA 1MY0A 1YCJA 4F31B 1SYIA 2Z23A 1T0KA 2NOOA 1B0HA 3TQLA 1WODA 1S7YA 1N84A 2Y7IA 4ESXA 3IO4A 1URDA 2CMOA 1TFDA 4GRKA 4ZEFA 5I2NA 4POWA 4OZ9A 1B2HA 1H43A 4IO7A 1MQGA 3O6IA 3VFJA 3T9UA 3OOAA 1MY1A 4ELPA 3RNNA 4R9GA 4FECA 2V3QA 1H44A 4LVQA 4ELRA 3IR1A 5M2VA 1Q35A 1Q1KA 3QYTA 4JSDA 1DSNA 1NNKA 3UIFA 4I62A 3RYAA 2XXWA 2PX1A 3C34A 5ELVA 1B46A 2Y7WA 2QMXA 1JEVA 5HM4B 3MAMA 3QSLA 4IB2A 2OWTA 2QL3A 3KFMA 3FTOA 3VLVA 1NH7A 2Z8FA 2XHDA 1IZ1A 3A3UA 2IA4A 1MQHA 3G7WA 3D4GA 2O51A 5TPAB 1NNPA 3FV1A 1ZMGA 4M1VA 4LATA 1LBCA 1OVBA 1USYH 2M8CA 5TPAA 1Z7NE 5L9MA 3FVOA 2OLBA 4NF6A 5DTBA 5B7DA 1BP5A 1B0LA 3QIMA 2B65A 1JETA 1Y4TA 3MJNA 3M8UA 2I3WA 3FXRA 3O6GA 3DM0A 3PPQA 4NWCA 3ZKKA 5I2KA 1LAXA 2H99A 1NMUA 1IUDA 2QS2A 2DOJA 3G3IA 3GBBA 3V8XB 2B3FA 5DVIA 1FQDA 1EZ9A 3O66A 4H1XA 3WAEA 1PB8A 3K1MA 4YKPA 4F29A 2VHAA 3CHGA 3TZAA 1SI1A 4JWXA 2AL4A 3LBSA 3K0VA 4HTGA 1M5CA 5ITOA 5HPQA 4YB5A 1IXIA 4NTLA 3G3JA 3SESA 3PUZE 2XX7A 1IXHA 1JVYA 2REJA 3HHFA 5L8DA 4YB6A 4XXUA 3EN3A 4RJZA 1IXCA 1PEBA 3RLFE 3PUWE 5FHOA 1MY3A 3C33A 5F7VA 3VV5A 3ZKLA 2XXPA 1UIVA 2I0BA 2XX8A 2OWSA 5TU0A 2DXYA 3FJMA 2XXRA 1WVJA 3A3CA 3W9WA 4YKKA 2ONRA 3OEKA 2DSFA 4ZE8A 2DQVA 2GFEA 1XVXA 2D5WA 3OELA 3RT6B 3CG3A 1MXYA 3KZGA 1FTKA 4RK9A 1B51A 3KJ7A 3TKDA 1US5A 5KCJA 3C4MA 2RC9A 3N6UA 2GHBA 3UA8A 2VD3A 2WOPA 3V83A 4ZZEA 3TAJA 4JSOA 1UIUA 1MQJA 1Y20A 1II5A 3TELA 4NF8B 4GL0A 3PUVE 2UVIA 4KYDA 1MY4A 1D3KA 2XXHA 1P1OA 4X48A 3SEXA 1M5BA 2F5XA 1NL5A 2PVUA 2ONKE 5AA2D 1R6ZA 3FGSA 3QAXA 4N07A 2XD2A 2UVGA 3O2AA 1R9QA 4G2ZA 2OK2A 3PV0E 4MH5A 1J1NA 2G29A 2R71A 1MQDA 2XXUA 4IO3A 5CBRA 2H5YA 2F97A 4F2OA 3IOWA 2ZXTA 5CMCA 1A8FA 4H6DA 1TT1A 5JEIA 3DRGA 4Q5TA 2I58A 4IO4A 3HHGA 2XXYA 1MH4A 1SD3A 1UTHA 1DOTA 4JXIA 1P99A 1M5EA 2XXQA 2A5TA 2O84X 1QW0A 1QULA 1MXZA 2DWAA 1N76A 4KHZE 3FIRA 3R6UA 3RY3A 1GVCA 3N94A 2UXAA 1XC1A 3E4RA 1AOVA 3TCGA 3RN8A 2HZKA 1SW1A 2D3IA 5J1DA 3RQTA 2G93A 4XTCQ 5I56A 3OD7A 3OO9A 3KSXA 3OENA 3E3KA 2FA7A 5TP9B 1Y1ZA 3TPAA 4LONB 1SQYA 2A5SA 1B6HA 2DWHA 2ZNSA 4LUBA 1MRPA 2OZZA 2WKYA 4EDPA 4TLMB 4ONYA 3DP8A 3PMVA 4YMAA 3MPKA 1B3GA 3KGCA 5KDTB 3EHUA 4PETA 4JB7A 2UVHA 3G3FA 3PMXA 4IO2A 3DP6A 1M5DA 1SVXB 3G3GA 4RPNA 2Z8EA 1LCFA 2Q9TA 1B3FA 1OLAA 3KOSA 1N3XA 5I57A 3OXNA 1JVXA 3DRJA 2P1SA 4IGTA 3HN0A 2DWIA 1N7XA 4NE4A 1LAHE 3CFXA 5H8NA 1DMBA 3KN7A 2QS4A 3ONMA 1XOCA 4YKJA 5KZTA 4LQ5A 2DP8A 1L5TA 1AIVA 4EUOA 2DE4A 4IY5A 5H8HB 3S9MC 1ZTYA 3L6GA 3S9EA 1N0TA 4FJPA 3OSRA 3W9VA 2XXTA 5H8HA 4I1DA 2UVJA 3VVEA 3IB1A 4FEDA 3AXFA 3UGWA 2PYYA 3G3KA 5I58A 4Q30B 2F6GA 2O69A 5H8FB 3TTRA 4ZZAA 1I69A 2VOZA 3MP8A 1H45A 3PD8A 4R6HA 3RYBA 2ZNTA 1A8EA 3SEYA 1VE4A 4G8HA 5H8FA 1IITA 4OWDA 1FTOA 4NF4A 3O9PA 2Y7RA 3LSXA 1MXUA 4H0WA 1UQWA 3G3HA 1B40A 4BLAA 4C1UA 4PFTA 1JQFA 3CRBA 3M3LA 3K6UA 4U1OA 5AA1A 3BFTA 3SEWA 4PQJA 4DXCA 3SKPA 3PAMA 1BIYA 1VFEA 4YAHX 4QFPA 1VFDA 5H8QB 3Q29A 4NEDA 1SYHA 5CM6A 1I6BA 3USDA 4G8NA 4ZE9A 1H3DA 2WOKA 3E9XA 4DCXA 1GGGA 3TTLA 5H8QA 3C32A 4KCCA 2V93A 1IXGA 2O1LA 4JWOA 3KSJA 4ESWA 1XT8A 4U1ZA 2NVUB 3A09A 4LZ5A 1SDXA 1JNFA 2R9JA 2F7CA 4OXVA 1TXFA 4AB5A 3LSFB 2V3UA 3CSGA 4GWOA 4XIGQ 3HO7A 1LGBC 2ZNUA 4P11A 3FVGA 3UN6A 3C31A 5A5XB 1B5JA 2F7AA 1JW1A 3FD3A 3CVGA 1IQ7A 4GD5A 1B9JA 2X7PA 4HCYA 4XKRA 2XD3A 4DIGA 4DCYA 3KOTA 2GRVA 3EPEA 5CRYA 1FQCA 4U21A 5HBCA 2QJEA 3W15C 4QHQA 1RYOA 4DDDA 1I6QA 1SW5A 4QF9A 3U93A 3O6HA 4F2QA 5B70A 1YPNA 5ISUA 1IIWA 2HAVA 1ANFA 1SI0A 3U1OA 3TTNA 5L9OA 2HCAA 3B7DA 4FE8A 1A54A 3K4UA 3MVZA 4KQPA 5BUUA 4IO5A 2F6PA 1PBQA 4XKNA 3IOVA 1ZKBA 4R72A 2AL5A 3MP6A 4JDFA 5AA2B 4RPOA 5LOMA 1PB9A 1LFIA 4GFRA 3S2VA 3Q26A 4OQOA 3GLBA 2ALUA 3N26A 4THIA 4ND9A 4OEVA 3PPRA 3I5OA 1QUIA 2OJTA 4U23A 1P1NA 3DELB 4C0RA 3RUMA 3K6VA 4ZDMA 3R7XA 3TEPA 3ZSFA 4UACA 3FVNA 4BDMA 1GTKA 3T9VA 2WOLA 1D9VA 1AMFA 1PDAA 2O7IA 2REGA 5I59B 4YU0A 1OLCA 5F1QA 2CZLA 4GF8A 1A55A 3K00A 3V89B 1FW0A 3VVDA 5I59A 4LP2B 2O6AA 4R73A 4G68B 5IKBA 4X1BA 2HXWA 3OO8A 3E13X 3GBAA 1A7LA 2E0SA 1AH5A 1HSJA 1MXWA 4U22A 1DPPA 3K01A 4G77A 3BBRA 3TQWA 3MZ9A 2B3BA 2ESNA 1N3WA 4P0IA 3RTFB 1IEJA 3QXMA 1NKXA 3B6TA 3PU5A 3RTWB 4NF8A 4X1DA 1PC3A 2B4LA 2B4MA 3U92A 1SW2A 1D9YA 1NNFA 2YJPA 1RYXA 3BKIB 1FQEA 2Z22A 4IGRA 1BTJA 4R2BA 4KR5A 4MBPA 5DT6A 4MFIA 5ITPA 4ZEDA 3K6WA 4WKMA 3I3VA 1B5HA 3ILTB 1GV8A 1SW4A 2YLNA 2BJJX 4OFLA 2DYXA 4F3SA 1QKBA 3O97A 5AA3A 4U4SA 2V25A 1QUJA 1MM7A 4JWYA 4O3BA 1KWHA 3FJ7A 2ZYNA 1P1UA 3H7MA 3O29A 3JYRA 4DZ1A 4F3BA 1LCTA 2P0SA 1B32A 4F1YA 3MZ1A 1FTLA 4PFYA 3DRIA 3MP1A 4OFJA 2AIXA 5DVJA 3B6WA 3DP4A 1MG1A 1URGA 5CMMA 2THIA 1ATGA 3ECRA 2QSXA 2I4CA 3O28A 3DRHA 2ANJA 1MY2A 3SDFA 5CC2A 1B4HA 4YZZA 1NFTA 3VXCA 4TQUQ 1QVSA 1POTA 1JW5A 4KCDA 1OIBA 2RCAA 1A99A 4EQ7A 2HZLA 5TP9A 4IY6A 2H25A 4H65A 4QSCA 4WXJA 1JEUA 1WDNA 2KLFA 3RPWA 2I4BA 4EQBA 1MQIA 4ZECA 1POY1 3OO6A 4I8CA 1DPEA 4Q0CA 1MM6A 2NUVA 5DYHA 3C35A 4EF2A 3OMBA 3KG2A 3H3GA 3CR9A 3K1NA 5FTIA 3UORA 4YICA 5KDTA 3TDJA 4H67A 4C1TA 2RKMA 4QFLA 1LLSA 4F1VA 5AA4B 1B3HA 4IO6A 2I0CA 1YAEA 3HSTA 3PUXE 2DE2A 2DWJA 4DXBA 1B58A 1P1QA 5IAIA 3FXUA 4OERA 3FATA 3TODA 5AA4A 3UP9A 1LSTA 2DXRA 3TCFA 4P0GA 5AE4A 1JW4A 1BLFA 5FHMA 4R2FA 1FQFA 1MPDA 3IB2A 4ZS9A 1Y9UA 1ZLQA 2RINA 4ZEKA 3Q27A 3P7IA 3U8QA 1LFGA 3M3FA 5DEXB 2UYFA 3IB0A 3IL1B 3JZJA 4HS7A 3TYHA 3N6TA 2RCBA 1R1NA 1B3LA 2ABHA 1OVTA 4RXLA 4N6PA 2O7UA 1QUKA 4ISUA 1B52A 5DEXA 2ZYKA 3WAFA 2NWJA 1EH3A 1LFHA 4R9FA 4QFNA 2XXXA 1LAFE 4GQOA 3T22A 1TFAA 4RNSA 3S9NC 1Y3NA 1URSA 4U4XA 3T66A 3S4UA 3KBRA 3K6XA 3OEMA 5CMKA 3QUJA 3B6QA 4AB6A 3H4ZA 4M4GA 5I84A 2PT1A 1OMPA 4HW8A 4H5GA 2DS9A 3UK4A 3LSWA 4KD5A 2X26A 2O1MA 4GVOA 3SEVA 4E0WA 1ZIUA 1SBPA 1N04A 2V84A 2F34A 4G68C 5K2XA 1HSEA 3FUZA 3RGYA 1YTVA 3HCQA 4QSEA 5I2NB 4E0XA 3T96B 1EU8A 2HEUA 3CFLA 1Y1MA 1A40A 1B1HA 4OVJA 2Q88A 1B7ZA 5BWJA 2ZYOA 2OBGA 2GHAA 2PMSA 2AYSA 2PBWA 3MBPA 4G8MA 1MPCA 4AQ4A 3IO6A 3VE1B 2DVZA 4ZEBA 3DRKA 3MWBA 1Y3PA 3SERA 3F11A 3PPOA 1D4NA 2Q2CA 1NNTA 4EXKA 4DLDA 4F1UA 3O6PA 5K2YA 4WEDA 1MS7A 2I3VA 3H03A 2QPQA 3PMWA 4XKQA 1TWYA 4GLIA 4LZ8A 2OCUA 4OESA 1O63A 1B7HA 2Y84A 1OQHA 2D21A 2Y7PA 4NF6B 4FORA 4OMBA 2Q8JA 1LB9A 3U72A 5EHSA 1P1WA 3DRFA 2H4IA 1EZPA 4FATA 4O3AA 4FEBA 3THIA 4F3GA 5I2KB 1CE2A 5A5XA 1HSLA 4GXSB 5DVFA 4HCWA 4OEUA 1AL3A 3KEIA 3EHSA 4QFOA 2Y7KA 1DTZA 3IAZA 5ICTA 3MPLA 3VDFA 3FVKA 3TMGA 1S9TA 3MW0A 4EF1A 4BDLA 1LB8A 2DE3A 1QKAA 4RA1A 4Z7EA 4R6YA 3H06B 4LQ2A 3CSBA 3K2DA 2QS3A 3VXBA 3FASA 3GXAA 4FAJA 3K1PA 3OSQA 4G4PA 3H6UA 3EF7A 1B5IA 1GR2A 1LBBA 4NF5B 3LVUA 1B3EA 2F35A 1I6AA 4NMYA 3T93B 1S50A 3LR1A 1O64A 3FV2A 5AA2A 4YMBA 3KJTA 4NF5A 2QRYA 2O68A 2GH9A 1XVYA 3LC8A 5FHNA 3HPIA 2ZYMA 4F3PA 4RYAA
chains in the Genus database with same CATH superfamily
4LZ7A 4H45A 2YPNA 4MNPA 5IGAA 3EKIA 4XKPA 1BKAA 1F9BA 3MVWA 2QVVA 5A5LA 2F8DA 3GYYA 1FBGA 4EXLA 4P1LA 3IOTA 5FTHA 4F18A 3IX1A 3U94A 1Y3QA 3OO7A 5EYHA 3T9HB 1IMAA 3H6WA 1MXXA 4QRZA 3GZGA 1QGXA 1G0HA 2HFBA 1Y4CA 4EQ9A 4N4UA 2I6EA 3SEUA 2DDKA 1PB7A 2PCRA 3PGFA 5ESYA 1O7TA 2NXOA 4BDRA 4F22A 3Q28A 4G68A 4ELOA 2F36A 4Z0IA 5KCJB 3M3KA 4UA8A 3TCHA 3E78A 4KYEA 4YKIA 2QMWA 3ODBA 1KA1A 2BJIA 1XHYA 3IORA 2CZKA 4KPTA 4MMPA 4MLVA 4O3CA 1R9LA 4PE5B 4GXAA 5EHMA 3PD9A 1LBXA 1M5FA 4PFUA 3ZS6A 4Q8RA 5JTYB 4DE8A 4N6KA 1XS5A 3HV1A 2QS1A 3IJOB 5CMBA 4ELQA 5JTYA 1OQGA 3MC2A 3QUFA 3CFZA 4R6KA 2VPOA 1B05A 4GL8A 4GWWA 2I48A 3MZBA 4WEPA 5H8SA 4K3FA 1N7WA 3KN8A 1FJ6A 4KYSA 4GIZA 4YB7A 3LUYA 2H98A 2WX9A 5JK4A 1BK4A 1MPBA 2E1SA 3CI8A 1IMCA 2IEEA 2W7YA 1FTMA 1UTHB 3MVYA 1Z7ME 1MXVA 4P8BA 3T9XB 3SETA 4ECFA 5EQAA 2A5TB 4NWDA 3TUSA 5CBSA 1VSOA 1B1XA 1ZJLA 3VLUA 1MDP1 1RKMA 3MUQA 1ZBMA 3ILUB 5EYFA 2ZZVA 3IK6B 1EZOA 4OETA 3Q25A 1NV3A 3TTKA 3N5LA 4R74A 4OENA 2F78A 3D1RA 3MYUA 1US4A 5I56B 2Y5LA 4DI4B 2PT2A 3D4CA 4PDHA 4GOTA 2ZMBA 5CI5A 2P3VA 2RC7A 3CG1A 4TOZA 4N91A 4F39A 3BFUA 4ZEIA 4OFOA 4RK2A 4H8IA 4BDOA 3CIJA 3R26A 2VP1A 4P1EA 1VR5A 3LUZA 4XF5A 4FIMA 2DVCA 3TFLA 3I6VA 3PPNA 4XEQA 2Q89A 2XWKA 4H8JA 1FCKA 3LSLA 2XX9A 4JVDA 3VVFA 1QJMA 4RY1A 2LAOA 4QFKA 4X8RA 3K02A 2HPGA 2UYEA 3H6VA 3MQ9A 3L6HA 3RT8A 2FHYA 3PUYE 1LAGE 1FTJA 2PFZA 4XFEA 2P2AA 4N6DA 5ICQA 2FYIA 2VGQA 1RDXA 2V3TA 2RC8A 1MH3A 3FZVA 3MVXA 2I49A 4BDQA 2H9BA 2Q2AA 2ONSA 1FQAA 5I57B 3DLNA 4KI0E 4N13A 3FJGA 1FQBA 3C36A 1ELJA 3C9HA 1FPLA 5I5PA 4JBZA 4QXDA 5H8NB 4DXUA 4R75A 4OTEA 4OHNA 4X9TA 3KN3A 3V5AA 4U2RA 1MDQA 4KFQA 2X7QA 2F7BA 1DTGA 1FPJA 1USYE 1UTBB 4POXA 4NHBA 1FPKA 3IOUA 2RF1A 4I9DA 3EHTA 4OYVA 3IJXB 2FNCA 2HQ0A 1ZU0A 4N15A 4TLLB 1PBPA 4O94A 1YZ0A 1UTBA 4GWZA 3VLWA 5EYGA 1CB6A 1NH8A 2XXVA 2XXIA 1H76A 2R6GE 3JV9A 4PP0A 3EQ1A 2QVRA 3S9LC 1B7UA 4PFWA 5I58B 4MLQA 4BDNA 1FPGA 4OANA 4LA9A 4QSDA 1LBYA 2VD2A 4H5FA 2FIXA 1B4ZA 3H6TA 3TTMA 3PPPA 2Z8DA 4F19A 2HAUA 1FBEA 4L17A 4NF4B 5L9SA 3QK6A 4MF3A 3FXQA 1MY0A 1YCJA 4F31B 1SYIA 2Z23A 1T0KA 1NV4A 2NOOA 2P3NA 1B0HA 3TQLA 1WODA 1S7YA 1N84A 2Y7IA 4ESXA 3IO4A 1URDA 2CMOA 1TFDA 4GRKA 4ZEFA 5I2NA 4POWA 4OZ9A 1B2HA 4HXVA 1H43A 4IO7A 1MQGA 3O6IA 3VFJA 1K9YA 3T9UA 3OOAA 1MY1A 4ELPA 3RNNA 3LV0A 4R9GA 4N8GA 4FECA 2V3QA 1H44A 4LVQA 4ELRA 3IR1A 5M2VA 1Q35A 1Q1KA 2FVZA 3QYTA 4O8MA 4JSDA 1DSNA 1NNKA 3UIFA 4I62A 1IMFA 3RYAA 2XXWA 1FJ9A 2PX1A 3C34A 5ELVA 3SZPA 1B46A 2Y7WA 2QMXA 1JEVA 5HM4B 3MAMA 3QSLA 4IB2A 2OWTA 2QL3A 3KFMA 3FTOA 3VLVA 1NH7A 2Z8FA 2XHDA 1IZ1A 3A3UA 2IA4A 1MQHA 3G7WA 3D4GA 2O51A 5TPAB 1NNPA 4PTKA 3FV1A 1ZMGA 2Y5KA 4M1VA 4LATA 1LBCA 1OVBA 1USYH 2M8CA 5TPAA 5LTCA 1Z7NE 5L9MA 3FVOA 2OLBA 4NF6A 5DTBA 5B7DA 5J16A 1BP5A 1B0LA 3QIMA 2B65A 1JETA 1Y4TA 3MJNA 3M8UA 2I3WA 3FXRA 3O6GA 3DM0A 3PPQA 4NWCA 3ZKKA 5I2KA 4P9KA 1LAXA 2H99A 1NMUA 1IUDA 1NUXA 2QS2A 3ROJA 2DOJA 1EYIA 3G3IA 3GBBA 4N17A 3V8XB 4OA4A 2B3FA 3PTYA 5DVIA 1FQDA 1EZ9A 3O66A 4H1XA 3WAEA 4PGNA 1PB8A 3K1MA 4YKPA 4F29A 2VHAA 3CHGA 3TZAA 1SI1A 4JWXA 2AL4A 3LBSA 3K0VA 4O7IA 4HTGA 1M5CA 4G61A 5ITOA 5HPQA 4YB5A 1IXIA 4NTLA 3G3JA 3SESA 3PUZE 2XX7A 1IXHA 1JVYA 4O7MA 2REJA 3HHFA 1LBVA 4KXPA 5L8DA 4MIJA 1Q9DA 4YB6A 4XXUA 3EN3A 4MJOA 4RJZA 1IXCA 1PEBA 3RLFE 3PUWE 5FHOA 1FPEA 1MY3A 3C33A 5F7VA 3VV5A 2WBDA 3ZKLA 2XXPA 1UIVA 2I0BA 2XX8A 2OWSA 5TU0A 2DXYA 3FJMA 2XXRA 1WVJA 3A3CA 3W9WA 4YKKA 2ONRA 3OEKA 2DSFA 4ZE8A 2DQVA 2GFEA 1XVXA 4NQ8A 2D5WA 4GWSA 3OELA 3RT6B 3CG3A 1MXYA 3KZGA 3FBPA 1FTKA 4RK9A 4AS4A 2JJKA 1LBZA 1B51A 3KJ7A 3TKDA 1US5A 5KCJA 3C4MA 2RC9A 3N6UA 2GHBA 3UA8A 2VD3A 2WOPA 3V83A 4ZZEA 3TAJA 4JSOA 1UIUA 1MQJA 1Y20A 1II5A 1AWBA 3TELA 4NF8B 4GL0A 3PUVE 2UVIA 4KYDA 1MY4A 1D3KA 2XXHA 1P1OA 4X48A 3SEXA 1M5BA 2F5XA 5EQ7A 1NL5A 2PVUA 3KC0A 2ONKE 5AA2D 1R6ZA 3FGSA 3QAXA 4N07A 2XD2A 2UVGA 3O2AA 1R9QA 4G2ZA 2OK2A 3PV0E 4MH5A 1J1NA 2G29A 2CEXA 2R71A 1MQDA 2XXUA 3NOHA 4IO3A 4MX6A 5CBRA 2H5YA 4MEVA 2F97A 4F2OA 3IOWA 2ZXTA 5CMCA 1A8FA 4H6DA 1TT1A 4MAGA 5JEIA 3DRGA 4Q5TA 2I58A 2CEYA 3HFUA 4IO4A 3T0JA 3HHGA 2XXYA 1MH4A 1SD3A 1UTHA 1DOTA 4JXIA 4PGPA 1P99A 1M5EA 2XXQA 2A5TA 4UABA 2O84X 1QW0A 1QULA 1MXZA 4QBAA 3B50A 3RPLB 2WBBA 2DWAA 1N76A 4KHZE 3FIRA 3R6UA 3RY3A 1GVCA 3N94A 2UXAA 1XC1A 3E4RA 3RYDA 1AOVA 3TCGA 3RN8A 2HZKA 1SW1A 2D3IA 5J1DA 3RQTA 2G93A 1NV5A 4XTCQ 4GWYA 4NGUA 5I56A 3OD7A 3OO9A 3KSXA 3OENA 3E3KA 2FA7A 5TP9B 1Y1ZA 3TPAA 4HE0A 4NG7A 4LONB 1SQYA 2A5SA 1B6HA 1NV7A 2DWHA 2ZNSA 1FBPA 2WEFA 2F3BA 4LUBA 1MRPA 2OZZA 2WKYA 4NX1A 4EDPA 4TLMB 2R8TA 4ONYA 3DP8A 3PMVA 2XWOA 4YMAA 3MPKA 1B3GA 3KGCA 5KDTB 3EHUA 4PETA 4JB7A 1IMEA 2UVHA 3G3FA 3PMXA 4IO2A 3DP6A 1M5DA 1SVXB 3G3GA 4RPNA 2Z8EA 2VT5A 4X04A 1LCFA 1FBFA 2Q9TA 5IZZA 1B3FA 5DW8A 1OLAA 2CZIA 2HHMA 3KOSA 1N3XA 5I57A 3OXNA 1JVXA 3DRJA 2P1SA 5ET5A 4IGTA 3HN0A 2DWIA 1N7XA 4NE4A 1LAHE 3CFXA 5H8NA 1CNQA 1DMBA 4OVSA 3KN7A 2QS4A 2XA5A 3ONMA 1XOCA 4YKJA 5KZTA 4LQ5A 2DP8A 1L5TA 1AIVA 4EUOA 2DE4A 4IY5A 5H8HB 5IZ1A 1ZTYA 3S9MC 3L6GA 3S9EA 1N0TA 1NUYA 1FRPA 4FJPA 3OSRA 3W9VA 2XXTA 5H8HA 4PF6A 4I1DA 1JP4A 2UVJA 5T3JA 3VVEA 3IB1A 4FEDA 3AXFA 5I3SA 3UGWA 2PYYA 3G3KA 4P3LA 5I58A 4Q30B 2XWVA 2F6GA 2O69A 5H8FB 3TTRA 4ZZAA 1I69A 1FBDA 2VOZA 3MP8A 4PAFA 1H45A 3PD8A 4R6HA 3RYBA 2ZNTA 1A8EA 3SEYA 1VE4A 4G8HA 5H8FA 1IITA 4OWDA 1FTOA 4NF4A 3O9PA 2Y7RA 3LSXA 1MXUA 4H0WA 1NV0A 1UQWA 3G3HA 1B40A 4BLAA 4C1UA 2MKZA 4PFTA 4NN3A 5I7IA 1JQFA 3CRBA 3M3LA 4PF8A 3K6UA 4U1OA 5AA1A 3BFTA 3SEWA 5LDZA 5ET7A 4PQJA 4DXCA 3SKPA 1VDWA 3PAMA 1BIYA 1VFEA 4YAHX 4QFPA 1VFDA 5H8QB 3Q29A 4NEDA 1SYHA 2XXKA 5CM6A 1I6BA 3USDA 4G8NA 4ZE9A 1H3DA 2WOKA 3E9XA 4DCXA 1GGGA 3TTLA 5H8QA 3C32A 4KCCA 2V93A 1IXGA 2O1LA 4JWOA 3KSJA 4P56A 4ESWA 1XT8A 4JVIA 4U1ZA 2NVUB 3A09A 4LZ5A 1SDXA 1JNFA 3BIGA 4PAKA 2R9JA 2F7CA 4OXVA 1TXFA 3KC1A 4AB5A 1YYZA 3B8BA 3LSFB 2V3UA 3CSGA 4GWOA 4XIGQ 4PFIA 3HO7A 4MCOA 1LGBC 2ZNUA 4P11A 3FVGA 5F24A 3UN6A 3C31A 5A5XB 1B5JA 2F7AA 1JW1A 3FD3A 3CVGA 1IQ7A 4GD5A 1B9JA 2X7PA 4HCYA 4XKRA 2XD3A 4DIGA 4DCYA 3KOTA 2GRVA 3EPEA 5CRYA 4FBPA 1FQCA 4U21A 5HBCA 2QJEA 3W15C 4QHQA 1RYOA 4DDDA 1I6QA 4GX4A 1SW5A 5EQ8A 4QF9A 3U93A 3O6HA 4F2QA 5B70A 1YPNA 4PCDA 5ISUA 1IIWA 2HAVA 1ANFA 1SI0A 3U1OA 3TTNA 5L9OA 2HCAA 3B7DA 4FE8A 1A54A 3K4UA 3MVZA 4KQPA 5BUUA 4IO5A 4PFBA 2F6PA 1PBQA 4XKNA 3IOVA 1ZKBA 4R72A 2AL5A 3MP6A 4JDFA 5AA2B 4RPOA 5LOMA 1PB9A 1LFIA 4GFRA 3S2VA 3Q26A 1IMDA 4OQOA 3GLBA 2ALUA 3N26A 4THIA 4ND9A 4OEVA 3PPRA 3I5OA 1QUIA 2OJTA 3QMFA 4U23A 1P1NA 3DELB 4OVPA 4C0RA 3RUMA 3K6VA 4ZDMA 3R7XA 3TEPA 3ZSFA 4UACA 3FVNA 4BDMA 1GTKA 3T9VA 2FIEA 2WOLA 1D9VA 1AMFA 1PDAA 2O7IA 2REGA 5I59B 4YU0A 1OLCA 5F1QA 2CZHA 2CZLA 4GF8A 4MNIA 1A55A 3A29A 3K00A 3V89B 1FW0A 3VVDA 5I59A 4LP2B 2O6AA 4R73A 4G68B 5IKBA 4X1BA 1FPIA 2HXWA 3OO8A 3E13X 3GBAA 1A7LA 2E0SA 1AH5A 1HSJA 1MXWA 4U22A 1DPPA 3K01A 4G77A 5IM2A 3BBRA 3TQWA 3MZ9A 2B3BA 2WYPA 2QVUA 2ESNA 1KZ8A 1N3WA 4P0IA 1FTAA 3RTFB 1IEJA 3QXMA 1NKXA 4DI3D 3B6TA 2ZZWA 5EQ9A 3PU5A 3RTWB 4NF8A 4X1DA 1PC3A 2B4LA 2B4MA 3U92A 3U65A 1SW2A 2WYKA 1D9YA 1NNFA 2YJPA 1RYXA 4JVCA 3BKIB 1FQEA 2Z22A 4IGRA 1BTJA 1FBCA 4R2BA 3FXBA 4KR5A 4MBPA 5DT6A 4MFIA 5ITPA 4ZEDA 3IFAA 1FPDA 4PFRA 3K6WA 4WKMA 3I3VA 1B5HA 1DK4A 1DCUA 3ILTB 1GV8A 1SW4A 2YLNA 4H46A 3E79A 2BJJX 4LN5A 4OFLA 2DYXA 4F3SA 1QKBA 3O97A 5AA3A 4U4SA 1RDYA 2V25A 4OVTA 1QUJA 1MM7A 4JWYA 4O3BA 1KWHA 3FJ7A 4PDDA 2ZZXA 2ZYNA 1P1UA 3ISPA 3H7MA 3O29A 3JYRA 4DZ1A 4F3BA 1LCTA 2P0SA 1B32A 3BIHA 4F1YA 3MZ1A 1FTLA 4PFYA 3DRIA 3MP1A 4GWUA 4OFJA 2AIXA 5DVJA 3B6WA 3DP4A 1MG1A 1URGA 1SPIA 5CMMA 2THIA 1ATGA 3ECRA 2QSXA 3IFCA 3RPLA 2I4CA 3O28A 4NF0A 3DRHA 2ANJA 1MY2A 1EYKA 3SDFA 5CC2A 1B4HA 4YZZA 1NFTA 3VXCA 4TQUQ 1QVSA 1POTA 1JW5A 4KCDA 1OIBA 2RCAA 1A99A 4EQ7A 2HZLA 5TP9A 4IY6A 2H25A 4H65A 4QSCA 4WXJA 1JEUA 1WDNA 4N8YA 2KLFA 3RPWA 2I4BA 4EQBA 1MQIA 4ZECA 1POY1 3OO6A 4I8CA 2V4CA 1DPEA 4Q0CA 4HE1A 1MM6A 2NUVA 5DYHA 1XI6A 1INPA 3C35A 4AS5A 4EF2A 3OMBA 3KG2A 3H3GA 3CR9A 3K1NA 5FTIA 3UORA 4YICA 4I3EA 5KDTA 1FPFA 3TDJA 4GWXA 4H67A 4C1TA 1DBZA 2RKMA 4QFLA 2GQ1A 1LLSA 4PE3A 4F1VA 5AA4B 1B3HA 4IO6A 2I0CA 1YAEA 3HSTA 3PUXE 2DE2A 2DWJA 4DXBA 1B58A 1P1QA 5IAIA 3FXUA 4OERA 2FBPA 3FATA 3TODA 4GX6A 1IMBA 5AA4A 2VPNA 3UP9A 1LSTA 2DXRA 3TCFA 4P0GA 5AE4A 1NV2A 1JW4A 1BLFA 5FHMA 4R2FA 1FQFA 1MPDA 3IB2A 1YXIA 4ZS9A 4GBWA 1Y9UA 2Q8MA 1ZLQA 2RINA 4ZEKA 3Q27A 3P7IA 3U8QA 1LFGA 3M3FA 1NV6A 5DEXB 2UYFA 3IB0A 3IL1B 3JZJA 4HS7A 3TYHA 3N6TA 2RCBA 1R1NA 1B3LA 2ABHA 1OVTA 4RXLA 4N6PA 2HXRA 2O7UA 1LEVA 1QUKA 4ISUA 2F3DA 1B52A 5DEXA 2ZYKA 3WAFA 2NWJA 1EH3A 1LFHA 4I3YA 4R9FA 4QFNA 1NV1A 2XXXA 5FBPA 1LAFE 4GQOA 3T22A 1TFAA 4RNSA 3S9NC 1Y3NA 2PFYA 1URSA 4U4XA 3T66A 3S4UA 3KBRA 3K6XA 4I40A 4NAPA 3OEMA 5CMKA 3QUJA 3B6QA 4AB6A 3H4ZA 4M4GA 5I84A 2PT1A 1OMPA 2Q74A 4HW8A 4H5GA 2DS9A 2KQZA 3UK4A 3LSWA 4KD5A 2X26A 2O1MA 4P47A 4GVOA 1K9ZA 3SEVA 4PC9A 4PBQA 4E0WA 1ZIUA 5IZ3B 4PBHA 2XWIA 1SBPA 1N04A 2V84A 2F34A 4G68C 5K2XA 1G0IA 1HSEA 3FUZA 1YTVA 3HCQA 3RGYA 4QSEA 5I2NB 4E0XA 3T96B 1EU8A 2HEUA 4MNCA 5IZ3A 3CFLA 1Y1MA 1A40A 4GX3A 1B1HA 4OVJA 2Q88A 1B7ZA 5BWJA 4OVQA 3KBZA 2ZYOA 2OBGA 2GHAA 2PMSA 2AYSA 2PBWA 3MBPA 4G8MA 1MPCA 1RDZA 4AQ4A 3IO6A 3VE1B 2DVZA 4IR8A 4ZEBA 3DRKA 3MWBA 1Y3PA 3SERA 3F11A 3PPOA 1D4NA 2Q2CA 1NNTA 2QFLA 4EXKA 2OX3A 1KA0A 4DLDA 4F1UA 3O6PA 1FPBA 5K2YA 4WEDA 1MS7A 2I3VA 3H03A 2QPQA 3PMWA 4XKQA 1TWYA 4GLIA 4LZ8A 2OCUA 4OESA 1O63A 1B7HA 2Y84A 2KR0A 1OQHA 5ET8A 2D21A 2Y7PA 4NF6B 4FORA 4OMBA 2Q8JA 1LB9A 4PAIA 3U72A 5EHSA 5ET6A 3T1BA 1P1WA 3DRFA 2H4IA 1EZPA 4FATA 4O3AA 1FSAA 4FEBA 3THIA 4F3GA 5I2KB 1CE2A 5A5XA 1HSLA 4GXSB 5DVFA 4HCWA 4OEUA 1AL3A 3KEIA 1NUWA 3EHSA 4QFOA 2Y7KA 1DTZA 1LBWA 3IAZA 5ICTA 3MPLA 3VDFA 3FVKA 3TMGA 1S9TA 3MW0A 2OWZA 4EF1A 4BDLA 1LB8A 2DE3A 1QKAA 4RA1A 4Z7EA 4R6YA 3H06B 1D9QA 4LQ2A 3CSBA 3K2DA 2QS3A 3VXBA 3FASA 4OVRA 1NI9A 3GXAA 4FAJA 3K1PA 3OSQA 4G4PA 3H6UA 3EF7A 1NUZA 1B5IA 1GR2A 1LBBA 4NF5B 3LVUA 1B3EA 2F35A 2L5VA 1I6AA 4NMYA 1EYJA 4GBVA 3T93B 1S50A 3LR1A 1O64A 3FV2A 5AA2A 4YMBA 3KJTA 4NF5A 2QRYA 2O68A 2GH9A 1XVYA 3MSTA 3LC8A 5FHNA 4MHFA 4HE2A 3HPIA 1FBHA 4N81A 2ZYMA 4F3PA 4RYAA
chains in the Genus database with same CATH topology
4LZ7A 2YPNA 4XKPA 1BKAA 1F9BA 3MVWA 2F8DA 4EXLA 3IOTA 5FTHA 4F18A 3IX1A 3U94A 1Y3QA 3OO7A 3T9HB 3H6WA 1MXXA 4QRZA 3GZGA 2HFBA 1Y4CA 4EQ9A 2I6EA 3SEUA 1PB7A 3PGFA 1O7TA 2NXOA 4BDRA 4F22A 3Q28A 4G68A 4ELOA 2F36A 4Z0IA 5KCJB 3M3KA 4UA8A 3TCHA 4KYEA 4YKIA 2QMWA 3ODBA 1XHYA 3IORA 4KPTA 4MLVA 4O3CA 1R9LA 4PE5B 4GXAA 5EHMA 3PD9A 1M5FA 4PFUA 3ZS6A 4Q8RA 5JTYB 4DE8A 1XS5A 3HV1A 2QS1A 3IJOB 5CMBA 4ELQA 5JTYA 1OQGA 3MC2A 3QUFA 3CFZA 4R6KA 1B05A 4GL8A 2I48A 3MZBA 4WEPA 5H8SA 4K3FA 1N7WA 3KN8A 4KYSA 4GIZA 4YB7A 3LUYA 2H98A 5JK4A 1MPBA 2E1SA 3CI8A 2IEEA 2W7YA 1FTMA 1UTHB 3MVYA 1Z7ME 1MXVA 3T9XB 3SETA 4ECFA 2A5TB 4NWDA 3TUSA 5CBSA 1VSOA 1B1XA 1ZJLA 3VLUA 1MDP1 1RKMA 3MUQA 1ZBMA 3ILUB 5EYFA 3IK6B 1EZOA 4OETA 3Q25A 3TTKA 3N5LA 4R74A 4OENA 2F78A 5I56B 1US4A 2PT2A 3D4CA 4GOTA 2ZMBA 5CI5A 2RC7A 3CG1A 4TOZA 4F39A 3BFUA 4ZEIA 4OFOA 4RK2A 4H8IA 4BDOA 3CIJA 3R26A 2VP1A 1VR5A 4FIMA 2DVCA 3TFLA 3I6VA 3PPNA 2Q89A 4H8JA 1FCKA 3LSLA 2XX9A 3VVFA 1QJMA 4RY1A 2LAOA 4QFKA 3K02A 2UYEA 3H6VA 3MQ9A 3L6HA 3RT8A 3PUYE 1LAGE 1FTJA 2P2AA 5ICQA 2FYIA 2VGQA 2V3TA 2RC8A 1MH3A 3FZVA 3MVXA 2I49A 4BDQA 2H9BA 2Q2AA 2ONSA 1FQAA 5I57B 3DLNA 4KI0E 4N13A 3FJGA 1FQBA 3C36A 1ELJA 3C9HA 4JBZA 5H8NB 4DXUA 4R75A 4OTEA 4OHNA 4X9TA 3KN3A 3V5AA 4U2RA 1MDQA 4KFQA 2X7QA 2F7BA 1DTGA 1USYE 1UTBB 4POXA 3IOUA 2RF1A 4I9DA 3EHTA 4OYVA 3IJXB 2FNCA 2HQ0A 1ZU0A 4TLLB 1PBPA 1UTBA 3VLWA 1CB6A 1NH8A 2XXVA 2XXIA 1H76A 2R6GE 3JV9A 4PP0A 3EQ1A 3S9LC 1B7UA 4PFWA 5I58B 4MLQA 4BDNA 4LA9A 4QSDA 2VD2A 4H5FA 1B4ZA 3H6TA 3TTMA 3PPPA 2Z8DA 4F19A 2HAUA 4L17A 4NF4B 5L9SA 3QK6A 4MF3A 3FXQA 1MY0A 1YCJA 4F31B 1SYIA 2Z23A 1T0KA 2NOOA 1B0HA 3TQLA 1WODA 1S7YA 1N84A 2Y7IA 4ESXA 3IO4A 1URDA 2CMOA 1TFDA 4GRKA 4ZEFA 5I2NA 4POWA 4OZ9A 1B2HA 1H43A 4IO7A 1MQGA 3O6IA 3VFJA 3T9UA 3OOAA 1MY1A 4ELPA 3RNNA 4R9GA 4FECA 2V3QA 1H44A 4LVQA 4ELRA 3IR1A 5M2VA 1Q35A 1Q1KA 3QYTA 4JSDA 1DSNA 1NNKA 3UIFA 4I62A 3RYAA 2XXWA 2PX1A 3C34A 5ELVA 1B46A 2Y7WA 2QMXA 1JEVA 5HM4B 3MAMA 3QSLA 4IB2A 2OWTA 2QL3A 3KFMA 3FTOA 3VLVA 1NH7A 2Z8FA 2XHDA 1IZ1A 3A3UA 2IA4A 1MQHA 3G7WA 3D4GA 2O51A 5TPAB 1NNPA 3FV1A 1ZMGA 4M1VA 4LATA 1LBCA 1OVBA 1USYH 2M8CA 5TPAA 1Z7NE 5L9MA 3FVOA 2OLBA 4NF6A 5DTBA 5B7DA 1BP5A 1B0LA 3QIMA 2B65A 1JETA 1Y4TA 3MJNA 3M8UA 2I3WA 3FXRA 3O6GA 3DM0A 3PPQA 4NWCA 3ZKKA 5I2KA 1LAXA 2H99A 1NMUA 1IUDA 2QS2A 2DOJA 3G3IA 3GBBA 3V8XB 2B3FA 5DVIA 1FQDA 1EZ9A 3O66A 4H1XA 3WAEA 1PB8A 3K1MA 4YKPA 4F29A 2VHAA 3CHGA 3TZAA 1SI1A 4JWXA 2AL4A 3LBSA 3K0VA 4HTGA 1M5CA 5ITOA 5HPQA 4YB5A 1IXIA 4NTLA 3G3JA 3SESA 3PUZE 2XX7A 1IXHA 1JVYA 2REJA 3HHFA 5L8DA 4YB6A 4XXUA 3EN3A 4RJZA 1IXCA 1PEBA 3RLFE 3PUWE 5FHOA 1MY3A 3C33A 5F7VA 3VV5A 3ZKLA 2XXPA 1UIVA 2I0BA 2XX8A 2OWSA 5TU0A 2DXYA 3FJMA 2XXRA 1WVJA 3A3CA 3W9WA 4YKKA 2ONRA 3OEKA 2DSFA 4ZE8A 2DQVA 2GFEA 1XVXA 2D5WA 3OELA 3RT6B 3CG3A 1MXYA 3KZGA 1FTKA 4RK9A 1B51A 3KJ7A 3TKDA 1US5A 5KCJA 3C4MA 2RC9A 3N6UA 2GHBA 3UA8A 2VD3A 2WOPA 3V83A 4ZZEA 3TAJA 4JSOA 1UIUA 1MQJA 1Y20A 1II5A 3TELA 4NF8B 4GL0A 3PUVE 2UVIA 4KYDA 1MY4A 1D3KA 2XXHA 1P1OA 4X48A 3SEXA 1M5BA 2F5XA 1NL5A 2PVUA 2ONKE 5AA2D 1R6ZA 3FGSA 3QAXA 4N07A 2XD2A 2UVGA 3O2AA 1R9QA 4G2ZA 2OK2A 3PV0E 4MH5A 1J1NA 2G29A 2R71A 1MQDA 2XXUA 4IO3A 5CBRA 2H5YA 2F97A 4F2OA 3IOWA 2ZXTA 5CMCA 1A8FA 4H6DA 1TT1A 5JEIA 3DRGA 4Q5TA 2I58A 4IO4A 3HHGA 2XXYA 1MH4A 1SD3A 1UTHA 1DOTA 4JXIA 1P99A 1M5EA 2XXQA 2A5TA 2O84X 1QW0A 1QULA 1MXZA 2DWAA 1N76A 4KHZE 3FIRA 3R6UA 3RY3A 1GVCA 3N94A 2UXAA 1XC1A 3E4RA 1AOVA 3TCGA 3RN8A 2HZKA 1SW1A 2D3IA 5J1DA 3RQTA 2G93A 4XTCQ 5I56A 3OD7A 3OO9A 3KSXA 3OENA 3E3KA 2FA7A 5TP9B 1Y1ZA 3TPAA 4LONB 1SQYA 2A5SA 1B6HA 2DWHA 2ZNSA 4LUBA 1MRPA 2OZZA 2WKYA 4EDPA 4TLMB 4ONYA 3DP8A 3PMVA 4YMAA 3MPKA 1B3GA 3KGCA 5KDTB 3EHUA 4PETA 4JB7A 2UVHA 3G3FA 3PMXA 4IO2A 3DP6A 1M5DA 1SVXB 3G3GA 4RPNA 2Z8EA 1LCFA 2Q9TA 1B3FA 1OLAA 3KOSA 1N3XA 5I57A 3OXNA 1JVXA 3DRJA 2P1SA 4IGTA 3HN0A 2DWIA 1N7XA 4NE4A 1LAHE 3CFXA 5H8NA 1DMBA 3KN7A 2QS4A 3ONMA 1XOCA 4YKJA 5KZTA 4LQ5A 2DP8A 1L5TA 1AIVA 4EUOA 2DE4A 4IY5A 5H8HB 3S9MC 1ZTYA 3L6GA 3S9EA 1N0TA 4FJPA 3OSRA 3W9VA 2XXTA 5H8HA 4I1DA 2UVJA 3VVEA 3IB1A 4FEDA 3AXFA 3UGWA 2PYYA 3G3KA 5I58A 4Q30B 2F6GA 2O69A 5H8FB 3TTRA 4ZZAA 1I69A 2VOZA 3MP8A 1H45A 3PD8A 4R6HA 3RYBA 2ZNTA 1A8EA 3SEYA 1VE4A 4G8HA 5H8FA 1IITA 4OWDA 1FTOA 4NF4A 3O9PA 2Y7RA 3LSXA 1MXUA 4H0WA 1UQWA 3G3HA 1B40A 4BLAA 4C1UA 4PFTA 1JQFA 3CRBA 3M3LA 3K6UA 4U1OA 5AA1A 3BFTA 3SEWA 4PQJA 4DXCA 3SKPA 3PAMA 1BIYA 1VFEA 4YAHX 4QFPA 1VFDA 5H8QB 3Q29A 4NEDA 1SYHA 5CM6A 1I6BA 3USDA 4G8NA 4ZE9A 1H3DA 2WOKA 3E9XA 4DCXA 1GGGA 3TTLA 5H8QA 3C32A 4KCCA 2V93A 1IXGA 2O1LA 4JWOA 3KSJA 4ESWA 1XT8A 4U1ZA 2NVUB 3A09A 4LZ5A 1SDXA 1JNFA 2R9JA 2F7CA 4OXVA 1TXFA 4AB5A 3LSFB 2V3UA 3CSGA 4GWOA 4XIGQ 3HO7A 1LGBC 2ZNUA 4P11A 3FVGA 3UN6A 3C31A 5A5XB 1B5JA 2F7AA 1JW1A 3FD3A 3CVGA 1IQ7A 4GD5A 1B9JA 2X7PA 4HCYA 4XKRA 2XD3A 4DIGA 4DCYA 3KOTA 2GRVA 3EPEA 5CRYA 1FQCA 4U21A 5HBCA 2QJEA 3W15C 4QHQA 1RYOA 4DDDA 1I6QA 1SW5A 4QF9A 3U93A 3O6HA 4F2QA 5B70A 1YPNA 5ISUA 1IIWA 2HAVA 1ANFA 1SI0A 3U1OA 3TTNA 5L9OA 2HCAA 3B7DA 4FE8A 1A54A 3K4UA 3MVZA 4KQPA 5BUUA 4IO5A 2F6PA 1PBQA 4XKNA 3IOVA 1ZKBA 4R72A 2AL5A 3MP6A 4JDFA 5AA2B 4RPOA 5LOMA 1PB9A 1LFIA 4GFRA 3S2VA 3Q26A 4OQOA 3GLBA 2ALUA 3N26A 4THIA 4ND9A 4OEVA 3PPRA 3I5OA 1QUIA 2OJTA 4U23A 1P1NA 3DELB 4C0RA 3RUMA 3K6VA 4ZDMA 3R7XA 3TEPA 3ZSFA 4UACA 3FVNA 4BDMA 1GTKA 3T9VA 2WOLA 1D9VA 1AMFA 1PDAA 2O7IA 2REGA 5I59B 4YU0A 1OLCA 5F1QA 2CZLA 4GF8A 1A55A 3K00A 3V89B 1FW0A 3VVDA 5I59A 4LP2B 2O6AA 4R73A 4G68B 5IKBA 4X1BA 2HXWA 3OO8A 3E13X 3GBAA 1A7LA 2E0SA 1AH5A 1HSJA 1MXWA 4U22A 1DPPA 3K01A 4G77A 3BBRA 3TQWA 3MZ9A 2B3BA 2ESNA 1N3WA 4P0IA 3RTFB 1IEJA 3QXMA 1NKXA 3B6TA 3PU5A 3RTWB 4NF8A 4X1DA 1PC3A 2B4LA 2B4MA 3U92A 1SW2A 1D9YA 1NNFA 2YJPA 1RYXA 3BKIB 1FQEA 2Z22A 4IGRA 1BTJA 4R2BA 4KR5A 4MBPA 5DT6A 4MFIA 5ITPA 4ZEDA 3K6WA 4WKMA 3I3VA 1B5HA 3ILTB 1GV8A 1SW4A 2YLNA 2BJJX 4OFLA 2DYXA 4F3SA 1QKBA 3O97A 5AA3A 4U4SA 2V25A 1QUJA 1MM7A 4JWYA 4O3BA 1KWHA 3FJ7A 2ZYNA 1P1UA 3H7MA 3O29A 3JYRA 4DZ1A 4F3BA 1LCTA 2P0SA 1B32A 4F1YA 3MZ1A 1FTLA 4PFYA 3DRIA 3MP1A 4OFJA 2AIXA 5DVJA 3B6WA 3DP4A 1MG1A 1URGA 5CMMA 2THIA 1ATGA 3ECRA 2QSXA 2I4CA 3O28A 3DRHA 2ANJA 1MY2A 3SDFA 5CC2A 1B4HA 4YZZA 1NFTA 3VXCA 4TQUQ 1QVSA 1POTA 1JW5A 4KCDA 1OIBA 2RCAA 1A99A 4EQ7A 2HZLA 5TP9A 4IY6A 2H25A 4H65A 4QSCA 4WXJA 1JEUA 1WDNA 2KLFA 3RPWA 2I4BA 4EQBA 1MQIA 4ZECA 1POY1 3OO6A 4I8CA 1DPEA 4Q0CA 1MM6A 2NUVA 5DYHA 3C35A 4EF2A 3OMBA 3KG2A 3H3GA 3CR9A 3K1NA 5FTIA 3UORA 4YICA 5KDTA 3TDJA 4H67A 4C1TA 2RKMA 4QFLA 1LLSA 4F1VA 5AA4B 1B3HA 4IO6A 2I0CA 1YAEA 3HSTA 3PUXE 2DE2A 2DWJA 4DXBA 1B58A 1P1QA 5IAIA 3FXUA 4OERA 3FATA 3TODA 5AA4A 3UP9A 1LSTA 2DXRA 3TCFA 4P0GA 5AE4A 1JW4A 1BLFA 5FHMA 4R2FA 1FQFA 1MPDA 3IB2A 4ZS9A 1Y9UA 1ZLQA 2RINA 4ZEKA 3Q27A 3P7IA 3U8QA 1LFGA 3M3FA 5DEXB 2UYFA 3IB0A 3IL1B 3JZJA 4HS7A 3TYHA 3N6TA 2RCBA 1R1NA 1B3LA 2ABHA 1OVTA 4RXLA 4N6PA 2O7UA 1QUKA 4ISUA 1B52A 5DEXA 2ZYKA 3WAFA 2NWJA 1EH3A 1LFHA 4R9FA 4QFNA 2XXXA 1LAFE 4GQOA 3T22A 1TFAA 4RNSA 3S9NC 1Y3NA 1URSA 4U4XA 3T66A 3S4UA 3KBRA 3K6XA 3OEMA 5CMKA 3QUJA 3B6QA 4AB6A 3H4ZA 4M4GA 5I84A 2PT1A 1OMPA 4HW8A 4H5GA 2DS9A 3UK4A 3LSWA 4KD5A 2X26A 2O1MA 4GVOA 3SEVA 4E0WA 1ZIUA 1SBPA 1N04A 2V84A 2F34A 4G68C 5K2XA 1HSEA 3FUZA 3RGYA 1YTVA 3HCQA 4QSEA 5I2NB 4E0XA 3T96B 1EU8A 2HEUA 3CFLA 1Y1MA 1A40A 1B1HA 4OVJA 2Q88A 1B7ZA 5BWJA 2ZYOA 2OBGA 2GHAA 2PMSA 2AYSA 2PBWA 3MBPA 4G8MA 1MPCA 4AQ4A 3IO6A 3VE1B 2DVZA 4ZEBA 3DRKA 3MWBA 1Y3PA 3SERA 3F11A 3PPOA 1D4NA 2Q2CA 1NNTA 4EXKA 4DLDA 4F1UA 3O6PA 5K2YA 4WEDA 1MS7A 2I3VA 3H03A 2QPQA 3PMWA 4XKQA 1TWYA 4GLIA 4LZ8A 2OCUA 4OESA 1O63A 1B7HA 2Y84A 1OQHA 2D21A 2Y7PA 4NF6B 4FORA 4OMBA 2Q8JA 1LB9A 3U72A 5EHSA 1P1WA 3DRFA 2H4IA 1EZPA 4FATA 4O3AA 4FEBA 3THIA 4F3GA 5I2KB 1CE2A 5A5XA 1HSLA 4GXSB 5DVFA 4HCWA 4OEUA 1AL3A 3KEIA 3EHSA 4QFOA 2Y7KA 1DTZA 3IAZA 5ICTA 3MPLA 3VDFA 3FVKA 3TMGA 1S9TA 3MW0A 4EF1A 4BDLA 1LB8A 2DE3A 1QKAA 4RA1A 4Z7EA 4R6YA 3H06B 4LQ2A 3CSBA 3K2DA 2QS3A 3VXBA 3FASA 3GXAA 4FAJA 3K1PA 3OSQA 4G4PA 3H6UA 3EF7A 1B5IA 1GR2A 1LBBA 4NF5B 3LVUA 1B3EA 2F35A 1I6AA 4NMYA 3T93B 1S50A 3LR1A 1O64A 3FV2A 5AA2A 4YMBA 3KJTA 4NF5A 2QRYA 2O68A 2GH9A 1XVYA 3LC8A 5FHNA 3HPIA 2ZYMA 4F3PA 4RYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LZ7 A;  2YPN A;  4XKP A;  1BKA A;  1F9B A;  3MVW A;  2F8D A;  4EXL A;  3IOT A;  5FTH A;  4F18 A;  3IX1 A;  3U94 A;  1Y3Q A;  3OO7 A;  3T9H B;  3H6W A;  1MXX A;  4QRZ A;  3GZG A;  2HFB A;  1Y4C A;  4EQ9 A;  2I6E A;  3SEU A;  1PB7 A;  3PGF A;  1O7T A;  2NXO A;  4BDR A;  4F22 A;  3Q28 A;  4G68 A;  4ELO A;  2F36 A;  4Z0I A;  5KCJ B;  3M3K A;  4UA8 A;  3TCH A;  4KYE A;  4YKI A;  2QMW A;  3ODB A;  1XHY A;  3IOR A;  4KPT A;  4MLV A;  4O3C A;  1R9L A;  4PE5 B;  4GXA A;  5EHM A;  3PD9 A;  1M5F A;  4PFU A;  3ZS6 A;  4Q8R A;  5JTY B;  4DE8 A;  1XS5 A;  3HV1 A;  2QS1 A;  3IJO B;  5CMB A;  4ELQ A;  5JTY A;  1OQG A;  3MC2 A;  3QUF A;  3CFZ A;  4R6K A;  1B05 A;  4GL8 A;  2I48 A;  3MZB A;  4WEP A;  5H8S A;  4K3F A;  1N7W A;  3KN8 A;  4KYS A;  4GIZ A;  4YB7 A;  3LUY A;  2H98 A;  5JK4 A;  1MPB A;  2E1S A;  3CI8 A;  2IEE A;  2W7Y A;  1FTM A;  1UTH B;  3MVY A;  1Z7M E;  1MXV A;  3T9X B;  3SET A;  4ECF A;  2A5T B;  4NWD A;  3TUS A;  5CBS A;  1VSO A;  1B1X A;  1ZJL A;  3VLU A;  1MDP 1;  1RKM A;  3MUQ A;  1ZBM A;  3ILU B;  5EYF A;  3IK6 B;  1EZO A;  4OET A;  3Q25 A;  3TTK A;  3N5L A;  4R74 A;  4OEN A;  2F78 A;  5I56 B;  1US4 A;  2PT2 A;  3D4C A;  4GOT A;  2ZMB A;  5CI5 A;  2RC7 A;  3CG1 A;  4TOZ A;  4F39 A;  3BFU A;  4ZEI A;  4OFO A;  4RK2 A;  4H8I A;  4BDO A;  3CIJ A;  3R26 A;  2VP1 A;  1VR5 A;  4FIM A;  2DVC A;  3TFL A;  3I6V A;  3PPN A;  2Q89 A;  4H8J A;  1FCK A;  3LSL A;  2XX9 A;  3VVF A;  1QJM A;  4RY1 A;  2LAO A;  4QFK A;  3K02 A;  2UYE A;  3H6V A;  3MQ9 A;  3L6H A;  3RT8 A;  3PUY E;  1LAG E;  1FTJ A;  2P2A A;  5ICQ A;  2FYI A;  2VGQ A;  2V3T A;  2RC8 A;  1MH3 A;  3FZV A;  3MVX A;  2I49 A;  4BDQ A;  2H9B A;  2Q2A A;  2ONS A;  1FQA A;  5I57 B;  3DLN A;  4KI0 E;  4N13 A;  3FJG A;  1FQB A;  3C36 A;  1ELJ A;  3C9H A;  4JBZ A;  5H8N B;  4DXU A;  4R75 A;  4OTE A;  4OHN A;  4X9T A;  3KN3 A;  3V5A A;  4U2R A;  1MDQ A;  4KFQ A;  2X7Q A;  2F7B A;  1DTG A;  1USY E;  1UTB B;  4POX A;  3IOU A;  2RF1 A;  4I9D A;  3EHT A;  4OYV A;  3IJX B;  2FNC A;  2HQ0 A;  1ZU0 A;  4TLL B;  1PBP A;  1UTB A;  3VLW A;  1CB6 A;  1NH8 A;  2XXV A;  2XXI A;  1H76 A;  2R6G E;  3JV9 A;  4PP0 A;  3EQ1 A;  3S9L C;  1B7U A;  4PFW A;  5I58 B;  4MLQ A;  4BDN A;  4LA9 A;  4QSD A;  2VD2 A;  4H5F A;  1B4Z A;  3H6T A;  3TTM A;  3PPP A;  2Z8D A;  4F19 A;  2HAU A;  4L17 A;  4NF4 B;  5L9S A;  3QK6 A;  4MF3 A;  3FXQ A;  1MY0 A;  1YCJ A;  4F31 B;  1SYI A;  2Z23 A;  1T0K A;  2NOO A;  1B0H A;  3TQL A;  1WOD A;  1S7Y A;  1N84 A;  2Y7I A;  4ESX A;  3IO4 A;  1URD A;  2CMO A;  1TFD A;  4GRK A;  4ZEF A;  5I2N A;  4POW A;  4OZ9 A;  1B2H A;  1H43 A;  4IO7 A;  1MQG A;  3O6I A;  3VFJ A;  3T9U A;  3OOA A;  1MY1 A;  4ELP A;  3RNN A;  4R9G A;  4FEC A;  2V3Q A;  1H44 A;  4LVQ A;  4ELR A;  3IR1 A;  5M2V A;  1Q35 A;  1Q1K A;  3QYT A;  4JSD A;  1DSN A;  1NNK A;  3UIF A;  4I62 A;  3RYA A;  2XXW A;  2PX1 A;  3C34 A;  5ELV A;  1B46 A;  2Y7W A;  2QMX A;  1JEV A;  5HM4 B;  3MAM A;  3QSL A;  4IB2 A;  2OWT A;  2QL3 A;  3KFM A;  3FTO A;  3VLV A;  1NH7 A;  2Z8F A;  2XHD A;  1IZ1 A;  3A3U A;  2IA4 A;  1MQH A;  3G7W A;  3D4G A;  2O51 A;  5TPA B;  1NNP A;  3FV1 A;  1ZMG A;  4M1V A;  4LAT A;  1LBC A;  1OVB A;  1USY H;  2M8C A;  5TPA A;  1Z7N E;  5L9M A;  3FVO A;  2OLB A;  4NF6 A;  5DTB A;  5B7D A;  1BP5 A;  1B0L A;  3QIM A;  2B65 A;  1JET A;  1Y4T A;  3MJN A;  3M8U A;  2I3W A;  3FXR A;  3O6G A;  3DM0 A;  3PPQ A;  4NWC A;  3ZKK A;  5I2K A;  1LAX A;  2H99 A;  1NMU A;  1IUD A;  2QS2 A;  2DOJ A;  3G3I A;  3GBB A;  3V8X B;  2B3F A;  5DVI A;  1FQD A;  1EZ9 A;  3O66 A;  4H1X A;  3WAE A;  1PB8 A;  3K1M A;  4YKP A;  4F29 A;  2VHA A;  3CHG A;  3TZA A;  1SI1 A;  4JWX A;  2AL4 A;  3LBS A;  3K0V A;  4HTG A;  1M5C A;  5ITO A;  5HPQ A;  4YB5 A;  1IXI A;  4NTL A;  3G3J A;  3SES A;  3PUZ E;  2XX7 A;  1IXH A;  1JVY A;  2REJ A;  3HHF A;  5L8D A;  4YB6 A;  4XXU A;  3EN3 A;  4RJZ A;  1IXC A;  1PEB A;  3RLF E;  3PUW E;  5FHO A;  1MY3 A;  3C33 A;  5F7V A;  3VV5 A;  3ZKL A;  2XXP A;  1UIV A;  2I0B A;  2XX8 A;  2OWS A;  5TU0 A;  2DXY A;  3FJM A;  2XXR A;  1WVJ A;  3A3C A;  3W9W A;  4YKK A;  2ONR A;  3OEK A;  2DSF A;  4ZE8 A;  2DQV A;  2GFE A;  1XVX A;  2D5W A;  3OEL A;  3RT6 B;  3CG3 A;  1MXY A;  3KZG A;  1FTK A;  4RK9 A;  1B51 A;  3KJ7 A;  3TKD A;  1US5 A;  5KCJ A;  3C4M A;  2RC9 A;  3N6U A;  2GHB A;  3UA8 A;  2VD3 A;  2WOP A;  3V83 A;  4ZZE A;  3TAJ A;  4JSO A;  1UIU A;  1MQJ A;  1Y20 A;  1II5 A;  3TEL A;  4NF8 B;  4GL0 A;  3PUV E;  2UVI A;  4KYD A;  1MY4 A;  1D3K A;  2XXH A;  1P1O A;  4X48 A;  3SEX A;  1M5B A;  2F5X A;  1NL5 A;  2PVU A;  2ONK E;  5AA2 D;  1R6Z A;  3FGS A;  3QAX A;  4N07 A;  2XD2 A;  2UVG A;  3O2A A;  1R9Q A;  4G2Z A;  2OK2 A;  3PV0 E;  4MH5 A;  1J1N A;  2G29 A;  2R71 A;  1MQD A;  2XXU A;  4IO3 A;  5CBR A;  2H5Y A;  2F97 A;  4F2O A;  3IOW A;  2ZXT A;  5CMC A;  1A8F A;  4H6D A;  1TT1 A;  5JEI A;  3DRG A;  4Q5T A;  2I58 A;  4IO4 A;  3HHG A;  2XXY A;  1MH4 A;  1SD3 A;  1UTH A;  1DOT A;  4JXI A;  1P99 A;  1M5E A;  2XXQ A;  2A5T A;  2O84 X;  1QW0 A;  1QUL A;  1MXZ A;  2DWA A;  1N76 A;  4KHZ E;  3FIR A;  3R6U A;  3RY3 A;  1GVC A;  3N94 A;  2UXA A;  1XC1 A;  3E4R A;  1AOV A;  3TCG A;  3RN8 A;  2HZK A;  1SW1 A;  2D3I A;  5J1D A;  3RQT A;  2G93 A;  4XTC Q;  5I56 A;  3OD7 A;  3OO9 A;  3KSX A;  3OEN A;  3E3K A;  2FA7 A;  5TP9 B;  1Y1Z A;  3TPA A;  4LON B;  1SQY A;  2A5S A;  1B6H A;  2DWH A;  2ZNS A;  4LUB A;  1MRP A;  2OZZ A;  2WKY A;  4EDP A;  4TLM B;  4ONY A;  3DP8 A;  3PMV A;  4YMA A;  3MPK A;  1B3G A;  3KGC A;  5KDT B;  3EHU A;  4PET A;  4JB7 A;  2UVH A;  3G3F A;  3PMX A;  4IO2 A;  3DP6 A;  1M5D A;  1SVX B;  3G3G A;  4RPN A;  2Z8E A;  1LCF A;  2Q9T A;  1B3F A;  1OLA A;  3KOS A;  1N3X A;  5I57 A;  3OXN A;  1JVX A;  3DRJ A;  2P1S A;  4IGT A;  3HN0 A;  2DWI A;  1N7X A;  4NE4 A;  1LAH E;  3CFX A;  5H8N A;  1DMB A;  3KN7 A;  2QS4 A;  3ONM A;  1XOC A;  4YKJ A;  5KZT A;  4LQ5 A;  2DP8 A;  1L5T A;  1AIV A;  4EUO A;  2DE4 A;  4IY5 A;  5H8H B;  3S9M C;  1ZTY A;  3L6G A;  3S9E A;  1N0T A;  4FJP A;  3OSR A;  3W9V A;  2XXT A;  5H8H A;  4I1D A;  2UVJ A;  3VVE A;  3IB1 A;  4FED A;  3AXF A;  3UGW A;  2PYY A;  3G3K A;  5I58 A;  4Q30 B;  2F6G A;  2O69 A;  5H8F B;  3TTR A;  4ZZA A;  1I69 A;  2VOZ A;  3MP8 A;  1H45 A;  3PD8 A;  4R6H A;  3RYB A;  2ZNT A;  1A8E A;  3SEY A;  1VE4 A;  4G8H A;  5H8F A;  1IIT A;  4OWD A;  1FTO A;  4NF4 A;  3O9P A;  2Y7R A;  3LSX A;  1MXU A;  4H0W A;  1UQW A;  3G3H A;  1B40 A;  4BLA A;  4C1U A;  4PFT A;  1JQF A;  3CRB A;  3M3L A;  3K6U A;  4U1O A;  5AA1 A;  3BFT A;  3SEW A;  4PQJ A;  4DXC A;  3SKP A;  3PAM A;  1BIY A;  1VFE A;  4YAH X;  4QFP A;  1VFD A;  5H8Q B;  3Q29 A;  4NED A;  1SYH A;  5CM6 A;  1I6B A;  3USD A;  4G8N A;  4ZE9 A;  1H3D A;  2WOK A;  3E9X A;  4DCX A;  1GGG A;  3TTL A;  5H8Q A;  3C32 A;  4KCC A;  2V93 A;  1IXG A;  2O1L A;  4JWO A;  3KSJ A;  4ESW A;  1XT8 A;  4U1Z A;  2NVU B;  3A09 A;  4LZ5 A;  1SDX A;  1JNF A;  2R9J A;  2F7C A;  4OXV A;  1TXF A;  4AB5 A;  3LSF B;  2V3U A;  3CSG A;  4GWO A;  4XIG Q;  3HO7 A;  1LGB C;  2ZNU A;  4P11 A;  3FVG A;  3UN6 A;  3C31 A;  5A5X B;  1B5J A;  2F7A A;  1JW1 A;  3FD3 A;  3CVG A;  1IQ7 A;  4GD5 A;  1B9J A;  2X7P A;  4HCY A;  4XKR A;  2XD3 A;  4DIG A;  4DCY A;  3KOT A;  2GRV A;  3EPE A;  5CRY A;  1FQC A;  4U21 A;  5HBC A;  2QJE A;  3W15 C;  4QHQ A;  1RYO A;  4DDD A;  1I6Q A;  1SW5 A;  4QF9 A;  3U93 A;  3O6H A;  4F2Q A;  5B70 A;  1YPN A;  5ISU A;  1IIW A;  2HAV A;  1ANF A;  1SI0 A;  3U1O A;  3TTN A;  5L9O A;  2HCA A;  3B7D A;  4FE8 A;  1A54 A;  3K4U A;  3MVZ A;  4KQP A;  5BUU A;  4IO5 A;  2F6P A;  1PBQ A;  4XKN A;  3IOV A;  1ZKB A;  4R72 A;  2AL5 A;  3MP6 A;  4JDF A;  5AA2 B;  4RPO A;  5LOM A;  1PB9 A;  1LFI A;  4GFR A;  3S2V A;  3Q26 A;  4OQO A;  3GLB A;  2ALU A;  3N26 A;  4THI A;  4ND9 A;  4OEV A;  3PPR A;  3I5O A;  1QUI A;  2OJT A;  4U23 A;  1P1N A;  3DEL B;  4C0R A;  3RUM A;  3K6V A;  4ZDM A;  3R7X A;  3TEP A;  3ZSF A;  4UAC A;  3FVN A;  4BDM A;  1GTK A;  3T9V A;  2WOL A;  1D9V A;  1AMF A;  1PDA A;  2O7I A;  2REG A;  5I59 B;  4YU0 A;  1OLC A;  5F1Q A;  2CZL A;  4GF8 A;  1A55 A;  3K00 A;  3V89 B;  1FW0 A;  3VVD A;  5I59 A;  4LP2 B;  2O6A A;  4R73 A;  4G68 B;  5IKB A;  4X1B A;  2HXW A;  3OO8 A;  3E13 X;  3GBA A;  1A7L A;  2E0S A;  1AH5 A;  1HSJ A;  1MXW A;  4U22 A;  1DPP A;  3K01 A;  4G77 A;  3BBR A;  3TQW A;  3MZ9 A;  2B3B A;  2ESN A;  1N3W A;  4P0I A;  3RTF B;  1IEJ A;  3QXM A;  1NKX A;  3B6T A;  3PU5 A;  3RTW B;  4NF8 A;  4X1D A;  1PC3 A;  2B4L A;  2B4M A;  3U92 A;  1SW2 A;  1D9Y A;  1NNF A;  2YJP A;  1RYX A;  3BKI B;  1FQE A;  2Z22 A;  4IGR A;  1BTJ A;  4R2B A;  4KR5 A;  4MBP A;  5DT6 A;  4MFI A;  5ITP A;  4ZED A;  3K6W A;  4WKM A;  3I3V A;  1B5H A;  3ILT B;  1GV8 A;  1SW4 A;  2YLN A;  2BJJ X;  4OFL A;  2DYX A;  4F3S A;  1QKB A;  3O97 A;  5AA3 A;  4U4S A;  2V25 A;  1QUJ A;  1MM7 A;  4JWY A;  4O3B A;  1KWH A;  3FJ7 A;  2ZYN A;  1P1U A;  3H7M A;  3O29 A;  3JYR A;  4DZ1 A;  4F3B A;  1LCT A;  2P0S A;  1B32 A;  4F1Y A;  3MZ1 A;  1FTL A;  4PFY A;  3DRI A;  3MP1 A;  4OFJ A;  2AIX A;  5DVJ A;  3B6W A;  3DP4 A;  1MG1 A;  1URG A;  5CMM A;  2THI A;  1ATG A;  3ECR A;  2QSX A;  2I4C A;  3O28 A;  3DRH A;  2ANJ A;  1MY2 A;  3SDF A;  5CC2 A;  1B4H A;  4YZZ A;  1NFT A;  3VXC A;  4TQU Q;  1QVS A;  1POT A;  1JW5 A;  4KCD A;  1OIB A;  2RCA A;  1A99 A;  4EQ7 A;  2HZL A;  5TP9 A;  4IY6 A;  2H25 A;  4H65 A;  4QSC A;  4WXJ A;  1JEU A;  1WDN A;  2KLF A;  3RPW A;  2I4B A;  4EQB A;  1MQI A;  4ZEC A;  1POY 1;  3OO6 A;  4I8C A;  1DPE A;  4Q0C A;  1MM6 A;  2NUV A;  5DYH A;  3C35 A;  4EF2 A;  3OMB A;  3KG2 A;  3H3G A;  3CR9 A;  3K1N A;  5FTI A;  3UOR A;  4YIC A;  5KDT A;  3TDJ A;  4H67 A;  4C1T A;  2RKM A;  4QFL A;  1LLS A;  4F1V A;  5AA4 B;  1B3H A;  4IO6 A;  2I0C A;  1YAE A;  3HST A;  3PUX E;  2DE2 A;  2DWJ A;  4DXB A;  1B58 A;  1P1Q A;  5IAI A;  3FXU A;  4OER A;  3FAT A;  3TOD A;  5AA4 A;  3UP9 A;  1LST A;  2DXR A;  3TCF A;  4P0G A;  5AE4 A;  1JW4 A;  1BLF A;  5FHM A;  4R2F A;  1FQF A;  1MPD A;  3IB2 A;  4ZS9 A;  1Y9U A;  1ZLQ A;  2RIN A;  4ZEK A;  3Q27 A;  3P7I A;  3U8Q A;  1LFG A;  3M3F A;  5DEX B;  2UYF A;  3IB0 A;  3IL1 B;  3JZJ A;  4HS7 A;  3TYH A;  3N6T A;  2RCB A;  1R1N A;  1B3L A;  2ABH A;  1OVT A;  4RXL A;  4N6P A;  2O7U A;  1QUK A;  4ISU A;  1B52 A;  5DEX A;  2ZYK A;  3WAF A;  2NWJ A;  1EH3 A;  1LFH A;  4R9F A;  4QFN A;  2XXX A;  1LAF E;  4GQO A;  3T22 A;  1TFA A;  4RNS A;  3S9N C;  1Y3N A;  1URS A;  4U4X A;  3T66 A;  3S4U A;  3KBR A;  3K6X A;  3OEM A;  5CMK A;  3QUJ A;  3B6Q A;  4AB6 A;  3H4Z A;  4M4G A;  5I84 A;  2PT1 A;  1OMP A;  4HW8 A;  4H5G A;  2DS9 A;  3UK4 A;  3LSW A;  4KD5 A;  2X26 A;  2O1M A;  4GVO A;  3SEV A;  4E0W A;  1ZIU A;  1SBP A;  1N04 A;  2V84 A;  2F34 A;  4G68 C;  5K2X A;  1HSE A;  3FUZ A;  3RGY A;  1YTV A;  3HCQ A;  4QSE A;  5I2N B;  4E0X A;  3T96 B;  1EU8 A;  2HEU A;  3CFL A;  1Y1M A;  1A40 A;  1B1H A;  4OVJ A;  2Q88 A;  1B7Z A;  5BWJ A;  2ZYO A;  2OBG A;  2GHA A;  2PMS A;  2AYS A;  2PBW A;  3MBP A;  4G8M A;  1MPC A;  4AQ4 A;  3IO6 A;  3VE1 B;  2DVZ A;  4ZEB A;  3DRK A;  3MWB A;  1Y3P A;  3SER A;  3F11 A;  3PPO A;  1D4N A;  2Q2C A;  1NNT A;  4EXK A;  4DLD A;  4F1U A;  3O6P A;  5K2Y A;  4WED A;  1MS7 A;  2I3V A;  3H03 A;  2QPQ A;  3PMW A;  4XKQ A;  1TWY A;  4GLI A;  4LZ8 A;  2OCU A;  4OES A;  1O63 A;  1B7H A;  2Y84 A;  1OQH A;  2D21 A;  2Y7P A;  4NF6 B;  4FOR A;  4OMB A;  2Q8J A;  1LB9 A;  3U72 A;  5EHS A;  1P1W A;  3DRF A;  2H4I A;  1EZP A;  4FAT A;  4O3A A;  4FEB A;  3THI A;  4F3G A;  5I2K B;  1CE2 A;  5A5X A;  1HSL A;  4GXS B;  5DVF A;  4HCW A;  4OEU A;  1AL3 A;  3KEI A;  3EHS A;  4QFO A;  2Y7K A;  1DTZ A;  3IAZ A;  5ICT A;  3MPL A;  3VDF A;  3FVK A;  3TMG A;  1S9T A;  3MW0 A;  4EF1 A;  4BDL A;  1LB8 A;  2DE3 A;  1QKA A;  4RA1 A;  4Z7E A;  4R6Y A;  3H06 B;  4LQ2 A;  3CSB A;  3K2D A;  2QS3 A;  3VXB A;  3FAS A;  3GXA A;  4FAJ A;  3K1P A;  3OSQ A;  4G4P A;  3H6U A;  3EF7 A;  1B5I A;  1GR2 A;  1LBB A;  4NF5 B;  3LVU A;  1B3E A;  2F35 A;  1I6A A;  4NMY A;  3T93 B;  1S50 A;  3LR1 A;  1O64 A;  3FV2 A;  5AA2 A;  4YMB A;  3KJT A;  4NF5 A;  2QRY A;  2O68 A;  2GH9 A;  1XVY A;  3LC8 A;  5FHN A;  3HPI A;  2ZYM A;  4F3P A;  4RYA A; 
#chains in the Genus database with same CATH topology
 4LZ7 A;  4H45 A;  2YPN A;  4MNP A;  5IGA A;  3EKI A;  4XKP A;  1BKA A;  1F9B A;  3MVW A;  2QVV A;  5A5L A;  2F8D A;  3GYY A;  1FBG A;  4EXL A;  4P1L A;  3IOT A;  5FTH A;  4F18 A;  3IX1 A;  3U94 A;  1Y3Q A;  3OO7 A;  5EYH A;  3T9H B;  1IMA A;  3H6W A;  1MXX A;  4QRZ A;  3GZG A;  1QGX A;  1G0H A;  2HFB A;  1Y4C A;  4EQ9 A;  4N4U A;  2I6E A;  3SEU A;  2DDK A;  1PB7 A;  2PCR A;  3PGF A;  5ESY A;  1O7T A;  2NXO A;  4BDR A;  4F22 A;  3Q28 A;  4G68 A;  4ELO A;  2F36 A;  4Z0I A;  5KCJ B;  3M3K A;  4UA8 A;  3TCH A;  3E78 A;  4KYE A;  4YKI A;  2QMW A;  3ODB A;  1KA1 A;  2BJI A;  1XHY A;  3IOR A;  2CZK A;  4KPT A;  4MMP A;  4MLV A;  4O3C A;  1R9L A;  4PE5 B;  4GXA A;  5EHM A;  3PD9 A;  1LBX A;  1M5F A;  4PFU A;  3ZS6 A;  4Q8R A;  5JTY B;  4DE8 A;  4N6K A;  1XS5 A;  3HV1 A;  2QS1 A;  3IJO B;  5CMB A;  4ELQ A;  5JTY A;  1OQG A;  3MC2 A;  3QUF A;  3CFZ A;  4R6K A;  2VPO A;  1B05 A;  4GL8 A;  4GWW A;  2I48 A;  3MZB A;  4WEP A;  5H8S A;  4K3F A;  1N7W A;  3KN8 A;  1FJ6 A;  4KYS A;  4GIZ A;  4YB7 A;  3LUY A;  2H98 A;  2WX9 A;  5JK4 A;  1BK4 A;  1MPB A;  2E1S A;  3CI8 A;  1IMC A;  2IEE A;  2W7Y A;  1FTM A;  1UTH B;  3MVY A;  1Z7M E;  1MXV A;  4P8B A;  3T9X B;  3SET A;  4ECF A;  5EQA A;  2A5T B;  4NWD A;  3TUS A;  5CBS A;  1VSO A;  1B1X A;  1ZJL A;  3VLU A;  1MDP 1;  1RKM A;  3MUQ A;  1ZBM A;  3ILU B;  5EYF A;  2ZZV A;  3IK6 B;  1EZO A;  4OET A;  3Q25 A;  1NV3 A;  3TTK A;  3N5L A;  4R74 A;  4OEN A;  2F78 A;  3D1R A;  3MYU A;  1US4 A;  5I56 B;  2Y5L A;  4DI4 B;  2PT2 A;  3D4C A;  4PDH A;  4GOT A;  2ZMB A;  5CI5 A;  2P3V A;  2RC7 A;  3CG1 A;  4TOZ A;  4N91 A;  4F39 A;  3BFU A;  4ZEI A;  4OFO A;  4RK2 A;  4H8I A;  4BDO A;  3CIJ A;  3R26 A;  2VP1 A;  4P1E A;  1VR5 A;  3LUZ A;  4XF5 A;  4FIM A;  2DVC A;  3TFL A;  3I6V A;  3PPN A;  4XEQ A;  2Q89 A;  2XWK A;  4H8J A;  1FCK A;  3LSL A;  2XX9 A;  4JVD A;  3VVF A;  1QJM A;  4RY1 A;  2LAO A;  4QFK A;  4X8R A;  3K02 A;  2HPG A;  2UYE A;  3H6V A;  3MQ9 A;  3L6H A;  3RT8 A;  2FHY A;  3PUY E;  1LAG E;  1FTJ A;  2PFZ A;  4XFE A;  2P2A A;  4N6D A;  5ICQ A;  2FYI A;  2VGQ A;  1RDX A;  2V3T A;  2RC8 A;  1MH3 A;  3FZV A;  3MVX A;  2I49 A;  4BDQ A;  2H9B A;  2Q2A A;  2ONS A;  1FQA A;  5I57 B;  3DLN A;  4KI0 E;  4N13 A;  3FJG A;  1FQB A;  3C36 A;  1ELJ A;  3C9H A;  1FPL A;  5I5P A;  4JBZ A;  4QXD A;  5H8N B;  4DXU A;  4R75 A;  4OTE A;  4OHN A;  4X9T A;  3KN3 A;  3V5A A;  4U2R A;  1MDQ A;  4KFQ A;  2X7Q A;  2F7B A;  1DTG A;  1FPJ A;  1USY E;  1UTB B;  4POX A;  4NHB A;  1FPK A;  3IOU A;  2RF1 A;  4I9D A;  3EHT A;  4OYV A;  3IJX B;  2FNC A;  2HQ0 A;  1ZU0 A;  4N15 A;  4TLL B;  1PBP A;  4O94 A;  1YZ0 A;  1UTB A;  4GWZ A;  3VLW A;  5EYG A;  1CB6 A;  1NH8 A;  2XXV A;  2XXI A;  1H76 A;  2R6G E;  3JV9 A;  4PP0 A;  3EQ1 A;  2QVR A;  3S9L C;  1B7U A;  4PFW A;  5I58 B;  4MLQ A;  4BDN A;  1FPG A;  4OAN A;  4LA9 A;  4QSD A;  1LBY A;  2VD2 A;  4H5F A;  2FIX A;  1B4Z A;  3H6T A;  3TTM A;  3PPP A;  2Z8D A;  4F19 A;  2HAU A;  1FBE A;  4L17 A;  4NF4 B;  5L9S A;  3QK6 A;  4MF3 A;  3FXQ A;  1MY0 A;  1YCJ A;  4F31 B;  1SYI A;  2Z23 A;  1T0K A;  1NV4 A;  2NOO A;  2P3N A;  1B0H A;  3TQL A;  1WOD A;  1S7Y A;  1N84 A;  2Y7I A;  4ESX A;  3IO4 A;  1URD A;  2CMO A;  1TFD A;  4GRK A;  4ZEF A;  5I2N A;  4POW A;  4OZ9 A;  1B2H A;  4HXV A;  1H43 A;  4IO7 A;  1MQG A;  3O6I A;  3VFJ A;  1K9Y A;  3T9U A;  3OOA A;  1MY1 A;  4ELP A;  3RNN A;  3LV0 A;  4R9G A;  4N8G A;  4FEC A;  2V3Q A;  1H44 A;  4LVQ A;  4ELR A;  3IR1 A;  5M2V A;  1Q35 A;  1Q1K A;  2FVZ A;  3QYT A;  4O8M A;  4JSD A;  1DSN A;  1NNK A;  3UIF A;  4I62 A;  1IMF A;  3RYA A;  2XXW A;  1FJ9 A;  2PX1 A;  3C34 A;  5ELV A;  3SZP A;  1B46 A;  2Y7W A;  2QMX A;  1JEV A;  5HM4 B;  3MAM A;  3QSL A;  4IB2 A;  2OWT A;  2QL3 A;  3KFM A;  3FTO A;  3VLV A;  1NH7 A;  2Z8F A;  2XHD A;  1IZ1 A;  3A3U A;  2IA4 A;  1MQH A;  3G7W A;  3D4G A;  2O51 A;  5TPA B;  1NNP A;  4PTK A;  3FV1 A;  1ZMG A;  2Y5K A;  4M1V A;  4LAT A;  1LBC A;  1OVB A;  1USY H;  2M8C A;  5TPA A;  5LTC A;  1Z7N E;  5L9M A;  3FVO A;  2OLB A;  4NF6 A;  5DTB A;  5B7D A;  5J16 A;  1BP5 A;  1B0L A;  3QIM A;  2B65 A;  1JET A;  1Y4T A;  3MJN A;  3M8U A;  2I3W A;  3FXR A;  3O6G A;  3DM0 A;  3PPQ A;  4NWC A;  3ZKK A;  5I2K A;  4P9K A;  1LAX A;  2H99 A;  1NMU A;  1IUD A;  1NUX A;  2QS2 A;  3ROJ A;  2DOJ A;  1EYI A;  3G3I A;  3GBB A;  4N17 A;  3V8X B;  4OA4 A;  2B3F A;  3PTY A;  5DVI A;  1FQD A;  1EZ9 A;  3O66 A;  4H1X A;  3WAE A;  4PGN A;  1PB8 A;  3K1M A;  4YKP A;  4F29 A;  2VHA A;  3CHG A;  3TZA A;  1SI1 A;  4JWX A;  2AL4 A;  3LBS A;  3K0V A;  4O7I A;  4HTG A;  1M5C A;  4G61 A;  5ITO A;  5HPQ A;  4YB5 A;  1IXI A;  4NTL A;  3G3J A;  3SES A;  3PUZ E;  2XX7 A;  1IXH A;  1JVY A;  4O7M A;  2REJ A;  3HHF A;  1LBV A;  4KXP A;  5L8D A;  4MIJ A;  1Q9D A;  4YB6 A;  4XXU A;  3EN3 A;  4MJO A;  4RJZ A;  1IXC A;  1PEB A;  3RLF E;  3PUW E;  5FHO A;  1FPE A;  1MY3 A;  3C33 A;  5F7V A;  3VV5 A;  2WBD A;  3ZKL A;  2XXP A;  1UIV A;  2I0B A;  2XX8 A;  2OWS A;  5TU0 A;  2DXY A;  3FJM A;  2XXR A;  1WVJ A;  3A3C A;  3W9W A;  4YKK A;  2ONR A;  3OEK A;  2DSF A;  4ZE8 A;  2DQV A;  2GFE A;  1XVX A;  4NQ8 A;  2D5W A;  4GWS A;  3OEL A;  3RT6 B;  3CG3 A;  1MXY A;  3KZG A;  3FBP A;  1FTK A;  4RK9 A;  4AS4 A;  2JJK A;  1LBZ A;  1B51 A;  3KJ7 A;  3TKD A;  1US5 A;  5KCJ A;  3C4M A;  2RC9 A;  3N6U A;  2GHB A;  3UA8 A;  2VD3 A;  2WOP A;  3V83 A;  4ZZE A;  3TAJ A;  4JSO A;  1UIU A;  1MQJ A;  1Y20 A;  1II5 A;  1AWB A;  3TEL A;  4NF8 B;  4GL0 A;  3PUV E;  2UVI A;  4KYD A;  1MY4 A;  1D3K A;  2XXH A;  1P1O A;  4X48 A;  3SEX A;  1M5B A;  2F5X A;  5EQ7 A;  1NL5 A;  2PVU A;  3KC0 A;  2ONK E;  5AA2 D;  1R6Z A;  3FGS A;  3QAX A;  4N07 A;  2XD2 A;  2UVG A;  3O2A A;  1R9Q A;  4G2Z A;  2OK2 A;  3PV0 E;  4MH5 A;  1J1N A;  2G29 A;  2CEX A;  2R71 A;  1MQD A;  2XXU A;  3NOH A;  4IO3 A;  4MX6 A;  5CBR A;  2H5Y A;  4MEV A;  2F97 A;  4F2O A;  3IOW A;  2ZXT A;  5CMC A;  1A8F A;  4H6D A;  1TT1 A;  4MAG A;  5JEI A;  3DRG A;  4Q5T A;  2I58 A;  2CEY A;  3HFU A;  4IO4 A;  3T0J A;  3HHG A;  2XXY A;  1MH4 A;  1SD3 A;  1UTH A;  1DOT A;  4JXI A;  4PGP A;  1P99 A;  1M5E A;  2XXQ A;  2A5T A;  4UAB A;  2O84 X;  1QW0 A;  1QUL A;  1MXZ A;  4QBA A;  3B50 A;  3RPL B;  2WBB A;  2DWA A;  1N76 A;  4KHZ E;  3FIR A;  3R6U A;  3RY3 A;  1GVC A;  3N94 A;  2UXA A;  1XC1 A;  3E4R A;  3RYD A;  1AOV A;  3TCG A;  3RN8 A;  2HZK A;  1SW1 A;  2D3I A;  5J1D A;  3RQT A;  2G93 A;  1NV5 A;  4XTC Q;  4GWY A;  4NGU A;  5I56 A;  3OD7 A;  3OO9 A;  3KSX A;  3OEN A;  3E3K A;  2FA7 A;  5TP9 B;  1Y1Z A;  3TPA A;  4HE0 A;  4NG7 A;  4LON B;  1SQY A;  2A5S A;  1B6H A;  1NV7 A;  2DWH A;  2ZNS A;  1FBP A;  2WEF A;  2F3B A;  4LUB A;  1MRP A;  2OZZ A;  2WKY A;  4NX1 A;  4EDP A;  4TLM B;  2R8T A;  4ONY A;  3DP8 A;  3PMV A;  2XWO A;  4YMA A;  3MPK A;  1B3G A;  3KGC A;  5KDT B;  3EHU A;  4PET A;  4JB7 A;  1IME A;  2UVH A;  3G3F A;  3PMX A;  4IO2 A;  3DP6 A;  1M5D A;  1SVX B;  3G3G A;  4RPN A;  2Z8E A;  2VT5 A;  4X04 A;  1LCF A;  1FBF A;  2Q9T A;  5IZZ A;  1B3F A;  5DW8 A;  1OLA A;  2CZI A;  2HHM A;  3KOS A;  1N3X A;  5I57 A;  3OXN A;  1JVX A;  3DRJ A;  2P1S A;  5ET5 A;  4IGT A;  3HN0 A;  2DWI A;  1N7X A;  4NE4 A;  1LAH E;  3CFX A;  5H8N A;  1CNQ A;  1DMB A;  4OVS A;  3KN7 A;  2QS4 A;  2XA5 A;  3ONM A;  1XOC A;  4YKJ A;  5KZT A;  4LQ5 A;  2DP8 A;  1L5T A;  1AIV A;  4EUO A;  2DE4 A;  4IY5 A;  5H8H B;  5IZ1 A;  1ZTY A;  3S9M C;  3L6G A;  3S9E A;  1N0T A;  1NUY A;  1FRP A;  4FJP A;  3OSR A;  3W9V A;  2XXT A;  5H8H A;  4PF6 A;  4I1D A;  1JP4 A;  2UVJ A;  5T3J A;  3VVE A;  3IB1 A;  4FED A;  3AXF A;  5I3S A;  3UGW A;  2PYY A;  3G3K A;  4P3L A;  5I58 A;  4Q30 B;  2XWV A;  2F6G A;  2O69 A;  5H8F B;  3TTR A;  4ZZA A;  1I69 A;  1FBD A;  2VOZ A;  3MP8 A;  4PAF A;  1H45 A;  3PD8 A;  4R6H A;  3RYB A;  2ZNT A;  1A8E A;  3SEY A;  1VE4 A;  4G8H A;  5H8F A;  1IIT A;  4OWD A;  1FTO A;  4NF4 A;  3O9P A;  2Y7R A;  3LSX A;  1MXU A;  4H0W A;  1NV0 A;  1UQW A;  3G3H A;  1B40 A;  4BLA A;  4C1U A;  2MKZ A;  4PFT A;  4NN3 A;  5I7I A;  1JQF A;  3CRB A;  3M3L A;  4PF8 A;  3K6U A;  4U1O A;  5AA1 A;  3BFT A;  3SEW A;  5LDZ A;  5ET7 A;  4PQJ A;  4DXC A;  3SKP A;  1VDW A;  3PAM A;  1BIY A;  1VFE A;  4YAH X;  4QFP A;  1VFD A;  5H8Q B;  3Q29 A;  4NED A;  1SYH A;  2XXK A;  5CM6 A;  1I6B A;  3USD A;  4G8N A;  4ZE9 A;  1H3D A;  2WOK A;  3E9X A;  4DCX A;  1GGG A;  3TTL A;  5H8Q A;  3C32 A;  4KCC A;  2V93 A;  1IXG A;  2O1L A;  4JWO A;  3KSJ A;  4P56 A;  4ESW A;  1XT8 A;  4JVI A;  4U1Z A;  2NVU B;  3A09 A;  4LZ5 A;  1SDX A;  1JNF A;  3BIG A;  4PAK A;  2R9J A;  2F7C A;  4OXV A;  1TXF A;  3KC1 A;  4AB5 A;  1YYZ A;  3B8B A;  3LSF B;  2V3U A;  3CSG A;  4GWO A;  4XIG Q;  4PFI A;  3HO7 A;  4MCO A;  1LGB C;  2ZNU A;  4P11 A;  3FVG A;  5F24 A;  3UN6 A;  3C31 A;  5A5X B;  1B5J A;  2F7A A;  1JW1 A;  3FD3 A;  3CVG A;  1IQ7 A;  4GD5 A;  1B9J A;  2X7P A;  4HCY A;  4XKR A;  2XD3 A;  4DIG A;  4DCY A;  3KOT A;  2GRV A;  3EPE A;  5CRY A;  4FBP A;  1FQC A;  4U21 A;  5HBC A;  2QJE A;  3W15 C;  4QHQ A;  1RYO A;  4DDD A;  1I6Q A;  4GX4 A;  1SW5 A;  5EQ8 A;  4QF9 A;  3U93 A;  3O6H A;  4F2Q A;  5B70 A;  1YPN A;  4PCD A;  5ISU A;  1IIW A;  2HAV A;  1ANF A;  1SI0 A;  3U1O A;  3TTN A;  5L9O A;  2HCA A;  3B7D A;  4FE8 A;  1A54 A;  3K4U A;  3MVZ A;  4KQP A;  5BUU A;  4IO5 A;  4PFB A;  2F6P A;  1PBQ A;  4XKN A;  3IOV A;  1ZKB A;  4R72 A;  2AL5 A;  3MP6 A;  4JDF A;  5AA2 B;  4RPO A;  5LOM A;  1PB9 A;  1LFI A;  4GFR A;  3S2V A;  3Q26 A;  1IMD A;  4OQO A;  3GLB A;  2ALU A;  3N26 A;  4THI A;  4ND9 A;  4OEV A;  3PPR A;  3I5O A;  1QUI A;  2OJT A;  3QMF A;  4U23 A;  1P1N A;  3DEL B;  4OVP A;  4C0R A;  3RUM A;  3K6V A;  4ZDM A;  3R7X A;  3TEP A;  3ZSF A;  4UAC A;  3FVN A;  4BDM A;  1GTK A;  3T9V A;  2FIE A;  2WOL A;  1D9V A;  1AMF A;  1PDA A;  2O7I A;  2REG A;  5I59 B;  4YU0 A;  1OLC A;  5F1Q A;  2CZH A;  2CZL A;  4GF8 A;  4MNI A;  1A55 A;  3A29 A;  3K00 A;  3V89 B;  1FW0 A;  3VVD A;  5I59 A;  4LP2 B;  2O6A A;  4R73 A;  4G68 B;  5IKB A;  4X1B A;  1FPI A;  2HXW A;  3OO8 A;  3E13 X;  3GBA A;  1A7L A;  2E0S A;  1AH5 A;  1HSJ A;  1MXW A;  4U22 A;  1DPP A;  3K01 A;  4G77 A;  5IM2 A;  3BBR A;  3TQW A;  3MZ9 A;  2B3B A;  2WYP A;  2QVU A;  2ESN A;  1KZ8 A;  1N3W A;  4P0I A;  1FTA A;  3RTF B;  1IEJ A;  3QXM A;  1NKX A;  4DI3 D;  3B6T A;  2ZZW A;  5EQ9 A;  3PU5 A;  3RTW B;  4NF8 A;  4X1D A;  1PC3 A;  2B4L A;  2B4M A;  3U92 A;  3U65 A;  1SW2 A;  2WYK A;  1D9Y A;  1NNF A;  2YJP A;  1RYX A;  4JVC A;  3BKI B;  1FQE A;  2Z22 A;  4IGR A;  1BTJ A;  1FBC A;  4R2B A;  3FXB A;  4KR5 A;  4MBP A;  5DT6 A;  4MFI A;  5ITP A;  4ZED A;  3IFA A;  1FPD A;  4PFR A;  3K6W A;  4WKM A;  3I3V A;  1B5H A;  1DK4 A;  1DCU A;  3ILT B;  1GV8 A;  1SW4 A;  2YLN A;  4H46 A;  3E79 A;  2BJJ X;  4LN5 A;  4OFL A;  2DYX A;  4F3S A;  1QKB A;  3O97 A;  5AA3 A;  4U4S A;  1RDY A;  2V25 A;  4OVT A;  1QUJ A;  1MM7 A;  4JWY A;  4O3B A;  1KWH A;  3FJ7 A;  4PDD A;  2ZZX A;  2ZYN A;  1P1U A;  3ISP A;  3H7M A;  3O29 A;  3JYR A;  4DZ1 A;  4F3B A;  1LCT A;  2P0S A;  1B32 A;  3BIH A;  4F1Y A;  3MZ1 A;  1FTL A;  4PFY A;  3DRI A;  3MP1 A;  4GWU A;  4OFJ A;  2AIX A;  5DVJ A;  3B6W A;  3DP4 A;  1MG1 A;  1URG A;  1SPI A;  5CMM A;  2THI A;  1ATG A;  3ECR A;  2QSX A;  3IFC A;  3RPL A;  2I4C A;  3O28 A;  4NF0 A;  3DRH A;  2ANJ A;  1MY2 A;  1EYK A;  3SDF A;  5CC2 A;  1B4H A;  4YZZ A;  1NFT A;  3VXC A;  4TQU Q;  1QVS A;  1POT A;  1JW5 A;  4KCD A;  1OIB A;  2RCA A;  1A99 A;  4EQ7 A;  2HZL A;  5TP9 A;  4IY6 A;  2H25 A;  4H65 A;  4QSC A;  4WXJ A;  1JEU A;  1WDN A;  4N8Y A;  2KLF A;  3RPW A;  2I4B A;  4EQB A;  1MQI A;  4ZEC A;  1POY 1;  3OO6 A;  4I8C A;  2V4C A;  1DPE A;  4Q0C A;  4HE1 A;  1MM6 A;  2NUV A;  5DYH A;  1XI6 A;  1INP A;  3C35 A;  4AS5 A;  4EF2 A;  3OMB A;  3KG2 A;  3H3G A;  3CR9 A;  3K1N A;  5FTI A;  3UOR A;  4YIC A;  4I3E A;  5KDT A;  1FPF A;  3TDJ A;  4GWX A;  4H67 A;  4C1T A;  1DBZ A;  2RKM A;  4QFL A;  2GQ1 A;  1LLS A;  4PE3 A;  4F1V A;  5AA4 B;  1B3H A;  4IO6 A;  2I0C A;  1YAE A;  3HST A;  3PUX E;  2DE2 A;  2DWJ A;  4DXB A;  1B58 A;  1P1Q A;  5IAI A;  3FXU A;  4OER A;  2FBP A;  3FAT A;  3TOD A;  4GX6 A;  1IMB A;  5AA4 A;  2VPN A;  3UP9 A;  1LST A;  2DXR A;  3TCF A;  4P0G A;  5AE4 A;  1NV2 A;  1JW4 A;  1BLF A;  5FHM A;  4R2F A;  1FQF A;  1MPD A;  3IB2 A;  1YXI A;  4ZS9 A;  4GBW A;  1Y9U A;  2Q8M A;  1ZLQ A;  2RIN A;  4ZEK A;  3Q27 A;  3P7I A;  3U8Q A;  1LFG A;  3M3F A;  1NV6 A;  5DEX B;  2UYF A;  3IB0 A;  3IL1 B;  3JZJ A;  4HS7 A;  3TYH A;  3N6T A;  2RCB A;  1R1N A;  1B3L A;  2ABH A;  1OVT A;  4RXL A;  4N6P A;  2HXR A;  2O7U A;  1LEV A;  1QUK A;  4ISU A;  2F3D A;  1B52 A;  5DEX A;  2ZYK A;  3WAF A;  2NWJ A;  1EH3 A;  1LFH A;  4I3Y A;  4R9F A;  4QFN A;  1NV1 A;  2XXX A;  5FBP A;  1LAF E;  4GQO A;  3T22 A;  1TFA A;  4RNS A;  3S9N C;  1Y3N A;  2PFY A;  1URS A;  4U4X A;  3T66 A;  3S4U A;  3KBR A;  3K6X A;  4I40 A;  4NAP A;  3OEM A;  5CMK A;  3QUJ A;  3B6Q A;  4AB6 A;  3H4Z A;  4M4G A;  5I84 A;  2PT1 A;  1OMP A;  2Q74 A;  4HW8 A;  4H5G A;  2DS9 A;  2KQZ A;  3UK4 A;  3LSW A;  4KD5 A;  2X26 A;  2O1M A;  4P47 A;  4GVO A;  1K9Z A;  3SEV A;  4PC9 A;  4PBQ A;  4E0W A;  1ZIU A;  5IZ3 B;  4PBH A;  2XWI A;  1SBP A;  1N04 A;  2V84 A;  2F34 A;  4G68 C;  5K2X A;  1G0I A;  1HSE A;  3FUZ A;  1YTV A;  3HCQ A;  3RGY A;  4QSE A;  5I2N B;  4E0X A;  3T96 B;  1EU8 A;  2HEU A;  4MNC A;  5IZ3 A;  3CFL A;  1Y1M A;  1A40 A;  4GX3 A;  1B1H A;  4OVJ A;  2Q88 A;  1B7Z A;  5BWJ A;  4OVQ A;  3KBZ A;  2ZYO A;  2OBG A;  2GHA A;  2PMS A;  2AYS A;  2PBW A;  3MBP A;  4G8M A;  1MPC A;  1RDZ A;  4AQ4 A;  3IO6 A;  3VE1 B;  2DVZ A;  4IR8 A;  4ZEB A;  3DRK A;  3MWB A;  1Y3P A;  3SER A;  3F11 A;  3PPO A;  1D4N A;  2Q2C A;  1NNT A;  2QFL A;  4EXK A;  2OX3 A;  1KA0 A;  4DLD A;  4F1U A;  3O6P A;  1FPB A;  5K2Y A;  4WED A;  1MS7 A;  2I3V A;  3H03 A;  2QPQ A;  3PMW A;  4XKQ A;  1TWY A;  4GLI A;  4LZ8 A;  2OCU A;  4OES A;  1O63 A;  1B7H A;  2Y84 A;  2KR0 A;  1OQH A;  5ET8 A;  2D21 A;  2Y7P A;  4NF6 B;  4FOR A;  4OMB A;  2Q8J A;  1LB9 A;  4PAI A;  3U72 A;  5EHS A;  5ET6 A;  3T1B A;  1P1W A;  3DRF A;  2H4I A;  1EZP A;  4FAT A;  4O3A A;  1FSA A;  4FEB A;  3THI A;  4F3G A;  5I2K B;  1CE2 A;  5A5X A;  1HSL A;  4GXS B;  5DVF A;  4HCW A;  4OEU A;  1AL3 A;  3KEI A;  1NUW A;  3EHS A;  4QFO A;  2Y7K A;  1DTZ A;  1LBW A;  3IAZ A;  5ICT A;  3MPL A;  3VDF A;  3FVK A;  3TMG A;  1S9T A;  3MW0 A;  2OWZ A;  4EF1 A;  4BDL A;  1LB8 A;  2DE3 A;  1QKA A;  4RA1 A;  4Z7E A;  4R6Y A;  3H06 B;  1D9Q A;  4LQ2 A;  3CSB A;  3K2D A;  2QS3 A;  3VXB A;  3FAS A;  4OVR A;  1NI9 A;  3GXA A;  4FAJ A;  3K1P A;  3OSQ A;  4G4P A;  3H6U A;  3EF7 A;  1NUZ A;  1B5I A;  1GR2 A;  1LBB A;  4NF5 B;  3LVU A;  1B3E A;  2F35 A;  2L5V A;  1I6A A;  4NMY A;  1EYJ A;  4GBV A;  3T93 B;  1S50 A;  3LR1 A;  1O64 A;  3FV2 A;  5AA2 A;  4YMB A;  3KJT A;  4NF5 A;  2QRY A;  2O68 A;  2GH9 A;  1XVY A;  3MST A;  3LC8 A;  5FHN A;  4MHF A;  4HE2 A;  3HPI A;  1FBH A;  4N81 A;  2ZYM A;  4F3P A;  4RYA A; 
#chains in the Genus database with same CATH homology
 4LZ7 A;  2YPN A;  4XKP A;  1BKA A;  1F9B A;  3MVW A;  2F8D A;  4EXL A;  3IOT A;  5FTH A;  4F18 A;  3IX1 A;  3U94 A;  1Y3Q A;  3OO7 A;  3T9H B;  3H6W A;  1MXX A;  4QRZ A;  3GZG A;  2HFB A;  1Y4C A;  4EQ9 A;  2I6E A;  3SEU A;  1PB7 A;  3PGF A;  1O7T A;  2NXO A;  4BDR A;  4F22 A;  3Q28 A;  4G68 A;  4ELO A;  2F36 A;  4Z0I A;  5KCJ B;  3M3K A;  4UA8 A;  3TCH A;  4KYE A;  4YKI A;  2QMW A;  3ODB A;  1XHY A;  3IOR A;  4KPT A;  4MLV A;  4O3C A;  1R9L A;  4PE5 B;  4GXA A;  5EHM A;  3PD9 A;  1M5F A;  4PFU A;  3ZS6 A;  4Q8R A;  5JTY B;  4DE8 A;  1XS5 A;  3HV1 A;  2QS1 A;  3IJO B;  5CMB A;  4ELQ A;  5JTY A;  1OQG A;  3MC2 A;  3QUF A;  3CFZ A;  4R6K A;  1B05 A;  4GL8 A;  2I48 A;  3MZB A;  4WEP A;  5H8S A;  4K3F A;  1N7W A;  3KN8 A;  4KYS A;  4GIZ A;  4YB7 A;  3LUY A;  2H98 A;  5JK4 A;  1MPB A;  2E1S A;  3CI8 A;  2IEE A;  2W7Y A;  1FTM A;  1UTH B;  3MVY A;  1Z7M E;  1MXV A;  3T9X B;  3SET A;  4ECF A;  2A5T B;  4NWD A;  3TUS A;  5CBS A;  1VSO A;  1B1X A;  1ZJL A;  3VLU A;  1MDP 1;  1RKM A;  3MUQ A;  1ZBM A;  3ILU B;  5EYF A;  3IK6 B;  1EZO A;  4OET A;  3Q25 A;  3TTK A;  3N5L A;  4R74 A;  4OEN A;  2F78 A;  5I56 B;  1US4 A;  2PT2 A;  3D4C A;  4GOT A;  2ZMB A;  5CI5 A;  2RC7 A;  3CG1 A;  4TOZ A;  4F39 A;  3BFU A;  4ZEI A;  4OFO A;  4RK2 A;  4H8I A;  4BDO A;  3CIJ A;  3R26 A;  2VP1 A;  1VR5 A;  4FIM A;  2DVC A;  3TFL A;  3I6V A;  3PPN A;  2Q89 A;  4H8J A;  1FCK A;  3LSL A;  2XX9 A;  3VVF A;  1QJM A;  4RY1 A;  2LAO A;  4QFK A;  3K02 A;  2UYE A;  3H6V A;  3MQ9 A;  3L6H A;  3RT8 A;  3PUY E;  1LAG E;  1FTJ A;  2P2A A;  5ICQ A;  2FYI A;  2VGQ A;  2V3T A;  2RC8 A;  1MH3 A;  3FZV A;  3MVX A;  2I49 A;  4BDQ A;  2H9B A;  2Q2A A;  2ONS A;  1FQA A;  5I57 B;  3DLN A;  4KI0 E;  4N13 A;  3FJG A;  1FQB A;  3C36 A;  1ELJ A;  3C9H A;  4JBZ A;  5H8N B;  4DXU A;  4R75 A;  4OTE A;  4OHN A;  4X9T A;  3KN3 A;  3V5A A;  4U2R A;  1MDQ A;  4KFQ A;  2X7Q A;  2F7B A;  1DTG A;  1USY E;  1UTB B;  4POX A;  3IOU A;  2RF1 A;  4I9D A;  3EHT A;  4OYV A;  3IJX B;  2FNC A;  2HQ0 A;  1ZU0 A;  4TLL B;  1PBP A;  1UTB A;  3VLW A;  1CB6 A;  1NH8 A;  2XXV A;  2XXI A;  1H76 A;  2R6G E;  3JV9 A;  4PP0 A;  3EQ1 A;  3S9L C;  1B7U A;  4PFW A;  5I58 B;  4MLQ A;  4BDN A;  4LA9 A;  4QSD A;  2VD2 A;  4H5F A;  1B4Z A;  3H6T A;  3TTM A;  3PPP A;  2Z8D A;  4F19 A;  2HAU A;  4L17 A;  4NF4 B;  5L9S A;  3QK6 A;  4MF3 A;  3FXQ A;  1MY0 A;  1YCJ A;  4F31 B;  1SYI A;  2Z23 A;  1T0K A;  2NOO A;  1B0H A;  3TQL A;  1WOD A;  1S7Y A;  1N84 A;  2Y7I A;  4ESX A;  3IO4 A;  1URD A;  2CMO A;  1TFD A;  4GRK A;  4ZEF A;  5I2N A;  4POW A;  4OZ9 A;  1B2H A;  1H43 A;  4IO7 A;  1MQG A;  3O6I A;  3VFJ A;  3T9U A;  3OOA A;  1MY1 A;  4ELP A;  3RNN A;  4R9G A;  4FEC A;  2V3Q A;  1H44 A;  4LVQ A;  4ELR A;  3IR1 A;  5M2V A;  1Q35 A;  1Q1K A;  3QYT A;  4JSD A;  1DSN A;  1NNK A;  3UIF A;  4I62 A;  3RYA A;  2XXW A;  2PX1 A;  3C34 A;  5ELV A;  1B46 A;  2Y7W A;  2QMX A;  1JEV A;  5HM4 B;  3MAM A;  3QSL A;  4IB2 A;  2OWT A;  2QL3 A;  3KFM A;  3FTO A;  3VLV A;  1NH7 A;  2Z8F A;  2XHD A;  1IZ1 A;  3A3U A;  2IA4 A;  1MQH A;  3G7W A;  3D4G A;  2O51 A;  5TPA B;  1NNP A;  3FV1 A;  1ZMG A;  4M1V A;  4LAT A;  1LBC A;  1OVB A;  1USY H;  2M8C A;  5TPA A;  1Z7N E;  5L9M A;  3FVO A;  2OLB A;  4NF6 A;  5DTB A;  5B7D A;  1BP5 A;  1B0L A;  3QIM A;  2B65 A;  1JET A;  1Y4T A;  3MJN A;  3M8U A;  2I3W A;  3FXR A;  3O6G A;  3DM0 A;  3PPQ A;  4NWC A;  3ZKK A;  5I2K A;  1LAX A;  2H99 A;  1NMU A;  1IUD A;  2QS2 A;  2DOJ A;  3G3I A;  3GBB A;  3V8X B;  2B3F A;  5DVI A;  1FQD A;  1EZ9 A;  3O66 A;  4H1X A;  3WAE A;  1PB8 A;  3K1M A;  4YKP A;  4F29 A;  2VHA A;  3CHG A;  3TZA A;  1SI1 A;  4JWX A;  2AL4 A;  3LBS A;  3K0V A;  4HTG A;  1M5C A;  5ITO A;  5HPQ A;  4YB5 A;  1IXI A;  4NTL A;  3G3J A;  3SES A;  3PUZ E;  2XX7 A;  1IXH A;  1JVY A;  2REJ A;  3HHF A;  5L8D A;  4YB6 A;  4XXU A;  3EN3 A;  4RJZ A;  1IXC A;  1PEB A;  3RLF E;  3PUW E;  5FHO A;  1MY3 A;  3C33 A;  5F7V A;  3VV5 A;  3ZKL A;  2XXP A;  1UIV A;  2I0B A;  2XX8 A;  2OWS A;  5TU0 A;  2DXY A;  3FJM A;  2XXR A;  1WVJ A;  3A3C A;  3W9W A;  4YKK A;  2ONR A;  3OEK A;  2DSF A;  4ZE8 A;  2DQV A;  2GFE A;  1XVX A;  2D5W A;  3OEL A;  3RT6 B;  3CG3 A;  1MXY A;  3KZG A;  1FTK A;  4RK9 A;  1B51 A;  3KJ7 A;  3TKD A;  1US5 A;  5KCJ A;  3C4M A;  2RC9 A;  3N6U A;  2GHB A;  3UA8 A;  2VD3 A;  2WOP A;  3V83 A;  4ZZE A;  3TAJ A;  4JSO A;  1UIU A;  1MQJ A;  1Y20 A;  1II5 A;  3TEL A;  4NF8 B;  4GL0 A;  3PUV E;  2UVI A;  4KYD A;  1MY4 A;  1D3K A;  2XXH A;  1P1O A;  4X48 A;  3SEX A;  1M5B A;  2F5X A;  1NL5 A;  2PVU A;  2ONK E;  5AA2 D;  1R6Z A;  3FGS A;  3QAX A;  4N07 A;  2XD2 A;  2UVG A;  3O2A A;  1R9Q A;  4G2Z A;  2OK2 A;  3PV0 E;  4MH5 A;  1J1N A;  2G29 A;  2R71 A;  1MQD A;  2XXU A;  4IO3 A;  5CBR A;  2H5Y A;  2F97 A;  4F2O A;  3IOW A;  2ZXT A;  5CMC A;  1A8F A;  4H6D A;  1TT1 A;  5JEI A;  3DRG A;  4Q5T A;  2I58 A;  4IO4 A;  3HHG A;  2XXY A;  1MH4 A;  1SD3 A;  1UTH A;  1DOT A;  4JXI A;  1P99 A;  1M5E A;  2XXQ A;  2A5T A;  2O84 X;  1QW0 A;  1QUL A;  1MXZ A;  2DWA A;  1N76 A;  4KHZ E;  3FIR A;  3R6U A;  3RY3 A;  1GVC A;  3N94 A;  2UXA A;  1XC1 A;  3E4R A;  1AOV A;  3TCG A;  3RN8 A;  2HZK A;  1SW1 A;  2D3I A;  5J1D A;  3RQT A;  2G93 A;  4XTC Q;  5I56 A;  3OD7 A;  3OO9 A;  3KSX A;  3OEN A;  3E3K A;  2FA7 A;  5TP9 B;  1Y1Z A;  3TPA A;  4LON B;  1SQY A;  2A5S A;  1B6H A;  2DWH A;  2ZNS A;  4LUB A;  1MRP A;  2OZZ A;  2WKY A;  4EDP A;  4TLM B;  4ONY A;  3DP8 A;  3PMV A;  4YMA A;  3MPK A;  1B3G A;  3KGC A;  5KDT B;  3EHU A;  4PET A;  4JB7 A;  2UVH A;  3G3F A;  3PMX A;  4IO2 A;  3DP6 A;  1M5D A;  1SVX B;  3G3G A;  4RPN A;  2Z8E A;  1LCF A;  2Q9T A;  1B3F A;  1OLA A;  3KOS A;  1N3X A;  5I57 A;  3OXN A;  1JVX A;  3DRJ A;  2P1S A;  4IGT A;  3HN0 A;  2DWI A;  1N7X A;  4NE4 A;  1LAH E;  3CFX A;  5H8N A;  1DMB A;  3KN7 A;  2QS4 A;  3ONM A;  1XOC A;  4YKJ A;  5KZT A;  4LQ5 A;  2DP8 A;  1L5T A;  1AIV A;  4EUO A;  2DE4 A;  4IY5 A;  5H8H B;  3S9M C;  1ZTY A;  3L6G A;  3S9E A;  1N0T A;  4FJP A;  3OSR A;  3W9V A;  2XXT A;  5H8H A;  4I1D A;  2UVJ A;  3VVE A;  3IB1 A;  4FED A;  3AXF A;  3UGW A;  2PYY A;  3G3K A;  5I58 A;  4Q30 B;  2F6G A;  2O69 A;  5H8F B;  3TTR A;  4ZZA A;  1I69 A;  2VOZ A;  3MP8 A;  1H45 A;  3PD8 A;  4R6H A;  3RYB A;  2ZNT A;  1A8E A;  3SEY A;  1VE4 A;  4G8H A;  5H8F A;  1IIT A;  4OWD A;  1FTO A;  4NF4 A;  3O9P A;  2Y7R A;  3LSX A;  1MXU A;  4H0W A;  1UQW A;  3G3H A;  1B40 A;  4BLA A;  4C1U A;  4PFT A;  1JQF A;  3CRB A;  3M3L A;  3K6U A;  4U1O A;  5AA1 A;  3BFT A;  3SEW A;  4PQJ A;  4DXC A;  3SKP A;  3PAM A;  1BIY A;  1VFE A;  4YAH X;  4QFP A;  1VFD A;  5H8Q B;  3Q29 A;  4NED A;  1SYH A;  5CM6 A;  1I6B A;  3USD A;  4G8N A;  4ZE9 A;  1H3D A;  2WOK A;  3E9X A;  4DCX A;  1GGG A;  3TTL A;  5H8Q A;  3C32 A;  4KCC A;  2V93 A;  1IXG A;  2O1L A;  4JWO A;  3KSJ A;  4ESW A;  1XT8 A;  4U1Z A;  2NVU B;  3A09 A;  4LZ5 A;  1SDX A;  1JNF A;  2R9J A;  2F7C A;  4OXV A;  1TXF A;  4AB5 A;  3LSF B;  2V3U A;  3CSG A;  4GWO A;  4XIG Q;  3HO7 A;  1LGB C;  2ZNU A;  4P11 A;  3FVG A;  3UN6 A;  3C31 A;  5A5X B;  1B5J A;  2F7A A;  1JW1 A;  3FD3 A;  3CVG A;  1IQ7 A;  4GD5 A;  1B9J A;  2X7P A;  4HCY A;  4XKR A;  2XD3 A;  4DIG A;  4DCY A;  3KOT A;  2GRV A;  3EPE A;  5CRY A;  1FQC A;  4U21 A;  5HBC A;  2QJE A;  3W15 C;  4QHQ A;  1RYO A;  4DDD A;  1I6Q A;  1SW5 A;  4QF9 A;  3U93 A;  3O6H A;  4F2Q A;  5B70 A;  1YPN A;  5ISU A;  1IIW A;  2HAV A;  1ANF A;  1SI0 A;  3U1O A;  3TTN A;  5L9O A;  2HCA A;  3B7D A;  4FE8 A;  1A54 A;  3K4U A;  3MVZ A;  4KQP A;  5BUU A;  4IO5 A;  2F6P A;  1PBQ A;  4XKN A;  3IOV A;  1ZKB A;  4R72 A;  2AL5 A;  3MP6 A;  4JDF A;  5AA2 B;  4RPO A;  5LOM A;  1PB9 A;  1LFI A;  4GFR A;  3S2V A;  3Q26 A;  4OQO A;  3GLB A;  2ALU A;  3N26 A;  4THI A;  4ND9 A;  4OEV A;  3PPR A;  3I5O A;  1QUI A;  2OJT A;  4U23 A;  1P1N A;  3DEL B;  4C0R A;  3RUM A;  3K6V A;  4ZDM A;  3R7X A;  3TEP A;  3ZSF A;  4UAC A;  3FVN A;  4BDM A;  1GTK A;  3T9V A;  2WOL A;  1D9V A;  1AMF A;  1PDA A;  2O7I A;  2REG A;  5I59 B;  4YU0 A;  1OLC A;  5F1Q A;  2CZL A;  4GF8 A;  1A55 A;  3K00 A;  3V89 B;  1FW0 A;  3VVD A;  5I59 A;  4LP2 B;  2O6A A;  4R73 A;  4G68 B;  5IKB A;  4X1B A;  2HXW A;  3OO8 A;  3E13 X;  3GBA A;  1A7L A;  2E0S A;  1AH5 A;  1HSJ A;  1MXW A;  4U22 A;  1DPP A;  3K01 A;  4G77 A;  3BBR A;  3TQW A;  3MZ9 A;  2B3B A;  2ESN A;  1N3W A;  4P0I A;  3RTF B;  1IEJ A;  3QXM A;  1NKX A;  3B6T A;  3PU5 A;  3RTW B;  4NF8 A;  4X1D A;  1PC3 A;  2B4L A;  2B4M A;  3U92 A;  1SW2 A;  1D9Y A;  1NNF A;  2YJP A;  1RYX A;  3BKI B;  1FQE A;  2Z22 A;  4IGR A;  1BTJ A;  4R2B A;  4KR5 A;  4MBP A;  5DT6 A;  4MFI A;  5ITP A;  4ZED A;  3K6W A;  4WKM A;  3I3V A;  1B5H A;  3ILT B;  1GV8 A;  1SW4 A;  2YLN A;  2BJJ X;  4OFL A;  2DYX A;  4F3S A;  1QKB A;  3O97 A;  5AA3 A;  4U4S A;  2V25 A;  1QUJ A;  1MM7 A;  4JWY A;  4O3B A;  1KWH A;  3FJ7 A;  2ZYN A;  1P1U A;  3H7M A;  3O29 A;  3JYR A;  4DZ1 A;  4F3B A;  1LCT A;  2P0S A;  1B32 A;  4F1Y A;  3MZ1 A;  1FTL A;  4PFY A;  3DRI A;  3MP1 A;  4OFJ A;  2AIX A;  5DVJ A;  3B6W A;  3DP4 A;  1MG1 A;  1URG A;  5CMM A;  2THI A;  1ATG A;  3ECR A;  2QSX A;  2I4C A;  3O28 A;  3DRH A;  2ANJ A;  1MY2 A;  3SDF A;  5CC2 A;  1B4H A;  4YZZ A;  1NFT A;  3VXC A;  4TQU Q;  1QVS A;  1POT A;  1JW5 A;  4KCD A;  1OIB A;  2RCA A;  1A99 A;  4EQ7 A;  2HZL A;  5TP9 A;  4IY6 A;  2H25 A;  4H65 A;  4QSC A;  4WXJ A;  1JEU A;  1WDN A;  2KLF A;  3RPW A;  2I4B A;  4EQB A;  1MQI A;  4ZEC A;  1POY 1;  3OO6 A;  4I8C A;  1DPE A;  4Q0C A;  1MM6 A;  2NUV A;  5DYH A;  3C35 A;  4EF2 A;  3OMB A;  3KG2 A;  3H3G A;  3CR9 A;  3K1N A;  5FTI A;  3UOR A;  4YIC A;  5KDT A;  3TDJ A;  4H67 A;  4C1T A;  2RKM A;  4QFL A;  1LLS A;  4F1V A;  5AA4 B;  1B3H A;  4IO6 A;  2I0C A;  1YAE A;  3HST A;  3PUX E;  2DE2 A;  2DWJ A;  4DXB A;  1B58 A;  1P1Q A;  5IAI A;  3FXU A;  4OER A;  3FAT A;  3TOD A;  5AA4 A;  3UP9 A;  1LST A;  2DXR A;  3TCF A;  4P0G A;  5AE4 A;  1JW4 A;  1BLF A;  5FHM A;  4R2F A;  1FQF A;  1MPD A;  3IB2 A;  4ZS9 A;  1Y9U A;  1ZLQ A;  2RIN A;  4ZEK A;  3Q27 A;  3P7I A;  3U8Q A;  1LFG A;  3M3F A;  5DEX B;  2UYF A;  3IB0 A;  3IL1 B;  3JZJ A;  4HS7 A;  3TYH A;  3N6T A;  2RCB A;  1R1N A;  1B3L A;  2ABH A;  1OVT A;  4RXL A;  4N6P A;  2O7U A;  1QUK A;  4ISU A;  1B52 A;  5DEX A;  2ZYK A;  3WAF A;  2NWJ A;  1EH3 A;  1LFH A;  4R9F A;  4QFN A;  2XXX A;  1LAF E;  4GQO A;  3T22 A;  1TFA A;  4RNS A;  3S9N C;  1Y3N A;  1URS A;  4U4X A;  3T66 A;  3S4U A;  3KBR A;  3K6X A;  3OEM A;  5CMK A;  3QUJ A;  3B6Q A;  4AB6 A;  3H4Z A;  4M4G A;  5I84 A;  2PT1 A;  1OMP A;  4HW8 A;  4H5G A;  2DS9 A;  3UK4 A;  3LSW A;  4KD5 A;  2X26 A;  2O1M A;  4GVO A;  3SEV A;  4E0W A;  1ZIU A;  1SBP A;  1N04 A;  2V84 A;  2F34 A;  4G68 C;  5K2X A;  1HSE A;  3FUZ A;  3RGY A;  1YTV A;  3HCQ A;  4QSE A;  5I2N B;  4E0X A;  3T96 B;  1EU8 A;  2HEU A;  3CFL A;  1Y1M A;  1A40 A;  1B1H A;  4OVJ A;  2Q88 A;  1B7Z A;  5BWJ A;  2ZYO A;  2OBG A;  2GHA A;  2PMS A;  2AYS A;  2PBW A;  3MBP A;  4G8M A;  1MPC A;  4AQ4 A;  3IO6 A;  3VE1 B;  2DVZ A;  4ZEB A;  3DRK A;  3MWB A;  1Y3P A;  3SER A;  3F11 A;  3PPO A;  1D4N A;  2Q2C A;  1NNT A;  4EXK A;  4DLD A;  4F1U A;  3O6P A;  5K2Y A;  4WED A;  1MS7 A;  2I3V A;  3H03 A;  2QPQ A;  3PMW A;  4XKQ A;  1TWY A;  4GLI A;  4LZ8 A;  2OCU A;  4OES A;  1O63 A;  1B7H A;  2Y84 A;  1OQH A;  2D21 A;  2Y7P A;  4NF6 B;  4FOR A;  4OMB A;  2Q8J A;  1LB9 A;  3U72 A;  5EHS A;  1P1W A;  3DRF A;  2H4I A;  1EZP A;  4FAT A;  4O3A A;  4FEB A;  3THI A;  4F3G A;  5I2K B;  1CE2 A;  5A5X A;  1HSL A;  4GXS B;  5DVF A;  4HCW A;  4OEU A;  1AL3 A;  3KEI A;  3EHS A;  4QFO A;  2Y7K A;  1DTZ A;  3IAZ A;  5ICT A;  3MPL A;  3VDF A;  3FVK A;  3TMG A;  1S9T A;  3MW0 A;  4EF1 A;  4BDL A;  1LB8 A;  2DE3 A;  1QKA A;  4RA1 A;  4Z7E A;  4R6Y A;  3H06 B;  4LQ2 A;  3CSB A;  3K2D A;  2QS3 A;  3VXB A;  3FAS A;  3GXA A;  4FAJ A;  3K1P A;  3OSQ A;  4G4P A;  3H6U A;  3EF7 A;  1B5I A;  1GR2 A;  1LBB A;  4NF5 B;  3LVU A;  1B3E A;  2F35 A;  1I6A A;  4NMY A;  3T93 B;  1S50 A;  3LR1 A;  1O64 A;  3FV2 A;  5AA2 A;  4YMB A;  3KJT A;  4NF5 A;  2QRY A;  2O68 A;  2GH9 A;  1XVY A;  3LC8 A;  5FHN A;  3HPI A;  2ZYM A;  4F3P A;  4RYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...