1B2HA

Oligo-peptide binding protein complexed with lysyl-ornithyl-lysine
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
total genus 186
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b2hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b2hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b2hA02
4C1TA 3QSLA 3H4ZA 1H43A 4OVJA 2HQ0A 1MY2A 3HSTA 4RXLA 4JBZA 3RPWA 3G3FA 4ELPA 3S9MC 4TLLB 1LAFE 4GOTA 4U2RA 3E9XA 3DRIA 3TCHA 3C9HA 2Z8EA 2UVHA 2XXWA 3IO4A 4KI0E 4GF8A 4O3BA 5F7VA 3OEKA 3K02A 4MFIA 4U1ZA 3VVEA 1NMUA 1O64A 2H98A 1A8EA 1QVSA 1LB9A 3ZS6A 4G68A 4WEPA 4FEBA 2ALUA 4NF8B 4FATA 3TEPA 3PV0E 4KHZE 4YB7A 3D4CA 5M2VA 3VLWA 3HPIA 1SW1A 1MXVA 3TMGA 4EQ9A 4GD5A 5AE4A 2V84A 2VD3A 5KZTA 1POTA 4PFUA 2GHAA 2XXIA 1NKXA 4P0IA 3CVGA 4MLVA 4IGTA 5HBCA 3MWBA 4F39A 1H45A 1NNPA 3A3UA 5I2KB 3VLVA 3KJTA 1SBPA 1Y1MA 2Q9TA 2VD2A 3B6WA 3OSRA 1UTBA 4H5GA 1NFTA 1US4A 1YPNA 5DVIA 5DYHA 2O1MA 2NVUB 5I58B 4GQOA 5LOMA 2AIXA 4GLIA 3DRHA 2ESNA 3K00A 3P7IA 3PD9A 5TPAB 4TQUQ 2QL3A 3IB0A 1USYH 3IAZA 4LP2B 1XVYA 1SW5A 4R2BA 4ZS9A 2D5WA 3QIMA 2DYXA 3K1MA 5EHMA 5CMMA 5K2YA 3Q26A 2RCBA 4IO7A 4OZ9A 4F19A 1I6QA 1P1QA 1TWYA 4F3SA 1XC1A 3K6UA 3PU5A 4Z0IA 3BFUA 3TTRA 1LBCA 2P0SA 2DOJA 1PEBA 4H67A 2O1LA 4NEDA 3IOUA 1J1NA 4OTEA 4F1YA 3MVZA 2Y7PA 2F97A 1Q35A 3RQTA 2GHBA 4RK9A 1VR5A 4IY5A 4XTCQ 5H8QA 4ZE9A 4R2FA 4OXVA 1BP5A 2B3BA 1H76A 3KOTA 3S2VA 1NNTA 2F7CA 3DM0A 4NWCA 1MY3A 4U23A 2DXYA 1A54A 3RYBA 3HCQA 3MVXA 1UIVA 5TU0A 3W9VA 4BDRA 4OFJA 1M5CA 4OETA 1N7WA 2A5SA 4M1VA 3V5AA 4GL8A 1B3HA 1TFDA 3O6GA 3FVGA 4H6DA 1MRPA 4ESWA 2VHAA 1Y4CA 2D21A 3DP6A 3U1OA 3QUFA 1A99A 3LSXA 2KLFA 3UK4A 1SD3A 4E0WA 3U94A 1FQDA 1AH5A 4F29A 4POXA 4QFOA 3E3KA 1SDXA 3OO9A 1VFDA 1B40A 1DPEA 1EZOA 3O66A 1XS5A 2IEEA 2NXOA 3N26A 2I0BA 3MVYA 1ZIUA 4QF9A 4ZZEA 4DLDA 1CE2A 4RJZA 3A3CA 1O63A 4DXBA 1PBPA 3O6PA 5I2NA 3UA8A 1LAGE 1SYIA 1TT1A 2A5TB 1JVYA 2REJA 2ZMBA 3HN0A 4ZECA 3TCGA 1DTGA 4P0GA 3TTMA 4MBPA 2RC7A 3T93B 2XXUA 1N0TA 2HZLA 3DRJA 3MZ9A 2PMSA 4LQ5A 4QSDA 4ONYA 1EH3A 2Q88A 3C4MA 1BLFA 4TLMB 2RC8A 4UA8A 4WEDA 3TTNA 2F78A 1M5EA 3KN3A 4IO2A 2F36A 1OLAA 2OWTA 1D9YA 2F5XA 3PMWA 3R26A 2Z8FA 3N94A 4KR5A 2X7QA 2Y7IA 1Y3NA 4O3CA 3DP8A 3UN6A 4F31B 3A09A 4OEVA 4DCYA 2XX8A 3VVFA 1ANFA 2OJTA 2XXXA 4FORA 5ELVA 4RA1A 3IORA 4NE4A 2ZYNA 1T0KA 3K01A 1MXYA 1GVCA 3MUQA 1LB8A 3PPRA 4R6KA 5A5XB 4QHQA 2DE3A 4DXUA 4OWDA 3DRGA 3FUZA 4YKJA 4ZEDA 1MS7A 3T96B 2QJEA 3DRFA 4DZ1A 4EXKA 2ONRA 4ELQA 5BWJA 1XVXA 2UVGA 1UTHB 1R1NA 4I1DA 4KYSA 1EU8A 4I9DA 1FTLA 1XT8A 2RINA 3OO6A 4NTLA 1BTJA 1II5A 3EPEA 3RLFE 4DIGA 5B70A 4HW8A 4R75A 4HCWA 4YZZA 3MPLA 2UVIA 5EHSA 1LSTA 4OENA 3FVOA 3ZSFA 2Z8DA 3R7XA 4F22A 5A5XA 1FTJA 1JW1A 3W15C 3DLNA 3IR1A 3MAMA 4IO3A 3I3VA 4OMBA 5CI5A 4DXCA 4Q30B 1VFEA 4GIZA 3MQ9A 4PP0A 3BKIB 5BUUA 3PUWE 3VVDA 3QK6A 2V3TA 3V8XB 4DE8A 4YMAA 4YKIA 3M3KA 1B3LA 2FYIA 3OO8A 3SESA 4GVOA 2F7BA 4NF6B 1B5JA 3C31A 1B7HA 4F18A 5AA4A 2UYFA 5JK4A 1ELJA 5I2KA 1ZTYA 5KDTA 1B52A 4KD5A 4XKQA 1QJMA 3CFZA 4GL0A 3G3HA 2ABHA 2HCAA 2PBWA 4R9GA 1NNKA 3M8UA 1MY0A 1B5IA 4OFOA 3HHGA 3EHTA 2PT2A 4O3AA 3IB2A 4H8JA 3EN3A 3TTKA 4F1UA 4QFLA 3DRKA 1MM6A 1Y3QA 3FIRA 2O7UA 3C32A 3G3KA 3SEVA 2Y7KA 4OQOA 2WKYA 3TQLA 5AA3A 2I48A 2G93A 4G77A 4FEDA 3Q29A 5JEIA 1XOCA 4QFNA 3G3JA 4ECFA 4R6YA 4FIMA 2QS3A 3FGSA 4X1DA 2B4MA 3KZGA 4DDDA 4I8CA 2FNCA 3IOVA 2XXHA 4ND9A 2NUVA 2B65A 3EHSA 4R9FA 2CMOA 3CIJA 4Q0CA 1B3EA 1B58A 3K1NA 4ZEKA 3KSJA 4QSEA 2WOPA 3JYRA 4YAHX 1PB9A 1B32A 4XKPA 1B1XA 2RCAA 5F1QA 2AL5A 4JWOA 1FQCA 1VSOA 5H8HA 5I59A 1ZJLA 2G29A 1N84A 2YJPA 3K6WA 1MH4A 2GFEA 3OENA 4ZEIA 2O6AA 2OBGA 1YAEA 1SVXB 1YCJA 1QUKA 1Y1ZA 4AQ4A 4MLQA 3LC8A 1EZPA 1LLSA 3T9HB 3CG1A 1WDNA 3IB1A 3KFMA 5ITPA 1DMBA 4OFLA 2QS4A 3LVUA 1FQEA 3GBBA 3ZKKA 2AYSA 1A8FA 2R9JA 4IO4A 1MH3A 2DWJA 4YB5A 4HCYA 1IITA 3VFJA 1RYOA 1UQWA 2VGQA 3B7DA 4I62A 1N3XA 1NL5A 5IKBA 3FJ7A 3SERA 3L6HA 3IOTA 1NH7A 2Y7WA 1LGBC 2OZZA 3KSXA 1IQ7A 3H06B 5AA4B 1PBQA 1JVXA 1LFIA 5KCJB 4L17A 3PUZE 4G68C 4C0RA 4YKPA 4GXSB 1SI0A 3RNNA 4F2QA 1SI1A 5CC2A 5TPAA 1FCKA 3H7MA 5I56A 2PVUA 2ZXTA 4QFKA 3MC2A 2I3VA 3PMVA 4NF5A 4YMBA 3R6UA 4EF1A 2AL4A 3MP8A 1TFAA 1B6HA 4QFPA 3ODBA 3QUJA 2ZNSA 3BBRA 4RK2A 3THIA 5HPQA 1RYXA 2X7PA 1OLCA 2O7IA 1FQFA 4MF3A 1DOTA 3SETA 2Y84A 4IO5A 1IXIA 3BFTA 1VE4A 1NH8A 3CSBA 4HTGA 5CMBA 2Q8JA 4U4XA 2DE4A 3Q27A 2HXWA 1LCFA 1UIUA 4K3FA 4X48A 4X1BA 5FHMA 4BLAA 4EQBA 1GR2A 4ESXA 4FAJA 3FATA 3O97A 2F34A 3RY3A 4POWA 3VXCA 1N7XA 2WOKA 3H6UA 4NF8A 3USDA 2P2AA 1O7TA 4F1VA 4G68B 1EZ9A 4H0WA 1M5BA 1B46A 2Y7RA 2I0CA 2R6GE 2RF1A 2ZYMA 4LA9A 2WOLA 3I5OA 3M3LA 4QSCA 3OMBA 3RN8A 4Q8RA 2PYYA 3CHGA 1JEUA 1S7YA 1F9BA 3FXRA 2XD3A 3K6XA 1ZLQA 2HFBA 5K2XA 3S4UA 2DVCA 2O84X 3Q25A 4KYDA 1Y20A 5DEXA 3LSWA 3UIFA 1MG1A 2ONSA 4KQPA 4R72A 5HM4B 1DSNA 4ZZAA 3W9WA 1H44A 1FTOA 5DTBA 4IY6A 4RPOA 1P1NA 2VOZA 3TELA 4OEUA 1JW4A 4EQ7A 1ZKBA 4OESA 1MY4A 4KCCA 3S9EA 1P1UA 2X26A 1S50A 3HO7A 1MXZA 1MXXA 3K0VA 1BIYA 1Y9UA 3K2DA 2RKMA 1ATGA 3QXMA 3TDJA 4KPTA 4U1OA 1DPPA 5DVJA 2QPQA 3TKDA 3ZKLA 3QYTA 3B6QA 1AOVA 3PUVE 3U72A 2Z22A 1B4ZA 2OWSA 5FTIA 5L9OA 4BDQA 1WVJA 3OD7A 1B0LA 1QKAA 4OHNA 3AXFA 1SQYA 3PGFA 3PPPA 2Z23A 4FECA 4YICA 5FHOA 1JQFA 1QKBA 3CFXA 3KN7A 4LZ8A 3GXAA 3PPQA 3H6WA 1B2HA 4JSOA 1US5A 2F35A 4LQ2A 3H03A 1P1WA 5CBSA 1MXUA 5ICTA 1RKMA 5KDTB 1R9LA 4H1XA 2F8DA 4NF6A 1HSJA 4N13A 3OOAA 3HHFA 1M5FA 1PC3A 4H65A 5H8NB 1PB7A 3LBSA 2XXRA 2UYEA 4BDLA 1DTZA 1HSEA 1D3KA 2DQVA 3D4GA 3DELB 3E13X 3KBRA 4C1UA 4F3GA 3MP6A 3SEYA 3UORA 4F3PA 2XXVA 3PUYE 5L8DA 3FVNA 1B05A 4ZEBA 1JNFA 2ZNUA 4KYEA 4Q5TA 4X9TA 5I59B 3RT6B 2XX7A 1MQJA 1MDQA 1SW4A 2DVZA 3KN8A 1B7UA 1L5TA 1URGA 3T22A 5H8QB 3IJOB 3KJ7A 2OK2A 3MJNA 2V3QA 3S9LC 3CFLA 4LONB 3O6HA 3IJXB 3MVWA 3IK6B 1YTVA 4LZ5A 1UTHA 2XXQA 3VXBA 1ZBMA 2P1SA 1LBBA 2B3FA 3GLBA 4HS7A 4IO6A 1GV8A 3SEWA 5IAIA 1LAHE 1OIBA 3SEXA 3N5LA 5H8FA 3LR1A 3RTFB 3RUMA 2Q2CA 4WKMA 4ISUA 5CM6A 3O2AA 2CZLA 2F6GA 3OXNA 3Q28A 3UGWA 2DP8A 5AA2A 2QMWA 4UACA 2V93A 4P11A 4GWOA 4BDNA 3KOSA 2F7AA 3PUXE 4NF5B 4ELRA 4AB5A 1B4HA 5I56B 1MDP1 3TFLA 1B1HA 1B3GA 4OERA 2UXAA 5J1DA 4Z7EA 4FE8A 1MY1A 4XKNA 1N76A 5L9MA 1LFHA 4THIA 1IXHA 5I58A 2O51A 1I6BA 1MPBA 4U4SA 3EHUA 2YLNA 1GTKA 1OMPA 3FD3A 2E0SA 2HAVA 5AA2B 1OVBA 3FV2A 4TOZA 2ZNTA 1SYHA 1IIWA 3O9PA 3MZBA 3FZVA 3HV1A 5KCJA 2I3WA 1GGGA 2FA7A 2OCUA 3LSLA 3EF7A 3PPOA 3RYAA 4FJPA 4G8NA 4JXIA 4NMYA 4ELOA 1LCTA 4PFTA 3OO7A 3GBAA 5ITOA 3U8QA 5L9SA 5I2NB 2NOOA 1FQBA 1MQHA 3PMXA 3F11A 5FHNA 1LAXA 1D9VA 1JW5A 3T9UA 2UVJA 1B7ZA 1MQDA 3MP1A 3IX1A 1OVTA 4G8MA 4NWDA 2DE2A 1R9QA 3FASA 3O28A 4N6PA 1B9JA 1Z7ME 2DWHA 3PPNA 4YKKA 3FTOA 2XHDA 3L6GA 4KFQA 4WXJA 2H9BA 1IUDA 4XIGQ 3WAEA 3K4UA 3O29A 4JWYA 4YB6A 5H8HB 1B51A 3UP9A 2QMXA 1IXCA 5ICQA 1TXFA 4BDMA 1AIVA 4H8IA 2ONKE 4ZDMA 3TODA 4ZE8A 1USYE 3EQ1A 2PX1A 3RGYA 5AA2D 4JDFA 3CSGA 3C36A 3RT8A 1QW0A 3LUYA 4YU0A 3V83A 2H5YA 2XD2A 1P99A 2V25A 1I6AA 2I49A 3K1PA 3QAXA 3C35A 4ZEFA 4LATA 1MQGA 2I6EA 3ONMA 1N04A 4NF4B 3RTWB 4GFRA 2RC9A 4OYVA 1URDA 2DS9A 2GH9A 2ZYOA 1NNFA 4R73A 3VV5A 1MQIA 2QSXA 2QS1A 3N6UA 2XX9A 3SKPA 5JTYB 1Y4TA 2XXYA 3B6TA 4GXAA 4RY1A 4XXUA 3C33A 2LAOA 3KGCA 5FTHA 1A7LA 4PETA 1FW0A 3SEUA 1FTKA 2H4IA 4RPNA 1A55A 4MH5A 4R6HA 2E1SA 3TTLA 2DXRA 1JETA 4IB2A 1Y3PA 3TQWA 4GRKA 3TYHA 1ZU0A 2O69A 2ZYKA 1XHYA 4RYAA 3U93A 3WAFA 2W7YA 3DP4A 2H25A 4E0XA 4EDPA 2HEUA 5CRYA 2DWIA 3ILTB 1AL3A 3MPKA 2V3UA 5B7DA 3T9VA 1A40A 1UTBB 2O68A 3FVKA 1OQGA 1Z7NE 3CR9A 3G3GA 1ZMGA 5EYFA 3TAJA 5DEXB 4LUBA 4PFWA 5CMCA 3PD8A 5JTYA 4RNSA 4PFYA 3IL1B 1FQAA 1IEJA 2XXTA 5I84A 1CB6A 4JSDA 1M5DA 1WODA 4G8HA 4PE5B 1I69A 1B5HA 3T9XB 1R6ZA 2F6PA 1QULA 3TPAA 3CRBA 3OELA 5H8FB 1QUIA 1PB8A 2QRYA 3U92A 3FJMA 1SW2A 1JEVA 1BKAA 2VP1A 3G7WA 3FV1A 3KG2A 3KEIA 4G2ZA 5CBRA 3TUSA 2OLBA 1MPDA 1B3FA 1H3DA 1N3WA 2I4CA 2GRVA 2PT1A 4JB7A 4U22A 2H99A 3O6IA 3VDFA 3T66A 3CI8A 4M4GA 2I58A 2IA4A 2M8CA 5DVFA 4F2OA 1QUJA 5DT6A 3MW0A 4EF2A 3VE1B 1AMFA 3FJGA 2HAUA 3MZ1A 3CG3A 3G3IA 5H8SA 1IZ1A 1HSLA 3MBPA 2ANJA 3S9NC 2DSFA 1MM7A 4N07A 2NWJA 4QRZA 3GZGA 3I6VA 3V89B 4U21A 5H8NA 3PAMA 2YPNA 1LFGA 1URSA 1Q1KA 4LVQA 3ECRA 2QS2A 1P1OA 5AA1A 2Q89A 1PDAA 3E4RA 3OEMA 4AB6A 1MPCA 1IXGA 3JZJA 3C34A 5TP9A 4F3BA 3H3GA 5I57A 1B0HA 1KWHA 1POY1 3K6VA 3M3FA 3SDFA 3H6VA 2R71A 3IO6A 3JV9A 3LSFB 3H6TA 4KCDA 4R74A 4EUOA 2XXPA 3OSQA 3N6TA 4BDOA 2A5TA 4XKRA 1MXWA 1D4NA 4JWXA 2B4LA 2REGA 3ILUB 4H5FA 4NF4A 4LZ7A 2HZKA 4PQJA 5CMKA 5I57B 3VLUA 5TP9B 3TCFA 4DCXA 4G4PA 2DWAA 2I4BA 3FXUA 5ISUA 2THIA 3TZAA 1OQHA 3FXQA 1S9TA 3IOWA 2D3IA 4EXLA 4IGRA 1FTMA 2BJJX 2Q2AA
chains in the Genus database with same CATH superfamily
4N6KA 3QSLA 1H43A 4UABA 3RPWA 4ELPA 4U2RA 3TCHA 2F3BA 2Z8EA 3IO4A 4O3BA 1O64A 4WEPA 2ALUA 4NF8B 5M2VA 3VLWA 3HPIA 4OVSA 2XXIA 4PE3A 1NKXA 4P0IA 3MWBA 3A3UA 3KJTA 1FBGA 1UTBA 1XI6A 5DVIA 5I58B 5LOMA 3K00A 3IB0A 4H46A 4LP2B 1SW5A 2CZKA 5CMMA 3Q26A 4F19A 1XC1A 3PU5A 2DOJA 2FHYA 4NEDA 2O1LA 2F97A 2XWIA 5H8QA 4IY5A 1BP5A 4QBAA 1NNTA 3HCQA 1N7WA 2A5SA 3V5AA 4XEQA 4GL8A 4I40A 4H6DA 2VHAA 3U1OA 1A99A 4F29A 1AH5A 1SDXA 1EZOA 3N26A 1FBFA 2I0BA 3MVYA 4DXBA 3IFCA 3O6PA 1FPFA 5I2NA 3UA8A 2ZMBA 3HN0A 4ZECA 1DTGA 5IGAA 4LQ5A 2PMSA 3DRJA 4ONYA 3C4MA 4UA8A 3TTNA 4WEDA 2F78A 3R26A 1D9YA 3N94A 2X7QA 4P1EA 4DCYA 3VVFA 1ANFA 2OJTA 2XXXA 4P9KA 1LB8A 2DE3A 4OWDA 4YKJA 1IMEA 1XVXA 2QVUA 4NTLA 4DIGA 1BTJA 1II5A 4R75A 4PFRA 5EHSA 3FVOA 3R7XA 1FTJA 1JW1A 3W15C 3IR1A 4DXCA 2ZZXA 1FPEA 5CI5A 3VVDA 2V3TA 3SESA 3C31A 4PFBA 4XKQA 1QJMA 2ABHA 2PBWA 1NNKA 3HHGA 4N81A 4H8JA 3DRKA 3FIRA 2O7UA 1LBXA 3G3KA 5FBPA 3ISPA 2I48A 2G93A 1FJ6A 1XOCA 4ECFA 3G3JA 4R6YA 3FGSA 3KZGA 4KXPA 4DDDA 4I8CA 2FNCA 3IOVA 4ND9A 3EHSA 4R9FA 1B3EA 4PBHA 2WOPA 1B1XA 5F1QA 4OVTA 1RDZA 3B50A 2GFEA 3OENA 1SVXB 1QUKA 4HE1A 1WDNA 4XFEA 4GWSA 3ZKLA 1MH3A 4YB5A 2VGQA 1DCUA 1N3XA 3SERA 3KSXA 1IQ7A 3H06B 4C0RA 3HFUA 1SI0A 4F2QA 1IMDA 4NF5A 3ODBA 1B6HA 4QFPA 4RK2A 4NG7A 1RYXA 1FQFA 4MF3A 2VPNA 1IXIA 3BFTA 1VE4A 4OA4A 3E79A 4BLAA 4K3FA 5FHMA 1GR2A 3RY3A 1O7TA 4G68B 1M5BA 2I0CA 2ZYMA 5AA3A 2WOLA 4NN3A 1IMFA 3OMBA 4P56A 2PYYA 1JEUA 1F9BA 3K6XA 3S4UA 1ZLQA 3UIFA 2O84X 4KYDA 1NV5A 1MG1A 2ONSA 4KQPA 1H44A 2VOZA 1MY4A 4KCCA 3HO7A 3K2DA 4KPTA 5DVJA 1DPPA 1SPIA 3PUVE 1B4ZA 5FTIA 1KZ8A 4BDQA 4OHNA 3PGFA 1JQFA 3GXAA 1US5A 1NV6A 3H03A 5ICTA 4NF6A 1PC3A 4OVPA 5H8NB 1PB7A 3LBSA 2XXRA 4BDLA 1HSEA 3E13X 4F3PA 5ET8A 3SEYA 4X9TA 1MDQA 3T22A 2DVZA 1YZ0A 3BIHA 2OK2A 2V3QA 3LUZA 4LONB 3O6HA 3IJXB 1FBCA 3GLBA 4IO6A 1GV8A 4MCOA 3N5LA 2Q2CA 4WKMA 2CZLA 2V93A 4BDNA 3KOSA 3PUXE 5I56B 1B3GA 5LTCA 1K9ZA 2UXAA 5L9MA 5J16A 1BK4A 4THIA 1IXHA 2O51A 1GTKA 1OVBA 1JP4A 4TOZA 1SYHA 5KCJA 2I3WA 2FA7A 5K2XA 2OCUA 5EYHA 4JXIA 3IFAA 5ITOA 3KC0A 5L9SA 1FQBA 1MQHA 1FPJA 1LAXA 1AWBA 4G8MA 3O28A 4YKKA 2H9BA 3K4UA 2QFLA 4YB6A 3UP9A 2QMXA 3LV0A 4ZDMA 3RGYA 5AA2D 3CSGA 3LUYA 4YU0A 2I49A 3C35A 3RTWB 4GFRA 2RC9A 2GH9A 3VV5A 2ZYOA 1NNFA 2QSXA 5EQAA 3B6TA 4GXAA 5FTHA 4HE2A 2DXRA 2ZYKA 3WAFA 3BIGA 3SZPA 4PAFA 5CRYA 5B7DA 1A40A 1UTBB 2O68A 1ZMGA 5ESYA 4RNSA 4PFYA 2XXTA 5IZ1A 1R6ZA 3U92A 2DDKA 1BKAA 3RYDA 5EQ8A 4EF2A 5DT6A 3MW0A 5IZZA 2NWJA 4N07A 4QRZA 2QS2A 3E4RA 3OEMA 1IXGA 3JZJA 5TP9A 5I57A 1POY1 4R74A 3LSFB 1NV7A 3H6TA 4KCDA 3OSQA 3N6TA 3NOHA 4JWXA 2REGA 4G4PA 1EYJA 3RPLB 2THIA 3IOWA 2D3IA 1FTMA 2Q2AA 5LDZA 3B8BA 3HSTA 4GX3A 3G3FA 4TLLB 2XXWA 4KI0E 4GF8A 1NMUA 5IM2A 1A8EA 1LB9A 4NHBA 4GX4A 4FATA 4KHZE 1EYIA 4P8BA 4PDHA 4GD5A 1POTA 3CVGA 2FIEA 4MLVA 2OX3A 1EYKA 1NNPA 4KFQA 4H5GA 5DYHA 1NUXA 1NFTA 1US4A 1YPNA 4DI3D 2NVUB 2O1MA 2AIXA 2ESNA 1USYH 3IAZA 2PFYA 4ZS9A 3QIMA 2DYXA 5EHMA 5K2YA 2RCBA 4MJOA 4N15A 4Z0IA 4GWUA 2WBDA 2GHBA 4FBPA 1VR5A 4XTCQ 4PCDA 1H76A 2F7CA 1FTAA 2XWOA 4NWCA 1MY3A 2DXYA 2CEYA 1A54A 1M5CA 4M1VA 1B3HA 1TFDA 4PC9A 4ESWA 2F3DA 3QUFA 3LSXA 2KLFA 3U94A 4POXA 4QFOA 2IEEA 1PBPA 2A5TB 1TT1A 2RC7A 2HZLA 3MZ9A 4QSDA 2Q88A 1BLFA 1M5EA 4KR5A 2QVVA 1Y3NA 4O3CA 3UN6A 3A09A 2VPOA 4HE0A 4NE4A 2ZYNA 1T0KA 3PPRA 4R6KA 3DRGA 2P3NA 4ZEDA 1MS7A 3T96B 4EXKA 2ONRA 4ELQA 5BWJA 2UVGA 1R1NA 4I1DA 4I9DA 3RLFE 2P3VA 5ET7A 2UVIA 3ZSFA 2Z8DA 4F22A 3DLNA 4PP0A 3BKIB 1D9QA 3M3KA 3OO8A 1B5JA 4F18A 2UYFA 5I2KA 1ZTYA 5KDTA 4KD5A 3CFZA 5JTYA 3EHTA 3TTKA 1Y3QA 3TQLA 4G77A 4I3EA 3Q29A 4OANA 4FIMA 2QS3A 4P3LA 2XXHA 3KSJA 4QSEA 3JYRA 1B32A 1FQCA 1VSOA 1ZJLA 2G29A 2YJPA 4ZEIA 2OBGA 1YAEA 1YCJA 4JVDA 1EZPA 1FBEA 4N8YA 1DMBA 4OFLA 2QS4A 1FQEA 2AYSA 1A8FA 4HCYA 1IITA 1RYOA 3B7DA 3FJ7A 2BJIA 2OZZA 4YKPA 1SI1A 5CC2A 5TPAA 5I56A 1NV1A 2I3VA 4YMBA 2AL4A 2ZNSA 4NQ8A 4HTGA 3CSBA 3Q27A 4X48A 4EQBA 1VDWA 3VXCA 1N7XA 3H6UA 4NF8A 1LBZA 1EZ9A 1B46A 4O94A 4QSCA 1NI9A 3RN8A 3CHGA 1S7YA 2DVCA 5DEXA 1Y20A 1NUYA 1FTOA 5DTBA 1P1NA 4OEUA 2CZHA 1ZKBA 1MXZA 3QXMA 4U1OA 3QYTA 1QKAA 4FECA 4YICA 5FHOA 4LQ2A 4JSOA 1P1WA 1MXUA 1RDXA 2UYEA 1D3KA 3KBRA 2Y5KA 1DK4A 3D4GA 5EQ7A 4X8RA 4C1UA 4F3GA 3MP6A 2ZNUA 2XX7A 1MQJA 1SW4A 1URGA 3S9LC 1KA0A 3TTMA 3MVWA 2R8TA 2XXQA 3VXBA 2P1SA 1NUZA 3LR1A 3RTFB 5I3SA 3Q28A 2DP8A 4UACA 4P11A 3TFLA 1YXIA 1FPDA 4XKNA 1N76A 1LFHA 2YLNA 1FPKA 3FD3A 5I5PA 2KR0A 3HV1A 4PBQA 1GGGA 3LSLA 4FJPA 3PPOA 4ELOA 4PFTA 3OO7A 3GBAA 2NOOA 3PMXA 5FHNA 3ROJA 3SETA 4PGNA 1B9JA 2DWHA 3FTOA 3WAEA 4WXJA 5ICQA 1TXFA 1AIVA 1USYE 3EQ1A 3RT8A 1QW0A 4ZEFA 4LATA 4OVQA 1N04A 4JVCA 4NF4B 1URDA 4NAPA 4R73A 1MQIA 3N6UA 2XXYA 3C33A 2LAOA 1FW0A 1FTKA 2H4IA 1A55A 2E1SA 1JETA 3TYHA 1ZU0A 5EQ9A 4E0XA 3MPKA 3FVKA 3CR9A 2VT5A 3T0JA 1FQAA 5I84A 1CB6A 4PE5B 1M5DA 1B5HA 3T9XB 3CRBA 2QRYA 3TUSA 3G7WA 4JB7A 4H45A 2H99A 3CI8A 4M4GA 3U65A 4X04A 3VE1B 3MZ1A 3FJGA 3G3IA 5H8SA 2ANJA 2FBPA 3S9NC 1MM7A 3PAMA 2YPNA 1PDAA 4AB6A 1MPCA 4F3BA 1B0HA 1KWHA 3M3FA 2R71A 3JV9A 4EUOA 4BDOA 2A5TA 4XKRA 1MXWA 4MNPA 2HZKA 4PQJA 2DWAA 3FXUA 5ISUA 1S9TA 2HXRA 4JVIA 4GWZA 2XA5A 2VD3A 2BJJX 4GBWA 3H4ZA 4OVJA 2HQ0A 1LAFE 4GOTA 3E9XA 2UVHA 5A5LA 3K02A 4U1ZA 3VVEA 4LN5A 1QVSA 3ZS6A 1YYZA 3PV0E 3D4CA 1MXVA 3TMGA 4EQ9A 1RDYA 2V84A 5KZTA 2GHAA 4IGTA 1H45A 2VD2A 3S9EA 4GQOA 3DRHA 1FPGA 5TPAB 1CNQA 1XVYA 3K1MA 1I6QA 1TWYA 4F3SA 3BFUA 1LBCA 2P0SA 1PEBA 1J1NA 2L5VA 4OTEA 3MVZA 4RK9A 4ZE9A 4OXVA 3S2VA 3RYBA 3W9VA 4OFJA 4AS5A 3O6GA 4E0WA 4GWWA 1FQDA 3E3KA 3OO9A 5EYGA 1VFDA 4AS4A 4MMPA 4QF9A 4ZZEA 1CE2A 4RJZA 3A3CA 1LAGE 1SYIA 1FJ9A 4MBPA 4TLMB 2RC8A 3KN3A 4PAKA 3TDJA 2F36A 1OLAA 2OWTA 3PMWA 2F5XA 3DP8A 4PTKA 2XX8A 4FORA 5ELVA 4RA1A 3K01A 1GVCA 3MUQA 5A5XB 4QHQA 4MIJA 4QXDA 3DRFA 4DZ1A 4GWXA 2RINA 3FBPA 4HW8A 4YZZA 3MPLA 4OENA 4IO3A 4OMBA 4NGUA 4Q30B 4GIZA 3MQ9A 1DBZA 5BUUA 3PUWE 3QK6A 4YMAA 3V8XB 2FYIA 4NF6B 2F7BA 5AA4A 5JK4A 2WX9A 1B52A 4GL0A 2WEFA 3G3HA 2HCAA 4R9GA 1MY0A 1B5IA 4F1UA 4QFLA 1MM6A 2WKYA 4QFNA 2B4MA 2NUVA 2B65A 3CIJA 4Q0CA 3K1NA 2XWKA 4YAHX 1PB9A 4XKPA 5H8HA 2AL5A 4JWOA 5F24A 4AQ4A 4MLQA 3T9HB 3IB1A 3PTYA 3KFMA 3LVUA 3GBBA 3ZKKA 2R9JA 2DWJA 4I62A 1NL5A 3L6HA 2Y7WA 5AA4B 1LGBC 1PBQA 1JVXA 5KCJB 3PUZE 1FCKA 3H7MA 2PVUA 3MC2A 4QFKA 1INPA 3PMVA 3QUJA 1TFAA 3THIA 5HPQA 4PDDA 2O7IA 2Y84A 4MNIA 4IO5A 5CMBA 4N17A 2HXWA 1UIUA 4X1BA 3FATA 3O97A 2F34A 2P2AA 1FBHA 2Y7RA 2RF1A 2R6GE 3FXRA 3E78A 4ZZAA 1NV4A 3W9WA 5HM4B 4IY6A 4RPOA 2V4CA 1JW4A 4OESA 2XXKA 2X26A 1S50A 1BIYA 1Y9UA 1ATGA 3TKDA 1AOVA 3U72A 2Z22A 2XWVA 2OWSA 4PAIA 1WVJA 3OD7A 3AXFA 4MNCA 2Z23A 3KN7A 1QKBA 3CFXA 4LZ8A 5I7IA 2F35A 1R9LA 4O7MA 2F8DA 4N13A 1M5FA 4H65A 2DQVA 2XXVA 3PUYE 5L8DA 3FVNA 1B05A 1JNFA 4Q5TA 4KYEA 5T3JA 1B7UA 2WYKA 5H8QB 4DI4B 3MJNA 3CFLA 4LZ5A 2B3FA 5IAIA 3SEWA 3SEXA 1OIBA 5H8FA 3RUMA 2HPGA 4ISUA 5CM6A 3OXNA 3UGWA 5AA2A 1LBVA 2PFZA 4NX1A 1NV2A 4AB5A 1B1HA 1I6BA 2Q8MA 3O9PA 3MZBA 3FZVA 4G8NA 4NMYA 3EF7A 3RYAA 2Y5LA 3U8QA 5I2NB 3F11A 1D9VA 3T9UA 1FPBA 1OVTA 2DE2A 4N6PA 3FASA 5I59A 1Z7ME 2XHDA 1IUDA 4XIGQ 3QMFA 4GX6A 3O29A 1IXCA 1IMBA 4H8IA 3TODA 3C36A 3MSTA 2H5YA 1NV3A 1P99A 2V25A 3QAXA 1MQGA 3ONMA 4OYVA 2DS9A 5ET6A 3SKPA 5JTYB 1Y4TA 4XXUA 4RY1A 4PETA 3SEUA 4RPNA 4MH5A 4IB2A 1Y3PA 4GRKA 4RYAA 1XHYA 2W7YA 3DP4A 4EDPA 2HEUA 3T9VA 1Z7NE 3G3GA 3TAJA 5DEXB 5CMCA 3PD8A 1FPIA 1IEJA 1WODA 1I69A 1QULA 3OELA 4P1LA 1SW2A 4G2ZA 3KG2A 3KEIA 2OLBA 1MPDA 1B3FA 1H3DA 2I4CA 1IMCA 2IA4A 4F2OA 3KC1A 3CG3A 1NV0A 3MBPA 2Q74A 2DSFA 3GZGA 3I6VA 3V89B 4U21A 5IZ3B 1LFGA 1Q1KA 4LVQA 1P1OA 3H6VA 2B4LA 3ILUB 4PGPA 5CMKA 3VLUA 4DCXA 2I4BA 1OQHA 3FXQA 3KBZA 4EXLA 3A29A 3FXBA 4C1TA 4MHFA 4RXLA 1MY2A 4JBZA 3S9MC 3DRIA 3C9HA 4N4UA 5F7VA 3OEKA 4MFIA 2H98A 4G68A 4FEBA 3TEPA 5DW8A 4YB7A 3EKIA 1SW1A 5AE4A 4PFUA 5HBCA 4F39A 5I2KB 3VLVA 5J1DA 1SBPA 1Y1MA 2Q9TA 3B6WA 3OSRA 4GLIA 3P7IA 3PD9A 4TQUQ 2QL3A 4R2BA 2D5WA 2CZIA 4IO7A 4OZ9A 3MYUA 1P1QA 3K6UA 2WBBA 4XF5A 3TTRA 4H67A 3IOUA 2Y7PA 1Q35A 3RQTA 4R2FA 2B3BA 4O8MA 3KOTA 3DM0A 4U23A 3MVXA 1UIVA 5TU0A 4BDRA 4OETA 3FVGA 1MRPA 1Y4CA 2D21A 3DP6A 3UK4A 1SD3A 1LBYA 1B40A 1DPEA 3O66A 1XS5A 2NXOA 1ZIUA 4DLDA 1IMAA 1O63A 1JVYA 5ET5A 2REJA 3TCGA 1LEVA 4P0GA 3T93B 2XXUA 1N0TA 4PF8A 4PF6A 1EH3A 4IO2A 2Z8FA 2Y7IA 4F31B 4OEVA 3IORA 1MXYA 2QVRA 3T1BA 4O7IA 4DXUA 3FUZA 2QJEA 1UTHB 4KYSA 1EU8A 1FTLA 3OO6A 1XT8A 5B70A 3EPEA 4HCWA 5ITPA 1LSTA 5A5XA 3MAMA 4MEVA 3I3VA 1VFEA 4DE8A 4YKIA 1B3LA 1KA1A 4GVOA 1B7HA 1ELJA 3M8UA 4O3AA 4OFOA 2PT2A 3IB2A 3EN3A 2HHMA 4MX6A 3SEVA 3C32A 2Y7KA 4OQOA 5JEIA 2ZZVA 4FEDA 4X1DA 1QGXA 2CMOA 1B58A 4ZEKA 4N91A 2RCAA 1N84A 3K6WA 1MH4A 2O6AA 1Y1ZA 3LC8A 1LLSA 3CG1A 4P47A 4IO4A 3VFJA 1G0IA 1K9YA 5IKBA 1UQWA 3IOTA 1NH7A 1LFIA 4L17A 2GQ1A 4G68C 5IZ3A 4GXSB 2MKZA 3RNNA 2ZXTA 3R6UA 4EF1A 3MP8A 4MAGA 3BBRA 2X7PA 1OLCA 1DOTA 2Q8JA 1NH8A 4U4XA 2DE4A 1LCFA 4ESXA 4FAJA 4POWA 2FIXA 2WOKA 3USDA 4F1VA 4H0WA 4LA9A 3I5OA 3M3LA 4Q8RA 4F1YA 2XD3A 2HFBA 3Q25A 3LSWA 4IR8A 4R72A 1DSNA 2FVZA 3TELA 4EQ7A 1P1UA 3D1RA 1MXXA 3K0VA 2RKMA 2QPQA 3B6QA 1Q9DA 2CEXA 5L9OA 1B0LA 1SQYA 3PPPA 3PPQA 3H6WA 1B2HA 5CBSA 1RKMA 5KDTB 4H1XA 1HSJA 3OOAA 3HHFA 4PFIA 1DTZA 3DELB 4I3YA 3UORA 1NUWA 4ZEBA 5I59B 3RT6B 3KN8A 1L5TA 3IJOB 3KJ7A 3IK6B 1YTVA 1UTHA 1ZBMA 1LBBA 4HS7A 1LAHE 1FSAA 3O2AA 2F6GA 2QMWA 4GWOA 2F7AA 4ELRA 4NF5B 4GBVA 1B4HA 1MDP1 4OERA 2ZZWA 4Z7EA 4FE8A 1MY1A 5I58A 1MPBA 4U4SA 3EHUA 1FPLA 1OMPA 2E0SA 2HAVA 5AA2B 2PCRA 3FV2A 2ZNTA 1IIWA 1LCTA 1JW5A 2UVJA 1B7ZA 1MQDA 3MP1A 3IX1A 4NWDA 1R9QA 3PPNA 3L6GA 4JWYA 5H8HB 3GYYA 1B51A 4BDMA 2ONKE 4ZE8A 2JJKA 2PX1A 4JDFA 4HXVA 3V83A 4GWYA 2XD2A 3K1PA 1I6AA 2I6EA 2QS1A 2XX9A 3KGCA 1A7LA 3TTLA 4R6HA 3TQWA 2O69A 3U93A 1FBDA 4NF0A 2H25A 4N8GA 2DWIA 3ILTB 1AL3A 2V3UA 1OQGA 5EYFA 4LUBA 4PFWA 3IL1B 4JSDA 4G8HA 4N6DA 2F6PA 3TPAA 5H8FB 1QUIA 1PB8A 3FJMA 1JEVA 2VP1A 3FV1A 5CBRA 2KQZA 1N3WA 2GRVA 1G0HA 2PT1A 4U22A 3O6IA 1LBWA 3T66A 3VDFA 2I58A 2M8CA 5DVFA 1FRPA 2WYPA 1QUJA 1AMFA 2HAUA 1IZ1A 1HSLA 2OWZA 5H8NA 1URSA 3ECRA 5AA1A 2Q89A 3RPLA 3C34A 3H3GA 3SDFA 3K6VA 3IO6A 2XXPA 1D4NA 4G61A 4H5FA 4NF4A 4LZ7A 5I57B 5TP9B 3TCFA 3TZAA 1FBPA 4IGRA 4OVRA
chains in the Genus database with same CATH topology
4C1TA 3QSLA 3H4ZA 1H43A 4OVJA 2HQ0A 1MY2A 3HSTA 4RXLA 4JBZA 3RPWA 3G3FA 4ELPA 3S9MC 4TLLB 1LAFE 4GOTA 4U2RA 3E9XA 3DRIA 3TCHA 3C9HA 2Z8EA 2UVHA 2XXWA 3IO4A 4KI0E 4GF8A 4O3BA 5F7VA 3OEKA 3K02A 4MFIA 4U1ZA 3VVEA 1NMUA 1O64A 2H98A 1A8EA 1QVSA 1LB9A 3ZS6A 4G68A 4WEPA 4FEBA 2ALUA 4NF8B 4FATA 3TEPA 3PV0E 4KHZE 4YB7A 3D4CA 5M2VA 3VLWA 3HPIA 1SW1A 1MXVA 3TMGA 4EQ9A 4GD5A 5AE4A 2V84A 2VD3A 5KZTA 1POTA 4PFUA 2GHAA 2XXIA 1NKXA 4P0IA 3CVGA 4MLVA 4IGTA 5HBCA 3MWBA 4F39A 1H45A 1NNPA 3A3UA 5I2KB 3VLVA 3KJTA 1SBPA 1Y1MA 2Q9TA 2VD2A 3B6WA 3OSRA 1UTBA 4H5GA 1NFTA 1US4A 1YPNA 5DVIA 5DYHA 2O1MA 2NVUB 5I58B 4GQOA 5LOMA 2AIXA 4GLIA 3DRHA 2ESNA 3K00A 3P7IA 3PD9A 5TPAB 4TQUQ 2QL3A 3IB0A 1USYH 3IAZA 4LP2B 1XVYA 1SW5A 4R2BA 4ZS9A 2D5WA 3QIMA 2DYXA 3K1MA 5EHMA 5CMMA 5K2YA 3Q26A 2RCBA 4IO7A 4OZ9A 4F19A 1I6QA 1P1QA 1TWYA 4F3SA 1XC1A 3K6UA 3PU5A 4Z0IA 3BFUA 3TTRA 1LBCA 2P0SA 2DOJA 1PEBA 4H67A 2O1LA 4NEDA 3IOUA 1J1NA 4OTEA 4F1YA 3MVZA 2Y7PA 2F97A 1Q35A 3RQTA 2GHBA 4RK9A 1VR5A 4IY5A 4XTCQ 5H8QA 4ZE9A 4R2FA 4OXVA 1BP5A 2B3BA 1H76A 3KOTA 3S2VA 1NNTA 2F7CA 3DM0A 4NWCA 1MY3A 4U23A 2DXYA 1A54A 3RYBA 3HCQA 3MVXA 1UIVA 5TU0A 3W9VA 4BDRA 4OFJA 1M5CA 4OETA 1N7WA 2A5SA 4M1VA 3V5AA 4GL8A 1B3HA 1TFDA 3O6GA 3FVGA 4H6DA 1MRPA 4ESWA 2VHAA 1Y4CA 2D21A 3DP6A 3U1OA 3QUFA 1A99A 3LSXA 2KLFA 3UK4A 1SD3A 4E0WA 3U94A 1FQDA 1AH5A 4F29A 4POXA 4QFOA 3E3KA 1SDXA 3OO9A 1VFDA 1B40A 1DPEA 1EZOA 3O66A 1XS5A 2IEEA 2NXOA 3N26A 2I0BA 3MVYA 1ZIUA 4QF9A 4ZZEA 4DLDA 1CE2A 4RJZA 3A3CA 1O63A 4DXBA 1PBPA 3O6PA 5I2NA 3UA8A 1LAGE 1SYIA 1TT1A 2A5TB 1JVYA 2REJA 2ZMBA 3HN0A 4ZECA 3TCGA 1DTGA 4P0GA 3TTMA 4MBPA 2RC7A 3T93B 2XXUA 1N0TA 2HZLA 3DRJA 3MZ9A 2PMSA 4LQ5A 4QSDA 4ONYA 1EH3A 2Q88A 3C4MA 1BLFA 4TLMB 2RC8A 4UA8A 4WEDA 3TTNA 2F78A 1M5EA 3KN3A 4IO2A 2F36A 1OLAA 2OWTA 1D9YA 2F5XA 3PMWA 3R26A 2Z8FA 3N94A 4KR5A 2X7QA 2Y7IA 1Y3NA 4O3CA 3DP8A 3UN6A 4F31B 3A09A 4OEVA 4DCYA 2XX8A 3VVFA 1ANFA 2OJTA 2XXXA 4FORA 5ELVA 4RA1A 3IORA 4NE4A 2ZYNA 1T0KA 3K01A 1MXYA 1GVCA 3MUQA 1LB8A 3PPRA 4R6KA 5A5XB 4QHQA 2DE3A 4DXUA 4OWDA 3DRGA 3FUZA 4YKJA 4ZEDA 1MS7A 3T96B 2QJEA 3DRFA 4DZ1A 4EXKA 2ONRA 4ELQA 5BWJA 1XVXA 2UVGA 1UTHB 1R1NA 4I1DA 4KYSA 1EU8A 4I9DA 1FTLA 1XT8A 2RINA 3OO6A 4NTLA 1BTJA 1II5A 3EPEA 3RLFE 4DIGA 5B70A 4HW8A 4R75A 4HCWA 4YZZA 3MPLA 2UVIA 5EHSA 1LSTA 4OENA 3FVOA 3ZSFA 2Z8DA 3R7XA 4F22A 5A5XA 1FTJA 1JW1A 3W15C 3DLNA 3IR1A 3MAMA 4IO3A 3I3VA 4OMBA 5CI5A 4DXCA 4Q30B 1VFEA 4GIZA 3MQ9A 4PP0A 3BKIB 5BUUA 3PUWE 3VVDA 3QK6A 2V3TA 3V8XB 4DE8A 4YMAA 4YKIA 3M3KA 1B3LA 2FYIA 3OO8A 3SESA 4GVOA 2F7BA 4NF6B 1B5JA 3C31A 1B7HA 4F18A 5AA4A 2UYFA 5JK4A 1ELJA 5I2KA 1ZTYA 5KDTA 1B52A 4KD5A 4XKQA 1QJMA 3CFZA 4GL0A 3G3HA 2ABHA 2HCAA 2PBWA 4R9GA 1NNKA 3M8UA 1MY0A 1B5IA 4OFOA 3HHGA 3EHTA 2PT2A 4O3AA 3IB2A 4H8JA 3EN3A 3TTKA 4F1UA 4QFLA 3DRKA 1MM6A 1Y3QA 3FIRA 2O7UA 3C32A 3G3KA 3SEVA 2Y7KA 4OQOA 2WKYA 3TQLA 5AA3A 2I48A 2G93A 4G77A 4FEDA 3Q29A 5JEIA 1XOCA 4QFNA 3G3JA 4ECFA 4R6YA 4FIMA 2QS3A 3FGSA 4X1DA 2B4MA 3KZGA 4DDDA 4I8CA 2FNCA 3IOVA 2XXHA 4ND9A 2NUVA 2B65A 3EHSA 4R9FA 2CMOA 3CIJA 4Q0CA 1B3EA 1B58A 3K1NA 4ZEKA 3KSJA 4QSEA 2WOPA 3JYRA 4YAHX 1PB9A 1B32A 4XKPA 1B1XA 2RCAA 5F1QA 2AL5A 4JWOA 1FQCA 1VSOA 5H8HA 5I59A 1ZJLA 2G29A 1N84A 2YJPA 3K6WA 1MH4A 2GFEA 3OENA 4ZEIA 2O6AA 2OBGA 1YAEA 1SVXB 1YCJA 1QUKA 1Y1ZA 4AQ4A 4MLQA 3LC8A 1EZPA 1LLSA 3T9HB 3CG1A 1WDNA 3IB1A 3KFMA 5ITPA 1DMBA 4OFLA 2QS4A 3LVUA 1FQEA 3GBBA 3ZKKA 2AYSA 1A8FA 2R9JA 4IO4A 1MH3A 2DWJA 4YB5A 4HCYA 1IITA 3VFJA 1RYOA 1UQWA 2VGQA 3B7DA 4I62A 1N3XA 1NL5A 5IKBA 3FJ7A 3SERA 3L6HA 3IOTA 1NH7A 2Y7WA 1LGBC 2OZZA 3KSXA 1IQ7A 3H06B 5AA4B 1PBQA 1JVXA 1LFIA 5KCJB 4L17A 3PUZE 4G68C 4C0RA 4YKPA 4GXSB 1SI0A 3RNNA 4F2QA 1SI1A 5CC2A 5TPAA 1FCKA 3H7MA 5I56A 2PVUA 2ZXTA 4QFKA 3MC2A 2I3VA 3PMVA 4NF5A 4YMBA 3R6UA 4EF1A 2AL4A 3MP8A 1TFAA 1B6HA 4QFPA 3ODBA 3QUJA 2ZNSA 3BBRA 4RK2A 3THIA 5HPQA 1RYXA 2X7PA 1OLCA 2O7IA 1FQFA 4MF3A 1DOTA 3SETA 2Y84A 4IO5A 1IXIA 3BFTA 1VE4A 1NH8A 3CSBA 4HTGA 5CMBA 2Q8JA 4U4XA 2DE4A 3Q27A 2HXWA 1LCFA 1UIUA 4K3FA 4X48A 4X1BA 5FHMA 4BLAA 4EQBA 1GR2A 4ESXA 4FAJA 3FATA 3O97A 2F34A 3RY3A 4POWA 3VXCA 1N7XA 2WOKA 3H6UA 4NF8A 3USDA 2P2AA 1O7TA 4F1VA 4G68B 1EZ9A 4H0WA 1M5BA 1B46A 2Y7RA 2I0CA 2R6GE 2RF1A 2ZYMA 4LA9A 2WOLA 3I5OA 3M3LA 4QSCA 3OMBA 3RN8A 4Q8RA 2PYYA 3CHGA 1JEUA 1S7YA 1F9BA 3FXRA 2XD3A 3K6XA 1ZLQA 2HFBA 5K2XA 3S4UA 2DVCA 2O84X 3Q25A 4KYDA 1Y20A 5DEXA 3LSWA 3UIFA 1MG1A 2ONSA 4KQPA 4R72A 5HM4B 1DSNA 4ZZAA 3W9WA 1H44A 1FTOA 5DTBA 4IY6A 4RPOA 1P1NA 2VOZA 3TELA 4OEUA 1JW4A 4EQ7A 1ZKBA 4OESA 1MY4A 4KCCA 3S9EA 1P1UA 2X26A 1S50A 3HO7A 1MXZA 1MXXA 3K0VA 1BIYA 1Y9UA 3K2DA 2RKMA 1ATGA 3QXMA 3TDJA 4KPTA 4U1OA 1DPPA 5DVJA 2QPQA 3TKDA 3ZKLA 3QYTA 3B6QA 1AOVA 3PUVE 3U72A 2Z22A 1B4ZA 2OWSA 5FTIA 5L9OA 4BDQA 1WVJA 3OD7A 1B0LA 1QKAA 4OHNA 3AXFA 1SQYA 3PGFA 3PPPA 2Z23A 4FECA 4YICA 5FHOA 1JQFA 1QKBA 3CFXA 3KN7A 4LZ8A 3GXAA 3PPQA 3H6WA 1B2HA 4JSOA 1US5A 2F35A 4LQ2A 3H03A 1P1WA 5CBSA 1MXUA 5ICTA 1RKMA 5KDTB 1R9LA 4H1XA 2F8DA 4NF6A 1HSJA 4N13A 3OOAA 3HHFA 1M5FA 1PC3A 4H65A 5H8NB 1PB7A 3LBSA 2XXRA 2UYEA 4BDLA 1DTZA 1HSEA 1D3KA 2DQVA 3D4GA 3DELB 3E13X 3KBRA 4C1UA 4F3GA 3MP6A 3SEYA 3UORA 4F3PA 2XXVA 3PUYE 5L8DA 3FVNA 1B05A 4ZEBA 1JNFA 2ZNUA 4KYEA 4Q5TA 4X9TA 5I59B 3RT6B 2XX7A 1MQJA 1MDQA 1SW4A 2DVZA 3KN8A 1B7UA 1L5TA 1URGA 3T22A 5H8QB 3IJOB 3KJ7A 2OK2A 3MJNA 2V3QA 3S9LC 3CFLA 4LONB 3O6HA 3IJXB 3MVWA 3IK6B 1YTVA 4LZ5A 1UTHA 2XXQA 3VXBA 1ZBMA 2P1SA 1LBBA 2B3FA 3GLBA 4HS7A 4IO6A 1GV8A 3SEWA 5IAIA 1LAHE 1OIBA 3SEXA 3N5LA 5H8FA 3LR1A 3RTFB 3RUMA 2Q2CA 4WKMA 4ISUA 5CM6A 3O2AA 2CZLA 2F6GA 3OXNA 3Q28A 3UGWA 2DP8A 5AA2A 2QMWA 4UACA 2V93A 4P11A 4GWOA 4BDNA 3KOSA 2F7AA 3PUXE 4NF5B 4ELRA 4AB5A 1B4HA 5I56B 1MDP1 3TFLA 1B1HA 1B3GA 4OERA 2UXAA 5J1DA 4Z7EA 4FE8A 1MY1A 4XKNA 1N76A 5L9MA 1LFHA 4THIA 1IXHA 5I58A 2O51A 1I6BA 1MPBA 4U4SA 3EHUA 2YLNA 1GTKA 1OMPA 3FD3A 2E0SA 2HAVA 5AA2B 1OVBA 3FV2A 4TOZA 2ZNTA 1SYHA 1IIWA 3O9PA 3MZBA 3FZVA 3HV1A 5KCJA 2I3WA 1GGGA 2FA7A 2OCUA 3LSLA 3EF7A 3PPOA 3RYAA 4FJPA 4G8NA 4JXIA 4NMYA 4ELOA 1LCTA 4PFTA 3OO7A 3GBAA 5ITOA 3U8QA 5L9SA 5I2NB 2NOOA 1FQBA 1MQHA 3PMXA 3F11A 5FHNA 1LAXA 1D9VA 1JW5A 3T9UA 2UVJA 1B7ZA 1MQDA 3MP1A 3IX1A 1OVTA 4G8MA 4NWDA 2DE2A 1R9QA 3FASA 3O28A 4N6PA 1B9JA 1Z7ME 2DWHA 3PPNA 4YKKA 3FTOA 2XHDA 3L6GA 4KFQA 4WXJA 2H9BA 1IUDA 4XIGQ 3WAEA 3K4UA 3O29A 4JWYA 4YB6A 5H8HB 1B51A 3UP9A 2QMXA 1IXCA 5ICQA 1TXFA 4BDMA 1AIVA 4H8IA 2ONKE 4ZDMA 3TODA 4ZE8A 1USYE 3EQ1A 2PX1A 3RGYA 5AA2D 4JDFA 3CSGA 3C36A 3RT8A 1QW0A 3LUYA 4YU0A 3V83A 2H5YA 2XD2A 1P99A 2V25A 1I6AA 2I49A 3K1PA 3QAXA 3C35A 4ZEFA 4LATA 1MQGA 2I6EA 3ONMA 1N04A 4NF4B 3RTWB 4GFRA 2RC9A 4OYVA 1URDA 2DS9A 2GH9A 2ZYOA 1NNFA 4R73A 3VV5A 1MQIA 2QSXA 2QS1A 3N6UA 2XX9A 3SKPA 5JTYB 1Y4TA 2XXYA 3B6TA 4GXAA 4RY1A 4XXUA 3C33A 2LAOA 3KGCA 5FTHA 1A7LA 4PETA 1FW0A 3SEUA 1FTKA 2H4IA 4RPNA 1A55A 4MH5A 4R6HA 2E1SA 3TTLA 2DXRA 1JETA 4IB2A 1Y3PA 3TQWA 4GRKA 3TYHA 1ZU0A 2O69A 2ZYKA 1XHYA 4RYAA 3U93A 3WAFA 2W7YA 3DP4A 2H25A 4E0XA 4EDPA 2HEUA 5CRYA 2DWIA 3ILTB 1AL3A 3MPKA 2V3UA 5B7DA 3T9VA 1A40A 1UTBB 2O68A 3FVKA 1OQGA 1Z7NE 3CR9A 3G3GA 1ZMGA 5EYFA 3TAJA 5DEXB 4LUBA 4PFWA 5CMCA 3PD8A 5JTYA 4RNSA 4PFYA 3IL1B 1FQAA 1IEJA 2XXTA 5I84A 1CB6A 4JSDA 1M5DA 1WODA 4G8HA 4PE5B 1I69A 1B5HA 3T9XB 1R6ZA 2F6PA 1QULA 3TPAA 3CRBA 3OELA 5H8FB 1QUIA 1PB8A 2QRYA 3U92A 3FJMA 1SW2A 1JEVA 1BKAA 2VP1A 3G7WA 3FV1A 3KG2A 3KEIA 4G2ZA 5CBRA 3TUSA 2OLBA 1MPDA 1B3FA 1H3DA 1N3WA 2I4CA 2GRVA 2PT1A 4JB7A 4U22A 2H99A 3O6IA 3VDFA 3T66A 3CI8A 4M4GA 2I58A 2IA4A 2M8CA 5DVFA 4F2OA 1QUJA 5DT6A 3MW0A 4EF2A 3VE1B 1AMFA 3FJGA 2HAUA 3MZ1A 3CG3A 3G3IA 5H8SA 1IZ1A 1HSLA 3MBPA 2ANJA 3S9NC 2DSFA 1MM7A 4N07A 2NWJA 4QRZA 3GZGA 3I6VA 3V89B 4U21A 5H8NA 3PAMA 2YPNA 1LFGA 1URSA 1Q1KA 4LVQA 3ECRA 2QS2A 1P1OA 5AA1A 2Q89A 1PDAA 3E4RA 3OEMA 4AB6A 1MPCA 1IXGA 3JZJA 3C34A 5TP9A 4F3BA 3H3GA 5I57A 1B0HA 1KWHA 1POY1 3K6VA 3M3FA 3SDFA 3H6VA 2R71A 3IO6A 3JV9A 3LSFB 3H6TA 4KCDA 4R74A 4EUOA 2XXPA 3OSQA 3N6TA 4BDOA 2A5TA 4XKRA 1MXWA 1D4NA 4JWXA 2B4LA 2REGA 3ILUB 4H5FA 4NF4A 4LZ7A 2HZKA 4PQJA 5CMKA 5I57B 3VLUA 5TP9B 3TCFA 4DCXA 4G4PA 2DWAA 2I4BA 3FXUA 5ISUA 2THIA 3TZAA 1OQHA 3FXQA 1S9TA 3IOWA 2D3IA 4EXLA 4IGRA 1FTMA 2BJJX 2Q2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1T A;  3QSL A;  3H4Z A;  1H43 A;  4OVJ A;  2HQ0 A;  1MY2 A;  3HST A;  4RXL A;  4JBZ A;  3RPW A;  3G3F A;  4ELP A;  3S9M C;  4TLL B;  1LAF E;  4GOT A;  4U2R A;  3E9X A;  3DRI A;  3TCH A;  3C9H A;  2Z8E A;  2UVH A;  2XXW A;  3IO4 A;  4KI0 E;  4GF8 A;  4O3B A;  5F7V A;  3OEK A;  3K02 A;  4MFI A;  4U1Z A;  3VVE A;  1NMU A;  1O64 A;  2H98 A;  1A8E A;  1QVS A;  1LB9 A;  3ZS6 A;  4G68 A;  4WEP A;  4FEB A;  2ALU A;  4NF8 B;  4FAT A;  3TEP A;  3PV0 E;  4KHZ E;  4YB7 A;  3D4C A;  5M2V A;  3VLW A;  3HPI A;  1SW1 A;  1MXV A;  3TMG A;  4EQ9 A;  4GD5 A;  5AE4 A;  2V84 A;  2VD3 A;  5KZT A;  1POT A;  4PFU A;  2GHA A;  2XXI A;  1NKX A;  4P0I A;  3CVG A;  4MLV A;  4IGT A;  5HBC A;  3MWB A;  4F39 A;  1H45 A;  1NNP A;  3A3U A;  5I2K B;  3VLV A;  3KJT A;  1SBP A;  1Y1M A;  2Q9T A;  2VD2 A;  3B6W A;  3OSR A;  1UTB A;  4H5G A;  1NFT A;  1US4 A;  1YPN A;  5DVI A;  5DYH A;  2O1M A;  2NVU B;  5I58 B;  4GQO A;  5LOM A;  2AIX A;  4GLI A;  3DRH A;  2ESN A;  3K00 A;  3P7I A;  3PD9 A;  5TPA B;  4TQU Q;  2QL3 A;  3IB0 A;  1USY H;  3IAZ A;  4LP2 B;  1XVY A;  1SW5 A;  4R2B A;  4ZS9 A;  2D5W A;  3QIM A;  2DYX A;  3K1M A;  5EHM A;  5CMM A;  5K2Y A;  3Q26 A;  2RCB A;  4IO7 A;  4OZ9 A;  4F19 A;  1I6Q A;  1P1Q A;  1TWY A;  4F3S A;  1XC1 A;  3K6U A;  3PU5 A;  4Z0I A;  3BFU A;  3TTR A;  1LBC A;  2P0S A;  2DOJ A;  1PEB A;  4H67 A;  2O1L A;  4NED A;  3IOU A;  1J1N A;  4OTE A;  4F1Y A;  3MVZ A;  2Y7P A;  2F97 A;  1Q35 A;  3RQT A;  2GHB A;  4RK9 A;  1VR5 A;  4IY5 A;  4XTC Q;  5H8Q A;  4ZE9 A;  4R2F A;  4OXV A;  1BP5 A;  2B3B A;  1H76 A;  3KOT A;  3S2V A;  1NNT A;  2F7C A;  3DM0 A;  4NWC A;  1MY3 A;  4U23 A;  2DXY A;  1A54 A;  3RYB A;  3HCQ A;  3MVX A;  1UIV A;  5TU0 A;  3W9V A;  4BDR A;  4OFJ A;  1M5C A;  4OET A;  1N7W A;  2A5S A;  4M1V A;  3V5A A;  4GL8 A;  1B3H A;  1TFD A;  3O6G A;  3FVG A;  4H6D A;  1MRP A;  4ESW A;  2VHA A;  1Y4C A;  2D21 A;  3DP6 A;  3U1O A;  3QUF A;  1A99 A;  3LSX A;  2KLF A;  3UK4 A;  1SD3 A;  4E0W A;  3U94 A;  1FQD A;  1AH5 A;  4F29 A;  4POX A;  4QFO A;  3E3K A;  1SDX A;  3OO9 A;  1VFD A;  1B40 A;  1DPE A;  1EZO A;  3O66 A;  1XS5 A;  2IEE A;  2NXO A;  3N26 A;  2I0B A;  3MVY A;  1ZIU A;  4QF9 A;  4ZZE A;  4DLD A;  1CE2 A;  4RJZ A;  3A3C A;  1O63 A;  4DXB A;  1PBP A;  3O6P A;  5I2N A;  3UA8 A;  1LAG E;  1SYI A;  1TT1 A;  2A5T B;  1JVY A;  2REJ A;  2ZMB A;  3HN0 A;  4ZEC A;  3TCG A;  1DTG A;  4P0G A;  3TTM A;  4MBP A;  2RC7 A;  3T93 B;  2XXU A;  1N0T A;  2HZL A;  3DRJ A;  3MZ9 A;  2PMS A;  4LQ5 A;  4QSD A;  4ONY A;  1EH3 A;  2Q88 A;  3C4M A;  1BLF A;  4TLM B;  2RC8 A;  4UA8 A;  4WED A;  3TTN A;  2F78 A;  1M5E A;  3KN3 A;  4IO2 A;  2F36 A;  1OLA A;  2OWT A;  1D9Y A;  2F5X A;  3PMW A;  3R26 A;  2Z8F A;  3N94 A;  4KR5 A;  2X7Q A;  2Y7I A;  1Y3N A;  4O3C A;  3DP8 A;  3UN6 A;  4F31 B;  3A09 A;  4OEV A;  4DCY A;  2XX8 A;  3VVF A;  1ANF A;  2OJT A;  2XXX A;  4FOR A;  5ELV A;  4RA1 A;  3IOR A;  4NE4 A;  2ZYN A;  1T0K A;  3K01 A;  1MXY A;  1GVC A;  3MUQ A;  1LB8 A;  3PPR A;  4R6K A;  5A5X B;  4QHQ A;  2DE3 A;  4DXU A;  4OWD A;  3DRG A;  3FUZ A;  4YKJ A;  4ZED A;  1MS7 A;  3T96 B;  2QJE A;  3DRF A;  4DZ1 A;  4EXK A;  2ONR A;  4ELQ A;  5BWJ A;  1XVX A;  2UVG A;  1UTH B;  1R1N A;  4I1D A;  4KYS A;  1EU8 A;  4I9D A;  1FTL A;  1XT8 A;  2RIN A;  3OO6 A;  4NTL A;  1BTJ A;  1II5 A;  3EPE A;  3RLF E;  4DIG A;  5B70 A;  4HW8 A;  4R75 A;  4HCW A;  4YZZ A;  3MPL A;  2UVI A;  5EHS A;  1LST A;  4OEN A;  3FVO A;  3ZSF A;  2Z8D A;  3R7X A;  4F22 A;  5A5X A;  1FTJ A;  1JW1 A;  3W15 C;  3DLN A;  3IR1 A;  3MAM A;  4IO3 A;  3I3V A;  4OMB A;  5CI5 A;  4DXC A;  4Q30 B;  1VFE A;  4GIZ A;  3MQ9 A;  4PP0 A;  3BKI B;  5BUU A;  3PUW E;  3VVD A;  3QK6 A;  2V3T A;  3V8X B;  4DE8 A;  4YMA A;  4YKI A;  3M3K A;  1B3L A;  2FYI A;  3OO8 A;  3SES A;  4GVO A;  2F7B A;  4NF6 B;  1B5J A;  3C31 A;  1B7H A;  4F18 A;  5AA4 A;  2UYF A;  5JK4 A;  1ELJ A;  5I2K A;  1ZTY A;  5KDT A;  1B52 A;  4KD5 A;  4XKQ A;  1QJM A;  3CFZ A;  4GL0 A;  3G3H A;  2ABH A;  2HCA A;  2PBW A;  4R9G A;  1NNK A;  3M8U A;  1MY0 A;  1B5I A;  4OFO A;  3HHG A;  3EHT A;  2PT2 A;  4O3A A;  3IB2 A;  4H8J A;  3EN3 A;  3TTK A;  4F1U A;  4QFL A;  3DRK A;  1MM6 A;  1Y3Q A;  3FIR A;  2O7U A;  3C32 A;  3G3K A;  3SEV A;  2Y7K A;  4OQO A;  2WKY A;  3TQL A;  5AA3 A;  2I48 A;  2G93 A;  4G77 A;  4FED A;  3Q29 A;  5JEI A;  1XOC A;  4QFN A;  3G3J A;  4ECF A;  4R6Y A;  4FIM A;  2QS3 A;  3FGS A;  4X1D A;  2B4M A;  3KZG A;  4DDD A;  4I8C A;  2FNC A;  3IOV A;  2XXH A;  4ND9 A;  2NUV A;  2B65 A;  3EHS A;  4R9F A;  2CMO A;  3CIJ A;  4Q0C A;  1B3E A;  1B58 A;  3K1N A;  4ZEK A;  3KSJ A;  4QSE A;  2WOP A;  3JYR A;  4YAH X;  1PB9 A;  1B32 A;  4XKP A;  1B1X A;  2RCA A;  5F1Q A;  2AL5 A;  4JWO A;  1FQC A;  1VSO A;  5H8H A;  5I59 A;  1ZJL A;  2G29 A;  1N84 A;  2YJP A;  3K6W A;  1MH4 A;  2GFE A;  3OEN A;  4ZEI A;  2O6A A;  2OBG A;  1YAE A;  1SVX B;  1YCJ A;  1QUK A;  1Y1Z A;  4AQ4 A;  4MLQ A;  3LC8 A;  1EZP A;  1LLS A;  3T9H B;  3CG1 A;  1WDN A;  3IB1 A;  3KFM A;  5ITP A;  1DMB A;  4OFL A;  2QS4 A;  3LVU A;  1FQE A;  3GBB A;  3ZKK A;  2AYS A;  1A8F A;  2R9J A;  4IO4 A;  1MH3 A;  2DWJ A;  4YB5 A;  4HCY A;  1IIT A;  3VFJ A;  1RYO A;  1UQW A;  2VGQ A;  3B7D A;  4I62 A;  1N3X A;  1NL5 A;  5IKB A;  3FJ7 A;  3SER A;  3L6H A;  3IOT A;  1NH7 A;  2Y7W A;  1LGB C;  2OZZ A;  3KSX A;  1IQ7 A;  3H06 B;  5AA4 B;  1PBQ A;  1JVX A;  1LFI A;  5KCJ B;  4L17 A;  3PUZ E;  4G68 C;  4C0R A;  4YKP A;  4GXS B;  1SI0 A;  3RNN A;  4F2Q A;  1SI1 A;  5CC2 A;  5TPA A;  1FCK A;  3H7M A;  5I56 A;  2PVU A;  2ZXT A;  4QFK A;  3MC2 A;  2I3V A;  3PMV A;  4NF5 A;  4YMB A;  3R6U A;  4EF1 A;  2AL4 A;  3MP8 A;  1TFA A;  1B6H A;  4QFP A;  3ODB A;  3QUJ A;  2ZNS A;  3BBR A;  4RK2 A;  3THI A;  5HPQ A;  1RYX A;  2X7P A;  1OLC A;  2O7I A;  1FQF A;  4MF3 A;  1DOT A;  3SET A;  2Y84 A;  4IO5 A;  1IXI A;  3BFT A;  1VE4 A;  1NH8 A;  3CSB A;  4HTG A;  5CMB A;  2Q8J A;  4U4X A;  2DE4 A;  3Q27 A;  2HXW A;  1LCF A;  1UIU A;  4K3F A;  4X48 A;  4X1B A;  5FHM A;  4BLA A;  4EQB A;  1GR2 A;  4ESX A;  4FAJ A;  3FAT A;  3O97 A;  2F34 A;  3RY3 A;  4POW A;  3VXC A;  1N7X A;  2WOK A;  3H6U A;  4NF8 A;  3USD A;  2P2A A;  1O7T A;  4F1V A;  4G68 B;  1EZ9 A;  4H0W A;  1M5B A;  1B46 A;  2Y7R A;  2I0C A;  2R6G E;  2RF1 A;  2ZYM A;  4LA9 A;  2WOL A;  3I5O A;  3M3L A;  4QSC A;  3OMB A;  3RN8 A;  4Q8R A;  2PYY A;  3CHG A;  1JEU A;  1S7Y A;  1F9B A;  3FXR A;  2XD3 A;  3K6X A;  1ZLQ A;  2HFB A;  5K2X A;  3S4U A;  2DVC A;  2O84 X;  3Q25 A;  4KYD A;  1Y20 A;  5DEX A;  3LSW A;  3UIF A;  1MG1 A;  2ONS A;  4KQP A;  4R72 A;  5HM4 B;  1DSN A;  4ZZA A;  3W9W A;  1H44 A;  1FTO A;  5DTB A;  4IY6 A;  4RPO A;  1P1N A;  2VOZ A;  3TEL A;  4OEU A;  1JW4 A;  4EQ7 A;  1ZKB A;  4OES A;  1MY4 A;  4KCC A;  3S9E A;  1P1U A;  2X26 A;  1S50 A;  3HO7 A;  1MXZ A;  1MXX A;  3K0V A;  1BIY A;  1Y9U A;  3K2D A;  2RKM A;  1ATG A;  3QXM A;  3TDJ A;  4KPT A;  4U1O A;  1DPP A;  5DVJ A;  2QPQ A;  3TKD A;  3ZKL A;  3QYT A;  3B6Q A;  1AOV A;  3PUV E;  3U72 A;  2Z22 A;  1B4Z A;  2OWS A;  5FTI A;  5L9O A;  4BDQ A;  1WVJ A;  3OD7 A;  1B0L A;  1QKA A;  4OHN A;  3AXF A;  1SQY A;  3PGF A;  3PPP A;  2Z23 A;  4FEC A;  4YIC A;  5FHO A;  1JQF A;  1QKB A;  3CFX A;  3KN7 A;  4LZ8 A;  3GXA A;  3PPQ A;  3H6W A;  1B2H A;  4JSO A;  1US5 A;  2F35 A;  4LQ2 A;  3H03 A;  1P1W A;  5CBS A;  1MXU A;  5ICT A;  1RKM A;  5KDT B;  1R9L A;  4H1X A;  2F8D A;  4NF6 A;  1HSJ A;  4N13 A;  3OOA A;  3HHF A;  1M5F A;  1PC3 A;  4H65 A;  5H8N B;  1PB7 A;  3LBS A;  2XXR A;  2UYE A;  4BDL A;  1DTZ A;  1HSE A;  1D3K A;  2DQV A;  3D4G A;  3DEL B;  3E13 X;  3KBR A;  4C1U A;  4F3G A;  3MP6 A;  3SEY A;  3UOR A;  4F3P A;  2XXV A;  3PUY E;  5L8D A;  3FVN A;  1B05 A;  4ZEB A;  1JNF A;  2ZNU A;  4KYE A;  4Q5T A;  4X9T A;  5I59 B;  3RT6 B;  2XX7 A;  1MQJ A;  1MDQ A;  1SW4 A;  2DVZ A;  3KN8 A;  1B7U A;  1L5T A;  1URG A;  3T22 A;  5H8Q B;  3IJO B;  3KJ7 A;  2OK2 A;  3MJN A;  2V3Q A;  3S9L C;  3CFL A;  4LON B;  3O6H A;  3IJX B;  3MVW A;  3IK6 B;  1YTV A;  4LZ5 A;  1UTH A;  2XXQ A;  3VXB A;  1ZBM A;  2P1S A;  1LBB A;  2B3F A;  3GLB A;  4HS7 A;  4IO6 A;  1GV8 A;  3SEW A;  5IAI A;  1LAH E;  1OIB A;  3SEX A;  3N5L A;  5H8F A;  3LR1 A;  3RTF B;  3RUM A;  2Q2C A;  4WKM A;  4ISU A;  5CM6 A;  3O2A A;  2CZL A;  2F6G A;  3OXN A;  3Q28 A;  3UGW A;  2DP8 A;  5AA2 A;  2QMW A;  4UAC A;  2V93 A;  4P11 A;  4GWO A;  4BDN A;  3KOS A;  2F7A A;  3PUX E;  4NF5 B;  4ELR A;  4AB5 A;  1B4H A;  5I56 B;  1MDP 1;  3TFL A;  1B1H A;  1B3G A;  4OER A;  2UXA A;  5J1D A;  4Z7E A;  4FE8 A;  1MY1 A;  4XKN A;  1N76 A;  5L9M A;  1LFH A;  4THI A;  1IXH A;  5I58 A;  2O51 A;  1I6B A;  1MPB A;  4U4S A;  3EHU A;  2YLN A;  1GTK A;  1OMP A;  3FD3 A;  2E0S A;  2HAV A;  5AA2 B;  1OVB A;  3FV2 A;  4TOZ A;  2ZNT A;  1SYH A;  1IIW A;  3O9P A;  3MZB A;  3FZV A;  3HV1 A;  5KCJ A;  2I3W A;  1GGG A;  2FA7 A;  2OCU A;  3LSL A;  3EF7 A;  3PPO A;  3RYA A;  4FJP A;  4G8N A;  4JXI A;  4NMY A;  4ELO A;  1LCT A;  4PFT A;  3OO7 A;  3GBA A;  5ITO A;  3U8Q A;  5L9S A;  5I2N B;  2NOO A;  1FQB A;  1MQH A;  3PMX A;  3F11 A;  5FHN A;  1LAX A;  1D9V A;  1JW5 A;  3T9U A;  2UVJ A;  1B7Z A;  1MQD A;  3MP1 A;  3IX1 A;  1OVT A;  4G8M A;  4NWD A;  2DE2 A;  1R9Q A;  3FAS A;  3O28 A;  4N6P A;  1B9J A;  1Z7M E;  2DWH A;  3PPN A;  4YKK A;  3FTO A;  2XHD A;  3L6G A;  4KFQ A;  4WXJ A;  2H9B A;  1IUD A;  4XIG Q;  3WAE A;  3K4U A;  3O29 A;  4JWY A;  4YB6 A;  5H8H B;  1B51 A;  3UP9 A;  2QMX A;  1IXC A;  5ICQ A;  1TXF A;  4BDM A;  1AIV A;  4H8I A;  2ONK E;  4ZDM A;  3TOD A;  4ZE8 A;  1USY E;  3EQ1 A;  2PX1 A;  3RGY A;  5AA2 D;  4JDF A;  3CSG A;  3C36 A;  3RT8 A;  1QW0 A;  3LUY A;  4YU0 A;  3V83 A;  2H5Y A;  2XD2 A;  1P99 A;  2V25 A;  1I6A A;  2I49 A;  3K1P A;  3QAX A;  3C35 A;  4ZEF A;  4LAT A;  1MQG A;  2I6E A;  3ONM A;  1N04 A;  4NF4 B;  3RTW B;  4GFR A;  2RC9 A;  4OYV A;  1URD A;  2DS9 A;  2GH9 A;  2ZYO A;  1NNF A;  4R73 A;  3VV5 A;  1MQI A;  2QSX A;  2QS1 A;  3N6U A;  2XX9 A;  3SKP A;  5JTY B;  1Y4T A;  2XXY A;  3B6T A;  4GXA A;  4RY1 A;  4XXU A;  3C33 A;  2LAO A;  3KGC A;  5FTH A;  1A7L A;  4PET A;  1FW0 A;  3SEU A;  1FTK A;  2H4I A;  4RPN A;  1A55 A;  4MH5 A;  4R6H A;  2E1S A;  3TTL A;  2DXR A;  1JET A;  4IB2 A;  1Y3P A;  3TQW A;  4GRK A;  3TYH A;  1ZU0 A;  2O69 A;  2ZYK A;  1XHY A;  4RYA A;  3U93 A;  3WAF A;  2W7Y A;  3DP4 A;  2H25 A;  4E0X A;  4EDP A;  2HEU A;  5CRY A;  2DWI A;  3ILT B;  1AL3 A;  3MPK A;  2V3U A;  5B7D A;  3T9V A;  1A40 A;  1UTB B;  2O68 A;  3FVK A;  1OQG A;  1Z7N E;  3CR9 A;  3G3G A;  1ZMG A;  5EYF A;  3TAJ A;  5DEX B;  4LUB A;  4PFW A;  5CMC A;  3PD8 A;  5JTY A;  4RNS A;  4PFY A;  3IL1 B;  1FQA A;  1IEJ A;  2XXT A;  5I84 A;  1CB6 A;  4JSD A;  1M5D A;  1WOD A;  4G8H A;  4PE5 B;  1I69 A;  1B5H A;  3T9X B;  1R6Z A;  2F6P A;  1QUL A;  3TPA A;  3CRB A;  3OEL A;  5H8F B;  1QUI A;  1PB8 A;  2QRY A;  3U92 A;  3FJM A;  1SW2 A;  1JEV A;  1BKA A;  2VP1 A;  3G7W A;  3FV1 A;  3KG2 A;  3KEI A;  4G2Z A;  5CBR A;  3TUS A;  2OLB A;  1MPD A;  1B3F A;  1H3D A;  1N3W A;  2I4C A;  2GRV A;  2PT1 A;  4JB7 A;  4U22 A;  2H99 A;  3O6I A;  3VDF A;  3T66 A;  3CI8 A;  4M4G A;  2I58 A;  2IA4 A;  2M8C A;  5DVF A;  4F2O A;  1QUJ A;  5DT6 A;  3MW0 A;  4EF2 A;  3VE1 B;  1AMF A;  3FJG A;  2HAU A;  3MZ1 A;  3CG3 A;  3G3I A;  5H8S A;  1IZ1 A;  1HSL A;  3MBP A;  2ANJ A;  3S9N C;  2DSF A;  1MM7 A;  4N07 A;  2NWJ A;  4QRZ A;  3GZG A;  3I6V A;  3V89 B;  4U21 A;  5H8N A;  3PAM A;  2YPN A;  1LFG A;  1URS A;  1Q1K A;  4LVQ A;  3ECR A;  2QS2 A;  1P1O A;  5AA1 A;  2Q89 A;  1PDA A;  3E4R A;  3OEM A;  4AB6 A;  1MPC A;  1IXG A;  3JZJ A;  3C34 A;  5TP9 A;  4F3B A;  3H3G A;  5I57 A;  1B0H A;  1KWH A;  1POY 1;  3K6V A;  3M3F A;  3SDF A;  3H6V A;  2R71 A;  3IO6 A;  3JV9 A;  3LSF B;  3H6T A;  4KCD A;  4R74 A;  4EUO A;  2XXP A;  3OSQ A;  3N6T A;  4BDO A;  2A5T A;  4XKR A;  1MXW A;  1D4N A;  4JWX A;  2B4L A;  2REG A;  3ILU B;  4H5F A;  4NF4 A;  4LZ7 A;  2HZK A;  4PQJ A;  5CMK A;  5I57 B;  3VLU A;  5TP9 B;  3TCF A;  4DCX A;  4G4P A;  2DWA A;  2I4B A;  3FXU A;  5ISU A;  2THI A;  3TZA A;  1OQH A;  3FXQ A;  1S9T A;  3IOW A;  2D3I A;  4EXL A;  4IGR A;  1FTM A;  2BJJ X;  2Q2A A; 
#chains in the Genus database with same CATH topology
 4N6K A;  3QSL A;  1H43 A;  4UAB A;  3RPW A;  4ELP A;  4U2R A;  3TCH A;  2F3B A;  2Z8E A;  3IO4 A;  4O3B A;  1O64 A;  4WEP A;  2ALU A;  4NF8 B;  5M2V A;  3VLW A;  3HPI A;  4OVS A;  2XXI A;  4PE3 A;  1NKX A;  4P0I A;  3MWB A;  3A3U A;  3KJT A;  1FBG A;  1UTB A;  1XI6 A;  5DVI A;  5I58 B;  5LOM A;  3K00 A;  3IB0 A;  4H46 A;  4LP2 B;  1SW5 A;  2CZK A;  5CMM A;  3Q26 A;  4F19 A;  1XC1 A;  3PU5 A;  2DOJ A;  2FHY A;  4NED A;  2O1L A;  2F97 A;  2XWI A;  5H8Q A;  4IY5 A;  1BP5 A;  4QBA A;  1NNT A;  3HCQ A;  1N7W A;  2A5S A;  3V5A A;  4XEQ A;  4GL8 A;  4I40 A;  4H6D A;  2VHA A;  3U1O A;  1A99 A;  4F29 A;  1AH5 A;  1SDX A;  1EZO A;  3N26 A;  1FBF A;  2I0B A;  3MVY A;  4DXB A;  3IFC A;  3O6P A;  1FPF A;  5I2N A;  3UA8 A;  2ZMB A;  3HN0 A;  4ZEC A;  1DTG A;  5IGA A;  4LQ5 A;  2PMS A;  3DRJ A;  4ONY A;  3C4M A;  4UA8 A;  3TTN A;  4WED A;  2F78 A;  3R26 A;  1D9Y A;  3N94 A;  2X7Q A;  4P1E A;  4DCY A;  3VVF A;  1ANF A;  2OJT A;  2XXX A;  4P9K A;  1LB8 A;  2DE3 A;  4OWD A;  4YKJ A;  1IME A;  1XVX A;  2QVU A;  4NTL A;  4DIG A;  1BTJ A;  1II5 A;  4R75 A;  4PFR A;  5EHS A;  3FVO A;  3R7X A;  1FTJ A;  1JW1 A;  3W15 C;  3IR1 A;  4DXC A;  2ZZX A;  1FPE A;  5CI5 A;  3VVD A;  2V3T A;  3SES A;  3C31 A;  4PFB A;  4XKQ A;  1QJM A;  2ABH A;  2PBW A;  1NNK A;  3HHG A;  4N81 A;  4H8J A;  3DRK A;  3FIR A;  2O7U A;  1LBX A;  3G3K A;  5FBP A;  3ISP A;  2I48 A;  2G93 A;  1FJ6 A;  1XOC A;  4ECF A;  3G3J A;  4R6Y A;  3FGS A;  3KZG A;  4KXP A;  4DDD A;  4I8C A;  2FNC A;  3IOV A;  4ND9 A;  3EHS A;  4R9F A;  1B3E A;  4PBH A;  2WOP A;  1B1X A;  5F1Q A;  4OVT A;  1RDZ A;  3B50 A;  2GFE A;  3OEN A;  1SVX B;  1QUK A;  4HE1 A;  1WDN A;  4XFE A;  4GWS A;  3ZKL A;  1MH3 A;  4YB5 A;  2VGQ A;  1DCU A;  1N3X A;  3SER A;  3KSX A;  1IQ7 A;  3H06 B;  4C0R A;  3HFU A;  1SI0 A;  4F2Q A;  1IMD A;  4NF5 A;  3ODB A;  1B6H A;  4QFP A;  4RK2 A;  4NG7 A;  1RYX A;  1FQF A;  4MF3 A;  2VPN A;  1IXI A;  3BFT A;  1VE4 A;  4OA4 A;  3E79 A;  4BLA A;  4K3F A;  5FHM A;  1GR2 A;  3RY3 A;  1O7T A;  4G68 B;  1M5B A;  2I0C A;  2ZYM A;  5AA3 A;  2WOL A;  4NN3 A;  1IMF A;  3OMB A;  4P56 A;  2PYY A;  1JEU A;  1F9B A;  3K6X A;  3S4U A;  1ZLQ A;  3UIF A;  2O84 X;  4KYD A;  1NV5 A;  1MG1 A;  2ONS A;  4KQP A;  1H44 A;  2VOZ A;  1MY4 A;  4KCC A;  3HO7 A;  3K2D A;  4KPT A;  5DVJ A;  1DPP A;  1SPI A;  3PUV E;  1B4Z A;  5FTI A;  1KZ8 A;  4BDQ A;  4OHN A;  3PGF A;  1JQF A;  3GXA A;  1US5 A;  1NV6 A;  3H03 A;  5ICT A;  4NF6 A;  1PC3 A;  4OVP A;  5H8N B;  1PB7 A;  3LBS A;  2XXR A;  4BDL A;  1HSE A;  3E13 X;  4F3P A;  5ET8 A;  3SEY A;  4X9T A;  1MDQ A;  3T22 A;  2DVZ A;  1YZ0 A;  3BIH A;  2OK2 A;  2V3Q A;  3LUZ A;  4LON B;  3O6H A;  3IJX B;  1FBC A;  3GLB A;  4IO6 A;  1GV8 A;  4MCO A;  3N5L A;  2Q2C A;  4WKM A;  2CZL A;  2V93 A;  4BDN A;  3KOS A;  3PUX E;  5I56 B;  1B3G A;  5LTC A;  1K9Z A;  2UXA A;  5L9M A;  5J16 A;  1BK4 A;  4THI A;  1IXH A;  2O51 A;  1GTK A;  1OVB A;  1JP4 A;  4TOZ A;  1SYH A;  5KCJ A;  2I3W A;  2FA7 A;  5K2X A;  2OCU A;  5EYH A;  4JXI A;  3IFA A;  5ITO A;  3KC0 A;  5L9S A;  1FQB A;  1MQH A;  1FPJ A;  1LAX A;  1AWB A;  4G8M A;  3O28 A;  4YKK A;  2H9B A;  3K4U A;  2QFL A;  4YB6 A;  3UP9 A;  2QMX A;  3LV0 A;  4ZDM A;  3RGY A;  5AA2 D;  3CSG A;  3LUY A;  4YU0 A;  2I49 A;  3C35 A;  3RTW B;  4GFR A;  2RC9 A;  2GH9 A;  3VV5 A;  2ZYO A;  1NNF A;  2QSX A;  5EQA A;  3B6T A;  4GXA A;  5FTH A;  4HE2 A;  2DXR A;  2ZYK A;  3WAF A;  3BIG A;  3SZP A;  4PAF A;  5CRY A;  5B7D A;  1A40 A;  1UTB B;  2O68 A;  1ZMG A;  5ESY A;  4RNS A;  4PFY A;  2XXT A;  5IZ1 A;  1R6Z A;  3U92 A;  2DDK A;  1BKA A;  3RYD A;  5EQ8 A;  4EF2 A;  5DT6 A;  3MW0 A;  5IZZ A;  2NWJ A;  4N07 A;  4QRZ A;  2QS2 A;  3E4R A;  3OEM A;  1IXG A;  3JZJ A;  5TP9 A;  5I57 A;  1POY 1;  4R74 A;  3LSF B;  1NV7 A;  3H6T A;  4KCD A;  3OSQ A;  3N6T A;  3NOH A;  4JWX A;  2REG A;  4G4P A;  1EYJ A;  3RPL B;  2THI A;  3IOW A;  2D3I A;  1FTM A;  2Q2A A;  5LDZ A;  3B8B A;  3HST A;  4GX3 A;  3G3F A;  4TLL B;  2XXW A;  4KI0 E;  4GF8 A;  1NMU A;  5IM2 A;  1A8E A;  1LB9 A;  4NHB A;  4GX4 A;  4FAT A;  4KHZ E;  1EYI A;  4P8B A;  4PDH A;  4GD5 A;  1POT A;  3CVG A;  2FIE A;  4MLV A;  2OX3 A;  1EYK A;  1NNP A;  4KFQ A;  4H5G A;  5DYH A;  1NUX A;  1NFT A;  1US4 A;  1YPN A;  4DI3 D;  2NVU B;  2O1M A;  2AIX A;  2ESN A;  1USY H;  3IAZ A;  2PFY A;  4ZS9 A;  3QIM A;  2DYX A;  5EHM A;  5K2Y A;  2RCB A;  4MJO A;  4N15 A;  4Z0I A;  4GWU A;  2WBD A;  2GHB A;  4FBP A;  1VR5 A;  4XTC Q;  4PCD A;  1H76 A;  2F7C A;  1FTA A;  2XWO A;  4NWC A;  1MY3 A;  2DXY A;  2CEY A;  1A54 A;  1M5C A;  4M1V A;  1B3H A;  1TFD A;  4PC9 A;  4ESW A;  2F3D A;  3QUF A;  3LSX A;  2KLF A;  3U94 A;  4POX A;  4QFO A;  2IEE A;  1PBP A;  2A5T B;  1TT1 A;  2RC7 A;  2HZL A;  3MZ9 A;  4QSD A;  2Q88 A;  1BLF A;  1M5E A;  4KR5 A;  2QVV A;  1Y3N A;  4O3C A;  3UN6 A;  3A09 A;  2VPO A;  4HE0 A;  4NE4 A;  2ZYN A;  1T0K A;  3PPR A;  4R6K A;  3DRG A;  2P3N A;  4ZED A;  1MS7 A;  3T96 B;  4EXK A;  2ONR A;  4ELQ A;  5BWJ A;  2UVG A;  1R1N A;  4I1D A;  4I9D A;  3RLF E;  2P3V A;  5ET7 A;  2UVI A;  3ZSF A;  2Z8D A;  4F22 A;  3DLN A;  4PP0 A;  3BKI B;  1D9Q A;  3M3K A;  3OO8 A;  1B5J A;  4F18 A;  2UYF A;  5I2K A;  1ZTY A;  5KDT A;  4KD5 A;  3CFZ A;  5JTY A;  3EHT A;  3TTK A;  1Y3Q A;  3TQL A;  4G77 A;  4I3E A;  3Q29 A;  4OAN A;  4FIM A;  2QS3 A;  4P3L A;  2XXH A;  3KSJ A;  4QSE A;  3JYR A;  1B32 A;  1FQC A;  1VSO A;  1ZJL A;  2G29 A;  2YJP A;  4ZEI A;  2OBG A;  1YAE A;  1YCJ A;  4JVD A;  1EZP A;  1FBE A;  4N8Y A;  1DMB A;  4OFL A;  2QS4 A;  1FQE A;  2AYS A;  1A8F A;  4HCY A;  1IIT A;  1RYO A;  3B7D A;  3FJ7 A;  2BJI A;  2OZZ A;  4YKP A;  1SI1 A;  5CC2 A;  5TPA A;  5I56 A;  1NV1 A;  2I3V A;  4YMB A;  2AL4 A;  2ZNS A;  4NQ8 A;  4HTG A;  3CSB A;  3Q27 A;  4X48 A;  4EQB A;  1VDW A;  3VXC A;  1N7X A;  3H6U A;  4NF8 A;  1LBZ A;  1EZ9 A;  1B46 A;  4O94 A;  4QSC A;  1NI9 A;  3RN8 A;  3CHG A;  1S7Y A;  2DVC A;  5DEX A;  1Y20 A;  1NUY A;  1FTO A;  5DTB A;  1P1N A;  4OEU A;  2CZH A;  1ZKB A;  1MXZ A;  3QXM A;  4U1O A;  3QYT A;  1QKA A;  4FEC A;  4YIC A;  5FHO A;  4LQ2 A;  4JSO A;  1P1W A;  1MXU A;  1RDX A;  2UYE A;  1D3K A;  3KBR A;  2Y5K A;  1DK4 A;  3D4G A;  5EQ7 A;  4X8R A;  4C1U A;  4F3G A;  3MP6 A;  2ZNU A;  2XX7 A;  1MQJ A;  1SW4 A;  1URG A;  3S9L C;  1KA0 A;  3TTM A;  3MVW A;  2R8T A;  2XXQ A;  3VXB A;  2P1S A;  1NUZ A;  3LR1 A;  3RTF B;  5I3S A;  3Q28 A;  2DP8 A;  4UAC A;  4P11 A;  3TFL A;  1YXI A;  1FPD A;  4XKN A;  1N76 A;  1LFH A;  2YLN A;  1FPK A;  3FD3 A;  5I5P A;  2KR0 A;  3HV1 A;  4PBQ A;  1GGG A;  3LSL A;  4FJP A;  3PPO A;  4ELO A;  4PFT A;  3OO7 A;  3GBA A;  2NOO A;  3PMX A;  5FHN A;  3ROJ A;  3SET A;  4PGN A;  1B9J A;  2DWH A;  3FTO A;  3WAE A;  4WXJ A;  5ICQ A;  1TXF A;  1AIV A;  1USY E;  3EQ1 A;  3RT8 A;  1QW0 A;  4ZEF A;  4LAT A;  4OVQ A;  1N04 A;  4JVC A;  4NF4 B;  1URD A;  4NAP A;  4R73 A;  1MQI A;  3N6U A;  2XXY A;  3C33 A;  2LAO A;  1FW0 A;  1FTK A;  2H4I A;  1A55 A;  2E1S A;  1JET A;  3TYH A;  1ZU0 A;  5EQ9 A;  4E0X A;  3MPK A;  3FVK A;  3CR9 A;  2VT5 A;  3T0J A;  1FQA A;  5I84 A;  1CB6 A;  4PE5 B;  1M5D A;  1B5H A;  3T9X B;  3CRB A;  2QRY A;  3TUS A;  3G7W A;  4JB7 A;  4H45 A;  2H99 A;  3CI8 A;  4M4G A;  3U65 A;  4X04 A;  3VE1 B;  3MZ1 A;  3FJG A;  3G3I A;  5H8S A;  2ANJ A;  2FBP A;  3S9N C;  1MM7 A;  3PAM A;  2YPN A;  1PDA A;  4AB6 A;  1MPC A;  4F3B A;  1B0H A;  1KWH A;  3M3F A;  2R71 A;  3JV9 A;  4EUO A;  4BDO A;  2A5T A;  4XKR A;  1MXW A;  4MNP A;  2HZK A;  4PQJ A;  2DWA A;  3FXU A;  5ISU A;  1S9T A;  2HXR A;  4JVI A;  4GWZ A;  2XA5 A;  2VD3 A;  2BJJ X;  4GBW A;  3H4Z A;  4OVJ A;  2HQ0 A;  1LAF E;  4GOT A;  3E9X A;  2UVH A;  5A5L A;  3K02 A;  4U1Z A;  3VVE A;  4LN5 A;  1QVS A;  3ZS6 A;  1YYZ A;  3PV0 E;  3D4C A;  1MXV A;  3TMG A;  4EQ9 A;  1RDY A;  2V84 A;  5KZT A;  2GHA A;  4IGT A;  1H45 A;  2VD2 A;  3S9E A;  4GQO A;  3DRH A;  1FPG A;  5TPA B;  1CNQ A;  1XVY A;  3K1M A;  1I6Q A;  1TWY A;  4F3S A;  3BFU A;  1LBC A;  2P0S A;  1PEB A;  1J1N A;  2L5V A;  4OTE A;  3MVZ A;  4RK9 A;  4ZE9 A;  4OXV A;  3S2V A;  3RYB A;  3W9V A;  4OFJ A;  4AS5 A;  3O6G A;  4E0W A;  4GWW A;  1FQD A;  3E3K A;  3OO9 A;  5EYG A;  1VFD A;  4AS4 A;  4MMP A;  4QF9 A;  4ZZE A;  1CE2 A;  4RJZ A;  3A3C A;  1LAG E;  1SYI A;  1FJ9 A;  4MBP A;  4TLM B;  2RC8 A;  3KN3 A;  4PAK A;  3TDJ A;  2F36 A;  1OLA A;  2OWT A;  3PMW A;  2F5X A;  3DP8 A;  4PTK A;  2XX8 A;  4FOR A;  5ELV A;  4RA1 A;  3K01 A;  1GVC A;  3MUQ A;  5A5X B;  4QHQ A;  4MIJ A;  4QXD A;  3DRF A;  4DZ1 A;  4GWX A;  2RIN A;  3FBP A;  4HW8 A;  4YZZ A;  3MPL A;  4OEN A;  4IO3 A;  4OMB A;  4NGU A;  4Q30 B;  4GIZ A;  3MQ9 A;  1DBZ A;  5BUU A;  3PUW E;  3QK6 A;  4YMA A;  3V8X B;  2FYI A;  4NF6 B;  2F7B A;  5AA4 A;  5JK4 A;  2WX9 A;  1B52 A;  4GL0 A;  2WEF A;  3G3H A;  2HCA A;  4R9G A;  1MY0 A;  1B5I A;  4F1U A;  4QFL A;  1MM6 A;  2WKY A;  4QFN A;  2B4M A;  2NUV A;  2B65 A;  3CIJ A;  4Q0C A;  3K1N A;  2XWK A;  4YAH X;  1PB9 A;  4XKP A;  5H8H A;  2AL5 A;  4JWO A;  5F24 A;  4AQ4 A;  4MLQ A;  3T9H B;  3IB1 A;  3PTY A;  3KFM A;  3LVU A;  3GBB A;  3ZKK A;  2R9J A;  2DWJ A;  4I62 A;  1NL5 A;  3L6H A;  2Y7W A;  5AA4 B;  1LGB C;  1PBQ A;  1JVX A;  5KCJ B;  3PUZ E;  1FCK A;  3H7M A;  2PVU A;  3MC2 A;  4QFK A;  1INP A;  3PMV A;  3QUJ A;  1TFA A;  3THI A;  5HPQ A;  4PDD A;  2O7I A;  2Y84 A;  4MNI A;  4IO5 A;  5CMB A;  4N17 A;  2HXW A;  1UIU A;  4X1B A;  3FAT A;  3O97 A;  2F34 A;  2P2A A;  1FBH A;  2Y7R A;  2RF1 A;  2R6G E;  3FXR A;  3E78 A;  4ZZA A;  1NV4 A;  3W9W A;  5HM4 B;  4IY6 A;  4RPO A;  2V4C A;  1JW4 A;  4OES A;  2XXK A;  2X26 A;  1S50 A;  1BIY A;  1Y9U A;  1ATG A;  3TKD A;  1AOV A;  3U72 A;  2Z22 A;  2XWV A;  2OWS A;  4PAI A;  1WVJ A;  3OD7 A;  3AXF A;  4MNC A;  2Z23 A;  3KN7 A;  1QKB A;  3CFX A;  4LZ8 A;  5I7I A;  2F35 A;  1R9L A;  4O7M A;  2F8D A;  4N13 A;  1M5F A;  4H65 A;  2DQV A;  2XXV A;  3PUY E;  5L8D A;  3FVN A;  1B05 A;  1JNF A;  4Q5T A;  4KYE A;  5T3J A;  1B7U A;  2WYK A;  5H8Q B;  4DI4 B;  3MJN A;  3CFL A;  4LZ5 A;  2B3F A;  5IAI A;  3SEW A;  3SEX A;  1OIB A;  5H8F A;  3RUM A;  2HPG A;  4ISU A;  5CM6 A;  3OXN A;  3UGW A;  5AA2 A;  1LBV A;  2PFZ A;  4NX1 A;  1NV2 A;  4AB5 A;  1B1H A;  1I6B A;  2Q8M A;  3O9P A;  3MZB A;  3FZV A;  4G8N A;  4NMY A;  3EF7 A;  3RYA A;  2Y5L A;  3U8Q A;  5I2N B;  3F11 A;  1D9V A;  3T9U A;  1FPB A;  1OVT A;  2DE2 A;  4N6P A;  3FAS A;  5I59 A;  1Z7M E;  2XHD A;  1IUD A;  4XIG Q;  3QMF A;  4GX6 A;  3O29 A;  1IXC A;  1IMB A;  4H8I A;  3TOD A;  3C36 A;  3MST A;  2H5Y A;  1NV3 A;  1P99 A;  2V25 A;  3QAX A;  1MQG A;  3ONM A;  4OYV A;  2DS9 A;  5ET6 A;  3SKP A;  5JTY B;  1Y4T A;  4XXU A;  4RY1 A;  4PET A;  3SEU A;  4RPN A;  4MH5 A;  4IB2 A;  1Y3P A;  4GRK A;  4RYA A;  1XHY A;  2W7Y A;  3DP4 A;  4EDP A;  2HEU A;  3T9V A;  1Z7N E;  3G3G A;  3TAJ A;  5DEX B;  5CMC A;  3PD8 A;  1FPI A;  1IEJ A;  1WOD A;  1I69 A;  1QUL A;  3OEL A;  4P1L A;  1SW2 A;  4G2Z A;  3KG2 A;  3KEI A;  2OLB A;  1MPD A;  1B3F A;  1H3D A;  2I4C A;  1IMC A;  2IA4 A;  4F2O A;  3KC1 A;  3CG3 A;  1NV0 A;  3MBP A;  2Q74 A;  2DSF A;  3GZG A;  3I6V A;  3V89 B;  4U21 A;  5IZ3 B;  1LFG A;  1Q1K A;  4LVQ A;  1P1O A;  3H6V A;  2B4L A;  3ILU B;  4PGP A;  5CMK A;  3VLU A;  4DCX A;  2I4B A;  1OQH A;  3FXQ A;  3KBZ A;  4EXL A;  3A29 A;  3FXB A;  4C1T A;  4MHF A;  4RXL A;  1MY2 A;  4JBZ A;  3S9M C;  3DRI A;  3C9H A;  4N4U A;  5F7V A;  3OEK A;  4MFI A;  2H98 A;  4G68 A;  4FEB A;  3TEP A;  5DW8 A;  4YB7 A;  3EKI A;  1SW1 A;  5AE4 A;  4PFU A;  5HBC A;  4F39 A;  5I2K B;  3VLV A;  5J1D A;  1SBP A;  1Y1M A;  2Q9T A;  3B6W A;  3OSR A;  4GLI A;  3P7I A;  3PD9 A;  4TQU Q;  2QL3 A;  4R2B A;  2D5W A;  2CZI A;  4IO7 A;  4OZ9 A;  3MYU A;  1P1Q A;  3K6U A;  2WBB A;  4XF5 A;  3TTR A;  4H67 A;  3IOU A;  2Y7P A;  1Q35 A;  3RQT A;  4R2F A;  2B3B A;  4O8M A;  3KOT A;  3DM0 A;  4U23 A;  3MVX A;  1UIV A;  5TU0 A;  4BDR A;  4OET A;  3FVG A;  1MRP A;  1Y4C A;  2D21 A;  3DP6 A;  3UK4 A;  1SD3 A;  1LBY A;  1B40 A;  1DPE A;  3O66 A;  1XS5 A;  2NXO A;  1ZIU A;  4DLD A;  1IMA A;  1O63 A;  1JVY A;  5ET5 A;  2REJ A;  3TCG A;  1LEV A;  4P0G A;  3T93 B;  2XXU A;  1N0T A;  4PF8 A;  4PF6 A;  1EH3 A;  4IO2 A;  2Z8F A;  2Y7I A;  4F31 B;  4OEV A;  3IOR A;  1MXY A;  2QVR A;  3T1B A;  4O7I A;  4DXU A;  3FUZ A;  2QJE A;  1UTH B;  4KYS A;  1EU8 A;  1FTL A;  3OO6 A;  1XT8 A;  5B70 A;  3EPE A;  4HCW A;  5ITP A;  1LST A;  5A5X A;  3MAM A;  4MEV A;  3I3V A;  1VFE A;  4DE8 A;  4YKI A;  1B3L A;  1KA1 A;  4GVO A;  1B7H A;  1ELJ A;  3M8U A;  4O3A A;  4OFO A;  2PT2 A;  3IB2 A;  3EN3 A;  2HHM A;  4MX6 A;  3SEV A;  3C32 A;  2Y7K A;  4OQO A;  5JEI A;  2ZZV A;  4FED A;  4X1D A;  1QGX A;  2CMO A;  1B58 A;  4ZEK A;  4N91 A;  2RCA A;  1N84 A;  3K6W A;  1MH4 A;  2O6A A;  1Y1Z A;  3LC8 A;  1LLS A;  3CG1 A;  4P47 A;  4IO4 A;  3VFJ A;  1G0I A;  1K9Y A;  5IKB A;  1UQW A;  3IOT A;  1NH7 A;  1LFI A;  4L17 A;  2GQ1 A;  4G68 C;  5IZ3 A;  4GXS B;  2MKZ A;  3RNN A;  2ZXT A;  3R6U A;  4EF1 A;  3MP8 A;  4MAG A;  3BBR A;  2X7P A;  1OLC A;  1DOT A;  2Q8J A;  1NH8 A;  4U4X A;  2DE4 A;  1LCF A;  4ESX A;  4FAJ A;  4POW A;  2FIX A;  2WOK A;  3USD A;  4F1V A;  4H0W A;  4LA9 A;  3I5O A;  3M3L A;  4Q8R A;  4F1Y A;  2XD3 A;  2HFB A;  3Q25 A;  3LSW A;  4IR8 A;  4R72 A;  1DSN A;  2FVZ A;  3TEL A;  4EQ7 A;  1P1U A;  3D1R A;  1MXX A;  3K0V A;  2RKM A;  2QPQ A;  3B6Q A;  1Q9D A;  2CEX A;  5L9O A;  1B0L A;  1SQY A;  3PPP A;  3PPQ A;  3H6W A;  1B2H A;  5CBS A;  1RKM A;  5KDT B;  4H1X A;  1HSJ A;  3OOA A;  3HHF A;  4PFI A;  1DTZ A;  3DEL B;  4I3Y A;  3UOR A;  1NUW A;  4ZEB A;  5I59 B;  3RT6 B;  3KN8 A;  1L5T A;  3IJO B;  3KJ7 A;  3IK6 B;  1YTV A;  1UTH A;  1ZBM A;  1LBB A;  4HS7 A;  1LAH E;  1FSA A;  3O2A A;  2F6G A;  2QMW A;  4GWO A;  2F7A A;  4ELR A;  4NF5 B;  4GBV A;  1B4H A;  1MDP 1;  4OER A;  2ZZW A;  4Z7E A;  4FE8 A;  1MY1 A;  5I58 A;  1MPB A;  4U4S A;  3EHU A;  1FPL A;  1OMP A;  2E0S A;  2HAV A;  5AA2 B;  2PCR A;  3FV2 A;  2ZNT A;  1IIW A;  1LCT A;  1JW5 A;  2UVJ A;  1B7Z A;  1MQD A;  3MP1 A;  3IX1 A;  4NWD A;  1R9Q A;  3PPN A;  3L6G A;  4JWY A;  5H8H B;  3GYY A;  1B51 A;  4BDM A;  2ONK E;  4ZE8 A;  2JJK A;  2PX1 A;  4JDF A;  4HXV A;  3V83 A;  4GWY A;  2XD2 A;  3K1P A;  1I6A A;  2I6E A;  2QS1 A;  2XX9 A;  3KGC A;  1A7L A;  3TTL A;  4R6H A;  3TQW A;  2O69 A;  3U93 A;  1FBD A;  4NF0 A;  2H25 A;  4N8G A;  2DWI A;  3ILT B;  1AL3 A;  2V3U A;  1OQG A;  5EYF A;  4LUB A;  4PFW A;  3IL1 B;  4JSD A;  4G8H A;  4N6D A;  2F6P A;  3TPA A;  5H8F B;  1QUI A;  1PB8 A;  3FJM A;  1JEV A;  2VP1 A;  3FV1 A;  5CBR A;  2KQZ A;  1N3W A;  2GRV A;  1G0H A;  2PT1 A;  4U22 A;  3O6I A;  1LBW A;  3T66 A;  3VDF A;  2I58 A;  2M8C A;  5DVF A;  1FRP A;  2WYP A;  1QUJ A;  1AMF A;  2HAU A;  1IZ1 A;  1HSL A;  2OWZ A;  5H8N A;  1URS A;  3ECR A;  5AA1 A;  2Q89 A;  3RPL A;  3C34 A;  3H3G A;  3SDF A;  3K6V A;  3IO6 A;  2XXP A;  1D4N A;  4G61 A;  4H5F A;  4NF4 A;  4LZ7 A;  5I57 B;  5TP9 B;  3TCF A;  3TZA A;  1FBP A;  4IGR A;  4OVR A; 
#chains in the Genus database with same CATH homology
 4C1T A;  3QSL A;  3H4Z A;  1H43 A;  4OVJ A;  2HQ0 A;  1MY2 A;  3HST A;  4RXL A;  4JBZ A;  3RPW A;  3G3F A;  4ELP A;  3S9M C;  4TLL B;  1LAF E;  4GOT A;  4U2R A;  3E9X A;  3DRI A;  3TCH A;  3C9H A;  2Z8E A;  2UVH A;  2XXW A;  3IO4 A;  4KI0 E;  4GF8 A;  4O3B A;  5F7V A;  3OEK A;  3K02 A;  4MFI A;  4U1Z A;  3VVE A;  1NMU A;  1O64 A;  2H98 A;  1A8E A;  1QVS A;  1LB9 A;  3ZS6 A;  4G68 A;  4WEP A;  4FEB A;  2ALU A;  4NF8 B;  4FAT A;  3TEP A;  3PV0 E;  4KHZ E;  4YB7 A;  3D4C A;  5M2V A;  3VLW A;  3HPI A;  1SW1 A;  1MXV A;  3TMG A;  4EQ9 A;  4GD5 A;  5AE4 A;  2V84 A;  2VD3 A;  5KZT A;  1POT A;  4PFU A;  2GHA A;  2XXI A;  1NKX A;  4P0I A;  3CVG A;  4MLV A;  4IGT A;  5HBC A;  3MWB A;  4F39 A;  1H45 A;  1NNP A;  3A3U A;  5I2K B;  3VLV A;  3KJT A;  1SBP A;  1Y1M A;  2Q9T A;  2VD2 A;  3B6W A;  3OSR A;  1UTB A;  4H5G A;  1NFT A;  1US4 A;  1YPN A;  5DVI A;  5DYH A;  2O1M A;  2NVU B;  5I58 B;  4GQO A;  5LOM A;  2AIX A;  4GLI A;  3DRH A;  2ESN A;  3K00 A;  3P7I A;  3PD9 A;  5TPA B;  4TQU Q;  2QL3 A;  3IB0 A;  1USY H;  3IAZ A;  4LP2 B;  1XVY A;  1SW5 A;  4R2B A;  4ZS9 A;  2D5W A;  3QIM A;  2DYX A;  3K1M A;  5EHM A;  5CMM A;  5K2Y A;  3Q26 A;  2RCB A;  4IO7 A;  4OZ9 A;  4F19 A;  1I6Q A;  1P1Q A;  1TWY A;  4F3S A;  1XC1 A;  3K6U A;  3PU5 A;  4Z0I A;  3BFU A;  3TTR A;  1LBC A;  2P0S A;  2DOJ A;  1PEB A;  4H67 A;  2O1L A;  4NED A;  3IOU A;  1J1N A;  4OTE A;  4F1Y A;  3MVZ A;  2Y7P A;  2F97 A;  1Q35 A;  3RQT A;  2GHB A;  4RK9 A;  1VR5 A;  4IY5 A;  4XTC Q;  5H8Q A;  4ZE9 A;  4R2F A;  4OXV A;  1BP5 A;  2B3B A;  1H76 A;  3KOT A;  3S2V A;  1NNT A;  2F7C A;  3DM0 A;  4NWC A;  1MY3 A;  4U23 A;  2DXY A;  1A54 A;  3RYB A;  3HCQ A;  3MVX A;  1UIV A;  5TU0 A;  3W9V A;  4BDR A;  4OFJ A;  1M5C A;  4OET A;  1N7W A;  2A5S A;  4M1V A;  3V5A A;  4GL8 A;  1B3H A;  1TFD A;  3O6G A;  3FVG A;  4H6D A;  1MRP A;  4ESW A;  2VHA A;  1Y4C A;  2D21 A;  3DP6 A;  3U1O A;  3QUF A;  1A99 A;  3LSX A;  2KLF A;  3UK4 A;  1SD3 A;  4E0W A;  3U94 A;  1FQD A;  1AH5 A;  4F29 A;  4POX A;  4QFO A;  3E3K A;  1SDX A;  3OO9 A;  1VFD A;  1B40 A;  1DPE A;  1EZO A;  3O66 A;  1XS5 A;  2IEE A;  2NXO A;  3N26 A;  2I0B A;  3MVY A;  1ZIU A;  4QF9 A;  4ZZE A;  4DLD A;  1CE2 A;  4RJZ A;  3A3C A;  1O63 A;  4DXB A;  1PBP A;  3O6P A;  5I2N A;  3UA8 A;  1LAG E;  1SYI A;  1TT1 A;  2A5T B;  1JVY A;  2REJ A;  2ZMB A;  3HN0 A;  4ZEC A;  3TCG A;  1DTG A;  4P0G A;  3TTM A;  4MBP A;  2RC7 A;  3T93 B;  2XXU A;  1N0T A;  2HZL A;  3DRJ A;  3MZ9 A;  2PMS A;  4LQ5 A;  4QSD A;  4ONY A;  1EH3 A;  2Q88 A;  3C4M A;  1BLF A;  4TLM B;  2RC8 A;  4UA8 A;  4WED A;  3TTN A;  2F78 A;  1M5E A;  3KN3 A;  4IO2 A;  2F36 A;  1OLA A;  2OWT A;  1D9Y A;  2F5X A;  3PMW A;  3R26 A;  2Z8F A;  3N94 A;  4KR5 A;  2X7Q A;  2Y7I A;  1Y3N A;  4O3C A;  3DP8 A;  3UN6 A;  4F31 B;  3A09 A;  4OEV A;  4DCY A;  2XX8 A;  3VVF A;  1ANF A;  2OJT A;  2XXX A;  4FOR A;  5ELV A;  4RA1 A;  3IOR A;  4NE4 A;  2ZYN A;  1T0K A;  3K01 A;  1MXY A;  1GVC A;  3MUQ A;  1LB8 A;  3PPR A;  4R6K A;  5A5X B;  4QHQ A;  2DE3 A;  4DXU A;  4OWD A;  3DRG A;  3FUZ A;  4YKJ A;  4ZED A;  1MS7 A;  3T96 B;  2QJE A;  3DRF A;  4DZ1 A;  4EXK A;  2ONR A;  4ELQ A;  5BWJ A;  1XVX A;  2UVG A;  1UTH B;  1R1N A;  4I1D A;  4KYS A;  1EU8 A;  4I9D A;  1FTL A;  1XT8 A;  2RIN A;  3OO6 A;  4NTL A;  1BTJ A;  1II5 A;  3EPE A;  3RLF E;  4DIG A;  5B70 A;  4HW8 A;  4R75 A;  4HCW A;  4YZZ A;  3MPL A;  2UVI A;  5EHS A;  1LST A;  4OEN A;  3FVO A;  3ZSF A;  2Z8D A;  3R7X A;  4F22 A;  5A5X A;  1FTJ A;  1JW1 A;  3W15 C;  3DLN A;  3IR1 A;  3MAM A;  4IO3 A;  3I3V A;  4OMB A;  5CI5 A;  4DXC A;  4Q30 B;  1VFE A;  4GIZ A;  3MQ9 A;  4PP0 A;  3BKI B;  5BUU A;  3PUW E;  3VVD A;  3QK6 A;  2V3T A;  3V8X B;  4DE8 A;  4YMA A;  4YKI A;  3M3K A;  1B3L A;  2FYI A;  3OO8 A;  3SES A;  4GVO A;  2F7B A;  4NF6 B;  1B5J A;  3C31 A;  1B7H A;  4F18 A;  5AA4 A;  2UYF A;  5JK4 A;  1ELJ A;  5I2K A;  1ZTY A;  5KDT A;  1B52 A;  4KD5 A;  4XKQ A;  1QJM A;  3CFZ A;  4GL0 A;  3G3H A;  2ABH A;  2HCA A;  2PBW A;  4R9G A;  1NNK A;  3M8U A;  1MY0 A;  1B5I A;  4OFO A;  3HHG A;  3EHT A;  2PT2 A;  4O3A A;  3IB2 A;  4H8J A;  3EN3 A;  3TTK A;  4F1U A;  4QFL A;  3DRK A;  1MM6 A;  1Y3Q A;  3FIR A;  2O7U A;  3C32 A;  3G3K A;  3SEV A;  2Y7K A;  4OQO A;  2WKY A;  3TQL A;  5AA3 A;  2I48 A;  2G93 A;  4G77 A;  4FED A;  3Q29 A;  5JEI A;  1XOC A;  4QFN A;  3G3J A;  4ECF A;  4R6Y A;  4FIM A;  2QS3 A;  3FGS A;  4X1D A;  2B4M A;  3KZG A;  4DDD A;  4I8C A;  2FNC A;  3IOV A;  2XXH A;  4ND9 A;  2NUV A;  2B65 A;  3EHS A;  4R9F A;  2CMO A;  3CIJ A;  4Q0C A;  1B3E A;  1B58 A;  3K1N A;  4ZEK A;  3KSJ A;  4QSE A;  2WOP A;  3JYR A;  4YAH X;  1PB9 A;  1B32 A;  4XKP A;  1B1X A;  2RCA A;  5F1Q A;  2AL5 A;  4JWO A;  1FQC A;  1VSO A;  5H8H A;  5I59 A;  1ZJL A;  2G29 A;  1N84 A;  2YJP A;  3K6W A;  1MH4 A;  2GFE A;  3OEN A;  4ZEI A;  2O6A A;  2OBG A;  1YAE A;  1SVX B;  1YCJ A;  1QUK A;  1Y1Z A;  4AQ4 A;  4MLQ A;  3LC8 A;  1EZP A;  1LLS A;  3T9H B;  3CG1 A;  1WDN A;  3IB1 A;  3KFM A;  5ITP A;  1DMB A;  4OFL A;  2QS4 A;  3LVU A;  1FQE A;  3GBB A;  3ZKK A;  2AYS A;  1A8F A;  2R9J A;  4IO4 A;  1MH3 A;  2DWJ A;  4YB5 A;  4HCY A;  1IIT A;  3VFJ A;  1RYO A;  1UQW A;  2VGQ A;  3B7D A;  4I62 A;  1N3X A;  1NL5 A;  5IKB A;  3FJ7 A;  3SER A;  3L6H A;  3IOT A;  1NH7 A;  2Y7W A;  1LGB C;  2OZZ A;  3KSX A;  1IQ7 A;  3H06 B;  5AA4 B;  1PBQ A;  1JVX A;  1LFI A;  5KCJ B;  4L17 A;  3PUZ E;  4G68 C;  4C0R A;  4YKP A;  4GXS B;  1SI0 A;  3RNN A;  4F2Q A;  1SI1 A;  5CC2 A;  5TPA A;  1FCK A;  3H7M A;  5I56 A;  2PVU A;  2ZXT A;  4QFK A;  3MC2 A;  2I3V A;  3PMV A;  4NF5 A;  4YMB A;  3R6U A;  4EF1 A;  2AL4 A;  3MP8 A;  1TFA A;  1B6H A;  4QFP A;  3ODB A;  3QUJ A;  2ZNS A;  3BBR A;  4RK2 A;  3THI A;  5HPQ A;  1RYX A;  2X7P A;  1OLC A;  2O7I A;  1FQF A;  4MF3 A;  1DOT A;  3SET A;  2Y84 A;  4IO5 A;  1IXI A;  3BFT A;  1VE4 A;  1NH8 A;  3CSB A;  4HTG A;  5CMB A;  2Q8J A;  4U4X A;  2DE4 A;  3Q27 A;  2HXW A;  1LCF A;  1UIU A;  4K3F A;  4X48 A;  4X1B A;  5FHM A;  4BLA A;  4EQB A;  1GR2 A;  4ESX A;  4FAJ A;  3FAT A;  3O97 A;  2F34 A;  3RY3 A;  4POW A;  3VXC A;  1N7X A;  2WOK A;  3H6U A;  4NF8 A;  3USD A;  2P2A A;  1O7T A;  4F1V A;  4G68 B;  1EZ9 A;  4H0W A;  1M5B A;  1B46 A;  2Y7R A;  2I0C A;  2R6G E;  2RF1 A;  2ZYM A;  4LA9 A;  2WOL A;  3I5O A;  3M3L A;  4QSC A;  3OMB A;  3RN8 A;  4Q8R A;  2PYY A;  3CHG A;  1JEU A;  1S7Y A;  1F9B A;  3FXR A;  2XD3 A;  3K6X A;  1ZLQ A;  2HFB A;  5K2X A;  3S4U A;  2DVC A;  2O84 X;  3Q25 A;  4KYD A;  1Y20 A;  5DEX A;  3LSW A;  3UIF A;  1MG1 A;  2ONS A;  4KQP A;  4R72 A;  5HM4 B;  1DSN A;  4ZZA A;  3W9W A;  1H44 A;  1FTO A;  5DTB A;  4IY6 A;  4RPO A;  1P1N A;  2VOZ A;  3TEL A;  4OEU A;  1JW4 A;  4EQ7 A;  1ZKB A;  4OES A;  1MY4 A;  4KCC A;  3S9E A;  1P1U A;  2X26 A;  1S50 A;  3HO7 A;  1MXZ A;  1MXX A;  3K0V A;  1BIY A;  1Y9U A;  3K2D A;  2RKM A;  1ATG A;  3QXM A;  3TDJ A;  4KPT A;  4U1O A;  1DPP A;  5DVJ A;  2QPQ A;  3TKD A;  3ZKL A;  3QYT A;  3B6Q A;  1AOV A;  3PUV E;  3U72 A;  2Z22 A;  1B4Z A;  2OWS A;  5FTI A;  5L9O A;  4BDQ A;  1WVJ A;  3OD7 A;  1B0L A;  1QKA A;  4OHN A;  3AXF A;  1SQY A;  3PGF A;  3PPP A;  2Z23 A;  4FEC A;  4YIC A;  5FHO A;  1JQF A;  1QKB A;  3CFX A;  3KN7 A;  4LZ8 A;  3GXA A;  3PPQ A;  3H6W A;  1B2H A;  4JSO A;  1US5 A;  2F35 A;  4LQ2 A;  3H03 A;  1P1W A;  5CBS A;  1MXU A;  5ICT A;  1RKM A;  5KDT B;  1R9L A;  4H1X A;  2F8D A;  4NF6 A;  1HSJ A;  4N13 A;  3OOA A;  3HHF A;  1M5F A;  1PC3 A;  4H65 A;  5H8N B;  1PB7 A;  3LBS A;  2XXR A;  2UYE A;  4BDL A;  1DTZ A;  1HSE A;  1D3K A;  2DQV A;  3D4G A;  3DEL B;  3E13 X;  3KBR A;  4C1U A;  4F3G A;  3MP6 A;  3SEY A;  3UOR A;  4F3P A;  2XXV A;  3PUY E;  5L8D A;  3FVN A;  1B05 A;  4ZEB A;  1JNF A;  2ZNU A;  4KYE A;  4Q5T A;  4X9T A;  5I59 B;  3RT6 B;  2XX7 A;  1MQJ A;  1MDQ A;  1SW4 A;  2DVZ A;  3KN8 A;  1B7U A;  1L5T A;  1URG A;  3T22 A;  5H8Q B;  3IJO B;  3KJ7 A;  2OK2 A;  3MJN A;  2V3Q A;  3S9L C;  3CFL A;  4LON B;  3O6H A;  3IJX B;  3MVW A;  3IK6 B;  1YTV A;  4LZ5 A;  1UTH A;  2XXQ A;  3VXB A;  1ZBM A;  2P1S A;  1LBB A;  2B3F A;  3GLB A;  4HS7 A;  4IO6 A;  1GV8 A;  3SEW A;  5IAI A;  1LAH E;  1OIB A;  3SEX A;  3N5L A;  5H8F A;  3LR1 A;  3RTF B;  3RUM A;  2Q2C A;  4WKM A;  4ISU A;  5CM6 A;  3O2A A;  2CZL A;  2F6G A;  3OXN A;  3Q28 A;  3UGW A;  2DP8 A;  5AA2 A;  2QMW A;  4UAC A;  2V93 A;  4P11 A;  4GWO A;  4BDN A;  3KOS A;  2F7A A;  3PUX E;  4NF5 B;  4ELR A;  4AB5 A;  1B4H A;  5I56 B;  1MDP 1;  3TFL A;  1B1H A;  1B3G A;  4OER A;  2UXA A;  5J1D A;  4Z7E A;  4FE8 A;  1MY1 A;  4XKN A;  1N76 A;  5L9M A;  1LFH A;  4THI A;  1IXH A;  5I58 A;  2O51 A;  1I6B A;  1MPB A;  4U4S A;  3EHU A;  2YLN A;  1GTK A;  1OMP A;  3FD3 A;  2E0S A;  2HAV A;  5AA2 B;  1OVB A;  3FV2 A;  4TOZ A;  2ZNT A;  1SYH A;  1IIW A;  3O9P A;  3MZB A;  3FZV A;  3HV1 A;  5KCJ A;  2I3W A;  1GGG A;  2FA7 A;  2OCU A;  3LSL A;  3EF7 A;  3PPO A;  3RYA A;  4FJP A;  4G8N A;  4JXI A;  4NMY A;  4ELO A;  1LCT A;  4PFT A;  3OO7 A;  3GBA A;  5ITO A;  3U8Q A;  5L9S A;  5I2N B;  2NOO A;  1FQB A;  1MQH A;  3PMX A;  3F11 A;  5FHN A;  1LAX A;  1D9V A;  1JW5 A;  3T9U A;  2UVJ A;  1B7Z A;  1MQD A;  3MP1 A;  3IX1 A;  1OVT A;  4G8M A;  4NWD A;  2DE2 A;  1R9Q A;  3FAS A;  3O28 A;  4N6P A;  1B9J A;  1Z7M E;  2DWH A;  3PPN A;  4YKK A;  3FTO A;  2XHD A;  3L6G A;  4KFQ A;  4WXJ A;  2H9B A;  1IUD A;  4XIG Q;  3WAE A;  3K4U A;  3O29 A;  4JWY A;  4YB6 A;  5H8H B;  1B51 A;  3UP9 A;  2QMX A;  1IXC A;  5ICQ A;  1TXF A;  4BDM A;  1AIV A;  4H8I A;  2ONK E;  4ZDM A;  3TOD A;  4ZE8 A;  1USY E;  3EQ1 A;  2PX1 A;  3RGY A;  5AA2 D;  4JDF A;  3CSG A;  3C36 A;  3RT8 A;  1QW0 A;  3LUY A;  4YU0 A;  3V83 A;  2H5Y A;  2XD2 A;  1P99 A;  2V25 A;  1I6A A;  2I49 A;  3K1P A;  3QAX A;  3C35 A;  4ZEF A;  4LAT A;  1MQG A;  2I6E A;  3ONM A;  1N04 A;  4NF4 B;  3RTW B;  4GFR A;  2RC9 A;  4OYV A;  1URD A;  2DS9 A;  2GH9 A;  2ZYO A;  1NNF A;  4R73 A;  3VV5 A;  1MQI A;  2QSX A;  2QS1 A;  3N6U A;  2XX9 A;  3SKP A;  5JTY B;  1Y4T A;  2XXY A;  3B6T A;  4GXA A;  4RY1 A;  4XXU A;  3C33 A;  2LAO A;  3KGC A;  5FTH A;  1A7L A;  4PET A;  1FW0 A;  3SEU A;  1FTK A;  2H4I A;  4RPN A;  1A55 A;  4MH5 A;  4R6H A;  2E1S A;  3TTL A;  2DXR A;  1JET A;  4IB2 A;  1Y3P A;  3TQW A;  4GRK A;  3TYH A;  1ZU0 A;  2O69 A;  2ZYK A;  1XHY A;  4RYA A;  3U93 A;  3WAF A;  2W7Y A;  3DP4 A;  2H25 A;  4E0X A;  4EDP A;  2HEU A;  5CRY A;  2DWI A;  3ILT B;  1AL3 A;  3MPK A;  2V3U A;  5B7D A;  3T9V A;  1A40 A;  1UTB B;  2O68 A;  3FVK A;  1OQG A;  1Z7N E;  3CR9 A;  3G3G A;  1ZMG A;  5EYF A;  3TAJ A;  5DEX B;  4LUB A;  4PFW A;  5CMC A;  3PD8 A;  5JTY A;  4RNS A;  4PFY A;  3IL1 B;  1FQA A;  1IEJ A;  2XXT A;  5I84 A;  1CB6 A;  4JSD A;  1M5D A;  1WOD A;  4G8H A;  4PE5 B;  1I69 A;  1B5H A;  3T9X B;  1R6Z A;  2F6P A;  1QUL A;  3TPA A;  3CRB A;  3OEL A;  5H8F B;  1QUI A;  1PB8 A;  2QRY A;  3U92 A;  3FJM A;  1SW2 A;  1JEV A;  1BKA A;  2VP1 A;  3G7W A;  3FV1 A;  3KG2 A;  3KEI A;  4G2Z A;  5CBR A;  3TUS A;  2OLB A;  1MPD A;  1B3F A;  1H3D A;  1N3W A;  2I4C A;  2GRV A;  2PT1 A;  4JB7 A;  4U22 A;  2H99 A;  3O6I A;  3VDF A;  3T66 A;  3CI8 A;  4M4G A;  2I58 A;  2IA4 A;  2M8C A;  5DVF A;  4F2O A;  1QUJ A;  5DT6 A;  3MW0 A;  4EF2 A;  3VE1 B;  1AMF A;  3FJG A;  2HAU A;  3MZ1 A;  3CG3 A;  3G3I A;  5H8S A;  1IZ1 A;  1HSL A;  3MBP A;  2ANJ A;  3S9N C;  2DSF A;  1MM7 A;  4N07 A;  2NWJ A;  4QRZ A;  3GZG A;  3I6V A;  3V89 B;  4U21 A;  5H8N A;  3PAM A;  2YPN A;  1LFG A;  1URS A;  1Q1K A;  4LVQ A;  3ECR A;  2QS2 A;  1P1O A;  5AA1 A;  2Q89 A;  1PDA A;  3E4R A;  3OEM A;  4AB6 A;  1MPC A;  1IXG A;  3JZJ A;  3C34 A;  5TP9 A;  4F3B A;  3H3G A;  5I57 A;  1B0H A;  1KWH A;  1POY 1;  3K6V A;  3M3F A;  3SDF A;  3H6V A;  2R71 A;  3IO6 A;  3JV9 A;  3LSF B;  3H6T A;  4KCD A;  4R74 A;  4EUO A;  2XXP A;  3OSQ A;  3N6T A;  4BDO A;  2A5T A;  4XKR A;  1MXW A;  1D4N A;  4JWX A;  2B4L A;  2REG A;  3ILU B;  4H5F A;  4NF4 A;  4LZ7 A;  2HZK A;  4PQJ A;  5CMK A;  5I57 B;  3VLU A;  5TP9 B;  3TCF A;  4DCX A;  4G4P A;  2DWA A;  2I4B A;  3FXU A;  5ISU A;  2THI A;  3TZA A;  1OQH A;  3FXQ A;  1S9T A;  3IOW A;  2D3I A;  4EXL A;  4IGR A;  1FTM A;  2BJJ X;  2Q2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...