4CHBA

Crystal structure of the human klhl2 kelch domain in complex with a wnk4 peptide
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
286
structure length
286
Chain Sequence
PKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Biochemical Characterisation of the Klhl3-Wnk Kinase Interaction Important in Blood Pressure Regulation.
pubmed doi rcsb
molecule keywords KELCH-LIKE PROTEIN 2
molecule tags Signaling protein/transferase
source organism Homo sapiens
total genus 66
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01344 Kelch_1 Kelch motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.80 Mainly Beta 6 Propeller Neuraminidase Kelch-type beta propeller 4chbA00
4IFJA 4ZY3A 5CGJA 5FNRA 1X2JA 4XMBA 4CHBA 3VNHA 3WDZA 4ZGCA 5FNTA 4L7DA 3ADEA 4IQKA 2DYHA 3WN7A 1X2RA 4ASCA 1ZGKA 5FZJA 4N1BA 2ZWAA 4IFLX 2Z32A 2VPJA 4L7BA 5FZNA 2ZW9A 4L7CA 2ZZKA 3II7A 3ZGCA 5FNUA 2WOZA 1U6DX 4YY8A 5F72C 4CH9A 3VNGA 2FLUX 4IFNX 5FNSA 2XN4A 4IN4A 5FNQA 3ZGDA
chains in the Genus database with same CATH superfamily
1C9UA 1MZ5A 2SIMA 3I1CA 4CPOA 2W20A 4IMBA 4XMBA 2W5OA 3VNHA 3D11A 4AH4A 2QWDA 4FOVA 1IUBA 2HTRA 1DIMA 4N1BA 3BEQA 2ZWAA 1NNCA 3SANA 1MS4A 2F11A 1NMAN 4L7CA 3V64C 1BJIA 4CPMA 1VCJA 3SILA 4YZ1A 4GZTA 5B2DA 2VAQA 1ZI0A 1MS1A 4NCSA 3GVKA 2QWBA 4FPFA 4ZLRA 5JYYA 2HTVA 1EUUA 1Z4VA 2VK6A 5GX1A 5HUMA 1MZ6A 4HZVA 4KS2A 2POOA 2OJHA 4NN9A 1E8UA 1NSBA 4MZAA 4X6KA 1S1DA 1N7DA 4B7QA 1PJXA 3H72A 3O9JA 2IASA 1Q7FA 2YDTA 2IAWA 4MWXA 4MWQA 5HX0A 3O9KA 1F8BA 3E5ZA 1N1VA 1NPEA 4XOGA 1IUCA 4GZQA 2HT7A 1W20A 3K3AA 1OFZA 1S0IA 3DR2A 4FP2A 2IAQA 3TI5A 2F12A 4QN3A 5FNUA 5F72C 4FPKA 1INGA 1IVGA 2FP9A 3SOQA 5D9DA 4Q1UA 4XJUA 1Z4YA 2HQSA 1MS8A 4WEGA 4FQ4A 1MS9A 5FNQA 4HW6A 2HTQA 3S8VA 4XIOA 6NN9A 4GN8A 2FHRA 4UF7A 1S0JA 4YZ3A 2HTYA 4K1JA 1X2RA 3NO0A 1F8EA 4D52A 2VVZA 3II7A 4FPOB 4CPZA 4CSDA 1W0OA 2F25A 2VWDA 1IVDA 2GVUA 1WCSA 3G4HA 2W8BA 4XHXA 3D12A 4WA3A 4GZOA 4IYGA 4M4NA 3AMRA 1Z4XA 2AGSA 4YW2A 1E8TA 3A9HA 2DG0A 4FPJA 1B9VA 2QWFA 1V3BA 1INXA 1IVFA 4YW5A 5GX3A 1V3CA 4KS4A 4CPYA 1W0PA 2IARA 3A72A 5HUKA 2QWHA 3H6JA 1A4QA 1N1YA 2H2NA 4FPHA 4HHOA 2ZZKA 1NCAN 4XIKA 4B7NA 2QWGA 1B9TA 1S18A 3VNGA 1NSCA 3HLIA 4IFNX 2HTUA 3LI3A 3TI8A 3TI3A 4ZY3A 4GEZA 2DG1A 1SO7A 1DILA 1W8NA 2P4OA 1KITA 1SLIA 4FPEA 2XZIA 2IAOA 3TIAA 4QN7A 2QWJA 1A4GA 2HU0A 2Z32A 2QWCA 3B7EA 2FP8A 3CYEA 4M4VA 4GZXA 2WOZA 3FVZA 4X47A 4HZYA 1MWEA 1NSDA 3BYCA 1SUUA 1QLGA 5CGJA 3SOBB 1USXA 3T1EA 3Q6KA 2FPBA 1EUSA 4QN6A 4O5TA 3WDZA 1N1TA 4O5SA 3K37A 4HHQA 4XJRA 4HZXA 3A9GA 4GN7A 4HIZA 5EO8A 2RKCA 4SLIA 2AEPA 5FWWA 2VK7A 2F24A 4MJUA 1RWIA 1L7HA 3V65B 1H6LA 1L7GA 4I00A 3L6VA 4B7JA 1INWA 2XZKA 5EX7A 4UOUA 1IJQA 5HUGA 1IVCA 2VW2A 2H2UA 4MJVA 2HT5A 2FPCA 1MS3A 4YZ4A 4Q6KA 1MR5A 5GX4A 4AGTA 3GVLA 1XOGA 3NSSA 1NNBA 3ALWA 1V0FA 4GDIA 3TICA 2F29A 4CPLA 3WW9A 4C1YB 1N1SA 2XN4A 3SALA 4B7MA 2F13A 4D52B 4CPNA 3ZGDA 4YZ5A 3V1SA 1EURA 4XJ8A 2BF6A 2QWKA 5FNRA 2W8BB 3UC1A 1V0EA 2XCYA 3H73A 2C4LA 3ADEA 4D4UA 2SLIA 2F27A 1F8DA 4IFLX 4C1YA 2G8SA 2YA5A 3DASA 3IAXA 4M4UA 2GVXA 2GVWA 3Q6PA 3G4EA 1EUTA 3SRGA 3ALXA 1VCUA 5B2CA 1POOA 1E8VA 4YZ2A 4X4AA 5EO7A 1L7FA 3LI5A 4K1HA 4GNCA 1INVA 1V3DA 3S2KA 1ZGKA 1Z4ZA 4XJAA 2HT8A 2YA7A 3CL2A 1WCQA 4MWWA 2IAUA 1SLLA 3LI4A 4YY8A 4CH9A 4FOWA 2SILA 2VSKA 2ZB6A 5HUNA 1IVBA 2IAPA 1CRUA 4GZSA 4QN5A 4CHBA 3GVJA 3TI4A 5F9TA 1MS0A 4NC5A 2V91A 4IQKA 3SLIA 3HLHA 4MC7A 1SNTA 5FZJA 4YW4A 2YA6A 5FZNA 3SOVA 4YW1A 2ZB5A 3HRPA 4M3MA 1E1AA 4K1IA 1K32A 1N6EA 3CKZA 2HU4A 1CVMA 2FLUX 2BERA 1USRA 4R40A 3W09A 4AHAA 5D9CA 2JKBA 3WWAA 1X2JA 4GNBA 4GJTA 1INFA 4MWRA 4MWJA 4XJ9A 2DYHA 4FVKA 4XJQA 4YW3A 4WA4A 3JU4A 2GHSA 4FPGA 5GX2A 4MX0A 4MWLA 3TI6A 3K38A 7NN9A 2BATA 3NN9A 4PWZA 4FJ6A 4XMAA 1INYA 4FZHA 4JMLA 1C5KA 1WP5A 3O4PA 1QBIA 2GVVA 5H47A 1V2IA 1Z4WA 4XYXA 1W1XA 4GZWA 3TIBA 1XOEA 3WN7A 4GDJA 2ZW9A 4D8SA 1INHA 4KS3A 4GB1A 4WA5A 4X49A 2YDPA 2DSOA 5FNSA 2QE8A 2ISMA 3PJQA 4IFJA 2A75A 1N6DA 2VW1A 3S94A 4FP3A 4ZGCA 5FNTA 2CMLA 4FOQA 4MWYA 3K39A 4H52A 4D52C 3OPZA 4ASCA 4FPYA 2VPJA 1NCDN 2QWIA 3AMSA 4MWUA 4QN4A 1Z50A 2W5NA 4K3YA 1W21A 3A71A 1U6DX 2QWAA 4GNAA 4XILA 5NN9A 4XHBA 2F0ZA 2AEQA 1V3EA 4MWVA 3U0SA 4XJWA 1IVEA 1RWLA 1N6FA 2F10A 2VW0A 2IAXA 3B69A 2XZJA 4WEFA 4AGIA 4B7RA 4DGRA 4A0PA 2VK5A 4L7DA 3TC9A 1NN2A 2AH2A 4K1KA 2QWEA 2HTWA 3KGGA 1B9SA 1A14N 2F28A 3KYAA 1NCBN 4DG6A 1NMCA 2YA4A 4MZEA 4KS5A 3S8ZA 1F8CA 4J9TA 1CRZA 3P5BL 4HZZA 4HZWA 5GX5A 2IATA 3INBA 1V04A 4IN4A 2YA8A 2BZDA 2IVZA 2F26A 4XE9A 4KS1A 4XMIA 1NNAA 4GZPA 3FW0A 2B8HA 1V0ZA 1NMBN 4FPCA 5M1ZA 4BBWA 3SREA 3K36A 2C4AA 1W8OA 3Q6TA 1CQ1A 1MS5A 4JF7A 2VSMA 2IAVA 2X9MA 4L7BA 5D9BA 1NCCN 4GN9A 4QNPA 5GTQA 3ZGCA 4FPLA 3H71A 4XJZA 4G3NA 4H53A 4FOYA 3CL0A 2W38A
chains in the Genus database with same CATH topology
4IFJA 4ZY3A 5CGJA 5FNRA 1X2JA 4XMBA 4CHBA 3VNHA 3WDZA 4ZGCA 5FNTA 4L7DA 3ADEA 4IQKA 2DYHA 3WN7A 1X2RA 4ASCA 1ZGKA 5FZJA 4N1BA 2ZWAA 4IFLX 2Z32A 2VPJA 4L7BA 5FZNA 2ZW9A 4L7CA 2ZZKA 3II7A 3ZGCA 5FNUA 2WOZA 1U6DX 4YY8A 5F72C 4CH9A 3VNGA 2FLUX 4IFNX 5FNSA 2XN4A 4IN4A 5FNQA 3ZGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFJ A;  4ZY3 A;  5CGJ A;  5FNR A;  1X2J A;  4XMB A;  4CHB A;  3VNH A;  3WDZ A;  4ZGC A;  5FNT A;  4L7D A;  3ADE A;  4IQK A;  2DYH A;  3WN7 A;  1X2R A;  4ASC A;  1ZGK A;  5FZJ A;  4N1B A;  2ZWA A;  4IFL X;  2Z32 A;  2VPJ A;  4L7B A;  5FZN A;  2ZW9 A;  4L7C A;  2ZZK A;  3II7 A;  3ZGC A;  5FNU A;  2WOZ A;  1U6D X;  4YY8 A;  5F72 C;  4CH9 A;  3VNG A;  2FLU X;  4IFN X;  5FNS A;  2XN4 A;  4IN4 A;  5FNQ A;  3ZGD A; 
#chains in the Genus database with same CATH topology
 1C9U A;  1MZ5 A;  2SIM A;  3I1C A;  4CPO A;  2W20 A;  4IMB A;  4XMB A;  2W5O A;  3VNH A;  3D11 A;  4AH4 A;  2QWD A;  4FOV A;  1IUB A;  2HTR A;  1DIM A;  4N1B A;  3BEQ A;  2ZWA A;  1NNC A;  3SAN A;  1MS4 A;  2F11 A;  1NMA N;  4L7C A;  3V64 C;  1BJI A;  4CPM A;  1VCJ A;  3SIL A;  4YZ1 A;  4GZT A;  5B2D A;  2VAQ A;  1ZI0 A;  1MS1 A;  4NCS A;  3GVK A;  2QWB A;  4FPF A;  4ZLR A;  5JYY A;  2HTV A;  1EUU A;  1Z4V A;  2VK6 A;  5GX1 A;  5HUM A;  1MZ6 A;  4HZV A;  4KS2 A;  2POO A;  2OJH A;  4NN9 A;  1E8U A;  1NSB A;  4MZA A;  4X6K A;  1S1D A;  1N7D A;  4B7Q A;  1PJX A;  3H72 A;  3O9J A;  2IAS A;  1Q7F A;  2YDT A;  2IAW A;  4MWX A;  4MWQ A;  5HX0 A;  3O9K A;  1F8B A;  3E5Z A;  1N1V A;  1NPE A;  4XOG A;  1IUC A;  4GZQ A;  2HT7 A;  1W20 A;  3K3A A;  1OFZ A;  1S0I A;  3DR2 A;  4FP2 A;  2IAQ A;  3TI5 A;  2F12 A;  4QN3 A;  5FNU A;  5F72 C;  4FPK A;  1ING A;  1IVG A;  2FP9 A;  3SOQ A;  5D9D A;  4Q1U A;  4XJU A;  1Z4Y A;  2HQS A;  1MS8 A;  4WEG A;  4FQ4 A;  1MS9 A;  5FNQ A;  4HW6 A;  2HTQ A;  3S8V A;  4XIO A;  6NN9 A;  4GN8 A;  2FHR A;  4UF7 A;  1S0J A;  4YZ3 A;  2HTY A;  4K1J A;  1X2R A;  3NO0 A;  1F8E A;  4D52 A;  2VVZ A;  3II7 A;  4FPO B;  4CPZ A;  4CSD A;  1W0O A;  2F25 A;  2VWD A;  1IVD A;  2GVU A;  1WCS A;  3G4H A;  2W8B A;  4XHX A;  3D12 A;  4WA3 A;  4GZO A;  4IYG A;  4M4N A;  3AMR A;  1Z4X A;  2AGS A;  4YW2 A;  1E8T A;  3A9H A;  2DG0 A;  4FPJ A;  1B9V A;  2QWF A;  1V3B A;  1INX A;  1IVF A;  4YW5 A;  5GX3 A;  1V3C A;  4KS4 A;  4CPY A;  1W0P A;  2IAR A;  3A72 A;  5HUK A;  2QWH A;  3H6J A;  1A4Q A;  1N1Y A;  2H2N A;  4FPH A;  4HHO A;  2ZZK A;  1NCA N;  4XIK A;  4B7N A;  2QWG A;  1B9T A;  1S18 A;  3VNG A;  1NSC A;  3HLI A;  4IFN X;  2HTU A;  3LI3 A;  3TI8 A;  3TI3 A;  4ZY3 A;  4GEZ A;  2DG1 A;  1SO7 A;  1DIL A;  1W8N A;  2P4O A;  1KIT A;  1SLI A;  4FPE A;  2XZI A;  2IAO A;  3TIA A;  4QN7 A;  2QWJ A;  1A4G A;  2HU0 A;  2Z32 A;  2QWC A;  3B7E A;  2FP8 A;  3CYE A;  4M4V A;  4GZX A;  2WOZ A;  3FVZ A;  4X47 A;  4HZY A;  1MWE A;  1NSD A;  3BYC A;  1SUU A;  1QLG A;  5CGJ A;  3SOB B;  1USX A;  3T1E A;  3Q6K A;  2FPB A;  1EUS A;  4QN6 A;  4O5T A;  3WDZ A;  1N1T A;  4O5S A;  3K37 A;  4HHQ A;  4XJR A;  4HZX A;  3A9G A;  4GN7 A;  4HIZ A;  5EO8 A;  2RKC A;  4SLI A;  2AEP A;  5FWW A;  2VK7 A;  2F24 A;  4MJU A;  1RWI A;  1L7H A;  3V65 B;  1H6L A;  1L7G A;  4I00 A;  3L6V A;  4B7J A;  1INW A;  2XZK A;  5EX7 A;  4UOU A;  1IJQ A;  5HUG A;  1IVC A;  2VW2 A;  2H2U A;  4MJV A;  2HT5 A;  2FPC A;  1MS3 A;  4YZ4 A;  4Q6K A;  1MR5 A;  5GX4 A;  4AGT A;  3GVL A;  1XOG A;  3NSS A;  1NNB A;  3ALW A;  1V0F A;  4GDI A;  3TIC A;  2F29 A;  4CPL A;  3WW9 A;  4C1Y B;  1N1S A;  2XN4 A;  3SAL A;  4B7M A;  2F13 A;  4D52 B;  4CPN A;  3ZGD A;  4YZ5 A;  3V1S A;  1EUR A;  4XJ8 A;  2BF6 A;  2QWK A;  5FNR A;  2W8B B;  3UC1 A;  1V0E A;  2XCY A;  3H73 A;  2C4L A;  3ADE A;  4D4U A;  2SLI A;  2F27 A;  1F8D A;  4IFL X;  4C1Y A;  2G8S A;  2YA5 A;  3DAS A;  3IAX A;  4M4U A;  2GVX A;  2GVW A;  3Q6P A;  3G4E A;  1EUT A;  3SRG A;  3ALX A;  1VCU A;  5B2C A;  1POO A;  1E8V A;  4YZ2 A;  4X4A A;  5EO7 A;  1L7F A;  3LI5 A;  4K1H A;  4GNC A;  1INV A;  1V3D A;  3S2K A;  1ZGK A;  1Z4Z A;  4XJA A;  2HT8 A;  2YA7 A;  3CL2 A;  1WCQ A;  4MWW A;  2IAU A;  1SLL A;  3LI4 A;  4YY8 A;  4CH9 A;  4FOW A;  2SIL A;  2VSK A;  2ZB6 A;  5HUN A;  1IVB A;  2IAP A;  1CRU A;  4GZS A;  4QN5 A;  4CHB A;  3GVJ A;  3TI4 A;  5F9T A;  1MS0 A;  4NC5 A;  2V91 A;  4IQK A;  3SLI A;  3HLH A;  4MC7 A;  1SNT A;  5FZJ A;  4YW4 A;  2YA6 A;  5FZN A;  3SOV A;  4YW1 A;  2ZB5 A;  3HRP A;  4M3M A;  1E1A A;  4K1I A;  1K32 A;  1N6E A;  3CKZ A;  2HU4 A;  1CVM A;  2FLU X;  2BER A;  1USR A;  4R40 A;  3W09 A;  4AHA A;  5D9C A;  2JKB A;  3WWA A;  1X2J A;  4GNB A;  4GJT A;  1INF A;  4MWR A;  4MWJ A;  4XJ9 A;  2DYH A;  4FVK A;  4XJQ A;  4YW3 A;  4WA4 A;  3JU4 A;  2GHS A;  4FPG A;  5GX2 A;  4MX0 A;  4MWL A;  3TI6 A;  3K38 A;  7NN9 A;  2BAT A;  3NN9 A;  4PWZ A;  4FJ6 A;  4XMA A;  1INY A;  4FZH A;  4JML A;  1C5K A;  1WP5 A;  3O4P A;  1QBI A;  2GVV A;  5H47 A;  1V2I A;  1Z4W A;  4XYX A;  1W1X A;  4GZW A;  3TIB A;  1XOE A;  3WN7 A;  4GDJ A;  2ZW9 A;  4D8S A;  1INH A;  4KS3 A;  4GB1 A;  4WA5 A;  4X49 A;  2YDP A;  2DSO A;  5FNS A;  2QE8 A;  2ISM A;  3PJQ A;  4IFJ A;  2A75 A;  1N6D A;  2VW1 A;  3S94 A;  4FP3 A;  4ZGC A;  5FNT A;  2CML A;  4FOQ A;  4MWY A;  3K39 A;  4H52 A;  4D52 C;  3OPZ A;  4ASC A;  4FPY A;  2VPJ A;  1NCD N;  2QWI A;  3AMS A;  4MWU A;  4QN4 A;  1Z50 A;  2W5N A;  4K3Y A;  1W21 A;  3A71 A;  1U6D X;  2QWA A;  4GNA A;  4XIL A;  5NN9 A;  4XHB A;  2F0Z A;  2AEQ A;  1V3E A;  4MWV A;  3U0S A;  4XJW A;  1IVE A;  1RWL A;  1N6F A;  2F10 A;  2VW0 A;  2IAX A;  3B69 A;  2XZJ A;  4WEF A;  4AGI A;  4B7R A;  4DGR A;  4A0P A;  2VK5 A;  4L7D A;  3TC9 A;  1NN2 A;  2AH2 A;  4K1K A;  2QWE A;  2HTW A;  3KGG A;  1B9S A;  1A14 N;  2F28 A;  3KYA A;  1NCB N;  4DG6 A;  1NMC A;  2YA4 A;  4MZE A;  4KS5 A;  3S8Z A;  1F8C A;  4J9T A;  1CRZ A;  3P5B L;  4HZZ A;  4HZW A;  5GX5 A;  2IAT A;  3INB A;  1V04 A;  4IN4 A;  2YA8 A;  2BZD A;  2IVZ A;  2F26 A;  4XE9 A;  4KS1 A;  4XMI A;  1NNA A;  4GZP A;  3FW0 A;  2B8H A;  1V0Z A;  1NMB N;  4FPC A;  5M1Z A;  4BBW A;  3SRE A;  3K36 A;  2C4A A;  1W8O A;  3Q6T A;  1CQ1 A;  1MS5 A;  4JF7 A;  2VSM A;  2IAV A;  2X9M A;  4L7B A;  5D9B A;  1NCC N;  4GN9 A;  4QNP A;  5GTQ A;  3ZGC A;  4FPL A;  3H71 A;  4XJZ A;  4G3N A;  4H53 A;  4FOY A;  3CL0 A;  2W38 A; 
#chains in the Genus database with same CATH homology
 4IFJ A;  4ZY3 A;  5CGJ A;  5FNR A;  1X2J A;  4XMB A;  4CHB A;  3VNH A;  3WDZ A;  4ZGC A;  5FNT A;  4L7D A;  3ADE A;  4IQK A;  2DYH A;  3WN7 A;  1X2R A;  4ASC A;  1ZGK A;  5FZJ A;  4N1B A;  2ZWA A;  4IFL X;  2Z32 A;  2VPJ A;  4L7B A;  5FZN A;  2ZW9 A;  4L7C A;  2ZZK A;  3II7 A;  3ZGC A;  5FNU A;  2WOZ A;  1U6D X;  4YY8 A;  5F72 C;  4CH9 A;  3VNG A;  2FLU X;  4IFN X;  5FNS A;  2XN4 A;  4IN4 A;  5FNQ A;  3ZGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...