3K38A

Crystal structure of b/perth neuraminidase d197e mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
389
structure length
389
Chain Sequence
PEWTYPRLSCPGSTFQKALLISPHRFGETKGNSAPLIIREPFIACGPKECKHFALTHYAAQPGGYYNGTRGDRNKLRHLISVKLGKIPTVENSIFHMAAWSGSACHDGKEWTYIGVDGPENNALLKIKYGEAYTDTYHSYANNILRTQESACNCIGGNCYLMITDGSASGISECRFLKIREGRIIKEIFPTGRVKHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRLMCTETYLDTPRPDDGSITGPCESNGDKGSGGIKGGFVHQRMASKIGRWYSRTMSKTKRMGMGLYVKYDGDPWTDSDALALSGVMVSMEEPGWYSFGFEIKDKKCDVPCIGIEMVHDGGKETWHSAATAIYCLMGSGQLLWDTVTGVDMAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Basis of Resistance to Neuraminidase Inhibitors of Influenza B Viruses.
pubmed doi rcsb
molecule keywords Neuraminidase
molecule tags Hydrolase
source organism Influenza b virus
total genus 105
structure length 389
sequence length 389
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 3k38A00
2BZDA 5JYYA 3GVLA 1Z4WA 4M4NA 1Z4VA 3W09A 4FP2A 2QWFA 4FOVA 3SANA 2BERA 1NCBN 4GJTA 1KITA 3SILA 3TI5A 4YW2A 4XE9A 4MWQA 2ZB5A 4CPZA 4YW4A 4QN4A 1V3BA 1W21A 2B8HA 4FPJA 5F9TA 2QWKA 1WCQA 3PJQA 1NN2A 2QWCA 2AEQA 2HU4A 1B9TA 4GZSA 1N1VA 3GVKA 1E8VA 2HTYA 4MWVA 3ALXA 4YZ2A 4CPNA 2QWEA 1NNBA 2HT5A 5HUNA 1S0JA 4D8SA 5B2CA 4GZOA 4HIZA 1WCSA 4XILA 2F29A 3D11A 1INGA 4MC7A 4YZ5A 4FPEA 2W20A 1A4GA 3CKZA 2HU0A 3TI4A 1IVFA 1MS5A 1F8DA 4B7JA 4XJZA 1MS1A 1MS3A 2VK7A 2VSMA 4XHBA 4NC5A 2AGSA 4FJ6A 4X49A 4XJ9A 3TI6A 1INXA 1NMAN 4FQ4A 2YA8A 1IVEA 4X4AA 2HTUA 4GZWA 1INVA 2YA7A 4XJRA 4FPLA 1W1XA 1NMBN 1EUTA 4WA5A 4MJUA 4SLIA 1V3EA 4XHXA 4YW3A 3H73A 4MZEA 1VCJA 1Z4XA 2F12A 3O9JA 4J9TA 2HTVA 1Z50A 1N1TA 1NCCN 3CL2A 1W0OA 4CPYA 1EUUA 3K36A 4QN6A 4FP3A 1F8CA 1A14N 2X9MA 1L7GA 4MWWA 4XJ8A 4WA3A 1S0IA 1MWEA 1INHA 6NN9A 1F8EA 1XOEA 3K37A 2SIMA 1V3CA 3T1EA 2HTRA 2ZB6A 2QWHA 4KS5A 3H72A 4H52A 3TI3A 4M3MA 4H53A 1W20A 2FHRA 1NSDA 4XOGA 1DILA 2CMLA 2C4LA 2F26A 4KS3A 4MWXA 4X6KA 1MZ6A 1V3DA 2YDTA 4K1JA 1V0ZA 4FPCA 4FPGA 3SLIA 4GZQA 1MS8A 4HZZA 4HZYA 2JKBA 1Z4YA 2HT8A 3K38A 3K39A 4FPFA 4MWJA 2XCYA 4GEZA 1IVGA 2QWIA 2HT7A 4K1HA 1IVDA 2F25A 2VK6A 2VSKA 4B7QA 1MS9A 1USRA 1NNCA 2QWBA 4K1IA 4WEFA 4FPHA 4GB1A 4XMIA 4MZAA 1N1SA 3CYEA 4FPYA 1MS0A 1NSCA 2HTQA 4HZWA 3OPZA 4M4VA 1VCUA 2F13A 2AH2A 4Q6KA 4YZ1A 2VW0A 3A71A 4X47A 4NCSA 4FZHA 1SLIA 3O9KA 1E8UA 4QN7A 2F27A 4UF7A 1INYA 2XZIA 3GVJA 1W0PA 1NMCA 4B7RA 1L7FA 2VWDA 3NN9A 4K1KA 4NN9A 1DIMA 4YZ4A 4B7MA 2BF6A 4WA4A 3K3AA 4GZTA 2F10A 1SLLA 4GDJA 4DGRA 2YA4A 2VW1A 1INWA 5HUKA 1INFA 2RKCA 1V0EA 4YW5A 4HZVA 1SNTA 2F11A 4BBWA 4KS4A 1V0FA 4YZ3A 4GDIA 3INBA 4XJWA 4HZXA 2C4AA 2F24A 4XJQA 4MJVA 1B9SA 5M1ZA 2F28A 4KS2A 1A4QA 1MR5A 4XIOA 1E8TA 4K3YA 4YW1A 5B2DA 2QWDA 4GZXA 4QN5A 2SLIA 7NN9A 1MZ5A 1EURA 4XMAA 1L7HA 2QWJA 3A72A 5HX0A 2W38A 3D12A 5HUMA 4KS1A 3ALWA 2VW2A 4QN3A 1NCAN 1SO7A 2BATA 2QWGA 1EUSA 2YA5A 3H71A 2W5NA 2YA6A 2W5OA 3CL0A 1B9VA 3TI8A 1MS4A 4MWYA 3NSSA 4CPMA 1N1YA 1NNAA 5NN9A 4QNPA 2XZKA 4MWRA 5HUGA 4CPLA 2F0ZA 3BEQA 4FOWA 1USXA 2QWAA 2AEPA 4FPOB 1XOGA 2HTWA 2VK5A 3B69A 4FOQA 4WEGA 4XJAA 1BJIA 4I00A 3JU4A 4GZPA 1NSBA 3H6JA 4JF7A 2VVZA 4XIKA 3SALA 4XJUA 4FOYA 4XYXA 3TICA 2SILA 3TIBA 4B7NA 4CPOA 1IVCA 4M4UA 4MWLA 1IVBA 3TIAA 1NCDN 1W8NA 4MX0A 4FVKA 1W8OA 2A75A 1F8BA 2YDPA 4FPKA 1Z4ZA 1V2IA 2XZJA 3B7EA 4MWUA
chains in the Genus database with same CATH superfamily
3KGGA 2BZDA 5JYYA 3P5BL 3GVLA 1Z4WA 4M4NA 1Z4VA 5GX2A 4O5SA 3WDZA 1RWLA 3A9GA 3W09A 4FP2A 2W8BB 2QWFA 4FOVA 3SANA 2BERA 1NCBN 2VAQA 4GJTA 1KITA 3SILA 3TI5A 4YW2A 1ZGKA 4IN4A 4XE9A 4MWQA 2ZB5A 4CPZA 4YW4A 1N6DA 4QN4A 1V3BA 1W21A 2B8HA 2IAXA 4FPJA 5F9TA 2QWKA 1WCQA 2HQSA 3PJQA 1IUBA 2IAPA 1NN2A 2QWCA 2AEQA 2HU4A 1B9TA 4GZSA 2DG0A 1N1VA 3GVKA 4CSDA 1E8VA 5EO8A 2HTYA 4MWVA 5GX1A 3ALXA 3S8VA 4YZ2A 4CPNA 2QWEA 4C1YA 1NNBA 1ZI0A 2HT5A 5HUNA 3LI3A 5H47A 1S0JA 1CRUA 4D8SA 5B2CA 4GZOA 1C9UA 4HIZA 1WCSA 4XILA 2F29A 3KYAA 2IAQA 3D11A 1Q7FA 1INGA 4MC7A 4YZ5A 4FPEA 2W20A 3Q6TA 1A4GA 2G8SA 3CKZA 2HU0A 3TI4A 2IAWA 1IVFA 1MS5A 1F8DA 4B7JA 4XJZA 4IFJA 4XMBA 4Q1UA 1MS1A 1MS3A 2VK7A 2VSMA 4XHBA 4NC5A 4AHAA 2AGSA 3WWAA 2W8BA 4FJ6A 4X49A 5CGJA 4XJ9A 3TI6A 1INXA 1NMAN 4FQ4A 4N1BA 2YA8A 5FNSA 1IVEA 1H6LA 4X4AA 2GVVA 1IJQA 3NO0A 4CH9A 2IARA 2HTUA 4GZWA 1INVA 2YA7A 4XJRA 2DSOA 4FPLA 1CVMA 2OJHA 1W1XA 1NMBN 3HRPA 2IATA 1EUTA 2H2UA 4A0PA 3U0SA 4WA5A 4MJUA 4SLIA 3V65B 1V3EA 4L7DA 4XHXA 4HW6A 3SOVA 4YW3A 3H73A 4MZEA 1VCJA 1Z4XA 2F12A 2FPBA 3O9JA 4J9TA 1K32A 2HTVA 1E1AA 1Z50A 3SOQA 3AMRA 1N1TA 2GVXA 3G4HA 1NCCN 2FP8A 3CL2A 5EO7A 3VNHA 5GX5A 1W0OA 4CPYA 1EUUA 3V1SA 3K36A 3E5ZA 4QN6A 4FP3A 1F8CA 1A14N 2X9MA 2ZW9A 1L7GA 4MWWA 4XJ8A 2IVZA 4WA3A 1S0IA 1CRZA 3VNGA 2VPJA 1MWEA 1INHA 6NN9A 1F8EA 1XOEA 3K37A 2SIMA 1V3CA 3T1EA 4D52B 2HTRA 2ZB6A 3SOBB 4L7CA 2QWHA 3LI4A 4KS5A 1RWIA 3H72A 4H52A 3TI3A 4M3MA 4H53A 1W20A 2POOA 2FHRA 2QE8A 1NSDA 4XOGA 3O4PA 1DILA 2CMLA 2C4LA 4GN8A 2F26A 4KS3A 4MWXA 1S18A 4X6KA 1MZ6A 1V3DA 2YDTA 4AGTA 4IMBA 4K1JA 1V0ZA 4FPCA 4FPGA 3SLIA 4GZQA 1MS8A 4HZZA 1V04A 3UC1A 4HZYA 5FNTA 2JKBA 1Z4YA 4O5TA 2HT8A 3K38A 3K39A 4FPFA 4MWJA 2XCYA 4GEZA 1IVGA 2DYHA 5FNQA 2QWIA 2HT7A 4GN9A 4ZGCA 4K1HA 4R40A 1IVDA 2F25A 2VK6A 2IAUA 2VSKA 4B7QA 1MS9A 4GN7A 1N6EA 1USRA 1NNCA 2QWBA 4K1IA 4WEFA 3LI5A 3DR2A 4FPHA 4UOUA 4GB1A 3S2KA 4XMIA 1POOA 4MZAA 4D52A 1N1SA 3CYEA 4FPYA 1IUCA 5FNRA 1MS0A 3AMSA 1NSCA 3HLHA 2HTQA 2FPCA 4HZWA 5D9DA 3OPZA 4M4VA 1VCUA 2F13A 2AH2A 2Z32A 4Q6KA 4YZ1A 2VW0A 3A71A 4X47A 4NCSA 4FZHA 4IFLX 1SLIA 4GNBA 5D9BA 1N6FA 3O9KA 1E8UA 2ZZKA 4QN7A 4HHQA 2F27A 4UF7A 4D4UA 1N7DA 5EX7A 1INYA 2XZIA 2H2NA 3GVJA 5FZNA 1W0PA 1NMCA 3V64C 4B7RA 1L7FA 3G4EA 2VWDA 3NN9A 4K1KA 4NN9A 1DIMA 4YZ4A 2XN4A 3WN7A 4B7MA 2BF6A 4WA4A 1SUUA 3K3AA 4GZTA 2F10A 4AH4A 2ISMA 4DG6A 1SLLA 3L6VA 4GDJA 4DGRA 2YA4A 5GTQA 2VW1A 1CQ1A 1INWA 5HUKA 1U6DX 1INFA 2RKCA 4HHOA 1V0EA 3IAXA 4YW5A 4HZVA 1SNTA 2F11A 1OFZA 4BBWA 3ADEA 4KS4A 1NPEA 1V0FA 4D52C 3FVZA 5D9CA 4YZ3A 4GDIA 4AGIA 3INBA 3I1CA 4XJWA 4HZXA 2C4AA 3DASA 3BYCA 3SRGA 2F24A 2V91A 2IASA 4XJQA 4MJVA 4ZY3A 1B9SA 1WP5A 5M1ZA 3Q6PA 2F28A 4KS2A 1A4QA 3TC9A 1MR5A 4XIOA 3ZGCA 4ZLRA 5FNUA 1E8TA 4K3YA 4YW1A 4L7BA 5B2DA 3S8ZA 4YY8A 2QWDA 2IAVA 4GZXA 4QN5A 2SLIA 7NN9A 1MZ5A 1EURA 4XMAA 1L7HA 3SREA 1X2RA 3Q6KA 2QWJA 3A9HA 3A72A 5GX4A 5HX0A 2W38A 3D12A 5HUMA 4KS1A 3ALWA 2VW2A 4QN3A 1NCAN 1SO7A 2BATA 2ZWAA 4GNAA 2QWGA 1EUSA 2YA5A 3H71A 2W5NA 2YA6A 3S94A 2W5OA 3CL0A 1B9VA 3TI8A 1S1DA 5F72C 2FP9A 1C5KA 1MS4A 4MWYA 2DG1A 2IAOA 3NSSA 4CPMA 1N1YA 3II7A 1NNAA 1PJXA 5NN9A 4QNPA 2XZKA 3WW9A 4MWRA 5HUGA 2GHSA 4CPLA 2F0ZA 2WOZA 4JMLA 3BEQA 2GVWA 4FOWA 1USXA 2QWAA 2AEPA 3FW0A 4FPOB 4PWZA 4ASCA 1XOGA 2HTWA 2VK5A 3B69A 4FOQA 3HLIA 4WEGA 1BJIA 4XJAA 4IFNX 2FLUX 4I00A 3JU4A 4GZPA 1NSBA 3H6JA 5FWWA 4JF7A 2VVZA 4XIKA 1X2JA 3SALA 4XJUA 4FOYA 4XYXA 4CHBA 3TICA 2SILA 3TIBA 5FZJA 4B7NA 4CPOA 1IVCA 4M4UA 4MWLA 1IVBA 4IYGA 3TIAA 1QBIA 1NCDN 4G3NA 4C1YB 1W8NA 4MX0A 4FVKA 4GNCA 1W8OA 2P4OA 2A75A 2GVUA 1F8BA 2YDPA 4FPKA 5GX3A 1Z4ZA 1QLGA 1V2IA 2XZJA 3B7EA 4IQKA 4MWUA 3ZGDA
chains in the Genus database with same CATH topology
2BZDA 5JYYA 3GVLA 1Z4WA 4M4NA 1Z4VA 3W09A 4FP2A 2QWFA 4FOVA 3SANA 2BERA 1NCBN 4GJTA 1KITA 3SILA 3TI5A 4YW2A 4XE9A 4MWQA 2ZB5A 4CPZA 4YW4A 4QN4A 1V3BA 1W21A 2B8HA 4FPJA 5F9TA 2QWKA 1WCQA 3PJQA 1NN2A 2QWCA 2AEQA 2HU4A 1B9TA 4GZSA 1N1VA 3GVKA 1E8VA 2HTYA 4MWVA 3ALXA 4YZ2A 4CPNA 2QWEA 1NNBA 2HT5A 5HUNA 1S0JA 4D8SA 5B2CA 4GZOA 4HIZA 1WCSA 4XILA 2F29A 3D11A 1INGA 4MC7A 4YZ5A 4FPEA 2W20A 1A4GA 3CKZA 2HU0A 3TI4A 1IVFA 1MS5A 1F8DA 4B7JA 4XJZA 1MS1A 1MS3A 2VK7A 2VSMA 4XHBA 4NC5A 2AGSA 4FJ6A 4X49A 4XJ9A 3TI6A 1INXA 1NMAN 4FQ4A 2YA8A 1IVEA 4X4AA 2HTUA 4GZWA 1INVA 2YA7A 4XJRA 4FPLA 1W1XA 1NMBN 1EUTA 2H2UA 4WA5A 4MJUA 4SLIA 1V3EA 4XHXA 4YW3A 3H73A 4MZEA 1VCJA 1Z4XA 2F12A 3O9JA 4J9TA 2HTVA 1Z50A 1N1TA 1NCCN 3CL2A 1W0OA 4CPYA 1EUUA 3K36A 4QN6A 4FP3A 1F8CA 1A14N 2X9MA 1L7GA 4MWWA 4XJ8A 4WA3A 1S0IA 1MWEA 1INHA 6NN9A 1F8EA 1XOEA 3K37A 2SIMA 1V3CA 3T1EA 2HTRA 2ZB6A 2QWHA 4KS5A 3H72A 4H52A 3TI3A 4M3MA 4H53A 1W20A 2FHRA 1NSDA 4XOGA 1DILA 2CMLA 2C4LA 2F26A 4KS3A 4MWXA 1S18A 4X6KA 1MZ6A 1V3DA 2YDTA 4K1JA 1V0ZA 4FPCA 4FPGA 3SLIA 4GZQA 1MS8A 4HZZA 4HZYA 2JKBA 1Z4YA 2HT8A 3K38A 3K39A 4FPFA 4MWJA 2XCYA 4GEZA 1IVGA 2QWIA 2HT7A 4K1HA 1IVDA 2F25A 2VK6A 2VSKA 4B7QA 1MS9A 1USRA 1NNCA 2QWBA 4K1IA 4WEFA 4FPHA 4GB1A 4XMIA 4MZAA 1N1SA 3CYEA 4FPYA 1MS0A 1NSCA 2HTQA 4HZWA 3OPZA 4M4VA 1VCUA 2F13A 2AH2A 4Q6KA 4YZ1A 2VW0A 3A71A 4X47A 4NCSA 4FZHA 1SLIA 3O9KA 1E8UA 4QN7A 2F27A 4UF7A 1INYA 2XZIA 2H2NA 3GVJA 1W0PA 1NMCA 4B7RA 1L7FA 2VWDA 3NN9A 4K1KA 4NN9A 1DIMA 4YZ4A 4B7MA 2BF6A 4WA4A 3K3AA 4GZTA 2F10A 1SLLA 4GDJA 4DGRA 2YA4A 2VW1A 1INWA 5HUKA 1INFA 2RKCA 1V0EA 4YW5A 4HZVA 1SNTA 2F11A 4BBWA 4KS4A 1V0FA 4YZ3A 4GDIA 3INBA 4XJWA 4HZXA 2C4AA 2F24A 4XJQA 4MJVA 1B9SA 5M1ZA 2F28A 4KS2A 1A4QA 1MR5A 4XIOA 1E8TA 4K3YA 4YW1A 5B2DA 2QWDA 4GZXA 4QN5A 2SLIA 7NN9A 1MZ5A 1EURA 4XMAA 1L7HA 2QWJA 3A72A 5HX0A 2W38A 3D12A 5HUMA 4KS1A 3ALWA 2VW2A 4QN3A 1NCAN 1SO7A 2BATA 2QWGA 1EUSA 2YA5A 3H71A 2W5NA 2YA6A 2W5OA 3CL0A 1B9VA 3TI8A 1S1DA 1MS4A 4MWYA 3NSSA 4CPMA 1N1YA 1NNAA 5NN9A 4QNPA 2XZKA 4MWRA 5HUGA 4CPLA 2F0ZA 3BEQA 4FOWA 1USXA 2QWAA 2AEPA 4FPOB 1XOGA 2HTWA 2VK5A 3B69A 4FOQA 4WEGA 4XJAA 1BJIA 4I00A 3JU4A 4GZPA 1NSBA 3H6JA 4JF7A 2VVZA 4XIKA 3SALA 4XJUA 4FOYA 4XYXA 3TICA 2SILA 3TIBA 4B7NA 4CPOA 1IVCA 4M4UA 4MWLA 1IVBA 3TIAA 1NCDN 1W8NA 4MX0A 4FVKA 1W8OA 2A75A 1F8BA 2YDPA 4FPKA 1Z4ZA 1V2IA 2XZJA 3B7EA 4MWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZD A;  5JYY A;  3GVL A;  1Z4W A;  4M4N A;  1Z4V A;  3W09 A;  4FP2 A;  2QWF A;  4FOV A;  3SAN A;  2BER A;  1NCB N;  4GJT A;  1KIT A;  3SIL A;  3TI5 A;  4YW2 A;  4XE9 A;  4MWQ A;  2ZB5 A;  4CPZ A;  4YW4 A;  4QN4 A;  1V3B A;  1W21 A;  2B8H A;  4FPJ A;  5F9T A;  2QWK A;  1WCQ A;  3PJQ A;  1NN2 A;  2QWC A;  2AEQ A;  2HU4 A;  1B9T A;  4GZS A;  1N1V A;  3GVK A;  1E8V A;  2HTY A;  4MWV A;  3ALX A;  4YZ2 A;  4CPN A;  2QWE A;  1NNB A;  2HT5 A;  5HUN A;  1S0J A;  4D8S A;  5B2C A;  4GZO A;  4HIZ A;  1WCS A;  4XIL A;  2F29 A;  3D11 A;  1ING A;  4MC7 A;  4YZ5 A;  4FPE A;  2W20 A;  1A4G A;  3CKZ A;  2HU0 A;  3TI4 A;  1IVF A;  1MS5 A;  1F8D A;  4B7J A;  4XJZ A;  1MS1 A;  1MS3 A;  2VK7 A;  2VSM A;  4XHB A;  4NC5 A;  2AGS A;  4FJ6 A;  4X49 A;  4XJ9 A;  3TI6 A;  1INX A;  1NMA N;  4FQ4 A;  2YA8 A;  1IVE A;  4X4A A;  2HTU A;  4GZW A;  1INV A;  2YA7 A;  4XJR A;  4FPL A;  1W1X A;  1NMB N;  1EUT A;  4WA5 A;  4MJU A;  4SLI A;  1V3E A;  4XHX A;  4YW3 A;  3H73 A;  4MZE A;  1VCJ A;  1Z4X A;  2F12 A;  3O9J A;  4J9T A;  2HTV A;  1Z50 A;  1N1T A;  1NCC N;  3CL2 A;  1W0O A;  4CPY A;  1EUU A;  3K36 A;  4QN6 A;  4FP3 A;  1F8C A;  1A14 N;  2X9M A;  1L7G A;  4MWW A;  4XJ8 A;  4WA3 A;  1S0I A;  1MWE A;  1INH A;  6NN9 A;  1F8E A;  1XOE A;  3K37 A;  2SIM A;  1V3C A;  3T1E A;  2HTR A;  2ZB6 A;  2QWH A;  4KS5 A;  3H72 A;  4H52 A;  3TI3 A;  4M3M A;  4H53 A;  1W20 A;  2FHR A;  1NSD A;  4XOG A;  1DIL A;  2CML A;  2C4L A;  2F26 A;  4KS3 A;  4MWX A;  4X6K A;  1MZ6 A;  1V3D A;  2YDT A;  4K1J A;  1V0Z A;  4FPC A;  4FPG A;  3SLI A;  4GZQ A;  1MS8 A;  4HZZ A;  4HZY A;  2JKB A;  1Z4Y A;  2HT8 A;  3K38 A;  3K39 A;  4FPF A;  4MWJ A;  2XCY A;  4GEZ A;  1IVG A;  2QWI A;  2HT7 A;  4K1H A;  1IVD A;  2F25 A;  2VK6 A;  2VSK A;  4B7Q A;  1MS9 A;  1USR A;  1NNC A;  2QWB A;  4K1I A;  4WEF A;  4FPH A;  4GB1 A;  4XMI A;  4MZA A;  1N1S A;  3CYE A;  4FPY A;  1MS0 A;  1NSC A;  2HTQ A;  4HZW A;  3OPZ A;  4M4V A;  1VCU A;  2F13 A;  2AH2 A;  4Q6K A;  4YZ1 A;  2VW0 A;  3A71 A;  4X47 A;  4NCS A;  4FZH A;  1SLI A;  3O9K A;  1E8U A;  4QN7 A;  2F27 A;  4UF7 A;  1INY A;  2XZI A;  3GVJ A;  1W0P A;  1NMC A;  4B7R A;  1L7F A;  2VWD A;  3NN9 A;  4K1K A;  4NN9 A;  1DIM A;  4YZ4 A;  4B7M A;  2BF6 A;  4WA4 A;  3K3A A;  4GZT A;  2F10 A;  1SLL A;  4GDJ A;  4DGR A;  2YA4 A;  2VW1 A;  1INW A;  5HUK A;  1INF A;  2RKC A;  1V0E A;  4YW5 A;  4HZV A;  1SNT A;  2F11 A;  4BBW A;  4KS4 A;  1V0F A;  4YZ3 A;  4GDI A;  3INB A;  4XJW A;  4HZX A;  2C4A A;  2F24 A;  4XJQ A;  4MJV A;  1B9S A;  5M1Z A;  2F28 A;  4KS2 A;  1A4Q A;  1MR5 A;  4XIO A;  1E8T A;  4K3Y A;  4YW1 A;  5B2D A;  2QWD A;  4GZX A;  4QN5 A;  2SLI A;  7NN9 A;  1MZ5 A;  1EUR A;  4XMA A;  1L7H A;  2QWJ A;  3A72 A;  5HX0 A;  2W38 A;  3D12 A;  5HUM A;  4KS1 A;  3ALW A;  2VW2 A;  4QN3 A;  1NCA N;  1SO7 A;  2BAT A;  2QWG A;  1EUS A;  2YA5 A;  3H71 A;  2W5N A;  2YA6 A;  2W5O A;  3CL0 A;  1B9V A;  3TI8 A;  1MS4 A;  4MWY A;  3NSS A;  4CPM A;  1N1Y A;  1NNA A;  5NN9 A;  4QNP A;  2XZK A;  4MWR A;  5HUG A;  4CPL A;  2F0Z A;  3BEQ A;  4FOW A;  1USX A;  2QWA A;  2AEP A;  4FPO B;  1XOG A;  2HTW A;  2VK5 A;  3B69 A;  4FOQ A;  4WEG A;  4XJA A;  1BJI A;  4I00 A;  3JU4 A;  4GZP A;  1NSB A;  3H6J A;  4JF7 A;  2VVZ A;  4XIK A;  3SAL A;  4XJU A;  4FOY A;  4XYX A;  3TIC A;  2SIL A;  3TIB A;  4B7N A;  4CPO A;  1IVC A;  4M4U A;  4MWL A;  1IVB A;  3TIA A;  1NCD N;  1W8N A;  4MX0 A;  4FVK A;  1W8O A;  2A75 A;  1F8B A;  2YDP A;  4FPK A;  1Z4Z A;  1V2I A;  2XZJ A;  3B7E A;  4MWU A; 
#chains in the Genus database with same CATH topology
 3KGG A;  2BZD A;  5JYY A;  3P5B L;  3GVL A;  1Z4W A;  4M4N A;  1Z4V A;  5GX2 A;  4O5S A;  3WDZ A;  1RWL A;  3A9G A;  3W09 A;  4FP2 A;  2W8B B;  2QWF A;  4FOV A;  3SAN A;  2BER A;  1NCB N;  2VAQ A;  4GJT A;  1KIT A;  3SIL A;  3TI5 A;  4YW2 A;  1ZGK A;  4IN4 A;  4XE9 A;  4MWQ A;  2ZB5 A;  4CPZ A;  4YW4 A;  1N6D A;  4QN4 A;  1V3B A;  1W21 A;  2B8H A;  2IAX A;  4FPJ A;  5F9T A;  2QWK A;  1WCQ A;  2HQS A;  3PJQ A;  1IUB A;  2IAP A;  1NN2 A;  2QWC A;  2AEQ A;  2HU4 A;  1B9T A;  4GZS A;  2DG0 A;  1N1V A;  3GVK A;  4CSD A;  1E8V A;  5EO8 A;  2HTY A;  4MWV A;  5GX1 A;  3ALX A;  3S8V A;  4YZ2 A;  4CPN A;  2QWE A;  4C1Y A;  1NNB A;  1ZI0 A;  2HT5 A;  5HUN A;  3LI3 A;  5H47 A;  1S0J A;  1CRU A;  4D8S A;  5B2C A;  4GZO A;  1C9U A;  4HIZ A;  1WCS A;  4XIL A;  2F29 A;  3KYA A;  2IAQ A;  3D11 A;  1Q7F A;  1ING A;  4MC7 A;  4YZ5 A;  4FPE A;  2W20 A;  3Q6T A;  1A4G A;  2G8S A;  3CKZ A;  2HU0 A;  3TI4 A;  2IAW A;  1IVF A;  1MS5 A;  1F8D A;  4B7J A;  4XJZ A;  4IFJ A;  4XMB A;  4Q1U A;  1MS1 A;  1MS3 A;  2VK7 A;  2VSM A;  4XHB A;  4NC5 A;  4AHA A;  2AGS A;  3WWA A;  2W8B A;  4FJ6 A;  4X49 A;  5CGJ A;  4XJ9 A;  3TI6 A;  1INX A;  1NMA N;  4FQ4 A;  4N1B A;  2YA8 A;  5FNS A;  1IVE A;  1H6L A;  4X4A A;  2GVV A;  1IJQ A;  3NO0 A;  4CH9 A;  2IAR A;  2HTU A;  4GZW A;  1INV A;  2YA7 A;  4XJR A;  2DSO A;  4FPL A;  1CVM A;  2OJH A;  1W1X A;  1NMB N;  3HRP A;  2IAT A;  1EUT A;  2H2U A;  4A0P A;  3U0S A;  4WA5 A;  4MJU A;  4SLI A;  3V65 B;  1V3E A;  4L7D A;  4XHX A;  4HW6 A;  3SOV A;  4YW3 A;  3H73 A;  4MZE A;  1VCJ A;  1Z4X A;  2F12 A;  2FPB A;  3O9J A;  4J9T A;  1K32 A;  2HTV A;  1E1A A;  1Z50 A;  3SOQ A;  3AMR A;  1N1T A;  2GVX A;  3G4H A;  1NCC N;  2FP8 A;  3CL2 A;  5EO7 A;  3VNH A;  5GX5 A;  1W0O A;  4CPY A;  1EUU A;  3V1S A;  3K36 A;  3E5Z A;  4QN6 A;  4FP3 A;  1F8C A;  1A14 N;  2X9M A;  2ZW9 A;  1L7G A;  4MWW A;  4XJ8 A;  2IVZ A;  4WA3 A;  1S0I A;  1CRZ A;  3VNG A;  2VPJ A;  1MWE A;  1INH A;  6NN9 A;  1F8E A;  1XOE A;  3K37 A;  2SIM A;  1V3C A;  3T1E A;  4D52 B;  2HTR A;  2ZB6 A;  3SOB B;  4L7C A;  2QWH A;  3LI4 A;  4KS5 A;  1RWI A;  3H72 A;  4H52 A;  3TI3 A;  4M3M A;  4H53 A;  1W20 A;  2POO A;  2FHR A;  2QE8 A;  1NSD A;  4XOG A;  3O4P A;  1DIL A;  2CML A;  2C4L A;  4GN8 A;  2F26 A;  4KS3 A;  4MWX A;  1S18 A;  4X6K A;  1MZ6 A;  1V3D A;  2YDT A;  4AGT A;  4IMB A;  4K1J A;  1V0Z A;  4FPC A;  4FPG A;  3SLI A;  4GZQ A;  1MS8 A;  4HZZ A;  1V04 A;  3UC1 A;  4HZY A;  5FNT A;  2JKB A;  1Z4Y A;  4O5T A;  2HT8 A;  3K38 A;  3K39 A;  4FPF A;  4MWJ A;  2XCY A;  4GEZ A;  1IVG A;  2DYH A;  5FNQ A;  2QWI A;  2HT7 A;  4GN9 A;  4ZGC A;  4K1H A;  4R40 A;  1IVD A;  2F25 A;  2VK6 A;  2IAU A;  2VSK A;  4B7Q A;  1MS9 A;  4GN7 A;  1N6E A;  1USR A;  1NNC A;  2QWB A;  4K1I A;  4WEF A;  3LI5 A;  3DR2 A;  4FPH A;  4UOU A;  4GB1 A;  3S2K A;  4XMI A;  1POO A;  4MZA A;  4D52 A;  1N1S A;  3CYE A;  4FPY A;  1IUC A;  5FNR A;  1MS0 A;  3AMS A;  1NSC A;  3HLH A;  2HTQ A;  2FPC A;  4HZW A;  5D9D A;  3OPZ A;  4M4V A;  1VCU A;  2F13 A;  2AH2 A;  2Z32 A;  4Q6K A;  4YZ1 A;  2VW0 A;  3A71 A;  4X47 A;  4NCS A;  4FZH A;  4IFL X;  1SLI A;  4GNB A;  5D9B A;  1N6F A;  3O9K A;  1E8U A;  2ZZK A;  4QN7 A;  4HHQ A;  2F27 A;  4UF7 A;  4D4U A;  1N7D A;  5EX7 A;  1INY A;  2XZI A;  2H2N A;  3GVJ A;  5FZN A;  1W0P A;  1NMC A;  3V64 C;  4B7R A;  1L7F A;  3G4E A;  2VWD A;  3NN9 A;  4K1K A;  4NN9 A;  1DIM A;  4YZ4 A;  2XN4 A;  3WN7 A;  4B7M A;  2BF6 A;  4WA4 A;  1SUU A;  3K3A A;  4GZT A;  2F10 A;  4AH4 A;  2ISM A;  4DG6 A;  1SLL A;  3L6V A;  4GDJ A;  4DGR A;  2YA4 A;  5GTQ A;  2VW1 A;  1CQ1 A;  1INW A;  5HUK A;  1U6D X;  1INF A;  2RKC A;  4HHO A;  1V0E A;  3IAX A;  4YW5 A;  4HZV A;  1SNT A;  2F11 A;  1OFZ A;  4BBW A;  3ADE A;  4KS4 A;  1NPE A;  1V0F A;  4D52 C;  3FVZ A;  5D9C A;  4YZ3 A;  4GDI A;  4AGI A;  3INB A;  3I1C A;  4XJW A;  4HZX A;  2C4A A;  3DAS A;  3BYC A;  3SRG A;  2F24 A;  2V91 A;  2IAS A;  4XJQ A;  4MJV A;  4ZY3 A;  1B9S A;  1WP5 A;  5M1Z A;  3Q6P A;  2F28 A;  4KS2 A;  1A4Q A;  3TC9 A;  1MR5 A;  4XIO A;  3ZGC A;  4ZLR A;  5FNU A;  1E8T A;  4K3Y A;  4YW1 A;  4L7B A;  5B2D A;  3S8Z A;  4YY8 A;  2QWD A;  2IAV A;  4GZX A;  4QN5 A;  2SLI A;  7NN9 A;  1MZ5 A;  1EUR A;  4XMA A;  1L7H A;  3SRE A;  1X2R A;  3Q6K A;  2QWJ A;  3A9H A;  3A72 A;  5GX4 A;  5HX0 A;  2W38 A;  3D12 A;  5HUM A;  4KS1 A;  3ALW A;  2VW2 A;  4QN3 A;  1NCA N;  1SO7 A;  2BAT A;  2ZWA A;  4GNA A;  2QWG A;  1EUS A;  2YA5 A;  3H71 A;  2W5N A;  2YA6 A;  3S94 A;  2W5O A;  3CL0 A;  1B9V A;  3TI8 A;  1S1D A;  5F72 C;  2FP9 A;  1C5K A;  1MS4 A;  4MWY A;  2DG1 A;  2IAO A;  3NSS A;  4CPM A;  1N1Y A;  3II7 A;  1NNA A;  1PJX A;  5NN9 A;  4QNP A;  2XZK A;  3WW9 A;  4MWR A;  5HUG A;  2GHS A;  4CPL A;  2F0Z A;  2WOZ A;  4JML A;  3BEQ A;  2GVW A;  4FOW A;  1USX A;  2QWA A;  2AEP A;  3FW0 A;  4FPO B;  4PWZ A;  4ASC A;  1XOG A;  2HTW A;  2VK5 A;  3B69 A;  4FOQ A;  3HLI A;  4WEG A;  1BJI A;  4XJA A;  4IFN X;  2FLU X;  4I00 A;  3JU4 A;  4GZP A;  1NSB A;  3H6J A;  5FWW A;  4JF7 A;  2VVZ A;  4XIK A;  1X2J A;  3SAL A;  4XJU A;  4FOY A;  4XYX A;  4CHB A;  3TIC A;  2SIL A;  3TIB A;  5FZJ A;  4B7N A;  4CPO A;  1IVC A;  4M4U A;  4MWL A;  1IVB A;  4IYG A;  3TIA A;  1QBI A;  1NCD N;  4G3N A;  4C1Y B;  1W8N A;  4MX0 A;  4FVK A;  4GNC A;  1W8O A;  2P4O A;  2A75 A;  2GVU A;  1F8B A;  2YDP A;  4FPK A;  5GX3 A;  1Z4Z A;  1QLG A;  1V2I A;  2XZJ A;  3B7E A;  4IQK A;  4MWU A;  3ZGD A; 
#chains in the Genus database with same CATH homology
 2BZD A;  5JYY A;  3GVL A;  1Z4W A;  4M4N A;  1Z4V A;  3W09 A;  4FP2 A;  2QWF A;  4FOV A;  3SAN A;  2BER A;  1NCB N;  4GJT A;  1KIT A;  3SIL A;  3TI5 A;  4YW2 A;  4XE9 A;  4MWQ A;  2ZB5 A;  4CPZ A;  4YW4 A;  4QN4 A;  1V3B A;  1W21 A;  2B8H A;  4FPJ A;  5F9T A;  2QWK A;  1WCQ A;  3PJQ A;  1NN2 A;  2QWC A;  2AEQ A;  2HU4 A;  1B9T A;  4GZS A;  1N1V A;  3GVK A;  1E8V A;  2HTY A;  4MWV A;  3ALX A;  4YZ2 A;  4CPN A;  2QWE A;  1NNB A;  2HT5 A;  5HUN A;  1S0J A;  4D8S A;  5B2C A;  4GZO A;  4HIZ A;  1WCS A;  4XIL A;  2F29 A;  3D11 A;  1ING A;  4MC7 A;  4YZ5 A;  4FPE A;  2W20 A;  1A4G A;  3CKZ A;  2HU0 A;  3TI4 A;  1IVF A;  1MS5 A;  1F8D A;  4B7J A;  4XJZ A;  1MS1 A;  1MS3 A;  2VK7 A;  2VSM A;  4XHB A;  4NC5 A;  2AGS A;  4FJ6 A;  4X49 A;  4XJ9 A;  3TI6 A;  1INX A;  1NMA N;  4FQ4 A;  2YA8 A;  1IVE A;  4X4A A;  2HTU A;  4GZW A;  1INV A;  2YA7 A;  4XJR A;  4FPL A;  1W1X A;  1NMB N;  1EUT A;  2H2U A;  4WA5 A;  4MJU A;  4SLI A;  1V3E A;  4XHX A;  4YW3 A;  3H73 A;  4MZE A;  1VCJ A;  1Z4X A;  2F12 A;  3O9J A;  4J9T A;  2HTV A;  1Z50 A;  1N1T A;  1NCC N;  3CL2 A;  1W0O A;  4CPY A;  1EUU A;  3K36 A;  4QN6 A;  4FP3 A;  1F8C A;  1A14 N;  2X9M A;  1L7G A;  4MWW A;  4XJ8 A;  4WA3 A;  1S0I A;  1MWE A;  1INH A;  6NN9 A;  1F8E A;  1XOE A;  3K37 A;  2SIM A;  1V3C A;  3T1E A;  2HTR A;  2ZB6 A;  2QWH A;  4KS5 A;  3H72 A;  4H52 A;  3TI3 A;  4M3M A;  4H53 A;  1W20 A;  2FHR A;  1NSD A;  4XOG A;  1DIL A;  2CML A;  2C4L A;  2F26 A;  4KS3 A;  4MWX A;  1S18 A;  4X6K A;  1MZ6 A;  1V3D A;  2YDT A;  4K1J A;  1V0Z A;  4FPC A;  4FPG A;  3SLI A;  4GZQ A;  1MS8 A;  4HZZ A;  4HZY A;  2JKB A;  1Z4Y A;  2HT8 A;  3K38 A;  3K39 A;  4FPF A;  4MWJ A;  2XCY A;  4GEZ A;  1IVG A;  2QWI A;  2HT7 A;  4K1H A;  1IVD A;  2F25 A;  2VK6 A;  2VSK A;  4B7Q A;  1MS9 A;  1USR A;  1NNC A;  2QWB A;  4K1I A;  4WEF A;  4FPH A;  4GB1 A;  4XMI A;  4MZA A;  1N1S A;  3CYE A;  4FPY A;  1MS0 A;  1NSC A;  2HTQ A;  4HZW A;  3OPZ A;  4M4V A;  1VCU A;  2F13 A;  2AH2 A;  4Q6K A;  4YZ1 A;  2VW0 A;  3A71 A;  4X47 A;  4NCS A;  4FZH A;  1SLI A;  3O9K A;  1E8U A;  4QN7 A;  2F27 A;  4UF7 A;  1INY A;  2XZI A;  2H2N A;  3GVJ A;  1W0P A;  1NMC A;  4B7R A;  1L7F A;  2VWD A;  3NN9 A;  4K1K A;  4NN9 A;  1DIM A;  4YZ4 A;  4B7M A;  2BF6 A;  4WA4 A;  3K3A A;  4GZT A;  2F10 A;  1SLL A;  4GDJ A;  4DGR A;  2YA4 A;  2VW1 A;  1INW A;  5HUK A;  1INF A;  2RKC A;  1V0E A;  4YW5 A;  4HZV A;  1SNT A;  2F11 A;  4BBW A;  4KS4 A;  1V0F A;  4YZ3 A;  4GDI A;  3INB A;  4XJW A;  4HZX A;  2C4A A;  2F24 A;  4XJQ A;  4MJV A;  1B9S A;  5M1Z A;  2F28 A;  4KS2 A;  1A4Q A;  1MR5 A;  4XIO A;  1E8T A;  4K3Y A;  4YW1 A;  5B2D A;  2QWD A;  4GZX A;  4QN5 A;  2SLI A;  7NN9 A;  1MZ5 A;  1EUR A;  4XMA A;  1L7H A;  2QWJ A;  3A72 A;  5HX0 A;  2W38 A;  3D12 A;  5HUM A;  4KS1 A;  3ALW A;  2VW2 A;  4QN3 A;  1NCA N;  1SO7 A;  2BAT A;  2QWG A;  1EUS A;  2YA5 A;  3H71 A;  2W5N A;  2YA6 A;  2W5O A;  3CL0 A;  1B9V A;  3TI8 A;  1S1D A;  1MS4 A;  4MWY A;  3NSS A;  4CPM A;  1N1Y A;  1NNA A;  5NN9 A;  4QNP A;  2XZK A;  4MWR A;  5HUG A;  4CPL A;  2F0Z A;  3BEQ A;  4FOW A;  1USX A;  2QWA A;  2AEP A;  4FPO B;  1XOG A;  2HTW A;  2VK5 A;  3B69 A;  4FOQ A;  4WEG A;  4XJA A;  1BJI A;  4I00 A;  3JU4 A;  4GZP A;  1NSB A;  3H6J A;  4JF7 A;  2VVZ A;  4XIK A;  3SAL A;  4XJU A;  4FOY A;  4XYX A;  3TIC A;  2SIL A;  3TIB A;  4B7N A;  4CPO A;  1IVC A;  4M4U A;  4MWL A;  1IVB A;  3TIA A;  1NCD N;  1W8N A;  4MX0 A;  4FVK A;  1W8O A;  2A75 A;  1F8B A;  2YDP A;  4FPK A;  1Z4Z A;  1V2I A;  2XZJ A;  3B7E A;  4MWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...