4D8SA

Influenza na in complex with antiviral compound
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
388
structure length
388
Chain Sequence
TYMNNTEAICDAKGFAPFSKDNGIRIGSRGHIFVIREPFVSCSPIECRTFFLTQGSLLNDKHSNGTVKDRSPFRTLMSVEVGQSPNVYQARFEAVAWSATACHDGKKWMTVGVTGPDSKAVAVIHYGGVPTDVVNSWAGDILRTQESSCTCIQGDCYWVMTDGPANRQAQYRIYKANQGRIIGQTDISFNGGHIEECSCYPNDGKVECVCRDNWTGTNRPVLVISPDLSYRVGYLCAGIPSDTPRGEDTQFTGSCTSPMGNQGYGVKGFGFRQGTDVWMGRTISRTSRSGFEILRIKNGWTQTSKEQIRKQVVVDNLNWSGYSGSFTLPVELSGKDCLVPCFWVEMIRGKPEEKTIWTSSSSIVMCGVDYEVADWSWHDGAILPFDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the interactions of unsaturated glucuronides with influenza virus sialidase.
pubmed doi rcsb
molecule keywords Neuraminidase
molecule tags Hydrolase
total genus 103
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 4d8sA00
4UF7A 1A14N 2RKCA 4FPYA 2XCYA 4FZHA 4XJZA 2QWFA 2F13A 2QWBA 3D11A 4KS1A 1MS0A 4MX0A 3TIBA 4FPLA 4MWJA 4XE9A 4GZQA 6NN9A 1B9VA 4JF7A 1E8TA 1MR5A 4MWLA 4X6KA 3CL0A 3SILA 2YA8A 1SLIA 4FPCA 2XZJA 4CPLA 2BATA 3D12A 1EUUA 1MZ6A 4FPJA 2F12A 1S0JA 1INGA 4HZVA 4D8SA 3K38A 4FPFA 4Q6KA 4CPOA 4FPGA 2HT5A 4GEZA 4XJ8A 2HTRA 1INYA 1N1VA 3GVLA 2VW1A 2VK7A 4MWVA 1NCBN 4GB1A 2W5NA 2VW2A 4K1HA 1SLLA 1NNAA 4K1JA 1IVEA 4FQ4A 1Z4VA 5NN9A 4QN5A 3B69A 2AEQA 1INHA 5B2DA 1F8EA 3H6JA 1W21A 1XOGA 1MWEA 4SLIA 4MWWA 4CPZA 4B7QA 4MJVA 4HZWA 3A71A 4HIZA 4KS4A 1INXA 1WCSA 4MC7A 3SALA 1IVGA 2VWDA 2XZIA 2X9MA 1B9SA 4HZZA 4YW1A 4XIKA 1L7GA 3BEQA 2C4AA 1IVBA 2XZKA 1DILA 1EUTA 4GZSA 3K39A 2F26A 2F0ZA 2A75A 4WA3A 4GZOA 3O9KA 2W20A 3GVJA 2QWJA 4XILA 3H73A 2YA5A 4QN7A 3GVKA 2HTUA 2HTWA 1MZ5A 2C4LA 2CMLA 1B9TA 4X47A 4HZYA 1Z4XA 2QWCA 4M4UA 1NSCA 4B7RA 4GJTA 4XJUA 1E8VA 2F25A 1MS1A 4FPKA 2YA7A 4WEGA 4XMIA 4MWQA 4BBWA 4GZPA 1V3EA 5B2CA 5HUNA 1KITA 2HU4A 5HX0A 3SLIA 4CPMA 1NSBA 1NCAN 4FP3A 4GZXA 4H52A 4KS3A 2BF6A 4NCSA 3OPZA 4MWXA 1USRA 4YW4A 3INBA 3TI4A 1L7HA 2YDPA 4YZ4A 2B8HA 4MWUA 1NNBA 1IVFA 1IVDA 3TI8A 1V3BA 4M4VA 4CPYA 3K36A 2JKBA 4XJ9A 4XJRA 5JYYA 2SLIA 1E8UA 2F27A 4B7MA 1DIMA 2F28A 4X49A 4NC5A 1EUSA 4KS2A 3TI3A 1NN2A 3JU4A 4QNPA 4GDJA 1W8OA 1V3CA 4FPOB 1W0PA 2F29A 4J9TA 4CPNA 2HTVA 2F24A 4B7JA 2AGSA 1NSDA 5M1ZA 4I00A 4FOWA 4DGRA 4YW3A 1EURA 4XJWA 2FHRA 1Z4ZA 1BJIA 3O9JA 2AH2A 1IVCA 1W0OA 4XOGA 2QWAA 3H72A 2VW0A 4FJ6A 4XHXA 4M4NA 4MZAA 5HUMA 3TI6A 1NMBN 1N1SA 1XOEA 2VK5A 1N1TA 1NCCN 4MWYA 4MJUA 4QN3A 1NMCA 3A72A 3ALWA 2YA4A 1F8CA 1Z4WA 1V0FA 3TICA 4B7NA 3ALXA 3NN9A 2VSMA 1MS4A 2HT8A 1F8DA 2ZB6A 3NSSA 2HTYA 2QWHA 3CKZA 4YZ2A 4MWRA 4XMAA 4FOVA 4XIOA 1NNCA 4YW5A 2QWEA 2QWIA 2SILA 3H71A 4GDIA 4YZ5A 1MS3A 4X4AA 2YA6A 3K3AA 1INFA 4FP2A 2HTQA 1Z50A 1W1XA 4K1KA 3PJQA 1NCDN 4FOQA 1MS5A 4QN4A 2BZDA 3K37A 1WCQA 5F9TA 4XYXA 4K1IA 2QWDA 2BERA 1S0IA 4XJAA 1V0EA 4FPEA 2YDTA 2F11A 4K3YA 4M3MA 4WEFA 4YW2A 1SO7A 1A4QA 2VSKA 3W09A 4WA5A 4QN6A 1V3DA 1W8NA 1INWA 4WA4A 5HUGA 4YZ1A 2HT7A 2F10A 2ZB5A 1VCJA 1USXA 4GZWA 2QWKA 4XHBA 4XJQA 4KS5A 1V0ZA 1SNTA 5HUKA 2QWGA 4NN9A 4FVKA 1Z4YA 1MS9A 1VCUA 4H53A 2VK6A 1N1YA 2W38A 3TI5A 4HZXA 7NN9A 1W20A 1A4GA 3TIAA 1L7FA 3SANA 2HU0A 2VVZA 4YZ3A 3B7EA 4FPHA 4FOYA 2W5OA 3CL2A 3T1EA 1NMAN 4MZEA 1V2IA 1F8BA 1INVA 3CYEA 4GZTA 1MS8A 2SIMA 2AEPA
chains in the Genus database with same CATH superfamily
4UF7A 1A14N 2RKCA 4FPYA 2XCYA 3ZGCA 3AMSA 4FZHA 5EX7A 4XJZA 2QWFA 4IQKA 2F13A 2QWBA 2P4OA 3D11A 4KS1A 1MS0A 4MX0A 3TIBA 3VNHA 4FPLA 1U6DX 4MWJA 3V65B 3FVZA 4GNAA 4DG6A 1NPEA 4XE9A 4GZQA 6NN9A 5EO7A 1B9VA 2DG1A 4JF7A 1N6EA 4IMBA 2W8BB 1E8TA 1MR5A 4MWLA 4X6KA 4L7BA 4ZGCA 3CL0A 3SILA 2GHSA 3S2KA 4HHOA 3A9GA 4JMLA 2YA8A 1SLIA 4FPCA 2XZJA 4CPLA 2BATA 3D12A 1QLGA 1EUUA 1WP5A 1MZ6A 4D4UA 4FPJA 2F12A 1S0JA 3WW9A 3V64C 1INGA 4HZVA 4D8SA 3K38A 4IFLX 4FPFA 4Q6KA 4CPOA 4FPGA 2HT5A 4GEZA 4XJ8A 3SOQA 2HTRA 1CRUA 1INYA 1N1VA 3GVLA 2VW1A 2VK7A 4MWVA 1NCBN 4GB1A 5FNSA 3LI3A 2W5NA 5D9DA 2VW2A 4K1HA 1SLLA 1NNAA 3WN7A 4K1JA 1IVEA 4FQ4A 1Z4VA 5NN9A 3DASA 2GVXA 4QN5A 3B69A 2AEQA 1INHA 2DYHA 3S94A 2IAVA 5B2DA 1F8EA 1PJXA 2POOA 3A9HA 3H6JA 4ZY3A 3FW0A 1W21A 1XOGA 1MWEA 4SLIA 4MWWA 4CPZA 4B7QA 5FWWA 4MJVA 3AMRA 4HZWA 5GX2A 3A71A 4HIZA 2IASA 3P5BL 1IUCA 4PWZA 5FZJA 2V91A 4D52B 1C5KA 4KS4A 1INXA 2FPBA 1WCSA 1ZI0A 3HRPA 4C1YB 4MC7A 3SALA 1IVGA 2VWDA 2XZIA 2X9MA 2IAXA 3DR2A 4IFNX 3ZGDA 1B9SA 4IN4A 4HZZA 4YW1A 2HQSA 4XIKA 1L7GA 3BEQA 2C4AA 1IVBA 2XZKA 1POOA 1Q7FA 1DILA 1CQ1A 1EUTA 5FNTA 4GZSA 3K39A 2F26A 2F0ZA 5GX4A 2A75A 4WA3A 4GZOA 3O9KA 4XMBA 2W20A 3GVJA 2QWJA 4XILA 3H73A 2YA5A 4QN7A 4YY8A 3GVKA 4GN8A 2HTUA 2HTWA 4O5TA 1MZ5A 2C4LA 2CMLA 1B9TA 4HW6A 4X47A 3S8VA 4HZYA 3VNGA 1Z4XA 3L6VA 2QWCA 4M4UA 1NSCA 4B7RA 4GJTA 4XJUA 4CH9A 1E8VA 2F25A 1MS1A 3BYCA 4FPKA 2YA7A 4WEGA 1IJQA 4XMIA 4MWQA 4BBWA 1S18A 3WWAA 4G3NA 2FLUX 4GZPA 2FPCA 4A0PA 1V3EA 5B2CA 5HUNA 1KITA 1N7DA 2HU4A 2FP9A 5FNRA 5HX0A 3SLIA 4CPMA 1N6FA 1NSBA 1NCAN 4FP3A 2H2UA 4GZXA 4H52A 4KS3A 4Q1UA 2IATA 2BF6A 4NCSA 3OPZA 4MWXA 3SRGA 1USRA 4YW4A 3INBA 3TI4A 1L7HA 2YDPA 4YZ4A 2B8HA 2WOZA 4MWUA 3II7A 1NNBA 1IVFA 1IVDA 3G4HA 3TI8A 4CSDA 1V3BA 4M4VA 1C9UA 3TC9A 4CPYA 3K36A 2JKBA 4XJ9A 1N6DA 1RWIA 3IAXA 4XJRA 2IARA 5JYYA 2SLIA 1E8UA 2IAPA 4ZLRA 2F27A 4B7MA 1DIMA 2F28A 4X49A 5GTQA 4NC5A 1EUSA 4KS2A 4O5SA 3TI3A 1NN2A 2XN4A 3JU4A 4QNPA 5FNQA 4GDJA 5GX5A 3SOBB 1W8OA 1V3CA 1X2RA 4FPOB 4L7CA 1W0PA 2FP8A 2F29A 4J9TA 5D9CA 3HLHA 4CPNA 1OFZA 4HHQA 2HTVA 2F24A 4B7JA 1X2JA 1NSDA 2AGSA 5M1ZA 4I00A 1E1AA 4FOWA 4DGRA 4YW3A 1EURA 4XJWA 2QE8A 2GVVA 2FHRA 1Z4ZA 4L7DA 1BJIA 3O9JA 2AH2A 3E5ZA 1IVCA 1W0OA 4XOGA 3WDZA 2QWAA 3KGGA 4R40A 3H72A 2VW0A 4FJ6A 5F72C 5CGJA 4XHXA 4M4NA 3S8ZA 5GX3A 2DG0A 4MZAA 5HUMA 3TI6A 1NMBN 1N1SA 1XOEA 1RWLA 1S1DA 2VK5A 1CRZA 1N1TA 1NCCN 4MJUA 4MWYA 4QN3A 1K32A 1NMCA 2VPJA 3A72A 3ALWA 4ASCA 2YA4A 1F8CA 1Z4WA 3Q6TA 1V0FA 3TICA 4B7NA 3ALXA 3NN9A 2VSMA 3SOVA 1MS4A 2HT8A 2W8BA 1F8DA 2ZB6A 4D52C 3UC1A 3NSSA 2HTYA 2QWHA 3CKZA 4YZ2A 4MWRA 4XMAA 4FOVA 4AGIA 4XIOA 1NNCA 1CVMA 2IAQA 1SUUA 3KYAA 4YW5A 2QWEA 2QWIA 2SILA 5GX1A 3H71A 4IFJA 3NO0A 4GDIA 4YZ5A 1MS3A 1ZGKA 2YA6A 3Q6KA 1QBIA 4X4AA 3K3AA 2ZZKA 1INFA 4UOUA 2Z32A 2G8SA 3ADEA 4FP2A 2HTQA 3Q6PA 1Z50A 2H2NA 1W1XA 1V04A 4AH4A 4K1KA 3LI5A 3PJQA 3V1SA 5EO8A 1NCDN 4FOQA 3O4PA 1MS5A 2IAWA 3G4EA 4QN4A 2BZDA 3K37A 2IAOA 1WCQA 5F9TA 3HLIA 4XYXA 4K1IA 2ISMA 2QWDA 2BERA 1S0IA 4GNBA 4AGTA 3U0SA 2IVZA 2ZWAA 4XJAA 1V0EA 4FPEA 2YDTA 2F11A 4K3YA 4M3MA 4WEFA 4YW2A 1SO7A 1A4QA 3I1CA 2VSKA 3W09A 4N1BA 5FZNA 4WA5A 1IUBA 4QN6A 1V3DA 4GN9A 1W8NA 1INWA 4WA4A 5HUGA 4AHAA 2GVWA 4YZ1A 2HT7A 2VAQA 2F10A 1H6LA 2ZB5A 1VCJA 1USXA 4GZWA 2QWKA 4XHBA 4XJQA 4KS5A 2ZW9A 2OJHA 1V0ZA 1SNTA 4D52A 4IYGA 5HUKA 2QWGA 5FNUA 4NN9A 4FVKA 1Z4YA 1MS9A 1VCUA 4H53A 2VK6A 1N1YA 4C1YA 2W38A 3TI5A 3LI4A 4HZXA 5D9BA 7NN9A 1W20A 1A4GA 3TIAA 2GVUA 1L7FA 3SANA 2HU0A 2VVZA 4YZ3A 3SREA 3B7EA 4FPHA 4FOYA 4CHBA 2W5OA 3CL2A 3T1EA 1NMAN 2IAUA 2DSOA 4MZEA 1V2IA 4GN7A 1F8BA 4GNCA 5H47A 1INVA 3CYEA 4GZTA 1MS8A 2SIMA 2AEPA
chains in the Genus database with same CATH topology
4UF7A 1A14N 2RKCA 4FPYA 2XCYA 4FZHA 4XJZA 2QWFA 2F13A 2QWBA 3D11A 4KS1A 1MS0A 4MX0A 3TIBA 4FPLA 4MWJA 4XE9A 4GZQA 6NN9A 1B9VA 4JF7A 1E8TA 1MR5A 4MWLA 4X6KA 3CL0A 3SILA 2YA8A 1SLIA 4FPCA 2XZJA 4CPLA 2BATA 3D12A 1EUUA 1MZ6A 4FPJA 2F12A 1S0JA 1INGA 4HZVA 4D8SA 3K38A 4FPFA 4Q6KA 4CPOA 4FPGA 2HT5A 4GEZA 4XJ8A 2HTRA 1INYA 1N1VA 3GVLA 2VW1A 2VK7A 4MWVA 1NCBN 4GB1A 2W5NA 2VW2A 4K1HA 1SLLA 1NNAA 4K1JA 1IVEA 4FQ4A 1Z4VA 5NN9A 4QN5A 3B69A 2AEQA 1INHA 5B2DA 1F8EA 3H6JA 1W21A 1XOGA 1MWEA 4SLIA 4MWWA 4CPZA 4B7QA 4MJVA 4HZWA 3A71A 4HIZA 4KS4A 1INXA 1WCSA 4MC7A 3SALA 1IVGA 2VWDA 2XZIA 2X9MA 1B9SA 4HZZA 4YW1A 4XIKA 1L7GA 3BEQA 2C4AA 1IVBA 2XZKA 1DILA 1EUTA 4GZSA 3K39A 2F26A 2F0ZA 2A75A 4WA3A 4GZOA 3O9KA 2W20A 3GVJA 2QWJA 4XILA 3H73A 2YA5A 4QN7A 3GVKA 2HTUA 2HTWA 1MZ5A 2C4LA 2CMLA 1B9TA 4X47A 4HZYA 1Z4XA 2QWCA 4M4UA 1NSCA 4B7RA 4GJTA 4XJUA 1E8VA 2F25A 1MS1A 4FPKA 2YA7A 4WEGA 4XMIA 4MWQA 4BBWA 1S18A 4GZPA 1V3EA 5B2CA 5HUNA 1KITA 2HU4A 5HX0A 3SLIA 4CPMA 1NSBA 1NCAN 4FP3A 2H2UA 4GZXA 4H52A 4KS3A 2BF6A 4NCSA 3OPZA 4MWXA 1USRA 4YW4A 3INBA 3TI4A 1L7HA 2YDPA 4YZ4A 2B8HA 4MWUA 1NNBA 1IVFA 1IVDA 3TI8A 1V3BA 4M4VA 4CPYA 3K36A 2JKBA 4XJ9A 4XJRA 5JYYA 2SLIA 1E8UA 2F27A 4B7MA 1DIMA 2F28A 4X49A 4NC5A 1EUSA 4KS2A 3TI3A 1NN2A 3JU4A 4QNPA 4GDJA 1W8OA 1V3CA 4FPOB 1W0PA 2F29A 4J9TA 4CPNA 2HTVA 2F24A 4B7JA 2AGSA 1NSDA 5M1ZA 4I00A 4FOWA 4DGRA 4YW3A 1EURA 4XJWA 2FHRA 1Z4ZA 1BJIA 3O9JA 2AH2A 1IVCA 1W0OA 4XOGA 2QWAA 3H72A 2VW0A 4FJ6A 4XHXA 4M4NA 4MZAA 5HUMA 3TI6A 1NMBN 1N1SA 1XOEA 1S1DA 4QN3A 2VK5A 1N1TA 1NCCN 4MJUA 4MWYA 1NMCA 3A72A 3ALWA 2YA4A 1F8CA 1Z4WA 1V0FA 3TICA 4B7NA 3ALXA 3NN9A 2VSMA 1MS4A 2HT8A 1F8DA 2ZB6A 3NSSA 2HTYA 2QWHA 3CKZA 4YZ2A 4MWRA 4XMAA 4FOVA 4XIOA 1NNCA 4YW5A 2QWEA 2QWIA 2SILA 3H71A 4GDIA 4YZ5A 1MS3A 4X4AA 2YA6A 3K3AA 1INFA 4FP2A 2HTQA 1Z50A 2H2NA 1W1XA 4K1KA 3PJQA 1NCDN 4FOQA 1MS5A 4QN4A 2BZDA 3K37A 1WCQA 5F9TA 4XYXA 4K1IA 2QWDA 2BERA 1S0IA 4XJAA 1V0EA 4FPEA 2YDTA 2F11A 4K3YA 4M3MA 4WEFA 4YW2A 1SO7A 1A4QA 2VSKA 3W09A 4WA5A 4QN6A 1V3DA 1W8NA 1INWA 4WA4A 5HUGA 4YZ1A 2HT7A 2F10A 2ZB5A 1VCJA 1USXA 4GZWA 2QWKA 4XHBA 4XJQA 4KS5A 1V0ZA 1SNTA 5HUKA 2QWGA 4NN9A 4FVKA 1Z4YA 1MS9A 1VCUA 4H53A 2VK6A 1N1YA 2W38A 3TI5A 4HZXA 7NN9A 1W20A 1A4GA 3TIAA 1L7FA 3SANA 2HU0A 2VVZA 4YZ3A 3B7EA 4FPHA 4FOYA 2W5OA 3CL2A 3T1EA 1NMAN 4MZEA 1V2IA 1F8BA 1INVA 3CYEA 4GZTA 1MS8A 2SIMA 2AEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UF7 A;  1A14 N;  2RKC A;  4FPY A;  2XCY A;  4FZH A;  4XJZ A;  2QWF A;  2F13 A;  2QWB A;  3D11 A;  4KS1 A;  1MS0 A;  4MX0 A;  3TIB A;  4FPL A;  4MWJ A;  4XE9 A;  4GZQ A;  6NN9 A;  1B9V A;  4JF7 A;  1E8T A;  1MR5 A;  4MWL A;  4X6K A;  3CL0 A;  3SIL A;  2YA8 A;  1SLI A;  4FPC A;  2XZJ A;  4CPL A;  2BAT A;  3D12 A;  1EUU A;  1MZ6 A;  4FPJ A;  2F12 A;  1S0J A;  1ING A;  4HZV A;  4D8S A;  3K38 A;  4FPF A;  4Q6K A;  4CPO A;  4FPG A;  2HT5 A;  4GEZ A;  4XJ8 A;  2HTR A;  1INY A;  1N1V A;  3GVL A;  2VW1 A;  2VK7 A;  4MWV A;  1NCB N;  4GB1 A;  2W5N A;  2VW2 A;  4K1H A;  1SLL A;  1NNA A;  4K1J A;  1IVE A;  4FQ4 A;  1Z4V A;  5NN9 A;  4QN5 A;  3B69 A;  2AEQ A;  1INH A;  5B2D A;  1F8E A;  3H6J A;  1W21 A;  1XOG A;  1MWE A;  4SLI A;  4MWW A;  4CPZ A;  4B7Q A;  4MJV A;  4HZW A;  3A71 A;  4HIZ A;  4KS4 A;  1INX A;  1WCS A;  4MC7 A;  3SAL A;  1IVG A;  2VWD A;  2XZI A;  2X9M A;  1B9S A;  4HZZ A;  4YW1 A;  4XIK A;  1L7G A;  3BEQ A;  2C4A A;  1IVB A;  2XZK A;  1DIL A;  1EUT A;  4GZS A;  3K39 A;  2F26 A;  2F0Z A;  2A75 A;  4WA3 A;  4GZO A;  3O9K A;  2W20 A;  3GVJ A;  2QWJ A;  4XIL A;  3H73 A;  2YA5 A;  4QN7 A;  3GVK A;  2HTU A;  2HTW A;  1MZ5 A;  2C4L A;  2CML A;  1B9T A;  4X47 A;  4HZY A;  1Z4X A;  2QWC A;  4M4U A;  1NSC A;  4B7R A;  4GJT A;  4XJU A;  1E8V A;  2F25 A;  1MS1 A;  4FPK A;  2YA7 A;  4WEG A;  4XMI A;  4MWQ A;  4BBW A;  4GZP A;  1V3E A;  5B2C A;  5HUN A;  1KIT A;  2HU4 A;  5HX0 A;  3SLI A;  4CPM A;  1NSB A;  1NCA N;  4FP3 A;  4GZX A;  4H52 A;  4KS3 A;  2BF6 A;  4NCS A;  3OPZ A;  4MWX A;  1USR A;  4YW4 A;  3INB A;  3TI4 A;  1L7H A;  2YDP A;  4YZ4 A;  2B8H A;  4MWU A;  1NNB A;  1IVF A;  1IVD A;  3TI8 A;  1V3B A;  4M4V A;  4CPY A;  3K36 A;  2JKB A;  4XJ9 A;  4XJR A;  5JYY A;  2SLI A;  1E8U A;  2F27 A;  4B7M A;  1DIM A;  2F28 A;  4X49 A;  4NC5 A;  1EUS A;  4KS2 A;  3TI3 A;  1NN2 A;  3JU4 A;  4QNP A;  4GDJ A;  1W8O A;  1V3C A;  4FPO B;  1W0P A;  2F29 A;  4J9T A;  4CPN A;  2HTV A;  2F24 A;  4B7J A;  2AGS A;  1NSD A;  5M1Z A;  4I00 A;  4FOW A;  4DGR A;  4YW3 A;  1EUR A;  4XJW A;  2FHR A;  1Z4Z A;  1BJI A;  3O9J A;  2AH2 A;  1IVC A;  1W0O A;  4XOG A;  2QWA A;  3H72 A;  2VW0 A;  4FJ6 A;  4XHX A;  4M4N A;  4MZA A;  5HUM A;  3TI6 A;  1NMB N;  1N1S A;  1XOE A;  2VK5 A;  1N1T A;  1NCC N;  4MWY A;  4MJU A;  4QN3 A;  1NMC A;  3A72 A;  3ALW A;  2YA4 A;  1F8C A;  1Z4W A;  1V0F A;  3TIC A;  4B7N A;  3ALX A;  3NN9 A;  2VSM A;  1MS4 A;  2HT8 A;  1F8D A;  2ZB6 A;  3NSS A;  2HTY A;  2QWH A;  3CKZ A;  4YZ2 A;  4MWR A;  4XMA A;  4FOV A;  4XIO A;  1NNC A;  4YW5 A;  2QWE A;  2QWI A;  2SIL A;  3H71 A;  4GDI A;  4YZ5 A;  1MS3 A;  4X4A A;  2YA6 A;  3K3A A;  1INF A;  4FP2 A;  2HTQ A;  1Z50 A;  1W1X A;  4K1K A;  3PJQ A;  1NCD N;  4FOQ A;  1MS5 A;  4QN4 A;  2BZD A;  3K37 A;  1WCQ A;  5F9T A;  4XYX A;  4K1I A;  2QWD A;  2BER A;  1S0I A;  4XJA A;  1V0E A;  4FPE A;  2YDT A;  2F11 A;  4K3Y A;  4M3M A;  4WEF A;  4YW2 A;  1SO7 A;  1A4Q A;  2VSK A;  3W09 A;  4WA5 A;  4QN6 A;  1V3D A;  1W8N A;  1INW A;  4WA4 A;  5HUG A;  4YZ1 A;  2HT7 A;  2F10 A;  2ZB5 A;  1VCJ A;  1USX A;  4GZW A;  2QWK A;  4XHB A;  4XJQ A;  4KS5 A;  1V0Z A;  1SNT A;  5HUK A;  2QWG A;  4NN9 A;  4FVK A;  1Z4Y A;  1MS9 A;  1VCU A;  4H53 A;  2VK6 A;  1N1Y A;  2W38 A;  3TI5 A;  4HZX A;  7NN9 A;  1W20 A;  1A4G A;  3TIA A;  1L7F A;  3SAN A;  2HU0 A;  2VVZ A;  4YZ3 A;  3B7E A;  4FPH A;  4FOY A;  2W5O A;  3CL2 A;  3T1E A;  1NMA N;  4MZE A;  1V2I A;  1F8B A;  1INV A;  3CYE A;  4GZT A;  1MS8 A;  2SIM A;  2AEP A; 
#chains in the Genus database with same CATH topology
 4UF7 A;  1A14 N;  2RKC A;  4FPY A;  2XCY A;  3ZGC A;  3AMS A;  4FZH A;  5EX7 A;  4XJZ A;  2QWF A;  4IQK A;  2F13 A;  2QWB A;  2P4O A;  3D11 A;  4KS1 A;  1MS0 A;  4MX0 A;  3TIB A;  3VNH A;  4FPL A;  1U6D X;  4MWJ A;  3V65 B;  3FVZ A;  4GNA A;  4DG6 A;  1NPE A;  4XE9 A;  4GZQ A;  6NN9 A;  5EO7 A;  1B9V A;  2DG1 A;  4JF7 A;  1N6E A;  4IMB A;  2W8B B;  1E8T A;  1MR5 A;  4MWL A;  4X6K A;  4L7B A;  4ZGC A;  3CL0 A;  3SIL A;  2GHS A;  3S2K A;  4HHO A;  3A9G A;  4JML A;  2YA8 A;  1SLI A;  4FPC A;  2XZJ A;  4CPL A;  2BAT A;  3D12 A;  1QLG A;  1EUU A;  1WP5 A;  1MZ6 A;  4D4U A;  4FPJ A;  2F12 A;  1S0J A;  3WW9 A;  3V64 C;  1ING A;  4HZV A;  4D8S A;  3K38 A;  4IFL X;  4FPF A;  4Q6K A;  4CPO A;  4FPG A;  2HT5 A;  4GEZ A;  4XJ8 A;  3SOQ A;  2HTR A;  1CRU A;  1INY A;  1N1V A;  3GVL A;  2VW1 A;  2VK7 A;  4MWV A;  1NCB N;  4GB1 A;  5FNS A;  3LI3 A;  2W5N A;  5D9D A;  2VW2 A;  4K1H A;  1SLL A;  1NNA A;  3WN7 A;  4K1J A;  1IVE A;  4FQ4 A;  1Z4V A;  5NN9 A;  3DAS A;  2GVX A;  4QN5 A;  3B69 A;  2AEQ A;  1INH A;  2DYH A;  3S94 A;  2IAV A;  5B2D A;  1F8E A;  1PJX A;  2POO A;  3A9H A;  3H6J A;  4ZY3 A;  3FW0 A;  1W21 A;  1XOG A;  1MWE A;  4SLI A;  4MWW A;  4CPZ A;  4B7Q A;  5FWW A;  4MJV A;  3AMR A;  4HZW A;  5GX2 A;  3A71 A;  4HIZ A;  2IAS A;  3P5B L;  1IUC A;  4PWZ A;  5FZJ A;  2V91 A;  4D52 B;  1C5K A;  4KS4 A;  1INX A;  2FPB A;  1WCS A;  1ZI0 A;  3HRP A;  4C1Y B;  4MC7 A;  3SAL A;  1IVG A;  2VWD A;  2XZI A;  2X9M A;  2IAX A;  3DR2 A;  4IFN X;  3ZGD A;  1B9S A;  4IN4 A;  4HZZ A;  4YW1 A;  2HQS A;  4XIK A;  1L7G A;  3BEQ A;  2C4A A;  1IVB A;  2XZK A;  1POO A;  1Q7F A;  1DIL A;  1CQ1 A;  1EUT A;  5FNT A;  4GZS A;  3K39 A;  2F26 A;  2F0Z A;  5GX4 A;  2A75 A;  4WA3 A;  4GZO A;  3O9K A;  4XMB A;  2W20 A;  3GVJ A;  2QWJ A;  4XIL A;  3H73 A;  2YA5 A;  4QN7 A;  4YY8 A;  3GVK A;  4GN8 A;  2HTU A;  2HTW A;  4O5T A;  1MZ5 A;  2C4L A;  2CML A;  1B9T A;  4HW6 A;  4X47 A;  3S8V A;  4HZY A;  3VNG A;  1Z4X A;  3L6V A;  2QWC A;  4M4U A;  1NSC A;  4B7R A;  4GJT A;  4XJU A;  4CH9 A;  1E8V A;  2F25 A;  1MS1 A;  3BYC A;  4FPK A;  2YA7 A;  4WEG A;  1IJQ A;  4XMI A;  4MWQ A;  4BBW A;  1S18 A;  3WWA A;  4G3N A;  2FLU X;  4GZP A;  2FPC A;  4A0P A;  1V3E A;  5B2C A;  5HUN A;  1KIT A;  1N7D A;  2HU4 A;  2FP9 A;  5FNR A;  5HX0 A;  3SLI A;  4CPM A;  1N6F A;  1NSB A;  1NCA N;  4FP3 A;  2H2U A;  4GZX A;  4H52 A;  4KS3 A;  4Q1U A;  2IAT A;  2BF6 A;  4NCS A;  3OPZ A;  4MWX A;  3SRG A;  1USR A;  4YW4 A;  3INB A;  3TI4 A;  1L7H A;  2YDP A;  4YZ4 A;  2B8H A;  2WOZ A;  4MWU A;  3II7 A;  1NNB A;  1IVF A;  1IVD A;  3G4H A;  3TI8 A;  4CSD A;  1V3B A;  4M4V A;  1C9U A;  3TC9 A;  4CPY A;  3K36 A;  2JKB A;  4XJ9 A;  1N6D A;  1RWI A;  3IAX A;  4XJR A;  2IAR A;  5JYY A;  2SLI A;  1E8U A;  2IAP A;  4ZLR A;  2F27 A;  4B7M A;  1DIM A;  2F28 A;  4X49 A;  5GTQ A;  4NC5 A;  1EUS A;  4KS2 A;  4O5S A;  3TI3 A;  1NN2 A;  2XN4 A;  3JU4 A;  4QNP A;  5FNQ A;  4GDJ A;  5GX5 A;  3SOB B;  1W8O A;  1V3C A;  1X2R A;  4FPO B;  4L7C A;  1W0P A;  2FP8 A;  2F29 A;  4J9T A;  5D9C A;  3HLH A;  4CPN A;  1OFZ A;  4HHQ A;  2HTV A;  2F24 A;  4B7J A;  1X2J A;  1NSD A;  2AGS A;  5M1Z A;  4I00 A;  1E1A A;  4FOW A;  4DGR A;  4YW3 A;  1EUR A;  4XJW A;  2QE8 A;  2GVV A;  2FHR A;  1Z4Z A;  4L7D A;  1BJI A;  3O9J A;  2AH2 A;  3E5Z A;  1IVC A;  1W0O A;  4XOG A;  3WDZ A;  2QWA A;  3KGG A;  4R40 A;  3H72 A;  2VW0 A;  4FJ6 A;  5F72 C;  5CGJ A;  4XHX A;  4M4N A;  3S8Z A;  5GX3 A;  2DG0 A;  4MZA A;  5HUM A;  3TI6 A;  1NMB N;  1N1S A;  1XOE A;  1RWL A;  1S1D A;  2VK5 A;  1CRZ A;  1N1T A;  1NCC N;  4MJU A;  4MWY A;  4QN3 A;  1K32 A;  1NMC A;  2VPJ A;  3A72 A;  3ALW A;  4ASC A;  2YA4 A;  1F8C A;  1Z4W A;  3Q6T A;  1V0F A;  3TIC A;  4B7N A;  3ALX A;  3NN9 A;  2VSM A;  3SOV A;  1MS4 A;  2HT8 A;  2W8B A;  1F8D A;  2ZB6 A;  4D52 C;  3UC1 A;  3NSS A;  2HTY A;  2QWH A;  3CKZ A;  4YZ2 A;  4MWR A;  4XMA A;  4FOV A;  4AGI A;  4XIO A;  1NNC A;  1CVM A;  2IAQ A;  1SUU A;  3KYA A;  4YW5 A;  2QWE A;  2QWI A;  2SIL A;  5GX1 A;  3H71 A;  4IFJ A;  3NO0 A;  4GDI A;  4YZ5 A;  1MS3 A;  1ZGK A;  2YA6 A;  3Q6K A;  1QBI A;  4X4A A;  3K3A A;  2ZZK A;  1INF A;  4UOU A;  2Z32 A;  2G8S A;  3ADE A;  4FP2 A;  2HTQ A;  3Q6P A;  1Z50 A;  2H2N A;  1W1X A;  1V04 A;  4AH4 A;  4K1K A;  3LI5 A;  3PJQ A;  3V1S A;  5EO8 A;  1NCD N;  4FOQ A;  3O4P A;  1MS5 A;  2IAW A;  3G4E A;  4QN4 A;  2BZD A;  3K37 A;  2IAO A;  1WCQ A;  5F9T A;  3HLI A;  4XYX A;  4K1I A;  2ISM A;  2QWD A;  2BER A;  1S0I A;  4GNB A;  4AGT A;  3U0S A;  2IVZ A;  2ZWA A;  4XJA A;  1V0E A;  4FPE A;  2YDT A;  2F11 A;  4K3Y A;  4M3M A;  4WEF A;  4YW2 A;  1SO7 A;  1A4Q A;  3I1C A;  2VSK A;  3W09 A;  4N1B A;  5FZN A;  4WA5 A;  1IUB A;  4QN6 A;  1V3D A;  4GN9 A;  1W8N A;  1INW A;  4WA4 A;  5HUG A;  4AHA A;  2GVW A;  4YZ1 A;  2HT7 A;  2VAQ A;  2F10 A;  1H6L A;  2ZB5 A;  1VCJ A;  1USX A;  4GZW A;  2QWK A;  4XHB A;  4XJQ A;  4KS5 A;  2ZW9 A;  2OJH A;  1V0Z A;  1SNT A;  4D52 A;  4IYG A;  5HUK A;  2QWG A;  5FNU A;  4NN9 A;  4FVK A;  1Z4Y A;  1MS9 A;  1VCU A;  4H53 A;  2VK6 A;  1N1Y A;  4C1Y A;  2W38 A;  3TI5 A;  3LI4 A;  4HZX A;  5D9B A;  7NN9 A;  1W20 A;  1A4G A;  3TIA A;  2GVU A;  1L7F A;  3SAN A;  2HU0 A;  2VVZ A;  4YZ3 A;  3SRE A;  3B7E A;  4FPH A;  4FOY A;  4CHB A;  2W5O A;  3CL2 A;  3T1E A;  1NMA N;  2IAU A;  2DSO A;  4MZE A;  1V2I A;  4GN7 A;  1F8B A;  4GNC A;  5H47 A;  1INV A;  3CYE A;  4GZT A;  1MS8 A;  2SIM A;  2AEP A; 
#chains in the Genus database with same CATH homology
 4UF7 A;  1A14 N;  2RKC A;  4FPY A;  2XCY A;  4FZH A;  4XJZ A;  2QWF A;  2F13 A;  2QWB A;  3D11 A;  4KS1 A;  1MS0 A;  4MX0 A;  3TIB A;  4FPL A;  4MWJ A;  4XE9 A;  4GZQ A;  6NN9 A;  1B9V A;  4JF7 A;  1E8T A;  1MR5 A;  4MWL A;  4X6K A;  3CL0 A;  3SIL A;  2YA8 A;  1SLI A;  4FPC A;  2XZJ A;  4CPL A;  2BAT A;  3D12 A;  1EUU A;  1MZ6 A;  4FPJ A;  2F12 A;  1S0J A;  1ING A;  4HZV A;  4D8S A;  3K38 A;  4FPF A;  4Q6K A;  4CPO A;  4FPG A;  2HT5 A;  4GEZ A;  4XJ8 A;  2HTR A;  1INY A;  1N1V A;  3GVL A;  2VW1 A;  2VK7 A;  4MWV A;  1NCB N;  4GB1 A;  2W5N A;  2VW2 A;  4K1H A;  1SLL A;  1NNA A;  4K1J A;  1IVE A;  4FQ4 A;  1Z4V A;  5NN9 A;  4QN5 A;  3B69 A;  2AEQ A;  1INH A;  5B2D A;  1F8E A;  3H6J A;  1W21 A;  1XOG A;  1MWE A;  4SLI A;  4MWW A;  4CPZ A;  4B7Q A;  4MJV A;  4HZW A;  3A71 A;  4HIZ A;  4KS4 A;  1INX A;  1WCS A;  4MC7 A;  3SAL A;  1IVG A;  2VWD A;  2XZI A;  2X9M A;  1B9S A;  4HZZ A;  4YW1 A;  4XIK A;  1L7G A;  3BEQ A;  2C4A A;  1IVB A;  2XZK A;  1DIL A;  1EUT A;  4GZS A;  3K39 A;  2F26 A;  2F0Z A;  2A75 A;  4WA3 A;  4GZO A;  3O9K A;  2W20 A;  3GVJ A;  2QWJ A;  4XIL A;  3H73 A;  2YA5 A;  4QN7 A;  3GVK A;  2HTU A;  2HTW A;  1MZ5 A;  2C4L A;  2CML A;  1B9T A;  4X47 A;  4HZY A;  1Z4X A;  2QWC A;  4M4U A;  1NSC A;  4B7R A;  4GJT A;  4XJU A;  1E8V A;  2F25 A;  1MS1 A;  4FPK A;  2YA7 A;  4WEG A;  4XMI A;  4MWQ A;  4BBW A;  1S18 A;  4GZP A;  1V3E A;  5B2C A;  5HUN A;  1KIT A;  2HU4 A;  5HX0 A;  3SLI A;  4CPM A;  1NSB A;  1NCA N;  4FP3 A;  2H2U A;  4GZX A;  4H52 A;  4KS3 A;  2BF6 A;  4NCS A;  3OPZ A;  4MWX A;  1USR A;  4YW4 A;  3INB A;  3TI4 A;  1L7H A;  2YDP A;  4YZ4 A;  2B8H A;  4MWU A;  1NNB A;  1IVF A;  1IVD A;  3TI8 A;  1V3B A;  4M4V A;  4CPY A;  3K36 A;  2JKB A;  4XJ9 A;  4XJR A;  5JYY A;  2SLI A;  1E8U A;  2F27 A;  4B7M A;  1DIM A;  2F28 A;  4X49 A;  4NC5 A;  1EUS A;  4KS2 A;  3TI3 A;  1NN2 A;  3JU4 A;  4QNP A;  4GDJ A;  1W8O A;  1V3C A;  4FPO B;  1W0P A;  2F29 A;  4J9T A;  4CPN A;  2HTV A;  2F24 A;  4B7J A;  2AGS A;  1NSD A;  5M1Z A;  4I00 A;  4FOW A;  4DGR A;  4YW3 A;  1EUR A;  4XJW A;  2FHR A;  1Z4Z A;  1BJI A;  3O9J A;  2AH2 A;  1IVC A;  1W0O A;  4XOG A;  2QWA A;  3H72 A;  2VW0 A;  4FJ6 A;  4XHX A;  4M4N A;  4MZA A;  5HUM A;  3TI6 A;  1NMB N;  1N1S A;  1XOE A;  1S1D A;  4QN3 A;  2VK5 A;  1N1T A;  1NCC N;  4MJU A;  4MWY A;  1NMC A;  3A72 A;  3ALW A;  2YA4 A;  1F8C A;  1Z4W A;  1V0F A;  3TIC A;  4B7N A;  3ALX A;  3NN9 A;  2VSM A;  1MS4 A;  2HT8 A;  1F8D A;  2ZB6 A;  3NSS A;  2HTY A;  2QWH A;  3CKZ A;  4YZ2 A;  4MWR A;  4XMA A;  4FOV A;  4XIO A;  1NNC A;  4YW5 A;  2QWE A;  2QWI A;  2SIL A;  3H71 A;  4GDI A;  4YZ5 A;  1MS3 A;  4X4A A;  2YA6 A;  3K3A A;  1INF A;  4FP2 A;  2HTQ A;  1Z50 A;  2H2N A;  1W1X A;  4K1K A;  3PJQ A;  1NCD N;  4FOQ A;  1MS5 A;  4QN4 A;  2BZD A;  3K37 A;  1WCQ A;  5F9T A;  4XYX A;  4K1I A;  2QWD A;  2BER A;  1S0I A;  4XJA A;  1V0E A;  4FPE A;  2YDT A;  2F11 A;  4K3Y A;  4M3M A;  4WEF A;  4YW2 A;  1SO7 A;  1A4Q A;  2VSK A;  3W09 A;  4WA5 A;  4QN6 A;  1V3D A;  1W8N A;  1INW A;  4WA4 A;  5HUG A;  4YZ1 A;  2HT7 A;  2F10 A;  2ZB5 A;  1VCJ A;  1USX A;  4GZW A;  2QWK A;  4XHB A;  4XJQ A;  4KS5 A;  1V0Z A;  1SNT A;  5HUK A;  2QWG A;  4NN9 A;  4FVK A;  1Z4Y A;  1MS9 A;  1VCU A;  4H53 A;  2VK6 A;  1N1Y A;  2W38 A;  3TI5 A;  4HZX A;  7NN9 A;  1W20 A;  1A4G A;  3TIA A;  1L7F A;  3SAN A;  2HU0 A;  2VVZ A;  4YZ3 A;  3B7E A;  4FPH A;  4FOY A;  2W5O A;  3CL2 A;  3T1E A;  1NMA N;  4MZE A;  1V2I A;  1F8B A;  1INV A;  3CYE A;  4GZT A;  1MS8 A;  2SIM A;  2AEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...