1B2HA

Oligo-peptide binding protein complexed with lysyl-ornithyl-lysine
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
total genus 186
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b2hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b2hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b2hA02
2YLNA 1O7TA 1JEVA 1N04A 3MZ1A 4RYAA 1R6ZA 4GF8A 5ICQA 1FTLA 1N0TA 1UTHB 2Z8DA 3CG1A 4MH5A 4TLMB 4X1BA 3I3VA 3TFLA 1B4HA 4C0RA 4X9TA 3T96B 3TQWA 3F11A 3PUVE 2Z8EA 2RINA 2I49A 4F3SA 4JXIA 2ABHA 2ZYKA 5TPAB 5J1DA 4ZEIA 4BDMA 1Y20A 2BJJX 1URDA 3QUFA 4IB2A 5DVIA 3G3KA 4QSEA 3K2DA 4R74A 3EHSA 3O28A 5I57A 5H8NB 1I69A 1QVSA 4MBPA 5BUUA 2XXWA 1QUJA 1QW0A 2GRVA 1FQCA 2O6AA 4FEDA 5JK4A 4LZ5A 4N07A 1IXCA 3RNNA 3OSRA 3VLUA 3ZKKA 4FAJA 1NH8A 3FXRA 3O6PA 1N7XA 1ZKBA 4NWDA 4PP0A 1HSJA 1TFAA 3M3FA 3UA8A 4GOTA 3TKDA 3CHGA 1SD3A 1SI0A 2XXUA 5BWJA 3TQLA 5H8FB 1A8EA 1FQFA 1A54A 2Q88A 5K2XA 1HSLA 3S9EA 3OO8A 1Y3NA 3QUJA 4RNSA 4QSDA 2GHAA 3FV2A 3OEKA 1OVTA 3U1OA 4XKRA 2HFBA 4U4SA 3TTKA 2A5TB 1AL3A 3MZ9A 1B7ZA 4RY1A 2UVIA 4WKMA 3ZS6A 4Z0IA 2OCUA 3K4UA 2F36A 1YPNA 3C9HA 1N3WA 1XVYA 4YKKA 5I2NA 1B5JA 2ONSA 2XXIA 4NF6B 3JYRA 4IGTA 4I62A 1SDXA 1A99A 3FIRA 1LLSA 3H6VA 3IOTA 3PGFA 4GXSB 4P0GA 3OMBA 1UTBB 4OQOA 3MVZA 1LAGE 1PBQA 3H4ZA 4KCDA 4NTLA 3I6VA 4YB7A 1JEUA 1OMPA 3IB2A 3ILUB 1JW4A 1YTVA 3FUZA 3OD7A 4QRZA 2UXAA 4R72A 2DWIA 4XKPA 2WKYA 3PUWE 4O3AA 5I2KA 3TCHA 4QFNA 2O1LA 3T9UA 1N76A 3G3HA 3DRJA 2I0BA 4PFUA 1FTOA 1NL5A 2D5WA 1MY3A 1DPPA 2F6PA 3FVOA 3HO7A 4LVQA 4PQJA 3RLFE 4ISUA 2UVJA 3EHTA 3PPNA 4BDNA 3ILTB 3E3KA 4DLDA 4FATA 4YU0A 4U1OA 1POY1 2XXHA 4F29A 1B46A 1PB8A 2OWSA 3PPOA 5AA4B 4OYVA 3GLBA 2NVUB 4RJZA 4RK9A 3K6UA 4FECA 4ONYA 4WEPA 1PDAA 3WAEA 1VFDA 5AA2B 1MH3A 2I4CA 5AA3A 3AXFA 4KD5A 1OLCA 3HSTA 1Y1MA 4AQ4A 1CB6A 3OO7A 3KGCA 2Q2AA 1B3GA 4ZEDA 2DYXA 2Q9TA 3IORA 4G8MA 4GFRA 4UACA 3PPRA 4MLVA 5H8QB 3RT8A 4GQOA 1P1OA 1P1QA 4LONB 3W9VA 2I3WA 2F97A 5DEXB 5HBCA 3MZBA 4XTCQ 2ONRA 2PBWA 5I59B 4HS7A 4EUOA 3SEUA 2ESNA 3LC8A 2I58A 3BFTA 2WOKA 1P99A 1YAEA 4PFTA 4PETA 4R2BA 3OSQA 3TTNA 3TTMA 4OENA 1Q1KA 4GLIA 5EHSA 5FTHA 3W9WA 4U1ZA 1XT8A 1B7UA 4OTEA 1FCKA 5TU0A 4IO2A 3QK6A 3IB1A 3MP6A 1S9TA 1DTGA 2F78A 3RYBA 1D9VA 1MQDA 3C31A 3K1NA 2NWJA 1GTKA 3RTFB 3TAJA 1B32A 2HAVA 1SW4A 2OJTA 5CMCA 4N13A 5M2VA 1B40A 4G77A 4E0WA 3JZJA 5AA4A 1MXVA 1EZ9A 1SW2A 3MWBA 4UA8A 1TWYA 1ATGA 1US4A 3CRBA 3KEIA 3Q28A 3QYTA 1RYOA 1WODA 2V3QA 3EQ1A 3H3GA 3OOAA 3SESA 2Z23A 5H8SA 3USDA 3U8QA 2DXRA 5AA2D 2H98A 4QFLA 3QAXA 1URGA 3SKPA 1B1XA 3FXUA 3O97A 2V84A 3H03A 3A3CA 2RCBA 4PFYA 4YB5A 5JTYB 5L9MA 3TYHA 3CR9A 1FTKA 1SI1A 5I57B 4H65A 3O9PA 4OFOA 1ELJA 4QFPA 1H76A 1WVJA 3Q26A 4OEUA 4G68C 2VOZA 1O64A 4FIMA 3TELA 3V89B 3TTLA 2UVGA 4ESWA 4EDPA 1S7YA 4WXJA 4AB6A 1QJMA 3DRFA 1DOTA 4H0WA 3SETA 5CC2A 3TCGA 2RC9A 3RPWA 2B65A 3DM0A 4JDFA 4QHQA 2V25A 3C32A 4I9DA 2Y7KA 3FVGA 1L5TA 5CMBA 3LVUA 3MVWA 2I4BA 1WDNA 2R6GE 4R73A 1Z7NE 1USYH 2XHDA 4R75A 1Y1ZA 4KYSA 4F22A 3OEMA 4YMAA 3H6UA 4F3PA 3LSWA 4OETA 2PMSA 2VHAA 5H8FA 2X26A 2Q8JA 1LAXA 4LQ2A 4ZZAA 3B7DA 3G3JA 4Q0CA 2H9BA 4R6KA 4GL8A 1KWHA 3ONMA 3ZKLA 3UK4A 1HSEA 2O84X 2YJPA 4KCCA 5TP9A 3T9VA 3RYAA 2O69A 2XD2A 5I59A 3RTWB 1LCFA 2WOLA 1TFDA 4NF8A 5CMKA 1FQEA 1TT1A 2FYIA 4LQ5A 2QSXA 2D3IA 3CFXA 4NF5A 3C33A 2Y7IA 3MP8A 3M3LA 1P1UA 3K1MA 5KDTB 2AL4A 5H8NA 4NF4B 4TQUQ 1NNFA 3ZSFA 1N7WA 1LBCA 3A09A 1MH4A 3D4GA 3SEYA 3B6QA 1DSNA 2I3VA 3IOUA 5HM4B 2DS9A 2VGQA 3EN3A 2LAOA 1XS5A 3DRIA 1N84A 3DP4A 3H6WA 3OO9A 3IJOB 1ANFA 2HQ0A 5L9OA 3TCFA 1MPDA 4H6DA 3VVFA 3EPEA 3K1PA 3WAFA 2H5YA 1IXGA 2H4IA 3N26A 1UTHA 1OQGA 4O3CA 1B58A 4OMBA 1N3XA 3RN8A 1FQDA 2ZYNA 3C4MA 4PE5B 3PMXA 1MPBA 1QKAA 4H5GA 3SDFA 4DZ1A 4U21A 1JW5A 2M8CA 4PFWA 2O7IA 3TZAA 2DP8A 1EZOA 1MY0A 4TLLB 1Y4TA 2QS2A 4FJPA 1MY1A 2DE4A 4ZE8A 2HZLA 4QFOA 3MP1A 3IL1B 3MUQA 4GRKA 4OESA 1ZLQA 1LAFE 3CSGA 3MAMA 3IOWA 4MFIA 5CRYA 3T93B 1ZBMA 2XXXA 4KYEA 1JVXA 2V93A 1MQGA 1BP5A 1SVXB 1B05A 2DVCA 2GHBA 3VLVA 2H99A 4KFQA 2Y7WA 3TODA 4H5FA 1MQJA 3ECRA 4JWOA 1MY2A 2QS3A 1LB8A 3C35A 3O2AA 2DE2A 2ZMBA 2F7BA 4HCYA 3M3KA 1ZTYA 2F7CA 1R9QA 4U22A 3RT6B 4C1UA 2RC7A 2F34A 1FTMA 4L17A 1RYXA 3FD3A 2DWHA 3QIMA 3P7IA 4YICA 4DCXA 1VR5A 2D21A 3K01A 3UP9A 4R9GA 1Q35A 3VXBA 5I56A 2NXOA 4FORA 1Y4CA 3KBRA 3MJNA 3LBSA 3PPQA 4DDDA 3UN6A 2HCAA 2ZYMA 4F31B 4QFKA 2VD2A 1UIVA 3DRKA 3T66A 4GXAA 1XVXA 1DTZA 4R2FA 3VDFA 2YPNA 3DLNA 4MLQA 5I2NB 1O63A 2B4MA 1MQIA 2REJA 4P0IA 3W15C 4EQ7A 3PU5A 1VSOA 2HEUA 5AA1A 2XX8A 2RKMA 5LOMA 4IO7A 3EHUA 5FHNA 1PB9A 2ZNTA 1M5DA 1YCJA 1QULA 5DEXA 3K6VA 2G93A 3TEPA 2B3FA 4BDLA 3CFZA 2RCAA 1XC1A 2R9JA 3MVYA 4WEDA 2HZKA 5L9SA 2Y84A 4NWCA 3CIJA 4EQBA 3PMVA 2ZNSA 3TTRA 2ZXTA 5I56B 4LZ8A 4LZ7A 2V3TA 3G3FA 2AL5A 1XOCA 3IX1A 4F2OA 1QUIA 2ZNUA 3FV1A 3N6UA 4ZZEA 4KI0E 3IO4A 4JSOA 4R9FA 5AA2A 2IA4A 5KCJB 3QSLA 3FTOA 2WOPA 2O7UA 5KDTA 1JW1A 2ANJA 4RK2A 1Y3QA 3IOVA 3G3IA 5ITPA 2HAUA 3IR1A 2O1MA 1H45A 4ZEKA 3E4RA 3FATA 4ZDMA 1MXYA 2DVZA 4Z7EA 1JVYA 2W7YA 3FJMA 1S50A 1MG1A 1B3LA 1H44A 3G3GA 4NF4A 1B7HA 1GGGA 4DCYA 1FQAA 1II5A 1B4ZA 2OZZA 2CMOA 1P1NA 4LUBA 4NE4A 5B70A 2FA7A 4NF5B 1AOVA 1DMBA 4H1XA 4HW8A 5I2KB 4RPOA 3U94A 4NF8B 1LFIA 1PBPA 3BFUA 3LSXA 4G8HA 1B3HA 3C34A 3KSXA 4G4PA 4DIGA 1B3FA 1IUDA 1MXWA 4OERA 5TP9B 1M5BA 3GBBA 1MY4A 5K2YA 4C1TA 1MM6A 4BDRA 2PT2A 3VVEA 3Q25A 1M5FA 3GBAA 4H67A 2UYFA 4NF6A 4XIGQ 4Q8RA 2XXYA 4GL0A 5B7DA 2H25A 3R26A 4KQPA 2ZYOA 2QPQA 3OENA 3K00A 1LCTA 3MPLA 1IEJA 2F7AA 3N5LA 1JQFA 4ND9A 5CMMA 2A5TA 1B51A 2E0SA 3T9XB 3VE1B 3MBPA 3S9NC 2R71A 1GVCA 1LGBC 3PD8A 1MXXA 2XX9A 3N94A 2QS4A 1AMFA 3A3UA 1IITA 3VFJA 4F18A 2DXYA 3MC2A 2PYYA 3VXCA 2XXPA 1R9LA 4U23A 4ZEFA 1BLFA 3CSBA 2KLFA 3VLWA 1B3EA 1MPCA 3FGSA 3IJXB 3K02A 5CBRA 4IO4A 1QUKA 3N6TA 3O6HA 3DRGA 1FW0A 2NUVA 2IEEA 3B6WA 3H06B 3T22A 2F5XA 3KJTA 2OK2A 4JBZA 2DSFA 5A5XB 2DOJA 4FEBA 1MRPA 4JWXA 4F3GA 1SYIA 1DPEA 3S9MC 4OZ9A 1ZIUA 3K6XA 3O6GA 1I6QA 4GD5A 5DTBA 4YMBA 1IZ1A 1LFHA 2XXTA 4F2QA 1F9BA 4U4XA 3VVDA 1IXIA 4YKIA 5JEIA 2RF1A 1B0LA 4BLAA 2QS1A 5TPAA 1R1NA 1M5CA 3VV5A 5ITOA 1MS7A 1NH7A 2F35A 3UIFA 1SYHA 3HPIA 2THIA 1EZPA 2PT1A 3FZVA 3TMGA 4BDQA 4F19A 2G29A 3DP8A 4OFJA 1Y3PA 2V3UA 3KSJA 4POWA 4BDOA 1XHYA 3THIA 4E0XA 1A55A 3BBRA 3V83A 1SW5A 1UQWA 3FASA 3GZGA 3JV9A 4HCWA 3EF7A 1GV8A 3M8UA 1URSA 4X1DA 3RUMA 3LR1A 3CI8A 1BIYA 2A5SA 3E9XA 2VP1A 2F6GA 3G7WA 3OO6A 3S2VA 3FJ7A 4YKJA 5ISUA 5EYFA 4JSDA 2QMWA 3CVGA 3FVKA 1PB7A 1NMUA 3SEXA 3V8XB 3QXMA 1MDQA 1NNPA 4ELPA 2QL3A 4G68B 2NOOA 2XD3A 5FHOA 3HV1A 1B5IA 1B6HA 1SW1A 1NKXA 3IB0A 4EXLA 2Q2CA 3KFMA 4H8JA 5H8QA 1VE4A 2OLBA 1EH3A 4YB6A 4KR5A 4RXLA 5F7VA 3S9LC 4ESXA 4FE8A 3Q27A 2ONKE 3E13X 5CI5A 1B0HA 4ZS9A 1MM7A 2AIXA 3RQTA 3PUZE 3RGYA 2Y7RA 4XKNA 5EHMA 2P1SA 4RA1A 4TOZA 4NMYA 2I48A 1ZU0A 3TPAA 3HHFA 3PMWA 4LATA 3U72A 3UGWA 1D9YA 5F1QA 4RPNA 2XX7A 3OXNA 1IXHA 3FVNA 1SBPA 3MQ9A 4P11A 1OIBA 2E1SA 2VD3A 1JETA 2PX1A 3KOTA 3O66A 4G8NA 4H8IA 4U2RA 3LSLA 3HHGA 4I8CA 4F1VA 5CM6A 3MPKA 2AYSA 3O6IA 3KG2A 4LA9A 3DRHA 3MVXA 1VFEA 3HCQA 3LUYA 2B4LA 4OHNA 3FXQA 3LSFB 2GH9A 1I6BA 1PEBA 3FJGA 5JTYA 1I6AA 1LBBA 5H8HA 1UTBA 3KZGA 2XXQA 3SEWA 1NNKA 3OELA 5CBSA 5I58B 3L6HA 4QSCA 4F39A 4EF2A 4K3FA 4F1YA 1EU8A 1ZMGA 1CE2A 1LSTA 2HXWA 3PUXE 5ELVA 4QF9A 3PPPA 3ODBA 3H6TA 2UYEA 4EF1A 4G2ZA 4MF3A 1AIVA 4OEVA 3D4CA 4N6PA 5AE4A 4NEDA 1B9JA 3CFLA 4JWYA 1QKBA 3V5AA 4YZZA 4AB5A 1A7LA 1LFGA 1MXZA 1M5EA 4ZE9A 1D4NA 2DWAA 3PUYE 4KHZE 4O3BA 1OQHA 3SERA 4GWOA 5I84A 3H7MA 1A8FA 4ZECA 1AH5A 1IIWA 3GXAA 2Z22A 1FTJA 3KN8A 3R7XA 4R6HA 4XKQA 3C36A 5ICTA 3PAMA 2XXRA 3PV0E 2FNCA 3BKIB 3KN3A 4Q5TA 4XXUA 1NNTA 4YKPA 4EQ9A 4F3BA 5HPQA 4ECFA 3T9HB 2DQVA 2PVUA 3UORA 5L8DA 2Q89A 4OFLA 5I58A 2OWTA 1J1NA 2P2AA 5FHMA 1MDP1 1ZJLA 5H8HB 2XXVA 2X7PA 3DELB 4GIZA 2DWJA 4KYDA 2F8DA 2B3BA 4IO3A 2X7QA 4F1UA 1SQYA 2I6EA 2QJEA 1A40A 3K6WA 1POTA 4HTGA 4KPTA 3SEVA 3MW0A 2GFEA 2OBGA 1P1WA 1Y9UA 4IY6A 4EXKA 1D3KA 1H3DA 5IKBA 1UIUA 1B5HA 4GVOA 3KN7A 1BTJA 1TXFA 4IGRA 2P0SA 1BKAA 3S4UA 1NFTA 4LP2B 4DE8A 4R6YA 4OXVA 3O29A 2O51A 3R6UA 2I0CA 4ELQA 3TDJA 1B1HA 5KZTA 5FTIA 1IQ7A 3Q29A 4ELRA 3TUSA 3L6GA 4JB7A 1OLAA 4DXUA 3I5OA 4M1VA 1Z7ME 3DP6A 4Q30B 4YAHX 2QMXA 1LAHE 3B6TA 4M4GA 1RKMA 1JNFA 5DT6A 4IO6A 1MQHA 1LB9A 2CZLA 4DXBA 3IAZA 3KJ7A 4IY5A 4IO5A 1PC3A 3HN0A 2Z8FA 2Y7PA 3IO6A 3KOSA 4THIA 5A5XA 2RC8A 2O68A 3U93A 1B52A 4G68A 1USYE 5KCJA 5DYHA 3U92A 3RY3A 3CG3A 4OVJA 3K0VA 4I1DA 5DVFA 2QRYA 3PD9A 5DVJA 1FQBA 4ELOA 1T0KA 2ALUA 1OVBA 2DE3A 1US5A 1H43A 4POXA 4OWDA 4DXCA 2UVHA 3IK6B 2REGA 5IAIA 1B2HA 1MXUA 4ZEBA 1GR2A 4X48A
chains in the Genus database with same CATH superfamily
4RYAA 5ICQA 4MH5A 1IMAA 4XEQA 4MMPA 3IFAA 1B4HA 2I49A 4NQ8A 2ZYKA 2BJJX 1G0IA 3K2DA 3O28A 1QW0A 2O6AA 4N07A 3RNNA 3OSRA 4NWDA 1TFAA 4GOTA 3CHGA 5H8FB 3BIHA 4XKRA 4U4SA 1B7ZA 3MZ9A 1N3WA 4YKKA 4NF6B 4IGTA 3FIRA 3IOTA 3MVZA 1LAGE 3H4ZA 2DDKA 4NTLA 1OMPA 3IFCA 3ILUB 4PBHA 1JW4A 3OD7A 4R72A 2UXAA 4O3AA 2Q74A 2O1LA 3T9UA 3FVOA 4PFUA 2F6PA 2D5WA 1DPPA 3HO7A 5EYHA 4ISUA 2UVJA 4BDNA 3PPNA 4YU0A 1POY1 2XXHA 4OYVA 2NVUB 3K6UA 3WAEA 1LBYA 5AA2B 2WX9A 1MH3A 2I4CA 1NV6A 2QVUA 2CZHA 2Q2AA 2DYXA 3PPRA 2XWIA 2FBPA 2PBWA 5I59B 2ESNA 2I58A 2V4CA 2WOKA 3TTNA 4R2BA 3N6UA 1DTGA 1D9VA 2OJTA 4E0WA 5M2VA 5AA4A 1SW2A 3MWBA 2DXRA 3SKPA 5JTYB 1FTAA 4HXVA 1ELJA 4QFPA 4G68C 4OEUA 2VOZA 3DRFA 3TCGA 1LBVA 4I9DA 2Y7KA 3FVGA 1L5TA 3LVUA 3MVWA 1WDNA 1Z7NE 2PMSA 4LQ2A 4ZZAA 2H9BA 1KWHA 1HSEA 2YJPA 2O69A 4LN5A 1TFDA 5CMKA 2QSXA 3CFXA 3C33A 1P1UA 3K1MA 5KDTB 3D4GA 3SEYA 4JVIA 1DSNA 3IOUA 2VGQA 3DP4A 3OO9A 4OVQA 3IJOB 2HQ0A 2PFZA 3VVFA 3A29A 4O3CA 2WYPA 2ZYNA 3PMXA 1QKAA 4H5GA 2O7IA 3TZAA 4G61A 1Y4TA 5I59A 2HZLA 3MP1A 5DVIA 4OESA 4MX6A 3IOWA 5CRYA 1NUXA 1SVXB 3VLVA 1MY2A 2QVRA 3C35A 3O2AA 2ZMBA 4HCYA 2QFLA 2DWHA 4YICA 3K01A 3VXBA 3KBRA 3MJNA 3PPQA 3LBSA 3UN6A 4QFKA 1UIVA 3T66A 1DTZA 5I2NB 3DLNA 5AA1A 2HEUA 2XX8A 5LOMA 4PDDA 2ZNTA 1M5DA 1YCJA 1BK4A 2G93A 2B3FA 4BDLA 1SPIA 3MVYA 3CIJA 1FPJA 4LZ8A 4LZ7A 3IX1A 1XOCA 5I5PA 1CNQA 4ZDMA 2O1MA 1H45A 4ZEKA 4GWZA 4Z7EA 1RDXA 3G3GA 4NF4A 4LUBA 5B70A 1K9ZA 1P1NA 2CMOA 1DMBA 1XI6A 3BFUA 4G4PA 1B3FA 1MY4A 4C1TA 4BDRA 2PT2A 3VVEA 3Q25A 2H25A 1JQFA 2Q8MA 1GVCA 1MXXA 2XX9A 1AMFA 4F18A 2XXPA 3VLWA 1MPCA 3FGSA 5CBRA 4IO4A 1QUKA 3N6TA 3B6WA 4PFRA 2WEFA 1SYIA 4OZ9A 1ZIUA 3O6GA 1I6QA 4F2QA 4U4XA 2QS1A 5ITOA 1MS7A 2HPGA 2THIA 2PT1A 2PCRA 2G29A 3DP8A 4OFJA 1Y3PA 4FATA 3V83A 1SW5A 3FASA 3GZGA 2ZZWA 1URSA 4X1DA 3CI8A 5ICTA 3S2VA 1PB7A 5FBPA 3SEXA 4OVSA 1NNPA 2QL3A 1IMFA 2XD3A 3HV1A 1B6HA 3IB0A 2Q2CA 3KFMA 4H8JA 5F24A 2ONKE 5CI5A 4ZS9A 5EHMA 2P1SA 4RA1A 3HHFA 4RPNA 5F1QA 3FVNA 1SBPA 4H8IA 4U2RA 3HHGA 3MPKA 3BIGA 3KG2A 3MVXA 2B4LA 4OHNA 3LSFB 3FJGA 1I6AA 1LBBA 1EU8A 1LSTA 2HXWA 3PPPA 2UYEA 4MF3A 3D4CA 4HE0A 4AB5A 5ET5A 1MXZA 1D4NA 4ZECA 1IIWA 3HFUA 2Z22A 4YKPA 1NNTA 4ECFA 3T9HB 5L8DA 2P2AA 2X7PA 4KYDA 2I6EA 4IR8A 1POTA 3SEVA 1P1WA 1H3DA 5IKBA 1UIUA 5ET8A 3KN7A 1NV1A 1BTJA 1NV7A 4R6YA 2I0CA 4ELQA 4MNPA 1NUZA 2VPOA 4M1VA 4YAHX 1RKMA 1LB9A 4DXBA 1YXIA 5J16A 2F3BA 4THIA 2RC8A 3U93A 3RY3A 3CG3A 4ELOA 2QRYA 1T0KA 1US5A 4GX4A 5IAIA 1B2HA 4X48A 4QBAA 4PBQA 2YLNA 3MZ1A 4GF8A 1FTLA 1UTHB 1N0TA 3I3VA 4X9TA 3TQWA 2Z8EA 5J1DA 4ZEIA 1URDA 3G3KA 4QSEA 3EHSA 5H8NB 2GRVA 1FQCA 2JJKA 4LZ5A 3VLUA 3ZKKA 1N7XA 1HSJA 4PAKA 3TKDA 1SI0A 1FQFA 3OO8A 2GHAA 3FV2A 3OEKA 3U1OA 3TTKA 4RY1A 1QGXA 2UVIA 3ZS6A 2OCUA 3K4UA 3C9HA 1XVYA 1B5JA 2ONSA 3JYRA 4OVTA 4OQOA 1PBQA 4KCDA 4X8RA 2R8TA 3G3HA 1FTOA 1NL5A 5EQ9A 4PAFA 3E3KA 2KQZA 4U1OA 4ONYA 1VFDA 5AA3A 1OLCA 1CB6A 3OO7A 3KGCA 4NX1A 1B3GA 4ZEDA 4G8MA 4PF8A 4XFEA 1P1QA 3MZBA 4XTCQ 2ONRA 2OX3A 3LC8A 3BFTA 4NF0A 5I2NA 1P99A 4PETA 4PFTA 4U1ZA 1XT8A 1B7UA 5TU0A 4IO2A 3QK6A 2VT5A 3K1NA 2F78A 3RYBA 3C31A 1MQDA 1FPEA 4N13A 1DCUA 3JZJA 1MXVA 1EZ9A 4AB6A 4PDHA 3OOAA 2V3QA 3EQ1A 5H8SA 4GWUA 3USDA 2H98A 3O97A 3A3CA 4PFYA 1FTKA 4MNIA 3O9PA 1H76A 3Q26A 1WVJA 1O64A 2WBBA 4EDPA 4H0WA 1IMEA 4JDFA 5IM2A 4R73A 4X1BA 1USYH 3H6UA 3LSWA 1LAXA 3B7DA 3ONMA 3ZKLA 5TP9A 2WOLA 1FQEA 2AL4A 5H8NA 4TQUQ 1N7WA 3A09A 2I3VA 4P1LA 2LAOA 1XS5A 3DRIA 3H6WA 3E78A 1IXGA 1B58A 1N3XA 1FQDA 3C4MA 1FPLA 1MPBA 4N8GA 3SDFA 4DZ1A 1FBFA 1JW5A 2DP8A 1EZOA 4TLLB 2QS2A 2DE4A 4ZE8A 4OA4A 1ZBMA 1JVXA 1MQGA 2QVVA 1BP5A 1B05A 4NAPA 4KFQA 2Y7WA 3ECRA 2QS3A 1LB8A 3T1BA 2DE2A 2F7BA 4AS4A 3M3KA 1ZTYA 1R9QA 1FPDA 2F34A 4L17A 1RYXA 3FD3A 3QIMA 1VR5A 4FORA 4DDDA 1XVXA 5IZZA 4R2FA 3VDFA 2YPNA 1O63A 4EQ7A 3PU5A 2CZKA 3K6VA 2RCAA 1VDWA 1XC1A 5EYGA 2R9JA 4KXPA 3PMVA 2ZXTA 5I56B 2XXKA 3G3FA 2AL5A 4F2OA 4KI0E 5AA2A 2IA4A 5KCJB 3FTOA 2WOPA 2ANJA 4N4UA 5ITPA 3E4RA 1MXYA 4P3LA 1S50A 3UORA 1H44A 4DCYA 1FQAA 1B4ZA 3E79A 2FA7A 1AOVA 4HW8A 4RPOA 3LSXA 3C34A 3KSXA 4DIGA 1IUDA 1MXWA 5TP9B 3GBBA 1NV3A 1MM6A 4XIGQ 2UYFA 4NF6A 4GL0A 3R26A 4KQPA 2ZYOA 3OENA 1FBPA 1B51A 2E0SA 2HHMA 1LGBC 2QS4A 1IITA 3VFJA 4ZEFA 4N91A 3O6HA 3DRGA 2F5XA 1FBEA 4JBZA 4MAGA 2DSFA 5A5XB 4JWXA 4F3GA 1DPEA 3S9MC 4GBWA 4YMBA 1LFHA 1IZ1A 5JEIA 1R1NA 4POWA 3KSJA 4E0XA 3THIA 1UQWA 4HCWA 3EF7A 1NV0A 3G7WA 2F6GA 5ISUA 5EYFA 3CVGA 1NMUA 4G68B 1SW1A 2MKZA 1NUWA 2OLBA 4RXLA 5F7VA 1IMBA 4P9KA 1B0HA 1MM7A 3RQTA 4XKNA 4DI4B 1ZU0A 3PMWA 3U72A 3UGWA 1D9YA 1IXHA 1YZ0A 1JETA 2OWZA 2PX1A 5CM6A 3O6IA 3DRHA 1VFEA 4MJOA 1I6BA 4NGUA 3KZGA 2XXQA 5I58B 5T3JA 4EF2A 1ZMGA 3PUXE 4QF9A 3CFLA 3V5AA 4JWYA 1QKBA 1FSAA 1A7LA 1M5EA 5KCJA 3SERA 1OQHA 3LV0A 1A8FA 3RPLA 1FTJA 3KN8A 4XKQA 3C36A 3PAMA 3PV0E 3D1RA 1KZ8A 4OFLA 1Q9DA 1ZJLA 5H8HB 5I3SA 4GIZA 2F8DA 4O7MA 4F1UA 1A40A 1Y9UA 1TXFA 2P0SA 1NV4A 3S4UA 4LP2B 4PTKA 3O29A 4N6DA 1AWBA 4ELRA 3L6GA 4DXUA 4OVPA 3B6TA 4M4GA 1KA1A 3KJ7A 1PC3A 3KOSA 2O68A 1B52A 4OVJA 5DVJA 1OVBA 1H43A 2REGA 1MXUA 1JEVA 1N04A 5ET6A 1EYJA 3T96B 3F11A 2RINA 4F3SA 4MEVA 4R74A 3MSTA 4QXDA 1I69A 1QVSA 3MYUA 4MBPA 2XXWA 4FEDA 4FAJA 3FXRA 1ZKBA 3M3FA 2XXUA 4N81A 5BWJA 3TQLA 1A8EA 5K2XA 3S9EA 2HFBA 2A5TB 2Y5KA 5JK4A 2F36A 1SDXA 1A99A 1LLSA 5EQAA 4GWWA 4GXSB 1JEUA 3IB2A 5JTYA 4QRZA 2DWIA 4XKPA 3TCHA 4QFNA 1N76A 4C0RA 1IMCA 1MY3A 4LVQA 4PQJA 5L9SA 5I57B 4DLDA 3EHTA 3ILTB 4F29A 1B46A 1PB8A 2OWSA 3PPOA 5AA4B 3GLBA 4RK9A 4FECA 3AXFA 4KD5A 3KBZA 1Y1MA 4AQ4A 2FHYA 2Q9TA 4GQOA 3B50A 1P1OA 2WBDA 3W9VA 2I3WA 2F97A 5DEXB 4HS7A 3SEUA 3TTMA 1Q1KA 4GLIA 5FTHA 3W9WA 4NHBA 1FCKA 2NWJA 1GTKA 1B32A 2HAVA 1SW4A 4PE3A 5CMCA 4G77A 1TWYA 1US4A 3CRBA 4PFBA 3Q28A 3QYTA 1RYOA 3H3GA 3SESA 1EYKA 2Z23A 2Y5LA 4MCOA 5AA2D 3QAXA 1B1XA 3FXUA 2RCBA 4MHFA 5L9MA 3TYHA 1FBCA 1SI1A 4OFOA 3V89B 3TTLA 1S7YA 5CC2A 2RC9A 3RPWA 3DM0A 4QHQA 3B8BA 2V25A 5CMBA 2I4BA 4R75A 4F22A 4YMAA 1Y1ZA 4KYSA 4F3PA 5H8FA 4Q0CA 4R6KA 4GL8A 4OANA 2FIXA 3RYAA 1G0HA 2XD2A 1LCFA 2FYIA 2D3IA 2Y7IA 3MP8A 3M3LA 4PGNA 5I7IA 4NF4B 1NNFA 3ZSFA 3TMGA 1MH4A 5EQ7A 3B6QA 3KC1A 1N84A 2PFYA 4H6DA 3EPEA 3WAFA 5ET7A 2H4IA 3N26A 1UTHA 1OQGA 4OMBA 1NUYA 4PE5B 4U21A 4PFWA 1NI9A 4FJPA 5CBSA 3IL1B 3MAMA 4MFIA 2XXXA 2DVCA 2GHBA 2KR0A 1MQJA 3ISPA 4JWOA 4U22A 3RT6B 4C1UA 2RC7A 4I3YA 3P7IA 4PAIA 1FPIA 1Y4CA 3QMFA 2HCAA 2ZYMA 4F31B 2VD2A 3DRKA 4MLQA 2B4MA 4P0IA 1INPA 1VSOA 4IO7A 3EHUA 5DEXA 1QULA 4GX6A 4WEDA 2Y84A 4NWCA 4EQBA 1D9QA 5L9OA 1QUIA 2ZNUA 3IO4A 4JSOA 4R9FA 3QSLA 2CZIA 2O7UA 1JW1A 3IOVA 3G3IA 3IR1A 2XWKA 2ZZXA 1JVYA 5I57A 1B3LA 5KDTA 1B7HA 1GGGA 1II5A 2OZZA 4NF5B 4H1XA 5I2KB 1PBPA 4G8HA 4OERA 5K2YA 1M5FA 2XXYA 2QPQA 1IEJA 4ND9A 3T9XB 3VE1B 3S9NC 3MBPA 2FVZA 3PD8A 2DXYA 3MC2A 3VXCA 4U23A 1R9LA 3CSBA 2NUVA 2IEEA 3H06B 4FEBA 3K6XA 4GD5A 5DTBA 2XXTA 2RF1A 1B0LA 5TPAA 3VV5A 1NH7A 5LTCA 3UIFA 2VPNA 4BDQA 1XHYA 3JV9A 1YYZA 3RUMA 4NN3A 3OO6A 3FJ7A 4YKJA 4JSDA 3V8XB 3QXMA 3EKIA 1MDQA 4PFIA 5FHOA 5H8QA 1EH3A 4YB6A 3RPLB 4FE8A 3Q27A 3E13X 2AIXA 3PUZE 3RGYA 2I48A 4LATA 1LBXA 1IMDA 2XX7A 3MQ9A 4P11A 1OIBA 2E1SA 2VD3A 4G8NA 3T22A 3LSLA 3LUYA 3HCQA 3FXQA 1PEBA 3L6HA 4F39A 4K3FA 4F1YA 2F3DA 1CE2A 3H6TA 1AIVA 4NEDA 4ZE9A 3H7MA 1AH5A 4H45A 3R7XA 4R6HA 2XXRA 2FNCA 3KN3A 4Q5TA 3TUSA 2PVUA 5I58A 1J1NA 1MDP1 4IO3A 2B3BA 3FXBA 1K9YA 2QJEA 4MNCA 4Q8RA 4HTGA 1B5HA 4HE1A 4OXVA 2CEYA 2O51A 3R6UA 3TDJA 1B1HA 1KA0A 1IQ7A 2FIEA 3Q29A 1OLAA 4Q30B 5DT6A 1DK4A 4IO6A 1MQHA 3IAZA 1FBGA 3IO6A 2Z8FA 4O94A 5A5XA 1USYE 3K0VA 4I1DA 3PD9A 1FQBA 2ALUA 1RDZA 4OWDA 4DXCA 2UVHA 3IK6B 4NG7A 1O7TA 1R6ZA 4JVCA 5DYHA 3CG1A 2Z8DA 4TLMB 3TFLA 3PUVE 4JXIA 2ABHA 5TPAB 4BDMA 1Y20A 3QUFA 2XWOA 4IB2A 4XF5A 4N17A 5BUUA 1QUJA 1IXCA 2GQ1A 1NH8A 3O6PA 4PP0A 3UA8A 3KC0A 1SD3A 2Q88A 1A54A 1HSLA 3QUJA 1Y3NA 4RNSA 4QSDA 1OVTA 5IZ1A 4I3EA 4O8MA 1AL3A 4Z0IA 4WKMA 5I56A 1YPNA 2XXIA 4I62A 3H6VA 3PGFA 2P3VA 4P0GA 3OMBA 1UTBB 4YB7A 3I6VA 1YTVA 1FPFA 3FUZA 5I2KA 2WKYA 3PUWE 3DRJA 2I0BA 3RLFE 4HE2A 5EQ8A 4RJZA 4WEPA 1PDAA 1LBZA 3HSTA 1LEVA 4UACA 5IZ3B 3IORA 4GFRA 5H8QB 4MLVA 3RT8A 2WYKA 4LONB 4GX3A 5HBCA 4EUOA 1YAEA 3OSQA 4OENA 5EHSA 4GBVA 4OTEA 3IB1A 3MP6A 1S9TA 3TAJA 3PTYA 3RTFB 3GYYA 1B40A 4UA8A 1FBDA 1ATGA 3KEIA 1WODA 1NV2A 4QFLA 1URGA 2V84A 3H03A 4YB5A 3CR9A 4H65A 4ESWA 4FIMA 3TELA 2UVGA 4WXJA 1QJMA 1DOTA 3SETA 2B65A 1FPKA 1FJ6A 3C32A 3RYDA 2R6GE 2XHDA 4I40A 3OEMA 4OETA 2VHAA 2X26A 2Q8JA 3G3JA 2XA5A 3UK4A 2O84X 4KCCA 3T9VA 3RTWB 4NF8A 1TT1A 4NF5A 1LBCA 5HM4B 2DS9A 3EN3A 5ESYA 1ANFA 3TCFA 1MPDA 3K1PA 2H5YA 3RN8A 2M8CA 1MY0A 1MY1A 4LQ5A 4QFOA 3MUQA 4GRKA 1LAFE 1ZLQA 3T93B 3CSGA 4KYEA 2V93A 1FBHA 4X04A 2H99A 3TODA 4H5FA 2F7CA 1FTMA 4OVRA 4P47A 4DCXA 2D21A 3UP9A 4R9GA 1Q35A 2NXOA 4GXAA 1MQIA 2REJA 3ROJA 3W15C 2RKMA 5FHNA 1PB9A 3TEPA 3CFZA 1NV5A 1EYIA 2HZKA 5IGAA 2ZNSA 3TTRA 4PGPA 2V3TA 4PC9A 3FV1A 4N8YA 4ZZEA 5DW8A 4RK2A 1Y3QA 2HAUA 3FATA 2DVZA 2W7YA 3FJMA 1JP4A 1MG1A 4NE4A 3U94A 4NF8B 1LFIA 4EXKA 4P1EA 1B3HA 1M5BA 1RDYA 4N15A 3GBAA 4H67A 2ZZVA 5B7DA 3LUZA 3K00A 1LCTA 3MPLA 2F7AA 3N5LA 5CMMA 2A5TA 2R71A 3N94A 3T0JA 4FBPA 1DBZA 3A3UA 4O7IA 2PYYA 1BLFA 2KLFA 1B3EA 3IJXB 3K02A 1FW0A 3KJTA 2OK2A 5A5LA 2DOJA 1MRPA 2CEXA 1F9BA 3VVDA 1IXIA 4YKIA 4BLAA 1M5CA 2F35A 1LBWA 1SYHA 3HPIA 1EZPA 3FZVA 4P8BA 4F19A 2V3UA 4BDOA 1A55A 3BBRA 4N6KA 3NOHA 1GV8A 3M8UA 3LR1A 1BIYA 2A5SA 3E9XA 2VP1A 2QMWA 3FVKA 4ELPA 2NOOA 1B5IA 1NKXA 4EXLA 1VE4A 4GWXA 5IZ3A 4KR5A 3S9LC 4ESXA 2XWVA 2BJIA 2Y7RA 4NMYA 4TOZA 3TPAA 4DI3D 3U65A 3OXNA 3KOTA 3O66A 4P56A 4I8CA 4F1VA 2AYSA 4LA9A 2GH9A 4H46A 5H8HA 1UTBA 3SEWA 1NNKA 3OELA 3FBPA 4AS5A 4QSCA 5ELVA 4GWSA 3ODBA 1FJ9A 4G2ZA 4EF1A 4OEVA 4N6PA 5AE4A 1B9JA 4YZZA 1LFGA 3PUYE 4O3BA 2DWAA 4KHZE 5I84A 4GWOA 3GXAA 5LDZA 3BKIB 4XXUA 4EQ9A 1FPGA 4F3BA 5HPQA 2DQVA 2Q89A 2OWTA 5FHMA 2XXVA 3DELB 2DWJA 2X7QA 1SQYA 3K6WA 4KPTA 3U8QA 2HXRA 3MW0A 2GFEA 2OBGA 4IY6A 4PCDA 1D3KA 4GVOA 4PF6A 4IGRA 1BKAA 4DE8A 1NFTA 5KZTA 5FTIA 2L5VA 4JB7A 3I5OA 1Z7ME 3DP6A 1FRPA 2QMXA 1LAHE 4GWYA 4UABA 1JNFA 2CZLA 4IY5A 1FPBA 4IO5A 3HN0A 2Y7PA 4MIJA 4G68A 3U92A 5DVFA 3SZPA 2P3NA 2DE3A 4POXA 4JVDA 4ZEBA 1GR2A
chains in the Genus database with same CATH topology
2YLNA 1O7TA 1JEVA 1N04A 3MZ1A 4RYAA 1R6ZA 4GF8A 5ICQA 1FTLA 1N0TA 1UTHB 2Z8DA 3CG1A 4MH5A 4TLMB 4X1BA 3I3VA 3TFLA 1B4HA 4C0RA 4X9TA 3T96B 3TQWA 3F11A 3PUVE 2Z8EA 2RINA 2I49A 4F3SA 4JXIA 2ABHA 2ZYKA 5TPAB 5J1DA 4ZEIA 4BDMA 1Y20A 2BJJX 1URDA 3QUFA 4IB2A 5DVIA 3G3KA 4QSEA 3K2DA 4R74A 3EHSA 3O28A 5I57A 5H8NB 1I69A 1QVSA 4MBPA 5BUUA 2XXWA 1QUJA 1QW0A 2GRVA 1FQCA 2O6AA 4FEDA 5JK4A 4LZ5A 4N07A 1IXCA 3RNNA 3OSRA 3VLUA 3ZKKA 4FAJA 1NH8A 3FXRA 3O6PA 1N7XA 1ZKBA 4NWDA 4PP0A 1HSJA 1TFAA 3M3FA 3UA8A 4GOTA 3TKDA 3CHGA 1SD3A 1SI0A 2XXUA 5BWJA 3TQLA 5H8FB 1A8EA 1FQFA 1A54A 2Q88A 5K2XA 1HSLA 3S9EA 3OO8A 1Y3NA 3QUJA 4RNSA 4QSDA 2GHAA 3FV2A 3OEKA 1OVTA 3U1OA 4XKRA 2HFBA 4U4SA 3TTKA 2A5TB 1AL3A 3MZ9A 1B7ZA 4RY1A 2UVIA 4WKMA 3ZS6A 4Z0IA 2OCUA 3K4UA 2F36A 1YPNA 3C9HA 1N3WA 1XVYA 4YKKA 5I2NA 1B5JA 2ONSA 2XXIA 4NF6B 3JYRA 4IGTA 4I62A 1SDXA 1A99A 3FIRA 1LLSA 3H6VA 3IOTA 3PGFA 4GXSB 4P0GA 3OMBA 1UTBB 4OQOA 3MVZA 1LAGE 1PBQA 3H4ZA 4KCDA 4NTLA 3I6VA 4YB7A 1JEUA 1OMPA 3IB2A 3ILUB 1JW4A 1YTVA 3FUZA 3OD7A 4QRZA 2UXAA 4R72A 2DWIA 4XKPA 2WKYA 3PUWE 4O3AA 5I2KA 3TCHA 4QFNA 2O1LA 3T9UA 1N76A 3G3HA 3DRJA 2I0BA 4PFUA 1FTOA 1NL5A 2D5WA 1MY3A 1DPPA 2F6PA 3FVOA 3HO7A 4LVQA 4PQJA 3RLFE 4ISUA 2UVJA 3EHTA 3PPNA 4BDNA 3ILTB 3E3KA 4DLDA 4FATA 4YU0A 4U1OA 1POY1 2XXHA 4F29A 1B46A 1PB8A 2OWSA 3PPOA 5AA4B 4OYVA 3GLBA 2NVUB 4RJZA 4RK9A 3K6UA 4FECA 4ONYA 4WEPA 1PDAA 3WAEA 1VFDA 5AA2B 1MH3A 2I4CA 5AA3A 3AXFA 4KD5A 1OLCA 3HSTA 1Y1MA 4AQ4A 1CB6A 3OO7A 3KGCA 2Q2AA 1B3GA 4ZEDA 2DYXA 2Q9TA 3IORA 4G8MA 4GFRA 4UACA 3PPRA 4MLVA 5H8QB 3RT8A 4GQOA 1P1OA 1P1QA 4LONB 3W9VA 2I3WA 2F97A 5DEXB 5HBCA 3MZBA 4XTCQ 2ONRA 2PBWA 5I59B 4HS7A 4EUOA 3SEUA 2ESNA 3LC8A 2I58A 3BFTA 2WOKA 1P99A 1YAEA 4PFTA 4PETA 4R2BA 3OSQA 3TTNA 3TTMA 4OENA 1Q1KA 4GLIA 5EHSA 5FTHA 3W9WA 4U1ZA 1XT8A 1B7UA 4OTEA 1FCKA 5TU0A 4IO2A 3QK6A 3IB1A 3MP6A 1S9TA 1DTGA 2F78A 3RYBA 1D9VA 1MQDA 3C31A 3K1NA 2NWJA 1GTKA 3RTFB 3TAJA 1B32A 2HAVA 1SW4A 2OJTA 5CMCA 4N13A 5M2VA 1B40A 4G77A 4E0WA 3JZJA 5AA4A 1MXVA 1EZ9A 1SW2A 3MWBA 4UA8A 1TWYA 1ATGA 1US4A 3CRBA 3KEIA 3Q28A 3QYTA 1RYOA 1WODA 2V3QA 3EQ1A 3H3GA 3OOAA 3SESA 2Z23A 5H8SA 3USDA 3U8QA 2DXRA 5AA2D 2H98A 4QFLA 3QAXA 1URGA 3SKPA 1B1XA 3FXUA 3O97A 2V84A 3H03A 3A3CA 2RCBA 4PFYA 4YB5A 5JTYB 5L9MA 3TYHA 3CR9A 1FTKA 1SI1A 5I57B 4H65A 3O9PA 4OFOA 1ELJA 4QFPA 1H76A 1WVJA 3Q26A 4OEUA 4G68C 2VOZA 1O64A 4FIMA 3TELA 3V89B 3TTLA 2UVGA 4ESWA 4EDPA 1S7YA 4WXJA 4AB6A 1QJMA 3DRFA 1DOTA 4H0WA 3SETA 5CC2A 3TCGA 2RC9A 3RPWA 2B65A 3DM0A 4JDFA 4QHQA 2V25A 3C32A 4I9DA 2Y7KA 3FVGA 1L5TA 5CMBA 3LVUA 3MVWA 2I4BA 1WDNA 2R6GE 4R73A 1Z7NE 1USYH 2XHDA 4R75A 1Y1ZA 4KYSA 4F22A 3OEMA 4YMAA 3H6UA 4F3PA 3LSWA 4OETA 2PMSA 2VHAA 5H8FA 2X26A 2Q8JA 1LAXA 4LQ2A 4ZZAA 3B7DA 3G3JA 4Q0CA 2H9BA 4R6KA 4GL8A 1KWHA 3ONMA 3ZKLA 3UK4A 1HSEA 2O84X 2YJPA 4KCCA 5TP9A 3T9VA 3RYAA 2O69A 2XD2A 5I59A 3RTWB 1LCFA 2WOLA 1TFDA 4NF8A 5CMKA 1FQEA 1TT1A 2FYIA 4LQ5A 2QSXA 2D3IA 3CFXA 4NF5A 3C33A 2Y7IA 3MP8A 3M3LA 1P1UA 3K1MA 5KDTB 2AL4A 5H8NA 4NF4B 4TQUQ 1NNFA 3ZSFA 1N7WA 1LBCA 3A09A 1MH4A 3D4GA 3SEYA 3B6QA 1DSNA 2I3VA 3IOUA 5HM4B 2DS9A 2VGQA 3EN3A 2LAOA 1XS5A 3DRIA 1N84A 3DP4A 3H6WA 3OO9A 3IJOB 1ANFA 2HQ0A 5L9OA 3TCFA 1MPDA 4H6DA 3VVFA 3EPEA 3K1PA 3WAFA 2H5YA 1IXGA 2H4IA 3N26A 1UTHA 1OQGA 4O3CA 1B58A 4OMBA 1N3XA 3RN8A 1FQDA 2ZYNA 3C4MA 4PE5B 3PMXA 1MPBA 1QKAA 4H5GA 3SDFA 4DZ1A 4U21A 1JW5A 2M8CA 4PFWA 2O7IA 3TZAA 2DP8A 1EZOA 1MY0A 4TLLB 1Y4TA 2QS2A 4FJPA 1MY1A 2DE4A 4ZE8A 2HZLA 4QFOA 3MP1A 3IL1B 3MUQA 4GRKA 4OESA 1ZLQA 1LAFE 3CSGA 3MAMA 3IOWA 4MFIA 5CRYA 3T93B 1ZBMA 2XXXA 4KYEA 1JVXA 2V93A 1MQGA 1BP5A 1SVXB 1B05A 2DVCA 2GHBA 3VLVA 2H99A 4KFQA 2Y7WA 3TODA 4H5FA 1MQJA 3ECRA 4JWOA 1MY2A 2QS3A 1LB8A 3C35A 3O2AA 2DE2A 2ZMBA 2F7BA 4HCYA 3M3KA 1ZTYA 2F7CA 1R9QA 4U22A 3RT6B 4C1UA 2RC7A 2F34A 1FTMA 4L17A 1RYXA 3FD3A 2DWHA 3QIMA 3P7IA 4YICA 4DCXA 1VR5A 2D21A 3K01A 3UP9A 4R9GA 1Q35A 3VXBA 5I56A 2NXOA 4FORA 1Y4CA 3KBRA 3MJNA 3LBSA 3PPQA 4DDDA 3UN6A 2HCAA 2ZYMA 4F31B 4QFKA 2VD2A 1UIVA 3DRKA 3T66A 4GXAA 1XVXA 1DTZA 4R2FA 3VDFA 2YPNA 3DLNA 4MLQA 5I2NB 1O63A 2B4MA 1MQIA 2REJA 4P0IA 3W15C 4EQ7A 3PU5A 1VSOA 2HEUA 5AA1A 2XX8A 2RKMA 5LOMA 4IO7A 3EHUA 5FHNA 1PB9A 2ZNTA 1M5DA 1YCJA 1QULA 5DEXA 3K6VA 2G93A 3TEPA 2B3FA 4BDLA 3CFZA 2RCAA 1XC1A 2R9JA 3MVYA 4WEDA 2HZKA 5L9SA 2Y84A 4NWCA 3CIJA 4EQBA 3PMVA 2ZNSA 3TTRA 2ZXTA 5I56B 4LZ8A 4LZ7A 2V3TA 3G3FA 2AL5A 1XOCA 3IX1A 4F2OA 1QUIA 2ZNUA 3FV1A 3N6UA 4ZZEA 4KI0E 3IO4A 4JSOA 4R9FA 5AA2A 2IA4A 5KCJB 3QSLA 3FTOA 2WOPA 2O7UA 5KDTA 1JW1A 2ANJA 4RK2A 1Y3QA 3IOVA 3G3IA 5ITPA 2HAUA 3IR1A 2O1MA 1H45A 4ZEKA 3E4RA 3FATA 4ZDMA 1MXYA 2DVZA 4Z7EA 1JVYA 2W7YA 3FJMA 1S50A 1MG1A 1B3LA 1H44A 3G3GA 4NF4A 1B7HA 1GGGA 4DCYA 1FQAA 1II5A 1B4ZA 2OZZA 2CMOA 1P1NA 4LUBA 4NE4A 5B70A 2FA7A 4NF5B 1AOVA 1DMBA 4H1XA 4HW8A 5I2KB 4RPOA 3U94A 4NF8B 1LFIA 1PBPA 3BFUA 3LSXA 4G8HA 1B3HA 3C34A 3KSXA 4G4PA 4DIGA 1B3FA 1IUDA 1MXWA 4OERA 5TP9B 1M5BA 3GBBA 1MY4A 5K2YA 4C1TA 1MM6A 4BDRA 2PT2A 3VVEA 3Q25A 1M5FA 3GBAA 4H67A 2UYFA 4NF6A 4XIGQ 4Q8RA 2XXYA 4GL0A 5B7DA 2H25A 3R26A 4KQPA 2ZYOA 2QPQA 3OENA 3K00A 1LCTA 3MPLA 1IEJA 2F7AA 3N5LA 1JQFA 4ND9A 5CMMA 2A5TA 1B51A 2E0SA 3T9XB 3VE1B 3MBPA 3S9NC 2R71A 1GVCA 1LGBC 3PD8A 1MXXA 2XX9A 3N94A 2QS4A 1AMFA 3A3UA 1IITA 3VFJA 4F18A 2DXYA 3MC2A 2PYYA 3VXCA 2XXPA 1R9LA 4U23A 4ZEFA 1BLFA 3CSBA 2KLFA 3VLWA 1B3EA 1MPCA 3FGSA 3IJXB 3K02A 5CBRA 4IO4A 1QUKA 3N6TA 3O6HA 3DRGA 1FW0A 2NUVA 2IEEA 3B6WA 3H06B 3T22A 2F5XA 3KJTA 2OK2A 4JBZA 2DSFA 5A5XB 2DOJA 4FEBA 1MRPA 4JWXA 4F3GA 1SYIA 1DPEA 3S9MC 4OZ9A 1ZIUA 3K6XA 3O6GA 1I6QA 4GD5A 5DTBA 4YMBA 1IZ1A 1LFHA 2XXTA 4F2QA 1F9BA 4U4XA 3VVDA 1IXIA 4YKIA 5JEIA 2RF1A 1B0LA 4BLAA 2QS1A 5TPAA 1R1NA 1M5CA 3VV5A 5ITOA 1MS7A 1NH7A 2F35A 3UIFA 1SYHA 3HPIA 2THIA 1EZPA 2PT1A 3FZVA 3TMGA 4BDQA 4F19A 2G29A 3DP8A 4OFJA 1Y3PA 2V3UA 3KSJA 4POWA 4BDOA 1XHYA 3THIA 4E0XA 1A55A 3BBRA 3V83A 1SW5A 1UQWA 3FASA 3GZGA 3JV9A 4HCWA 3EF7A 1GV8A 3M8UA 1URSA 4X1DA 3RUMA 3LR1A 3CI8A 1BIYA 2A5SA 3E9XA 2VP1A 2F6GA 3G7WA 3OO6A 3S2VA 3FJ7A 4YKJA 5ISUA 5EYFA 4JSDA 2QMWA 3CVGA 3FVKA 1PB7A 1NMUA 3SEXA 3V8XB 3QXMA 1MDQA 1NNPA 4ELPA 2QL3A 4G68B 2NOOA 2XD3A 5FHOA 3HV1A 1B5IA 1B6HA 1SW1A 1NKXA 3IB0A 4EXLA 2Q2CA 3KFMA 4H8JA 5H8QA 1VE4A 2OLBA 1EH3A 4YB6A 4KR5A 4RXLA 5F7VA 3S9LC 4ESXA 4FE8A 3Q27A 2ONKE 3E13X 5CI5A 1B0HA 4ZS9A 1MM7A 2AIXA 3RQTA 3PUZE 3RGYA 2Y7RA 4XKNA 5EHMA 2P1SA 4RA1A 4TOZA 4NMYA 2I48A 1ZU0A 3TPAA 3HHFA 3PMWA 4LATA 3U72A 3UGWA 1D9YA 5F1QA 4RPNA 2XX7A 3OXNA 1IXHA 3FVNA 1SBPA 3MQ9A 4P11A 1OIBA 2E1SA 2VD3A 1JETA 2PX1A 3KOTA 3O66A 4G8NA 4H8IA 4U2RA 3LSLA 3HHGA 4I8CA 4F1VA 5CM6A 3MPKA 2AYSA 3O6IA 3KG2A 4LA9A 3DRHA 3MVXA 1VFEA 3HCQA 3LUYA 2B4LA 4OHNA 3FXQA 3LSFB 2GH9A 1I6BA 1PEBA 3FJGA 5JTYA 1I6AA 1LBBA 5H8HA 1UTBA 3KZGA 2XXQA 3SEWA 1NNKA 3OELA 5CBSA 5I58B 3L6HA 4QSCA 4F39A 4EF2A 4K3FA 4F1YA 1EU8A 1ZMGA 1CE2A 1LSTA 2HXWA 3PUXE 5ELVA 4QF9A 3PPPA 3ODBA 3H6TA 2UYEA 4EF1A 4G2ZA 4MF3A 1AIVA 4OEVA 3D4CA 4N6PA 5AE4A 4NEDA 1B9JA 3CFLA 4JWYA 1QKBA 3V5AA 4YZZA 4AB5A 1A7LA 1LFGA 1MXZA 1M5EA 4ZE9A 1D4NA 2DWAA 3PUYE 4KHZE 4O3BA 1OQHA 3SERA 4GWOA 5I84A 3H7MA 1A8FA 4ZECA 1AH5A 1IIWA 3GXAA 2Z22A 1FTJA 3KN8A 3R7XA 4R6HA 4XKQA 3C36A 5ICTA 3PAMA 2XXRA 3PV0E 2FNCA 3BKIB 3KN3A 4Q5TA 4XXUA 1NNTA 4YKPA 4EQ9A 4F3BA 5HPQA 4ECFA 3T9HB 2DQVA 2PVUA 3UORA 5L8DA 2Q89A 4OFLA 5I58A 2OWTA 1J1NA 2P2AA 5FHMA 1MDP1 1ZJLA 5H8HB 2XXVA 2X7PA 3DELB 4GIZA 2DWJA 4KYDA 2F8DA 2B3BA 4IO3A 2X7QA 4F1UA 1SQYA 2I6EA 2QJEA 1A40A 3K6WA 1POTA 4HTGA 4KPTA 3SEVA 3MW0A 2GFEA 2OBGA 1P1WA 1Y9UA 4IY6A 4EXKA 1D3KA 1H3DA 5IKBA 1UIUA 1B5HA 4GVOA 3KN7A 1BTJA 1TXFA 4IGRA 2P0SA 1BKAA 3S4UA 1NFTA 4LP2B 4DE8A 4R6YA 4OXVA 3O29A 2O51A 3R6UA 2I0CA 4ELQA 3TDJA 1B1HA 5KZTA 5FTIA 1IQ7A 3Q29A 4ELRA 3TUSA 3L6GA 4JB7A 1OLAA 4DXUA 3I5OA 4M1VA 1Z7ME 3DP6A 4Q30B 4YAHX 2QMXA 1LAHE 3B6TA 4M4GA 1RKMA 1JNFA 5DT6A 4IO6A 1MQHA 1LB9A 2CZLA 4DXBA 3IAZA 3KJ7A 4IY5A 4IO5A 1PC3A 3HN0A 2Z8FA 2Y7PA 3IO6A 3KOSA 4THIA 5A5XA 2RC8A 2O68A 3U93A 1B52A 4G68A 1USYE 5KCJA 5DYHA 3U92A 3RY3A 3CG3A 4OVJA 3K0VA 4I1DA 5DVFA 2QRYA 3PD9A 5DVJA 1FQBA 4ELOA 1T0KA 2ALUA 1OVBA 2DE3A 1US5A 1H43A 4POXA 4OWDA 4DXCA 2UVHA 3IK6B 2REGA 5IAIA 1B2HA 1MXUA 4ZEBA 1GR2A 4X48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLN A;  1O7T A;  1JEV A;  1N04 A;  3MZ1 A;  4RYA A;  1R6Z A;  4GF8 A;  5ICQ A;  1FTL A;  1N0T A;  1UTH B;  2Z8D A;  3CG1 A;  4MH5 A;  4TLM B;  4X1B A;  3I3V A;  3TFL A;  1B4H A;  4C0R A;  4X9T A;  3T96 B;  3TQW A;  3F11 A;  3PUV E;  2Z8E A;  2RIN A;  2I49 A;  4F3S A;  4JXI A;  2ABH A;  2ZYK A;  5TPA B;  5J1D A;  4ZEI A;  4BDM A;  1Y20 A;  2BJJ X;  1URD A;  3QUF A;  4IB2 A;  5DVI A;  3G3K A;  4QSE A;  3K2D A;  4R74 A;  3EHS A;  3O28 A;  5I57 A;  5H8N B;  1I69 A;  1QVS A;  4MBP A;  5BUU A;  2XXW A;  1QUJ A;  1QW0 A;  2GRV A;  1FQC A;  2O6A A;  4FED A;  5JK4 A;  4LZ5 A;  4N07 A;  1IXC A;  3RNN A;  3OSR A;  3VLU A;  3ZKK A;  4FAJ A;  1NH8 A;  3FXR A;  3O6P A;  1N7X A;  1ZKB A;  4NWD A;  4PP0 A;  1HSJ A;  1TFA A;  3M3F A;  3UA8 A;  4GOT A;  3TKD A;  3CHG A;  1SD3 A;  1SI0 A;  2XXU A;  5BWJ A;  3TQL A;  5H8F B;  1A8E A;  1FQF A;  1A54 A;  2Q88 A;  5K2X A;  1HSL A;  3S9E A;  3OO8 A;  1Y3N A;  3QUJ A;  4RNS A;  4QSD A;  2GHA A;  3FV2 A;  3OEK A;  1OVT A;  3U1O A;  4XKR A;  2HFB A;  4U4S A;  3TTK A;  2A5T B;  1AL3 A;  3MZ9 A;  1B7Z A;  4RY1 A;  2UVI A;  4WKM A;  3ZS6 A;  4Z0I A;  2OCU A;  3K4U A;  2F36 A;  1YPN A;  3C9H A;  1N3W A;  1XVY A;  4YKK A;  5I2N A;  1B5J A;  2ONS A;  2XXI A;  4NF6 B;  3JYR A;  4IGT A;  4I62 A;  1SDX A;  1A99 A;  3FIR A;  1LLS A;  3H6V A;  3IOT A;  3PGF A;  4GXS B;  4P0G A;  3OMB A;  1UTB B;  4OQO A;  3MVZ A;  1LAG E;  1PBQ A;  3H4Z A;  4KCD A;  4NTL A;  3I6V A;  4YB7 A;  1JEU A;  1OMP A;  3IB2 A;  3ILU B;  1JW4 A;  1YTV A;  3FUZ A;  3OD7 A;  4QRZ A;  2UXA A;  4R72 A;  2DWI A;  4XKP A;  2WKY A;  3PUW E;  4O3A A;  5I2K A;  3TCH A;  4QFN A;  2O1L A;  3T9U A;  1N76 A;  3G3H A;  3DRJ A;  2I0B A;  4PFU A;  1FTO A;  1NL5 A;  2D5W A;  1MY3 A;  1DPP A;  2F6P A;  3FVO A;  3HO7 A;  4LVQ A;  4PQJ A;  3RLF E;  4ISU A;  2UVJ A;  3EHT A;  3PPN A;  4BDN A;  3ILT B;  3E3K A;  4DLD A;  4FAT A;  4YU0 A;  4U1O A;  1POY 1;  2XXH A;  4F29 A;  1B46 A;  1PB8 A;  2OWS A;  3PPO A;  5AA4 B;  4OYV A;  3GLB A;  2NVU B;  4RJZ A;  4RK9 A;  3K6U A;  4FEC A;  4ONY A;  4WEP A;  1PDA A;  3WAE A;  1VFD A;  5AA2 B;  1MH3 A;  2I4C A;  5AA3 A;  3AXF A;  4KD5 A;  1OLC A;  3HST A;  1Y1M A;  4AQ4 A;  1CB6 A;  3OO7 A;  3KGC A;  2Q2A A;  1B3G A;  4ZED A;  2DYX A;  2Q9T A;  3IOR A;  4G8M A;  4GFR A;  4UAC A;  3PPR A;  4MLV A;  5H8Q B;  3RT8 A;  4GQO A;  1P1O A;  1P1Q A;  4LON B;  3W9V A;  2I3W A;  2F97 A;  5DEX B;  5HBC A;  3MZB A;  4XTC Q;  2ONR A;  2PBW A;  5I59 B;  4HS7 A;  4EUO A;  3SEU A;  2ESN A;  3LC8 A;  2I58 A;  3BFT A;  2WOK A;  1P99 A;  1YAE A;  4PFT A;  4PET A;  4R2B A;  3OSQ A;  3TTN A;  3TTM A;  4OEN A;  1Q1K A;  4GLI A;  5EHS A;  5FTH A;  3W9W A;  4U1Z A;  1XT8 A;  1B7U A;  4OTE A;  1FCK A;  5TU0 A;  4IO2 A;  3QK6 A;  3IB1 A;  3MP6 A;  1S9T A;  1DTG A;  2F78 A;  3RYB A;  1D9V A;  1MQD A;  3C31 A;  3K1N A;  2NWJ A;  1GTK A;  3RTF B;  3TAJ A;  1B32 A;  2HAV A;  1SW4 A;  2OJT A;  5CMC A;  4N13 A;  5M2V A;  1B40 A;  4G77 A;  4E0W A;  3JZJ A;  5AA4 A;  1MXV A;  1EZ9 A;  1SW2 A;  3MWB A;  4UA8 A;  1TWY A;  1ATG A;  1US4 A;  3CRB A;  3KEI A;  3Q28 A;  3QYT A;  1RYO A;  1WOD A;  2V3Q A;  3EQ1 A;  3H3G A;  3OOA A;  3SES A;  2Z23 A;  5H8S A;  3USD A;  3U8Q A;  2DXR A;  5AA2 D;  2H98 A;  4QFL A;  3QAX A;  1URG A;  3SKP A;  1B1X A;  3FXU A;  3O97 A;  2V84 A;  3H03 A;  3A3C A;  2RCB A;  4PFY A;  4YB5 A;  5JTY B;  5L9M A;  3TYH A;  3CR9 A;  1FTK A;  1SI1 A;  5I57 B;  4H65 A;  3O9P A;  4OFO A;  1ELJ A;  4QFP A;  1H76 A;  1WVJ A;  3Q26 A;  4OEU A;  4G68 C;  2VOZ A;  1O64 A;  4FIM A;  3TEL A;  3V89 B;  3TTL A;  2UVG A;  4ESW A;  4EDP A;  1S7Y A;  4WXJ A;  4AB6 A;  1QJM A;  3DRF A;  1DOT A;  4H0W A;  3SET A;  5CC2 A;  3TCG A;  2RC9 A;  3RPW A;  2B65 A;  3DM0 A;  4JDF A;  4QHQ A;  2V25 A;  3C32 A;  4I9D A;  2Y7K A;  3FVG A;  1L5T A;  5CMB A;  3LVU A;  3MVW A;  2I4B A;  1WDN A;  2R6G E;  4R73 A;  1Z7N E;  1USY H;  2XHD A;  4R75 A;  1Y1Z A;  4KYS A;  4F22 A;  3OEM A;  4YMA A;  3H6U A;  4F3P A;  3LSW A;  4OET A;  2PMS A;  2VHA A;  5H8F A;  2X26 A;  2Q8J A;  1LAX A;  4LQ2 A;  4ZZA A;  3B7D A;  3G3J A;  4Q0C A;  2H9B A;  4R6K A;  4GL8 A;  1KWH A;  3ONM A;  3ZKL A;  3UK4 A;  1HSE A;  2O84 X;  2YJP A;  4KCC A;  5TP9 A;  3T9V A;  3RYA A;  2O69 A;  2XD2 A;  5I59 A;  3RTW B;  1LCF A;  2WOL A;  1TFD A;  4NF8 A;  5CMK A;  1FQE A;  1TT1 A;  2FYI A;  4LQ5 A;  2QSX A;  2D3I A;  3CFX A;  4NF5 A;  3C33 A;  2Y7I A;  3MP8 A;  3M3L A;  1P1U A;  3K1M A;  5KDT B;  2AL4 A;  5H8N A;  4NF4 B;  4TQU Q;  1NNF A;  3ZSF A;  1N7W A;  1LBC A;  3A09 A;  1MH4 A;  3D4G A;  3SEY A;  3B6Q A;  1DSN A;  2I3V A;  3IOU A;  5HM4 B;  2DS9 A;  2VGQ A;  3EN3 A;  2LAO A;  1XS5 A;  3DRI A;  1N84 A;  3DP4 A;  3H6W A;  3OO9 A;  3IJO B;  1ANF A;  2HQ0 A;  5L9O A;  3TCF A;  1MPD A;  4H6D A;  3VVF A;  3EPE A;  3K1P A;  3WAF A;  2H5Y A;  1IXG A;  2H4I A;  3N26 A;  1UTH A;  1OQG A;  4O3C A;  1B58 A;  4OMB A;  1N3X A;  3RN8 A;  1FQD A;  2ZYN A;  3C4M A;  4PE5 B;  3PMX A;  1MPB A;  1QKA A;  4H5G A;  3SDF A;  4DZ1 A;  4U21 A;  1JW5 A;  2M8C A;  4PFW A;  2O7I A;  3TZA A;  2DP8 A;  1EZO A;  1MY0 A;  4TLL B;  1Y4T A;  2QS2 A;  4FJP A;  1MY1 A;  2DE4 A;  4ZE8 A;  2HZL A;  4QFO A;  3MP1 A;  3IL1 B;  3MUQ A;  4GRK A;  4OES A;  1ZLQ A;  1LAF E;  3CSG A;  3MAM A;  3IOW A;  4MFI A;  5CRY A;  3T93 B;  1ZBM A;  2XXX A;  4KYE A;  1JVX A;  2V93 A;  1MQG A;  1BP5 A;  1SVX B;  1B05 A;  2DVC A;  2GHB A;  3VLV A;  2H99 A;  4KFQ A;  2Y7W A;  3TOD A;  4H5F A;  1MQJ A;  3ECR A;  4JWO A;  1MY2 A;  2QS3 A;  1LB8 A;  3C35 A;  3O2A A;  2DE2 A;  2ZMB A;  2F7B A;  4HCY A;  3M3K A;  1ZTY A;  2F7C A;  1R9Q A;  4U22 A;  3RT6 B;  4C1U A;  2RC7 A;  2F34 A;  1FTM A;  4L17 A;  1RYX A;  3FD3 A;  2DWH A;  3QIM A;  3P7I A;  4YIC A;  4DCX A;  1VR5 A;  2D21 A;  3K01 A;  3UP9 A;  4R9G A;  1Q35 A;  3VXB A;  5I56 A;  2NXO A;  4FOR A;  1Y4C A;  3KBR A;  3MJN A;  3LBS A;  3PPQ A;  4DDD A;  3UN6 A;  2HCA A;  2ZYM A;  4F31 B;  4QFK A;  2VD2 A;  1UIV A;  3DRK A;  3T66 A;  4GXA A;  1XVX A;  1DTZ A;  4R2F A;  3VDF A;  2YPN A;  3DLN A;  4MLQ A;  5I2N B;  1O63 A;  2B4M A;  1MQI A;  2REJ A;  4P0I A;  3W15 C;  4EQ7 A;  3PU5 A;  1VSO A;  2HEU A;  5AA1 A;  2XX8 A;  2RKM A;  5LOM A;  4IO7 A;  3EHU A;  5FHN A;  1PB9 A;  2ZNT A;  1M5D A;  1YCJ A;  1QUL A;  5DEX A;  3K6V A;  2G93 A;  3TEP A;  2B3F A;  4BDL A;  3CFZ A;  2RCA A;  1XC1 A;  2R9J A;  3MVY A;  4WED A;  2HZK A;  5L9S A;  2Y84 A;  4NWC A;  3CIJ A;  4EQB A;  3PMV A;  2ZNS A;  3TTR A;  2ZXT A;  5I56 B;  4LZ8 A;  4LZ7 A;  2V3T A;  3G3F A;  2AL5 A;  1XOC A;  3IX1 A;  4F2O A;  1QUI A;  2ZNU A;  3FV1 A;  3N6U A;  4ZZE A;  4KI0 E;  3IO4 A;  4JSO A;  4R9F A;  5AA2 A;  2IA4 A;  5KCJ B;  3QSL A;  3FTO A;  2WOP A;  2O7U A;  5KDT A;  1JW1 A;  2ANJ A;  4RK2 A;  1Y3Q A;  3IOV A;  3G3I A;  5ITP A;  2HAU A;  3IR1 A;  2O1M A;  1H45 A;  4ZEK A;  3E4R A;  3FAT A;  4ZDM A;  1MXY A;  2DVZ A;  4Z7E A;  1JVY A;  2W7Y A;  3FJM A;  1S50 A;  1MG1 A;  1B3L A;  1H44 A;  3G3G A;  4NF4 A;  1B7H A;  1GGG A;  4DCY A;  1FQA A;  1II5 A;  1B4Z A;  2OZZ A;  2CMO A;  1P1N A;  4LUB A;  4NE4 A;  5B70 A;  2FA7 A;  4NF5 B;  1AOV A;  1DMB A;  4H1X A;  4HW8 A;  5I2K B;  4RPO A;  3U94 A;  4NF8 B;  1LFI A;  1PBP A;  3BFU A;  3LSX A;  4G8H A;  1B3H A;  3C34 A;  3KSX A;  4G4P A;  4DIG A;  1B3F A;  1IUD A;  1MXW A;  4OER A;  5TP9 B;  1M5B A;  3GBB A;  1MY4 A;  5K2Y A;  4C1T A;  1MM6 A;  4BDR A;  2PT2 A;  3VVE A;  3Q25 A;  1M5F A;  3GBA A;  4H67 A;  2UYF A;  4NF6 A;  4XIG Q;  4Q8R A;  2XXY A;  4GL0 A;  5B7D A;  2H25 A;  3R26 A;  4KQP A;  2ZYO A;  2QPQ A;  3OEN A;  3K00 A;  1LCT A;  3MPL A;  1IEJ A;  2F7A A;  3N5L A;  1JQF A;  4ND9 A;  5CMM A;  2A5T A;  1B51 A;  2E0S A;  3T9X B;  3VE1 B;  3MBP A;  3S9N C;  2R71 A;  1GVC A;  1LGB C;  3PD8 A;  1MXX A;  2XX9 A;  3N94 A;  2QS4 A;  1AMF A;  3A3U A;  1IIT A;  3VFJ A;  4F18 A;  2DXY A;  3MC2 A;  2PYY A;  3VXC A;  2XXP A;  1R9L A;  4U23 A;  4ZEF A;  1BLF A;  3CSB A;  2KLF A;  3VLW A;  1B3E A;  1MPC A;  3FGS A;  3IJX B;  3K02 A;  5CBR A;  4IO4 A;  1QUK A;  3N6T A;  3O6H A;  3DRG A;  1FW0 A;  2NUV A;  2IEE A;  3B6W A;  3H06 B;  3T22 A;  2F5X A;  3KJT A;  2OK2 A;  4JBZ A;  2DSF A;  5A5X B;  2DOJ A;  4FEB A;  1MRP A;  4JWX A;  4F3G A;  1SYI A;  1DPE A;  3S9M C;  4OZ9 A;  1ZIU A;  3K6X A;  3O6G A;  1I6Q A;  4GD5 A;  5DTB A;  4YMB A;  1IZ1 A;  1LFH A;  2XXT A;  4F2Q A;  1F9B A;  4U4X A;  3VVD A;  1IXI A;  4YKI A;  5JEI A;  2RF1 A;  1B0L A;  4BLA A;  2QS1 A;  5TPA A;  1R1N A;  1M5C A;  3VV5 A;  5ITO A;  1MS7 A;  1NH7 A;  2F35 A;  3UIF A;  1SYH A;  3HPI A;  2THI A;  1EZP A;  2PT1 A;  3FZV A;  3TMG A;  4BDQ A;  4F19 A;  2G29 A;  3DP8 A;  4OFJ A;  1Y3P A;  2V3U A;  3KSJ A;  4POW A;  4BDO A;  1XHY A;  3THI A;  4E0X A;  1A55 A;  3BBR A;  3V83 A;  1SW5 A;  1UQW A;  3FAS A;  3GZG A;  3JV9 A;  4HCW A;  3EF7 A;  1GV8 A;  3M8U A;  1URS A;  4X1D A;  3RUM A;  3LR1 A;  3CI8 A;  1BIY A;  2A5S A;  3E9X A;  2VP1 A;  2F6G A;  3G7W A;  3OO6 A;  3S2V A;  3FJ7 A;  4YKJ A;  5ISU A;  5EYF A;  4JSD A;  2QMW A;  3CVG A;  3FVK A;  1PB7 A;  1NMU A;  3SEX A;  3V8X B;  3QXM A;  1MDQ A;  1NNP A;  4ELP A;  2QL3 A;  4G68 B;  2NOO A;  2XD3 A;  5FHO A;  3HV1 A;  1B5I A;  1B6H A;  1SW1 A;  1NKX A;  3IB0 A;  4EXL A;  2Q2C A;  3KFM A;  4H8J A;  5H8Q A;  1VE4 A;  2OLB A;  1EH3 A;  4YB6 A;  4KR5 A;  4RXL A;  5F7V A;  3S9L C;  4ESX A;  4FE8 A;  3Q27 A;  2ONK E;  3E13 X;  5CI5 A;  1B0H A;  4ZS9 A;  1MM7 A;  2AIX A;  3RQT A;  3PUZ E;  3RGY A;  2Y7R A;  4XKN A;  5EHM A;  2P1S A;  4RA1 A;  4TOZ A;  4NMY A;  2I48 A;  1ZU0 A;  3TPA A;  3HHF A;  3PMW A;  4LAT A;  3U72 A;  3UGW A;  1D9Y A;  5F1Q A;  4RPN A;  2XX7 A;  3OXN A;  1IXH A;  3FVN A;  1SBP A;  3MQ9 A;  4P11 A;  1OIB A;  2E1S A;  2VD3 A;  1JET A;  2PX1 A;  3KOT A;  3O66 A;  4G8N A;  4H8I A;  4U2R A;  3LSL A;  3HHG A;  4I8C A;  4F1V A;  5CM6 A;  3MPK A;  2AYS A;  3O6I A;  3KG2 A;  4LA9 A;  3DRH A;  3MVX A;  1VFE A;  3HCQ A;  3LUY A;  2B4L A;  4OHN A;  3FXQ A;  3LSF B;  2GH9 A;  1I6B A;  1PEB A;  3FJG A;  5JTY A;  1I6A A;  1LBB A;  5H8H A;  1UTB A;  3KZG A;  2XXQ A;  3SEW A;  1NNK A;  3OEL A;  5CBS A;  5I58 B;  3L6H A;  4QSC A;  4F39 A;  4EF2 A;  4K3F A;  4F1Y A;  1EU8 A;  1ZMG A;  1CE2 A;  1LST A;  2HXW A;  3PUX E;  5ELV A;  4QF9 A;  3PPP A;  3ODB A;  3H6T A;  2UYE A;  4EF1 A;  4G2Z A;  4MF3 A;  1AIV A;  4OEV A;  3D4C A;  4N6P A;  5AE4 A;  4NED A;  1B9J A;  3CFL A;  4JWY A;  1QKB A;  3V5A A;  4YZZ A;  4AB5 A;  1A7L A;  1LFG A;  1MXZ A;  1M5E A;  4ZE9 A;  1D4N A;  2DWA A;  3PUY E;  4KHZ E;  4O3B A;  1OQH A;  3SER A;  4GWO A;  5I84 A;  3H7M A;  1A8F A;  4ZEC A;  1AH5 A;  1IIW A;  3GXA A;  2Z22 A;  1FTJ A;  3KN8 A;  3R7X A;  4R6H A;  4XKQ A;  3C36 A;  5ICT A;  3PAM A;  2XXR A;  3PV0 E;  2FNC A;  3BKI B;  3KN3 A;  4Q5T A;  4XXU A;  1NNT A;  4YKP A;  4EQ9 A;  4F3B A;  5HPQ A;  4ECF A;  3T9H B;  2DQV A;  2PVU A;  3UOR A;  5L8D A;  2Q89 A;  4OFL A;  5I58 A;  2OWT A;  1J1N A;  2P2A A;  5FHM A;  1MDP 1;  1ZJL A;  5H8H B;  2XXV A;  2X7P A;  3DEL B;  4GIZ A;  2DWJ A;  4KYD A;  2F8D A;  2B3B A;  4IO3 A;  2X7Q A;  4F1U A;  1SQY A;  2I6E A;  2QJE A;  1A40 A;  3K6W A;  1POT A;  4HTG A;  4KPT A;  3SEV A;  3MW0 A;  2GFE A;  2OBG A;  1P1W A;  1Y9U A;  4IY6 A;  4EXK A;  1D3K A;  1H3D A;  5IKB A;  1UIU A;  1B5H A;  4GVO A;  3KN7 A;  1BTJ A;  1TXF A;  4IGR A;  2P0S A;  1BKA A;  3S4U A;  1NFT A;  4LP2 B;  4DE8 A;  4R6Y A;  4OXV A;  3O29 A;  2O51 A;  3R6U A;  2I0C A;  4ELQ A;  3TDJ A;  1B1H A;  5KZT A;  5FTI A;  1IQ7 A;  3Q29 A;  4ELR A;  3TUS A;  3L6G A;  4JB7 A;  1OLA A;  4DXU A;  3I5O A;  4M1V A;  1Z7M E;  3DP6 A;  4Q30 B;  4YAH X;  2QMX A;  1LAH E;  3B6T A;  4M4G A;  1RKM A;  1JNF A;  5DT6 A;  4IO6 A;  1MQH A;  1LB9 A;  2CZL A;  4DXB A;  3IAZ A;  3KJ7 A;  4IY5 A;  4IO5 A;  1PC3 A;  3HN0 A;  2Z8F A;  2Y7P A;  3IO6 A;  3KOS A;  4THI A;  5A5X A;  2RC8 A;  2O68 A;  3U93 A;  1B52 A;  4G68 A;  1USY E;  5KCJ A;  5DYH A;  3U92 A;  3RY3 A;  3CG3 A;  4OVJ A;  3K0V A;  4I1D A;  5DVF A;  2QRY A;  3PD9 A;  5DVJ A;  1FQB A;  4ELO A;  1T0K A;  2ALU A;  1OVB A;  2DE3 A;  1US5 A;  1H43 A;  4POX A;  4OWD A;  4DXC A;  2UVH A;  3IK6 B;  2REG A;  5IAI A;  1B2H A;  1MXU A;  4ZEB A;  1GR2 A;  4X48 A; 
#chains in the Genus database with same CATH topology
 4RYA A;  5ICQ A;  4MH5 A;  1IMA A;  4XEQ A;  4MMP A;  3IFA A;  1B4H A;  2I49 A;  4NQ8 A;  2ZYK A;  2BJJ X;  1G0I A;  3K2D A;  3O28 A;  1QW0 A;  2O6A A;  4N07 A;  3RNN A;  3OSR A;  4NWD A;  1TFA A;  4GOT A;  3CHG A;  5H8F B;  3BIH A;  4XKR A;  4U4S A;  1B7Z A;  3MZ9 A;  1N3W A;  4YKK A;  4NF6 B;  4IGT A;  3FIR A;  3IOT A;  3MVZ A;  1LAG E;  3H4Z A;  2DDK A;  4NTL A;  1OMP A;  3IFC A;  3ILU B;  4PBH A;  1JW4 A;  3OD7 A;  4R72 A;  2UXA A;  4O3A A;  2Q74 A;  2O1L A;  3T9U A;  3FVO A;  4PFU A;  2F6P A;  2D5W A;  1DPP A;  3HO7 A;  5EYH A;  4ISU A;  2UVJ A;  4BDN A;  3PPN A;  4YU0 A;  1POY 1;  2XXH A;  4OYV A;  2NVU B;  3K6U A;  3WAE A;  1LBY A;  5AA2 B;  2WX9 A;  1MH3 A;  2I4C A;  1NV6 A;  2QVU A;  2CZH A;  2Q2A A;  2DYX A;  3PPR A;  2XWI A;  2FBP A;  2PBW A;  5I59 B;  2ESN A;  2I58 A;  2V4C A;  2WOK A;  3TTN A;  4R2B A;  3N6U A;  1DTG A;  1D9V A;  2OJT A;  4E0W A;  5M2V A;  5AA4 A;  1SW2 A;  3MWB A;  2DXR A;  3SKP A;  5JTY B;  1FTA A;  4HXV A;  1ELJ A;  4QFP A;  4G68 C;  4OEU A;  2VOZ A;  3DRF A;  3TCG A;  1LBV A;  4I9D A;  2Y7K A;  3FVG A;  1L5T A;  3LVU A;  3MVW A;  1WDN A;  1Z7N E;  2PMS A;  4LQ2 A;  4ZZA A;  2H9B A;  1KWH A;  1HSE A;  2YJP A;  2O69 A;  4LN5 A;  1TFD A;  5CMK A;  2QSX A;  3CFX A;  3C33 A;  1P1U A;  3K1M A;  5KDT B;  3D4G A;  3SEY A;  4JVI A;  1DSN A;  3IOU A;  2VGQ A;  3DP4 A;  3OO9 A;  4OVQ A;  3IJO B;  2HQ0 A;  2PFZ A;  3VVF A;  3A29 A;  4O3C A;  2WYP A;  2ZYN A;  3PMX A;  1QKA A;  4H5G A;  2O7I A;  3TZA A;  4G61 A;  1Y4T A;  5I59 A;  2HZL A;  3MP1 A;  5DVI A;  4OES A;  4MX6 A;  3IOW A;  5CRY A;  1NUX A;  1SVX B;  3VLV A;  1MY2 A;  2QVR A;  3C35 A;  3O2A A;  2ZMB A;  4HCY A;  2QFL A;  2DWH A;  4YIC A;  3K01 A;  3VXB A;  3KBR A;  3MJN A;  3PPQ A;  3LBS A;  3UN6 A;  4QFK A;  1UIV A;  3T66 A;  1DTZ A;  5I2N B;  3DLN A;  5AA1 A;  2HEU A;  2XX8 A;  5LOM A;  4PDD A;  2ZNT A;  1M5D A;  1YCJ A;  1BK4 A;  2G93 A;  2B3F A;  4BDL A;  1SPI A;  3MVY A;  3CIJ A;  1FPJ A;  4LZ8 A;  4LZ7 A;  3IX1 A;  1XOC A;  5I5P A;  1CNQ A;  4ZDM A;  2O1M A;  1H45 A;  4ZEK A;  4GWZ A;  4Z7E A;  1RDX A;  3G3G A;  4NF4 A;  4LUB A;  5B70 A;  1K9Z A;  1P1N A;  2CMO A;  1DMB A;  1XI6 A;  3BFU A;  4G4P A;  1B3F A;  1MY4 A;  4C1T A;  4BDR A;  2PT2 A;  3VVE A;  3Q25 A;  2H25 A;  1JQF A;  2Q8M A;  1GVC A;  1MXX A;  2XX9 A;  1AMF A;  4F18 A;  2XXP A;  3VLW A;  1MPC A;  3FGS A;  5CBR A;  4IO4 A;  1QUK A;  3N6T A;  3B6W A;  4PFR A;  2WEF A;  1SYI A;  4OZ9 A;  1ZIU A;  3O6G A;  1I6Q A;  4F2Q A;  4U4X A;  2QS1 A;  5ITO A;  1MS7 A;  2HPG A;  2THI A;  2PT1 A;  2PCR A;  2G29 A;  3DP8 A;  4OFJ A;  1Y3P A;  4FAT A;  3V83 A;  1SW5 A;  3FAS A;  3GZG A;  2ZZW A;  1URS A;  4X1D A;  3CI8 A;  5ICT A;  3S2V A;  1PB7 A;  5FBP A;  3SEX A;  4OVS A;  1NNP A;  2QL3 A;  1IMF A;  2XD3 A;  3HV1 A;  1B6H A;  3IB0 A;  2Q2C A;  3KFM A;  4H8J A;  5F24 A;  2ONK E;  5CI5 A;  4ZS9 A;  5EHM A;  2P1S A;  4RA1 A;  3HHF A;  4RPN A;  5F1Q A;  3FVN A;  1SBP A;  4H8I A;  4U2R A;  3HHG A;  3MPK A;  3BIG A;  3KG2 A;  3MVX A;  2B4L A;  4OHN A;  3LSF B;  3FJG A;  1I6A A;  1LBB A;  1EU8 A;  1LST A;  2HXW A;  3PPP A;  2UYE A;  4MF3 A;  3D4C A;  4HE0 A;  4AB5 A;  5ET5 A;  1MXZ A;  1D4N A;  4ZEC A;  1IIW A;  3HFU A;  2Z22 A;  4YKP A;  1NNT A;  4ECF A;  3T9H B;  5L8D A;  2P2A A;  2X7P A;  4KYD A;  2I6E A;  4IR8 A;  1POT A;  3SEV A;  1P1W A;  1H3D A;  5IKB A;  1UIU A;  5ET8 A;  3KN7 A;  1NV1 A;  1BTJ A;  1NV7 A;  4R6Y A;  2I0C A;  4ELQ A;  4MNP A;  1NUZ A;  2VPO A;  4M1V A;  4YAH X;  1RKM A;  1LB9 A;  4DXB A;  1YXI A;  5J16 A;  2F3B A;  4THI A;  2RC8 A;  3U93 A;  3RY3 A;  3CG3 A;  4ELO A;  2QRY A;  1T0K A;  1US5 A;  4GX4 A;  5IAI A;  1B2H A;  4X48 A;  4QBA A;  4PBQ A;  2YLN A;  3MZ1 A;  4GF8 A;  1FTL A;  1UTH B;  1N0T A;  3I3V A;  4X9T A;  3TQW A;  2Z8E A;  5J1D A;  4ZEI A;  1URD A;  3G3K A;  4QSE A;  3EHS A;  5H8N B;  2GRV A;  1FQC A;  2JJK A;  4LZ5 A;  3VLU A;  3ZKK A;  1N7X A;  1HSJ A;  4PAK A;  3TKD A;  1SI0 A;  1FQF A;  3OO8 A;  2GHA A;  3FV2 A;  3OEK A;  3U1O A;  3TTK A;  4RY1 A;  1QGX A;  2UVI A;  3ZS6 A;  2OCU A;  3K4U A;  3C9H A;  1XVY A;  1B5J A;  2ONS A;  3JYR A;  4OVT A;  4OQO A;  1PBQ A;  4KCD A;  4X8R A;  2R8T A;  3G3H A;  1FTO A;  1NL5 A;  5EQ9 A;  4PAF A;  3E3K A;  2KQZ A;  4U1O A;  4ONY A;  1VFD A;  5AA3 A;  1OLC A;  1CB6 A;  3OO7 A;  3KGC A;  4NX1 A;  1B3G A;  4ZED A;  4G8M A;  4PF8 A;  4XFE A;  1P1Q A;  3MZB A;  4XTC Q;  2ONR A;  2OX3 A;  3LC8 A;  3BFT A;  4NF0 A;  5I2N A;  1P99 A;  4PET A;  4PFT A;  4U1Z A;  1XT8 A;  1B7U A;  5TU0 A;  4IO2 A;  3QK6 A;  2VT5 A;  3K1N A;  2F78 A;  3RYB A;  3C31 A;  1MQD A;  1FPE A;  4N13 A;  1DCU A;  3JZJ A;  1MXV A;  1EZ9 A;  4AB6 A;  4PDH A;  3OOA A;  2V3Q A;  3EQ1 A;  5H8S A;  4GWU A;  3USD A;  2H98 A;  3O97 A;  3A3C A;  4PFY A;  1FTK A;  4MNI A;  3O9P A;  1H76 A;  3Q26 A;  1WVJ A;  1O64 A;  2WBB A;  4EDP A;  4H0W A;  1IME A;  4JDF A;  5IM2 A;  4R73 A;  4X1B A;  1USY H;  3H6U A;  3LSW A;  1LAX A;  3B7D A;  3ONM A;  3ZKL A;  5TP9 A;  2WOL A;  1FQE A;  2AL4 A;  5H8N A;  4TQU Q;  1N7W A;  3A09 A;  2I3V A;  4P1L A;  2LAO A;  1XS5 A;  3DRI A;  3H6W A;  3E78 A;  1IXG A;  1B58 A;  1N3X A;  1FQD A;  3C4M A;  1FPL A;  1MPB A;  4N8G A;  3SDF A;  4DZ1 A;  1FBF A;  1JW5 A;  2DP8 A;  1EZO A;  4TLL B;  2QS2 A;  2DE4 A;  4ZE8 A;  4OA4 A;  1ZBM A;  1JVX A;  1MQG A;  2QVV A;  1BP5 A;  1B05 A;  4NAP A;  4KFQ A;  2Y7W A;  3ECR A;  2QS3 A;  1LB8 A;  3T1B A;  2DE2 A;  2F7B A;  4AS4 A;  3M3K A;  1ZTY A;  1R9Q A;  1FPD A;  2F34 A;  4L17 A;  1RYX A;  3FD3 A;  3QIM A;  1VR5 A;  4FOR A;  4DDD A;  1XVX A;  5IZZ A;  4R2F A;  3VDF A;  2YPN A;  1O63 A;  4EQ7 A;  3PU5 A;  2CZK A;  3K6V A;  2RCA A;  1VDW A;  1XC1 A;  5EYG A;  2R9J A;  4KXP A;  3PMV A;  2ZXT A;  5I56 B;  2XXK A;  3G3F A;  2AL5 A;  4F2O A;  4KI0 E;  5AA2 A;  2IA4 A;  5KCJ B;  3FTO A;  2WOP A;  2ANJ A;  4N4U A;  5ITP A;  3E4R A;  1MXY A;  4P3L A;  1S50 A;  3UOR A;  1H44 A;  4DCY A;  1FQA A;  1B4Z A;  3E79 A;  2FA7 A;  1AOV A;  4HW8 A;  4RPO A;  3LSX A;  3C34 A;  3KSX A;  4DIG A;  1IUD A;  1MXW A;  5TP9 B;  3GBB A;  1NV3 A;  1MM6 A;  4XIG Q;  2UYF A;  4NF6 A;  4GL0 A;  3R26 A;  4KQP A;  2ZYO A;  3OEN A;  1FBP A;  1B51 A;  2E0S A;  2HHM A;  1LGB C;  2QS4 A;  1IIT A;  3VFJ A;  4ZEF A;  4N91 A;  3O6H A;  3DRG A;  2F5X A;  1FBE A;  4JBZ A;  4MAG A;  2DSF A;  5A5X B;  4JWX A;  4F3G A;  1DPE A;  3S9M C;  4GBW A;  4YMB A;  1LFH A;  1IZ1 A;  5JEI A;  1R1N A;  4POW A;  3KSJ A;  4E0X A;  3THI A;  1UQW A;  4HCW A;  3EF7 A;  1NV0 A;  3G7W A;  2F6G A;  5ISU A;  5EYF A;  3CVG A;  1NMU A;  4G68 B;  1SW1 A;  2MKZ A;  1NUW A;  2OLB A;  4RXL A;  5F7V A;  1IMB A;  4P9K A;  1B0H A;  1MM7 A;  3RQT A;  4XKN A;  4DI4 B;  1ZU0 A;  3PMW A;  3U72 A;  3UGW A;  1D9Y A;  1IXH A;  1YZ0 A;  1JET A;  2OWZ A;  2PX1 A;  5CM6 A;  3O6I A;  3DRH A;  1VFE A;  4MJO A;  1I6B A;  4NGU A;  3KZG A;  2XXQ A;  5I58 B;  5T3J A;  4EF2 A;  1ZMG A;  3PUX E;  4QF9 A;  3CFL A;  3V5A A;  4JWY A;  1QKB A;  1FSA A;  1A7L A;  1M5E A;  5KCJ A;  3SER A;  1OQH A;  3LV0 A;  1A8F A;  3RPL A;  1FTJ A;  3KN8 A;  4XKQ A;  3C36 A;  3PAM A;  3PV0 E;  3D1R A;  1KZ8 A;  4OFL A;  1Q9D A;  1ZJL A;  5H8H B;  5I3S A;  4GIZ A;  2F8D A;  4O7M A;  4F1U A;  1A40 A;  1Y9U A;  1TXF A;  2P0S A;  1NV4 A;  3S4U A;  4LP2 B;  4PTK A;  3O29 A;  4N6D A;  1AWB A;  4ELR A;  3L6G A;  4DXU A;  4OVP A;  3B6T A;  4M4G A;  1KA1 A;  3KJ7 A;  1PC3 A;  3KOS A;  2O68 A;  1B52 A;  4OVJ A;  5DVJ A;  1OVB A;  1H43 A;  2REG A;  1MXU A;  1JEV A;  1N04 A;  5ET6 A;  1EYJ A;  3T96 B;  3F11 A;  2RIN A;  4F3S A;  4MEV A;  4R74 A;  3MST A;  4QXD A;  1I69 A;  1QVS A;  3MYU A;  4MBP A;  2XXW A;  4FED A;  4FAJ A;  3FXR A;  1ZKB A;  3M3F A;  2XXU A;  4N81 A;  5BWJ A;  3TQL A;  1A8E A;  5K2X A;  3S9E A;  2HFB A;  2A5T B;  2Y5K A;  5JK4 A;  2F36 A;  1SDX A;  1A99 A;  1LLS A;  5EQA A;  4GWW A;  4GXS B;  1JEU A;  3IB2 A;  5JTY A;  4QRZ A;  2DWI A;  4XKP A;  3TCH A;  4QFN A;  1N76 A;  4C0R A;  1IMC A;  1MY3 A;  4LVQ A;  4PQJ A;  5L9S A;  5I57 B;  4DLD A;  3EHT A;  3ILT B;  4F29 A;  1B46 A;  1PB8 A;  2OWS A;  3PPO A;  5AA4 B;  3GLB A;  4RK9 A;  4FEC A;  3AXF A;  4KD5 A;  3KBZ A;  1Y1M A;  4AQ4 A;  2FHY A;  2Q9T A;  4GQO A;  3B50 A;  1P1O A;  2WBD A;  3W9V A;  2I3W A;  2F97 A;  5DEX B;  4HS7 A;  3SEU A;  3TTM A;  1Q1K A;  4GLI A;  5FTH A;  3W9W A;  4NHB A;  1FCK A;  2NWJ A;  1GTK A;  1B32 A;  2HAV A;  1SW4 A;  4PE3 A;  5CMC A;  4G77 A;  1TWY A;  1US4 A;  3CRB A;  4PFB A;  3Q28 A;  3QYT A;  1RYO A;  3H3G A;  3SES A;  1EYK A;  2Z23 A;  2Y5L A;  4MCO A;  5AA2 D;  3QAX A;  1B1X A;  3FXU A;  2RCB A;  4MHF A;  5L9M A;  3TYH A;  1FBC A;  1SI1 A;  4OFO A;  3V89 B;  3TTL A;  1S7Y A;  5CC2 A;  2RC9 A;  3RPW A;  3DM0 A;  4QHQ A;  3B8B A;  2V25 A;  5CMB A;  2I4B A;  4R75 A;  4F22 A;  4YMA A;  1Y1Z A;  4KYS A;  4F3P A;  5H8F A;  4Q0C A;  4R6K A;  4GL8 A;  4OAN A;  2FIX A;  3RYA A;  1G0H A;  2XD2 A;  1LCF A;  2FYI A;  2D3I A;  2Y7I A;  3MP8 A;  3M3L A;  4PGN A;  5I7I A;  4NF4 B;  1NNF A;  3ZSF A;  3TMG A;  1MH4 A;  5EQ7 A;  3B6Q A;  3KC1 A;  1N84 A;  2PFY A;  4H6D A;  3EPE A;  3WAF A;  5ET7 A;  2H4I A;  3N26 A;  1UTH A;  1OQG A;  4OMB A;  1NUY A;  4PE5 B;  4U21 A;  4PFW A;  1NI9 A;  4FJP A;  5CBS A;  3IL1 B;  3MAM A;  4MFI A;  2XXX A;  2DVC A;  2GHB A;  2KR0 A;  1MQJ A;  3ISP A;  4JWO A;  4U22 A;  3RT6 B;  4C1U A;  2RC7 A;  4I3Y A;  3P7I A;  4PAI A;  1FPI A;  1Y4C A;  3QMF A;  2HCA A;  2ZYM A;  4F31 B;  2VD2 A;  3DRK A;  4MLQ A;  2B4M A;  4P0I A;  1INP A;  1VSO A;  4IO7 A;  3EHU A;  5DEX A;  1QUL A;  4GX6 A;  4WED A;  2Y84 A;  4NWC A;  4EQB A;  1D9Q A;  5L9O A;  1QUI A;  2ZNU A;  3IO4 A;  4JSO A;  4R9F A;  3QSL A;  2CZI A;  2O7U A;  1JW1 A;  3IOV A;  3G3I A;  3IR1 A;  2XWK A;  2ZZX A;  1JVY A;  5I57 A;  1B3L A;  5KDT A;  1B7H A;  1GGG A;  1II5 A;  2OZZ A;  4NF5 B;  4H1X A;  5I2K B;  1PBP A;  4G8H A;  4OER A;  5K2Y A;  1M5F A;  2XXY A;  2QPQ A;  1IEJ A;  4ND9 A;  3T9X B;  3VE1 B;  3S9N C;  3MBP A;  2FVZ A;  3PD8 A;  2DXY A;  3MC2 A;  3VXC A;  4U23 A;  1R9L A;  3CSB A;  2NUV A;  2IEE A;  3H06 B;  4FEB A;  3K6X A;  4GD5 A;  5DTB A;  2XXT A;  2RF1 A;  1B0L A;  5TPA A;  3VV5 A;  1NH7 A;  5LTC A;  3UIF A;  2VPN A;  4BDQ A;  1XHY A;  3JV9 A;  1YYZ A;  3RUM A;  4NN3 A;  3OO6 A;  3FJ7 A;  4YKJ A;  4JSD A;  3V8X B;  3QXM A;  3EKI A;  1MDQ A;  4PFI A;  5FHO A;  5H8Q A;  1EH3 A;  4YB6 A;  3RPL B;  4FE8 A;  3Q27 A;  3E13 X;  2AIX A;  3PUZ E;  3RGY A;  2I48 A;  4LAT A;  1LBX A;  1IMD A;  2XX7 A;  3MQ9 A;  4P11 A;  1OIB A;  2E1S A;  2VD3 A;  4G8N A;  3T22 A;  3LSL A;  3LUY A;  3HCQ A;  3FXQ A;  1PEB A;  3L6H A;  4F39 A;  4K3F A;  4F1Y A;  2F3D A;  1CE2 A;  3H6T A;  1AIV A;  4NED A;  4ZE9 A;  3H7M A;  1AH5 A;  4H45 A;  3R7X A;  4R6H A;  2XXR A;  2FNC A;  3KN3 A;  4Q5T A;  3TUS A;  2PVU A;  5I58 A;  1J1N A;  1MDP 1;  4IO3 A;  2B3B A;  3FXB A;  1K9Y A;  2QJE A;  4MNC A;  4Q8R A;  4HTG A;  1B5H A;  4HE1 A;  4OXV A;  2CEY A;  2O51 A;  3R6U A;  3TDJ A;  1B1H A;  1KA0 A;  1IQ7 A;  2FIE A;  3Q29 A;  1OLA A;  4Q30 B;  5DT6 A;  1DK4 A;  4IO6 A;  1MQH A;  3IAZ A;  1FBG A;  3IO6 A;  2Z8F A;  4O94 A;  5A5X A;  1USY E;  3K0V A;  4I1D A;  3PD9 A;  1FQB A;  2ALU A;  1RDZ A;  4OWD A;  4DXC A;  2UVH A;  3IK6 B;  4NG7 A;  1O7T A;  1R6Z A;  4JVC A;  5DYH A;  3CG1 A;  2Z8D A;  4TLM B;  3TFL A;  3PUV E;  4JXI A;  2ABH A;  5TPA B;  4BDM A;  1Y20 A;  3QUF A;  2XWO A;  4IB2 A;  4XF5 A;  4N17 A;  5BUU A;  1QUJ A;  1IXC A;  2GQ1 A;  1NH8 A;  3O6P A;  4PP0 A;  3UA8 A;  3KC0 A;  1SD3 A;  2Q88 A;  1A54 A;  1HSL A;  3QUJ A;  1Y3N A;  4RNS A;  4QSD A;  1OVT A;  5IZ1 A;  4I3E A;  4O8M A;  1AL3 A;  4Z0I A;  4WKM A;  5I56 A;  1YPN A;  2XXI A;  4I62 A;  3H6V A;  3PGF A;  2P3V A;  4P0G A;  3OMB A;  1UTB B;  4YB7 A;  3I6V A;  1YTV A;  1FPF A;  3FUZ A;  5I2K A;  2WKY A;  3PUW E;  3DRJ A;  2I0B A;  3RLF E;  4HE2 A;  5EQ8 A;  4RJZ A;  4WEP A;  1PDA A;  1LBZ A;  3HST A;  1LEV A;  4UAC A;  5IZ3 B;  3IOR A;  4GFR A;  5H8Q B;  4MLV A;  3RT8 A;  2WYK A;  4LON B;  4GX3 A;  5HBC A;  4EUO A;  1YAE A;  3OSQ A;  4OEN A;  5EHS A;  4GBV A;  4OTE A;  3IB1 A;  3MP6 A;  1S9T A;  3TAJ A;  3PTY A;  3RTF B;  3GYY A;  1B40 A;  4UA8 A;  1FBD A;  1ATG A;  3KEI A;  1WOD A;  1NV2 A;  4QFL A;  1URG A;  2V84 A;  3H03 A;  4YB5 A;  3CR9 A;  4H65 A;  4ESW A;  4FIM A;  3TEL A;  2UVG A;  4WXJ A;  1QJM A;  1DOT A;  3SET A;  2B65 A;  1FPK A;  1FJ6 A;  3C32 A;  3RYD A;  2R6G E;  2XHD A;  4I40 A;  3OEM A;  4OET A;  2VHA A;  2X26 A;  2Q8J A;  3G3J A;  2XA5 A;  3UK4 A;  2O84 X;  4KCC A;  3T9V A;  3RTW B;  4NF8 A;  1TT1 A;  4NF5 A;  1LBC A;  5HM4 B;  2DS9 A;  3EN3 A;  5ESY A;  1ANF A;  3TCF A;  1MPD A;  3K1P A;  2H5Y A;  3RN8 A;  2M8C A;  1MY0 A;  1MY1 A;  4LQ5 A;  4QFO A;  3MUQ A;  4GRK A;  1LAF E;  1ZLQ A;  3T93 B;  3CSG A;  4KYE A;  2V93 A;  1FBH A;  4X04 A;  2H99 A;  3TOD A;  4H5F A;  2F7C A;  1FTM A;  4OVR A;  4P47 A;  4DCX A;  2D21 A;  3UP9 A;  4R9G A;  1Q35 A;  2NXO A;  4GXA A;  1MQI A;  2REJ A;  3ROJ A;  3W15 C;  2RKM A;  5FHN A;  1PB9 A;  3TEP A;  3CFZ A;  1NV5 A;  1EYI A;  2HZK A;  5IGA A;  2ZNS A;  3TTR A;  4PGP A;  2V3T A;  4PC9 A;  3FV1 A;  4N8Y A;  4ZZE A;  5DW8 A;  4RK2 A;  1Y3Q A;  2HAU A;  3FAT A;  2DVZ A;  2W7Y A;  3FJM A;  1JP4 A;  1MG1 A;  4NE4 A;  3U94 A;  4NF8 B;  1LFI A;  4EXK A;  4P1E A;  1B3H A;  1M5B A;  1RDY A;  4N15 A;  3GBA A;  4H67 A;  2ZZV A;  5B7D A;  3LUZ A;  3K00 A;  1LCT A;  3MPL A;  2F7A A;  3N5L A;  5CMM A;  2A5T A;  2R71 A;  3N94 A;  3T0J A;  4FBP A;  1DBZ A;  3A3U A;  4O7I A;  2PYY A;  1BLF A;  2KLF A;  1B3E A;  3IJX B;  3K02 A;  1FW0 A;  3KJT A;  2OK2 A;  5A5L A;  2DOJ A;  1MRP A;  2CEX A;  1F9B A;  3VVD A;  1IXI A;  4YKI A;  4BLA A;  1M5C A;  2F35 A;  1LBW A;  1SYH A;  3HPI A;  1EZP A;  3FZV A;  4P8B A;  4F19 A;  2V3U A;  4BDO A;  1A55 A;  3BBR A;  4N6K A;  3NOH A;  1GV8 A;  3M8U A;  3LR1 A;  1BIY A;  2A5S A;  3E9X A;  2VP1 A;  2QMW A;  3FVK A;  4ELP A;  2NOO A;  1B5I A;  1NKX A;  4EXL A;  1VE4 A;  4GWX A;  5IZ3 A;  4KR5 A;  3S9L C;  4ESX A;  2XWV A;  2BJI A;  2Y7R A;  4NMY A;  4TOZ A;  3TPA A;  4DI3 D;  3U65 A;  3OXN A;  3KOT A;  3O66 A;  4P56 A;  4I8C A;  4F1V A;  2AYS A;  4LA9 A;  2GH9 A;  4H46 A;  5H8H A;  1UTB A;  3SEW A;  1NNK A;  3OEL A;  3FBP A;  4AS5 A;  4QSC A;  5ELV A;  4GWS A;  3ODB A;  1FJ9 A;  4G2Z A;  4EF1 A;  4OEV A;  4N6P A;  5AE4 A;  1B9J A;  4YZZ A;  1LFG A;  3PUY E;  4O3B A;  2DWA A;  4KHZ E;  5I84 A;  4GWO A;  3GXA A;  5LDZ A;  3BKI B;  4XXU A;  4EQ9 A;  1FPG A;  4F3B A;  5HPQ A;  2DQV A;  2Q89 A;  2OWT A;  5FHM A;  2XXV A;  3DEL B;  2DWJ A;  2X7Q A;  1SQY A;  3K6W A;  4KPT A;  3U8Q A;  2HXR A;  3MW0 A;  2GFE A;  2OBG A;  4IY6 A;  4PCD A;  1D3K A;  4GVO A;  4PF6 A;  4IGR A;  1BKA A;  4DE8 A;  1NFT A;  5KZT A;  5FTI A;  2L5V A;  4JB7 A;  3I5O A;  1Z7M E;  3DP6 A;  1FRP A;  2QMX A;  1LAH E;  4GWY A;  4UAB A;  1JNF A;  2CZL A;  4IY5 A;  1FPB A;  4IO5 A;  3HN0 A;  2Y7P A;  4MIJ A;  4G68 A;  3U92 A;  5DVF A;  3SZP A;  2P3N A;  2DE3 A;  4POX A;  4JVD A;  4ZEB A;  1GR2 A; 
#chains in the Genus database with same CATH homology
 2YLN A;  1O7T A;  1JEV A;  1N04 A;  3MZ1 A;  4RYA A;  1R6Z A;  4GF8 A;  5ICQ A;  1FTL A;  1N0T A;  1UTH B;  2Z8D A;  3CG1 A;  4MH5 A;  4TLM B;  4X1B A;  3I3V A;  3TFL A;  1B4H A;  4C0R A;  4X9T A;  3T96 B;  3TQW A;  3F11 A;  3PUV E;  2Z8E A;  2RIN A;  2I49 A;  4F3S A;  4JXI A;  2ABH A;  2ZYK A;  5TPA B;  5J1D A;  4ZEI A;  4BDM A;  1Y20 A;  2BJJ X;  1URD A;  3QUF A;  4IB2 A;  5DVI A;  3G3K A;  4QSE A;  3K2D A;  4R74 A;  3EHS A;  3O28 A;  5I57 A;  5H8N B;  1I69 A;  1QVS A;  4MBP A;  5BUU A;  2XXW A;  1QUJ A;  1QW0 A;  2GRV A;  1FQC A;  2O6A A;  4FED A;  5JK4 A;  4LZ5 A;  4N07 A;  1IXC A;  3RNN A;  3OSR A;  3VLU A;  3ZKK A;  4FAJ A;  1NH8 A;  3FXR A;  3O6P A;  1N7X A;  1ZKB A;  4NWD A;  4PP0 A;  1HSJ A;  1TFA A;  3M3F A;  3UA8 A;  4GOT A;  3TKD A;  3CHG A;  1SD3 A;  1SI0 A;  2XXU A;  5BWJ A;  3TQL A;  5H8F B;  1A8E A;  1FQF A;  1A54 A;  2Q88 A;  5K2X A;  1HSL A;  3S9E A;  3OO8 A;  1Y3N A;  3QUJ A;  4RNS A;  4QSD A;  2GHA A;  3FV2 A;  3OEK A;  1OVT A;  3U1O A;  4XKR A;  2HFB A;  4U4S A;  3TTK A;  2A5T B;  1AL3 A;  3MZ9 A;  1B7Z A;  4RY1 A;  2UVI A;  4WKM A;  3ZS6 A;  4Z0I A;  2OCU A;  3K4U A;  2F36 A;  1YPN A;  3C9H A;  1N3W A;  1XVY A;  4YKK A;  5I2N A;  1B5J A;  2ONS A;  2XXI A;  4NF6 B;  3JYR A;  4IGT A;  4I62 A;  1SDX A;  1A99 A;  3FIR A;  1LLS A;  3H6V A;  3IOT A;  3PGF A;  4GXS B;  4P0G A;  3OMB A;  1UTB B;  4OQO A;  3MVZ A;  1LAG E;  1PBQ A;  3H4Z A;  4KCD A;  4NTL A;  3I6V A;  4YB7 A;  1JEU A;  1OMP A;  3IB2 A;  3ILU B;  1JW4 A;  1YTV A;  3FUZ A;  3OD7 A;  4QRZ A;  2UXA A;  4R72 A;  2DWI A;  4XKP A;  2WKY A;  3PUW E;  4O3A A;  5I2K A;  3TCH A;  4QFN A;  2O1L A;  3T9U A;  1N76 A;  3G3H A;  3DRJ A;  2I0B A;  4PFU A;  1FTO A;  1NL5 A;  2D5W A;  1MY3 A;  1DPP A;  2F6P A;  3FVO A;  3HO7 A;  4LVQ A;  4PQJ A;  3RLF E;  4ISU A;  2UVJ A;  3EHT A;  3PPN A;  4BDN A;  3ILT B;  3E3K A;  4DLD A;  4FAT A;  4YU0 A;  4U1O A;  1POY 1;  2XXH A;  4F29 A;  1B46 A;  1PB8 A;  2OWS A;  3PPO A;  5AA4 B;  4OYV A;  3GLB A;  2NVU B;  4RJZ A;  4RK9 A;  3K6U A;  4FEC A;  4ONY A;  4WEP A;  1PDA A;  3WAE A;  1VFD A;  5AA2 B;  1MH3 A;  2I4C A;  5AA3 A;  3AXF A;  4KD5 A;  1OLC A;  3HST A;  1Y1M A;  4AQ4 A;  1CB6 A;  3OO7 A;  3KGC A;  2Q2A A;  1B3G A;  4ZED A;  2DYX A;  2Q9T A;  3IOR A;  4G8M A;  4GFR A;  4UAC A;  3PPR A;  4MLV A;  5H8Q B;  3RT8 A;  4GQO A;  1P1O A;  1P1Q A;  4LON B;  3W9V A;  2I3W A;  2F97 A;  5DEX B;  5HBC A;  3MZB A;  4XTC Q;  2ONR A;  2PBW A;  5I59 B;  4HS7 A;  4EUO A;  3SEU A;  2ESN A;  3LC8 A;  2I58 A;  3BFT A;  2WOK A;  1P99 A;  1YAE A;  4PFT A;  4PET A;  4R2B A;  3OSQ A;  3TTN A;  3TTM A;  4OEN A;  1Q1K A;  4GLI A;  5EHS A;  5FTH A;  3W9W A;  4U1Z A;  1XT8 A;  1B7U A;  4OTE A;  1FCK A;  5TU0 A;  4IO2 A;  3QK6 A;  3IB1 A;  3MP6 A;  1S9T A;  1DTG A;  2F78 A;  3RYB A;  1D9V A;  1MQD A;  3C31 A;  3K1N A;  2NWJ A;  1GTK A;  3RTF B;  3TAJ A;  1B32 A;  2HAV A;  1SW4 A;  2OJT A;  5CMC A;  4N13 A;  5M2V A;  1B40 A;  4G77 A;  4E0W A;  3JZJ A;  5AA4 A;  1MXV A;  1EZ9 A;  1SW2 A;  3MWB A;  4UA8 A;  1TWY A;  1ATG A;  1US4 A;  3CRB A;  3KEI A;  3Q28 A;  3QYT A;  1RYO A;  1WOD A;  2V3Q A;  3EQ1 A;  3H3G A;  3OOA A;  3SES A;  2Z23 A;  5H8S A;  3USD A;  3U8Q A;  2DXR A;  5AA2 D;  2H98 A;  4QFL A;  3QAX A;  1URG A;  3SKP A;  1B1X A;  3FXU A;  3O97 A;  2V84 A;  3H03 A;  3A3C A;  2RCB A;  4PFY A;  4YB5 A;  5JTY B;  5L9M A;  3TYH A;  3CR9 A;  1FTK A;  1SI1 A;  5I57 B;  4H65 A;  3O9P A;  4OFO A;  1ELJ A;  4QFP A;  1H76 A;  1WVJ A;  3Q26 A;  4OEU A;  4G68 C;  2VOZ A;  1O64 A;  4FIM A;  3TEL A;  3V89 B;  3TTL A;  2UVG A;  4ESW A;  4EDP A;  1S7Y A;  4WXJ A;  4AB6 A;  1QJM A;  3DRF A;  1DOT A;  4H0W A;  3SET A;  5CC2 A;  3TCG A;  2RC9 A;  3RPW A;  2B65 A;  3DM0 A;  4JDF A;  4QHQ A;  2V25 A;  3C32 A;  4I9D A;  2Y7K A;  3FVG A;  1L5T A;  5CMB A;  3LVU A;  3MVW A;  2I4B A;  1WDN A;  2R6G E;  4R73 A;  1Z7N E;  1USY H;  2XHD A;  4R75 A;  1Y1Z A;  4KYS A;  4F22 A;  3OEM A;  4YMA A;  3H6U A;  4F3P A;  3LSW A;  4OET A;  2PMS A;  2VHA A;  5H8F A;  2X26 A;  2Q8J A;  1LAX A;  4LQ2 A;  4ZZA A;  3B7D A;  3G3J A;  4Q0C A;  2H9B A;  4R6K A;  4GL8 A;  1KWH A;  3ONM A;  3ZKL A;  3UK4 A;  1HSE A;  2O84 X;  2YJP A;  4KCC A;  5TP9 A;  3T9V A;  3RYA A;  2O69 A;  2XD2 A;  5I59 A;  3RTW B;  1LCF A;  2WOL A;  1TFD A;  4NF8 A;  5CMK A;  1FQE A;  1TT1 A;  2FYI A;  4LQ5 A;  2QSX A;  2D3I A;  3CFX A;  4NF5 A;  3C33 A;  2Y7I A;  3MP8 A;  3M3L A;  1P1U A;  3K1M A;  5KDT B;  2AL4 A;  5H8N A;  4NF4 B;  4TQU Q;  1NNF A;  3ZSF A;  1N7W A;  1LBC A;  3A09 A;  1MH4 A;  3D4G A;  3SEY A;  3B6Q A;  1DSN A;  2I3V A;  3IOU A;  5HM4 B;  2DS9 A;  2VGQ A;  3EN3 A;  2LAO A;  1XS5 A;  3DRI A;  1N84 A;  3DP4 A;  3H6W A;  3OO9 A;  3IJO B;  1ANF A;  2HQ0 A;  5L9O A;  3TCF A;  1MPD A;  4H6D A;  3VVF A;  3EPE A;  3K1P A;  3WAF A;  2H5Y A;  1IXG A;  2H4I A;  3N26 A;  1UTH A;  1OQG A;  4O3C A;  1B58 A;  4OMB A;  1N3X A;  3RN8 A;  1FQD A;  2ZYN A;  3C4M A;  4PE5 B;  3PMX A;  1MPB A;  1QKA A;  4H5G A;  3SDF A;  4DZ1 A;  4U21 A;  1JW5 A;  2M8C A;  4PFW A;  2O7I A;  3TZA A;  2DP8 A;  1EZO A;  1MY0 A;  4TLL B;  1Y4T A;  2QS2 A;  4FJP A;  1MY1 A;  2DE4 A;  4ZE8 A;  2HZL A;  4QFO A;  3MP1 A;  3IL1 B;  3MUQ A;  4GRK A;  4OES A;  1ZLQ A;  1LAF E;  3CSG A;  3MAM A;  3IOW A;  4MFI A;  5CRY A;  3T93 B;  1ZBM A;  2XXX A;  4KYE A;  1JVX A;  2V93 A;  1MQG A;  1BP5 A;  1SVX B;  1B05 A;  2DVC A;  2GHB A;  3VLV A;  2H99 A;  4KFQ A;  2Y7W A;  3TOD A;  4H5F A;  1MQJ A;  3ECR A;  4JWO A;  1MY2 A;  2QS3 A;  1LB8 A;  3C35 A;  3O2A A;  2DE2 A;  2ZMB A;  2F7B A;  4HCY A;  3M3K A;  1ZTY A;  2F7C A;  1R9Q A;  4U22 A;  3RT6 B;  4C1U A;  2RC7 A;  2F34 A;  1FTM A;  4L17 A;  1RYX A;  3FD3 A;  2DWH A;  3QIM A;  3P7I A;  4YIC A;  4DCX A;  1VR5 A;  2D21 A;  3K01 A;  3UP9 A;  4R9G A;  1Q35 A;  3VXB A;  5I56 A;  2NXO A;  4FOR A;  1Y4C A;  3KBR A;  3MJN A;  3LBS A;  3PPQ A;  4DDD A;  3UN6 A;  2HCA A;  2ZYM A;  4F31 B;  4QFK A;  2VD2 A;  1UIV A;  3DRK A;  3T66 A;  4GXA A;  1XVX A;  1DTZ A;  4R2F A;  3VDF A;  2YPN A;  3DLN A;  4MLQ A;  5I2N B;  1O63 A;  2B4M A;  1MQI A;  2REJ A;  4P0I A;  3W15 C;  4EQ7 A;  3PU5 A;  1VSO A;  2HEU A;  5AA1 A;  2XX8 A;  2RKM A;  5LOM A;  4IO7 A;  3EHU A;  5FHN A;  1PB9 A;  2ZNT A;  1M5D A;  1YCJ A;  1QUL A;  5DEX A;  3K6V A;  2G93 A;  3TEP A;  2B3F A;  4BDL A;  3CFZ A;  2RCA A;  1XC1 A;  2R9J A;  3MVY A;  4WED A;  2HZK A;  5L9S A;  2Y84 A;  4NWC A;  3CIJ A;  4EQB A;  3PMV A;  2ZNS A;  3TTR A;  2ZXT A;  5I56 B;  4LZ8 A;  4LZ7 A;  2V3T A;  3G3F A;  2AL5 A;  1XOC A;  3IX1 A;  4F2O A;  1QUI A;  2ZNU A;  3FV1 A;  3N6U A;  4ZZE A;  4KI0 E;  3IO4 A;  4JSO A;  4R9F A;  5AA2 A;  2IA4 A;  5KCJ B;  3QSL A;  3FTO A;  2WOP A;  2O7U A;  5KDT A;  1JW1 A;  2ANJ A;  4RK2 A;  1Y3Q A;  3IOV A;  3G3I A;  5ITP A;  2HAU A;  3IR1 A;  2O1M A;  1H45 A;  4ZEK A;  3E4R A;  3FAT A;  4ZDM A;  1MXY A;  2DVZ A;  4Z7E A;  1JVY A;  2W7Y A;  3FJM A;  1S50 A;  1MG1 A;  1B3L A;  1H44 A;  3G3G A;  4NF4 A;  1B7H A;  1GGG A;  4DCY A;  1FQA A;  1II5 A;  1B4Z A;  2OZZ A;  2CMO A;  1P1N A;  4LUB A;  4NE4 A;  5B70 A;  2FA7 A;  4NF5 B;  1AOV A;  1DMB A;  4H1X A;  4HW8 A;  5I2K B;  4RPO A;  3U94 A;  4NF8 B;  1LFI A;  1PBP A;  3BFU A;  3LSX A;  4G8H A;  1B3H A;  3C34 A;  3KSX A;  4G4P A;  4DIG A;  1B3F A;  1IUD A;  1MXW A;  4OER A;  5TP9 B;  1M5B A;  3GBB A;  1MY4 A;  5K2Y A;  4C1T A;  1MM6 A;  4BDR A;  2PT2 A;  3VVE A;  3Q25 A;  1M5F A;  3GBA A;  4H67 A;  2UYF A;  4NF6 A;  4XIG Q;  4Q8R A;  2XXY A;  4GL0 A;  5B7D A;  2H25 A;  3R26 A;  4KQP A;  2ZYO A;  2QPQ A;  3OEN A;  3K00 A;  1LCT A;  3MPL A;  1IEJ A;  2F7A A;  3N5L A;  1JQF A;  4ND9 A;  5CMM A;  2A5T A;  1B51 A;  2E0S A;  3T9X B;  3VE1 B;  3MBP A;  3S9N C;  2R71 A;  1GVC A;  1LGB C;  3PD8 A;  1MXX A;  2XX9 A;  3N94 A;  2QS4 A;  1AMF A;  3A3U A;  1IIT A;  3VFJ A;  4F18 A;  2DXY A;  3MC2 A;  2PYY A;  3VXC A;  2XXP A;  1R9L A;  4U23 A;  4ZEF A;  1BLF A;  3CSB A;  2KLF A;  3VLW A;  1B3E A;  1MPC A;  3FGS A;  3IJX B;  3K02 A;  5CBR A;  4IO4 A;  1QUK A;  3N6T A;  3O6H A;  3DRG A;  1FW0 A;  2NUV A;  2IEE A;  3B6W A;  3H06 B;  3T22 A;  2F5X A;  3KJT A;  2OK2 A;  4JBZ A;  2DSF A;  5A5X B;  2DOJ A;  4FEB A;  1MRP A;  4JWX A;  4F3G A;  1SYI A;  1DPE A;  3S9M C;  4OZ9 A;  1ZIU A;  3K6X A;  3O6G A;  1I6Q A;  4GD5 A;  5DTB A;  4YMB A;  1IZ1 A;  1LFH A;  2XXT A;  4F2Q A;  1F9B A;  4U4X A;  3VVD A;  1IXI A;  4YKI A;  5JEI A;  2RF1 A;  1B0L A;  4BLA A;  2QS1 A;  5TPA A;  1R1N A;  1M5C A;  3VV5 A;  5ITO A;  1MS7 A;  1NH7 A;  2F35 A;  3UIF A;  1SYH A;  3HPI A;  2THI A;  1EZP A;  2PT1 A;  3FZV A;  3TMG A;  4BDQ A;  4F19 A;  2G29 A;  3DP8 A;  4OFJ A;  1Y3P A;  2V3U A;  3KSJ A;  4POW A;  4BDO A;  1XHY A;  3THI A;  4E0X A;  1A55 A;  3BBR A;  3V83 A;  1SW5 A;  1UQW A;  3FAS A;  3GZG A;  3JV9 A;  4HCW A;  3EF7 A;  1GV8 A;  3M8U A;  1URS A;  4X1D A;  3RUM A;  3LR1 A;  3CI8 A;  1BIY A;  2A5S A;  3E9X A;  2VP1 A;  2F6G A;  3G7W A;  3OO6 A;  3S2V A;  3FJ7 A;  4YKJ A;  5ISU A;  5EYF A;  4JSD A;  2QMW A;  3CVG A;  3FVK A;  1PB7 A;  1NMU A;  3SEX A;  3V8X B;  3QXM A;  1MDQ A;  1NNP A;  4ELP A;  2QL3 A;  4G68 B;  2NOO A;  2XD3 A;  5FHO A;  3HV1 A;  1B5I A;  1B6H A;  1SW1 A;  1NKX A;  3IB0 A;  4EXL A;  2Q2C A;  3KFM A;  4H8J A;  5H8Q A;  1VE4 A;  2OLB A;  1EH3 A;  4YB6 A;  4KR5 A;  4RXL A;  5F7V A;  3S9L C;  4ESX A;  4FE8 A;  3Q27 A;  2ONK E;  3E13 X;  5CI5 A;  1B0H A;  4ZS9 A;  1MM7 A;  2AIX A;  3RQT A;  3PUZ E;  3RGY A;  2Y7R A;  4XKN A;  5EHM A;  2P1S A;  4RA1 A;  4TOZ A;  4NMY A;  2I48 A;  1ZU0 A;  3TPA A;  3HHF A;  3PMW A;  4LAT A;  3U72 A;  3UGW A;  1D9Y A;  5F1Q A;  4RPN A;  2XX7 A;  3OXN A;  1IXH A;  3FVN A;  1SBP A;  3MQ9 A;  4P11 A;  1OIB A;  2E1S A;  2VD3 A;  1JET A;  2PX1 A;  3KOT A;  3O66 A;  4G8N A;  4H8I A;  4U2R A;  3LSL A;  3HHG A;  4I8C A;  4F1V A;  5CM6 A;  3MPK A;  2AYS A;  3O6I A;  3KG2 A;  4LA9 A;  3DRH A;  3MVX A;  1VFE A;  3HCQ A;  3LUY A;  2B4L A;  4OHN A;  3FXQ A;  3LSF B;  2GH9 A;  1I6B A;  1PEB A;  3FJG A;  5JTY A;  1I6A A;  1LBB A;  5H8H A;  1UTB A;  3KZG A;  2XXQ A;  3SEW A;  1NNK A;  3OEL A;  5CBS A;  5I58 B;  3L6H A;  4QSC A;  4F39 A;  4EF2 A;  4K3F A;  4F1Y A;  1EU8 A;  1ZMG A;  1CE2 A;  1LST A;  2HXW A;  3PUX E;  5ELV A;  4QF9 A;  3PPP A;  3ODB A;  3H6T A;  2UYE A;  4EF1 A;  4G2Z A;  4MF3 A;  1AIV A;  4OEV A;  3D4C A;  4N6P A;  5AE4 A;  4NED A;  1B9J A;  3CFL A;  4JWY A;  1QKB A;  3V5A A;  4YZZ A;  4AB5 A;  1A7L A;  1LFG A;  1MXZ A;  1M5E A;  4ZE9 A;  1D4N A;  2DWA A;  3PUY E;  4KHZ E;  4O3B A;  1OQH A;  3SER A;  4GWO A;  5I84 A;  3H7M A;  1A8F A;  4ZEC A;  1AH5 A;  1IIW A;  3GXA A;  2Z22 A;  1FTJ A;  3KN8 A;  3R7X A;  4R6H A;  4XKQ A;  3C36 A;  5ICT A;  3PAM A;  2XXR A;  3PV0 E;  2FNC A;  3BKI B;  3KN3 A;  4Q5T A;  4XXU A;  1NNT A;  4YKP A;  4EQ9 A;  4F3B A;  5HPQ A;  4ECF A;  3T9H B;  2DQV A;  2PVU A;  3UOR A;  5L8D A;  2Q89 A;  4OFL A;  5I58 A;  2OWT A;  1J1N A;  2P2A A;  5FHM A;  1MDP 1;  1ZJL A;  5H8H B;  2XXV A;  2X7P A;  3DEL B;  4GIZ A;  2DWJ A;  4KYD A;  2F8D A;  2B3B A;  4IO3 A;  2X7Q A;  4F1U A;  1SQY A;  2I6E A;  2QJE A;  1A40 A;  3K6W A;  1POT A;  4HTG A;  4KPT A;  3SEV A;  3MW0 A;  2GFE A;  2OBG A;  1P1W A;  1Y9U A;  4IY6 A;  4EXK A;  1D3K A;  1H3D A;  5IKB A;  1UIU A;  1B5H A;  4GVO A;  3KN7 A;  1BTJ A;  1TXF A;  4IGR A;  2P0S A;  1BKA A;  3S4U A;  1NFT A;  4LP2 B;  4DE8 A;  4R6Y A;  4OXV A;  3O29 A;  2O51 A;  3R6U A;  2I0C A;  4ELQ A;  3TDJ A;  1B1H A;  5KZT A;  5FTI A;  1IQ7 A;  3Q29 A;  4ELR A;  3TUS A;  3L6G A;  4JB7 A;  1OLA A;  4DXU A;  3I5O A;  4M1V A;  1Z7M E;  3DP6 A;  4Q30 B;  4YAH X;  2QMX A;  1LAH E;  3B6T A;  4M4G A;  1RKM A;  1JNF A;  5DT6 A;  4IO6 A;  1MQH A;  1LB9 A;  2CZL A;  4DXB A;  3IAZ A;  3KJ7 A;  4IY5 A;  4IO5 A;  1PC3 A;  3HN0 A;  2Z8F A;  2Y7P A;  3IO6 A;  3KOS A;  4THI A;  5A5X A;  2RC8 A;  2O68 A;  3U93 A;  1B52 A;  4G68 A;  1USY E;  5KCJ A;  5DYH A;  3U92 A;  3RY3 A;  3CG3 A;  4OVJ A;  3K0V A;  4I1D A;  5DVF A;  2QRY A;  3PD9 A;  5DVJ A;  1FQB A;  4ELO A;  1T0K A;  2ALU A;  1OVB A;  2DE3 A;  1US5 A;  1H43 A;  4POX A;  4OWD A;  4DXC A;  2UVH A;  3IK6 B;  2REG A;  5IAI A;  1B2H A;  1MXU A;  4ZEB A;  1GR2 A;  4X48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...