1AJ6A

Novobiocin-resistant mutant (r136h) of the n-terminal 24 kda fragment of dna gyrase b complexed with novobiocin at 2.3 angstroms resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
194
Chain Sequence
VLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGGLHGVGVSVVNALSQKLELVIQHEGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GYRASE
publication title The entropic penalty of ordered water accounts for weaker binding of the antibiotic novobiocin to a resistant mutant of DNA gyrase: a thermodynamic and crystallographic study.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Topoisomerase
total genus 61
structure length 194
sequence length 206
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1aj6A00
4BIUA 1Y4SA 3CGZA 2YKIA 3G7EA 2YEJA 2BYHA 4YKUA 4BIZA 3OWBA 3GIEA 5GGZA 2BU7A 2ZDXA 3D2RA 5D7RA 4GCZA 4NH7A 2YEFA 2XDXA 2IWXA 3NMQA 4YKRA 1EI1A 4XDMA 2VWCA 2YE6A 4Q20A 4CE2A 4XCLA 4P8OA 4QPKA 1R62A 2H8MA 4XIQA 2XABA 4EEHA 4LP0A 4P7AA 4GGLA 2YEGA 1GKZA 1US7A 1I5AA 4K4OA 4I3HA 2Q8FA 2C2AA 4ZKIA 4LWEA 1TBWA 4LWHA 4W7TA 4LWGA 2XHXA 4KSGA 2O1WA 1PVGA 3B27A 3FT5A 4XE2A 2YGFA 4XITA 3HZ5A 4PRVA 5CTUA 1AH8A 3K97A 1KIJA 4CWNA 2K5BA 4KQVA 3VHCA 3WQ9A 3ZKDA 2YKJA 4URMA 4ZVIA 2CGFA 3QTFA 4JASA 4LWFA 3OPDA 4NH9A 1QZRA 2WI5A 2FWZA 2Q8HA 4URLA 4O0BA 4PL9A 4FCRA 4V25A 1GJVA 2XK2A 4L94A 4HXZA 3O6OA 2Q8GA 1TC0A 4KTNA 4AWQA 4L90A 4ASBA 1UYHA 1ZWHA 5FNDA 3QDDA 4KP4A 5CPHA 3T0ZA 3T2SA 1YC1A 3BMYA 4X9LA 4XD8A 2BREA 3RLQA 2HKJA 4B7PA 2HCHA 3C0EA 5CTYA 3FT8A 2YJXA 4DUHA 3RKZA 5M4PA 5BOCA 2UWDA 4MPNA 4EGHA 2H55A 3GIGA 3T0HA 3GIGB 1U0ZA 3EHJA 2BT0A 4CWSA 2CH4A 2BRCA 1TH8A 1UYKA 2WERA 3WHAA 1NHJA 3K98A 4YKYA 1UYDA 2YEAA 1UYEA 3EHFA 5D7CA 4L91A 4U7NA 3TZ2A 4MPEA 3Q5LA 2YKBA 3HZ1A 4WUBA 2YE3A 4YKTA 3G7BA 1YESA 4E02A 2YEEA 2JKIA 2GQPA 4LWIA 4UROA 3TTZA 4ASGA 1YT1A 4H7QA 2WI1A 2YE5A 1Y8PA 3Q5JA 3OWDA 3PEHA 1AH6A 1QY8A 3B24A 4CWPA 5M4HA 3R4PA 4CE1A 1Z5CA 4MOTA 4R3AA 4MBCA 3A0ZA 4XKOA 5D6QA 3U2DA 4XIPA 3VHDA 4HYPA 5J6AA 2WEPA 4ASFA 4YKXA 4O04A 4XIRA 4GQTA 3H4LA 4EGKA 2CG9A 2BZ5A 4BAEA 3K60A 4AWOA 4XKKA 2YE4A 1YT2A 2BYIA 5C93A 2FXSA 4CWTA 1TILA 4JAVA 2XHRA 3HYZA 1B62A 1JM6A 3HYYA 4BXIA 3KE6A 4AWPA 2E0AA 2YEBA 2IORA 2O1VA 3C11A 4HY1A 2XCMA 2CCSA 2BU5A 3EKOA 4CWQA 2QF6A 4GEEA 2BU8A 2ZKJA 3CRKA 1UYFA 2FYPA 5FNFA 1BKNA 2YGAA 2YKEA 3DGEA 2WI7A 2WI2A 2Q2EB 1YC3A 3OMUA 2WI3A 2YE7A 1H7SA 4MPCA 4MP7A 3CGYA 1Z5AA 4CE3A 3B25A 3ZXQA 2VW5A 1I5DA 4R1FA 2IOPA 1YC4A 4PU9A 4O05A 2GFDA 3ZXOA 2XHTA 4EFUA 3TZ5A 1MU5A 4JQLA 3R4OA 1BXDA 3TUHA 1UYGA 1Y8OA 2VCJA 4YKWA 2CCTA 2EXLA 1A4HA 3A0YA 2QG0A 1I58A 1NHHA 3U67A 5IDJA 4URNA 4XC0A 1UY6A 4FMTA 3G75A 3EKRA 4XCJA 2CCUA 4WUDA 1L0OA 4AS9A 2YI0A 2BSMA 2VCIA 1ZXMA 2XX5A 5M4NA 3R4MA 3VADA 4BQJA 2JJCA 3D36A 4MP2A 3JZ3A 4E00A 3CRLA 3OW6A 4LPBA 4L8ZA 1UY9A 1UY8A 5F5RA 3INXA 2BTZA 1AJ6A 1TIDA 3O0IA 2ZDYA 3LPSA 1UYCA 1NHIA 3FV5A 4MB9A 4HZ5A 2YI6A 4EMVA 1THNA 5FNCA 4XKAA 2XJGA 3IEDA 2WEQA 4YKQA 3HHUA 5J71A 4I5SA 3EHHA 1YS3A 3R4NA 4KSHA 4V26A 2O1UA 1ID0A 2XJJA 3H80A 4B6CA 1Y8NA 1I5CA 4H81A 3B28A 2AKPA 3BM9A 4FPPA 4O07A 3R91A 2IWSA 2XX4A 3HEKA 4HZ0A 5CTXA 1Z5BA 1EA6A 3R92A 3A0WA 1BGQA 1S14A 4JAUA 5CTWA 4KFGA 3EHGA 3SL2A 4O09A 2HG1A 2ESAA 2YECA 4HY6A 4PRXA 5CF0A 1Z59A 1U2OA 1UYIA 2YKCA 1ZXNA 3B26A 2XX2A 4YKZA 1UYMA 1OSFA 1UYLA 1I59A 2QFOA 4CWRA 4EFTA 5IN9A 1TC6A 2YE8A 3RLRA 2QG2A 2YGEA 5BODA 2WI6A 3GIFA 3LNUA 5L3JA 3Q5KA 4CWFA 2BU2A 2BU6A 3K99A 4WUCA 2PNRA 4R3MA 4U93A 5F3KA 3T10A 2XJXA 3MNRP 3A0RA 4HYMA 3INWA 1QYEA 3TZ0A 3O2FA 4U7OA 3ZKBA 1ZW9A 2YK9A 4L93A 2YE9A 1MX0A 1YETA 2FWYA 5D7DA 3ZM7A 3TZ4A 5M4EA 2YK2A 3D0BA 5M4MA 3RLPA 1YSRA 2IWUA 4GFNA 3T1KA 4HXWA 2XDSA 4EM7A 2IOQA 3A0TA 2XDKA 4E01A 5M4KA 5D6PA 1GKXA 4CWOA 2WI4A 4ASAA 4DZYA 2XD6A 2YI5A 1B63A 4GT8A 3U2KA 2YE2A 4QPJA 1YSZA 2YJWA 2YEDA 1KZNA 1H7UA 4EGIA 1Y4UA 1UY7A 2ZBKB 4XTJA 4FCPA 2YEHA 1I5BA 4FCQA 5IDMA 2YI7A 1BYQA 3CWVA 4BQGA 2Q8IA 2YEIA 1B3QA 3VHAA 1YERA 3PEJA 4H85A 5FWKA 4NH8A 2XDLA 1YT0A 1AMWA 1S16A 3A0XA 2XDUA 1AM1A
chains in the Genus database with same CATH superfamily
4BIUA 1Y4SA 3CGZA 2YKIA 3G7EA 2YEJA 2BYHA 4YKUA 4BIZA 3OWBA 3GIEA 5GGZA 2BU7A 2ZDXA 3D2RA 5D7RA 4GCZA 4NH7A 2YEFA 2XDXA 2IWXA 2HHIA 3NMQA 4YKRA 1EI1A 4XDMA 2VWCA 2YE6A 4Q20A 4CE2A 4XCLA 4P8OA 4QPKA 1R62A 2H8MA 4XIQA 2XABA 4EEHA 4LP0A 4P7AA 4GGLA 2YEGA 2C1IA 1GKZA 1US7A 1I5AA 4K4OA 4I3HA 2Q8FA 2C2AA 4ZKIA 4LWEA 1TBWA 4LWHA 4W7TA 4LWGA 2XHXA 4KSGA 2O1WA 1PVGA 3B27A 3FT5A 4XE2A 2YGFA 4XITA 3HZ5A 4PRVA 5CTUA 1AH8A 3K97A 1KIJA 4CWNA 2K5BA 4KQVA 3VHCA 3WQ9A 3ZKDA 2YKJA 4URMA 4ZVIA 2CGFA 3QTFA 4JASA 4LWFA 3OPDA 4NH9A 1IXMA 1QZRA 2WI5A 2FWZA 2Q8HA 4URLA 4O0BA 4PL9A 4FCRA 4V25A 1GJVA 2XK2A 4L94A 4HXZA 3O6OA 2Q8GA 1TC0A 4KTNA 4AWQA 4L90A 4ASBA 1UYHA 1ZWHA 5FNDA 3QDDA 4KP4A 5CPHA 3T0ZA 3T2SA 1YC1A 3BMYA 4X9LA 4XD8A 2BREA 3RLQA 2HKJA 4B7PA 2HCHA 3C0EA 5CTYA 3FT8A 2YJXA 4DUHA 3RKZA 5M4PA 5BOCA 2UWDA 4MPNA 4EGHA 2H55A 3GIGA 3T0HA 3GIGB 1U0ZA 3EHJA 2BT0A 4CWSA 2CH4A 2BRCA 1TH8A 1UYKA 2WERA 3WHAA 1NHJA 3K98A 4YKYA 1UYDA 2YEAA 1UYEA 3EHFA 5D7CA 4L91A 4U7NA 3TZ2A 4MPEA 3Q5LA 2YKBA 3HZ1A 4WUBA 2YE3A 4YKTA 3G7BA 1YESA 4E02A 2YEEA 3CYGA 4E72A 2JKIA 2GQPA 4LWIA 4UROA 3TTZA 4ASGA 1YT1A 4H7QA 2WI1A 2YE5A 1Y8PA 3Q5JA 3OWDA 3PEHA 1AH6A 1QY8A 3B24A 4CWPA 5M4HA 3R4PA 4CE1A 1Z5CA 4MOTA 4R3AA 4MBCA 3A0ZA 4XKOA 5D6QA 3U2DA 4XIPA 3VHDA 4HYPA 5J6AA 2WEPA 4ASFA 4YKXA 4O04A 4XIRA 4GQTA 3H4LA 4EGKA 2CG9A 2BZ5A 4BAEA 3K60A 4AWOA 4XKKA 2YE4A 1YT2A 2BYIA 5C93A 2FXSA 4CWTA 1TILA 4JAVA 2XHRA 3HYZA 1B62A 1JM6A 3HYYA 4BXIA 3KE6A 4AWPA 2E0AA 2YEBA 2IORA 2O1VA 3C11A 4HY1A 2XCMA 2CCSA 2BU5A 3EKOA 4CWQA 2QF6A 4GEEA 2BU8A 2ZKJA 3CRKA 1UYFA 2FYPA 5FNFA 1BKNA 2YGAA 2YKEA 3DGEA 2WI7A 2WI2A 2Q2EB 1YC3A 3OMUA 2WI3A 2YE7A 1H7SA 4MPCA 3LMMA 3CGYA 4MP7A 1Z5AA 4CE3A 3B25A 3ZXQA 2VW5A 1I5DA 4R1FA 2IOPA 1YC4A 4PU9A 4O05A 2GFDA 3ZXOA 2XHTA 4EFUA 3TZ5A 1MU5A 4JQLA 3R4OA 1BXDA 3TUHA 1UYGA 1Y8OA 2VCJA 4YKWA 2CCTA 2EXLA 1A4HA 3A0YA 2QG0A 1I58A 1NHHA 3U67A 5IDJA 4URNA 4XC0A 1UY6A 4FMTA 3G75A 3EKRA 4XCJA 2CCUA 4WUDA 1L0OA 4AS9A 2YI0A 2BSMA 2VCIA 1ZXMA 2XX5A 5M4NA 3R4MA 3VADA 4BQJA 2JJCA 3D36A 4MP2A 3JZ3A 4E00A 3CRLA 3OW6A 4LPBA 4L8ZA 1UY9A 1UY8A 2C1GA 5F5RA 3INXA 2BTZA 1AJ6A 1TIDA 3O0IA 2ZDYA 3LPSA 1UYCA 1NHIA 3FV5A 4MB9A 4HZ5A 2YI6A 2FTKA 4EMVA 1THNA 5FNCA 4XKAA 2XJGA 3IEDA 2WEQA 4YKQA 3HHUA 5J71A 4I5SA 3EHHA 1YS3A 3R4NA 4KSHA 4V26A 2O1UA 1ID0A 2XJJA 3H80A 4B6CA 1Y8NA 1I5CA 4H81A 3B28A 2AKPA 3BM9A 4FPPA 4O07A 3R91A 2IWSA 2XX4A 3HEKA 4HZ0A 5CTXA 1Z5BA 1EA6A 3R92A 3A0WA 1BGQA 1S14A 4JAUA 5CTWA 4KFGA 3EHGA 3SL2A 4O09A 2HG1A 2ESAA 2YECA 4HY6A 4PRXA 5CF0A 1Z59A 1U2OA 1UYIA 2YKCA 1ZXNA 3S5TA 3B26A 2XX2A 4YKZA 1UYMA 1OSFA 1UYLA 1I59A 2QFOA 4CWRA 4EFTA 5IN9A 1TC6A 2YE8A 3RLRA 2QG2A 2YGEA 5BODA 2WI6A 3GIFA 3LNUA 5L3JA 3Q5KA 4CWFA 2BU2A 2BU6A 3K99A 4WUCA 2PNRA 4R3MA 4U93A 5F3KA 3T10A 2XJXA 3MNRP 3A0RA 4HYMA 3INWA 1QYEA 3TZ0A 3O2FA 4U7OA 3ZKBA 1ZW9A 2YK9A 4L93A 2YE9A 1MX0A 1YETA 2FWYA 5D7DA 3ZM7A 3TZ4A 5M4EA 2YK2A 3D0BA 5M4MA 3RLPA 1YSRA 2IWUA 4GFNA 3T1KA 4HXWA 2XDSA 4EM7A 2IOQA 3A0TA 2XDKA 4E01A 5M4KA 5D6PA 1GKXA 4CWOA 2WI4A 4ASAA 4DZYA 2XD6A 2YI5A 1B63A 5JENA 4GT8A 3U2KA 2YE2A 4QPJA 1YSZA 2YJWA 2YEDA 1KZNA 1H7UA 4EGIA 1Y4UA 1F51A 1UY7A 2ZBKB 4XTJA 4FCPA 2YEHA 1I5BA 4FCQA 5IDMA 2YI7A 1BYQA 3CWVA 4BQGA 2Q8IA 2YEIA 1B3QA 3VHAA 1YERA 3PEJA 4H85A 5FWKA 4NH8A 2XDLA 1YT0A 1AMWA 1S16A 3A0XA 2XDUA 1AM1A
chains in the Genus database with same CATH topology
4BIUA 1Y4SA 3CGZA 2YKIA 3G7EA 2YEJA 2BYHA 4YKUA 4BIZA 3OWBA 3GIEA 5GGZA 2BU7A 2ZDXA 3D2RA 5D7RA 4GCZA 4NH7A 2YEFA 2XDXA 2IWXA 3NMQA 4YKRA 1EI1A 4XDMA 2VWCA 2YE6A 4Q20A 4CE2A 4XCLA 4P8OA 4QPKA 1R62A 2H8MA 4XIQA 2XABA 4EEHA 4LP0A 4P7AA 4GGLA 2YEGA 1GKZA 1US7A 1I5AA 4K4OA 4I3HA 2Q8FA 2C2AA 4ZKIA 4LWEA 1TBWA 4LWHA 4W7TA 4LWGA 2XHXA 4KSGA 2O1WA 1PVGA 3B27A 3FT5A 4XE2A 2YGFA 4XITA 3HZ5A 4PRVA 5CTUA 1AH8A 3K97A 1KIJA 4CWNA 2K5BA 4KQVA 3VHCA 3WQ9A 3ZKDA 2YKJA 4URMA 4ZVIA 2CGFA 3QTFA 4JASA 4LWFA 3OPDA 4NH9A 1QZRA 2WI5A 2FWZA 2Q8HA 4URLA 4O0BA 4PL9A 4FCRA 4V25A 1GJVA 2XK2A 4L94A 4HXZA 3O6OA 2Q8GA 1TC0A 4KTNA 4AWQA 4L90A 4ASBA 1UYHA 1ZWHA 5FNDA 3QDDA 4KP4A 5CPHA 3T0ZA 3T2SA 1YC1A 3BMYA 4X9LA 4XD8A 2BREA 3RLQA 2HKJA 4B7PA 2HCHA 3C0EA 5CTYA 3FT8A 2YJXA 4DUHA 3RKZA 5M4PA 5BOCA 2UWDA 4MPNA 4EGHA 2H55A 3GIGA 3T0HA 3GIGB 1U0ZA 3EHJA 2BT0A 4CWSA 2CH4A 2BRCA 1TH8A 1UYKA 2WERA 3WHAA 1NHJA 3K98A 4YKYA 1UYDA 2YEAA 1UYEA 3EHFA 5D7CA 4L91A 4U7NA 3TZ2A 4MPEA 3Q5LA 2YKBA 3HZ1A 4WUBA 2YE3A 4YKTA 3G7BA 1YESA 4E02A 2YEEA 2JKIA 2GQPA 4LWIA 4UROA 3TTZA 4ASGA 1YT1A 4H7QA 2WI1A 2YE5A 1Y8PA 3Q5JA 3OWDA 3PEHA 1AH6A 1QY8A 3B24A 4CWPA 5M4HA 3R4PA 4CE1A 1Z5CA 4MOTA 4R3AA 4MBCA 3A0ZA 4XKOA 5D6QA 3U2DA 4XIPA 3VHDA 4HYPA 5J6AA 2WEPA 4ASFA 4YKXA 4O04A 4XIRA 4GQTA 3H4LA 4EGKA 2CG9A 2BZ5A 4BAEA 3K60A 4AWOA 4XKKA 2YE4A 1YT2A 2BYIA 5C93A 2FXSA 4CWTA 1TILA 4JAVA 2XHRA 3HYZA 1B62A 1JM6A 3HYYA 4BXIA 3KE6A 4AWPA 2E0AA 2YEBA 2IORA 2O1VA 3C11A 4HY1A 2XCMA 2CCSA 2BU5A 3EKOA 4CWQA 2QF6A 4GEEA 2BU8A 2ZKJA 3CRKA 1UYFA 2FYPA 5FNFA 1BKNA 2YGAA 2YKEA 3DGEA 2WI7A 2WI2A 2Q2EB 1YC3A 3OMUA 2WI3A 2YE7A 1H7SA 4MPCA 4MP7A 3CGYA 1Z5AA 4CE3A 3B25A 3ZXQA 2VW5A 1I5DA 4R1FA 2IOPA 1YC4A 4PU9A 4O05A 2GFDA 3ZXOA 2XHTA 4EFUA 3TZ5A 1MU5A 4JQLA 3R4OA 1BXDA 3TUHA 1UYGA 1Y8OA 2VCJA 4YKWA 2CCTA 2EXLA 1A4HA 3A0YA 2QG0A 1I58A 1NHHA 3U67A 5IDJA 4URNA 4XC0A 1UY6A 4FMTA 3G75A 3EKRA 4XCJA 2CCUA 4WUDA 1L0OA 4AS9A 2YI0A 2BSMA 2VCIA 1ZXMA 2XX5A 5M4NA 3R4MA 3VADA 4BQJA 2JJCA 3D36A 4MP2A 3JZ3A 4E00A 3CRLA 3OW6A 4LPBA 4L8ZA 1UY9A 1UY8A 5F5RA 3INXA 2BTZA 1AJ6A 1TIDA 3O0IA 2ZDYA 3LPSA 1UYCA 1NHIA 3FV5A 4MB9A 4HZ5A 2YI6A 4EMVA 1THNA 5FNCA 4XKAA 2XJGA 3IEDA 2WEQA 4YKQA 3HHUA 5J71A 4I5SA 3EHHA 1YS3A 3R4NA 4KSHA 4V26A 2O1UA 1ID0A 2XJJA 3H80A 4B6CA 1Y8NA 1I5CA 4H81A 3B28A 2AKPA 3BM9A 4FPPA 4O07A 3R91A 2IWSA 2XX4A 3HEKA 4HZ0A 5CTXA 1Z5BA 1EA6A 3R92A 3A0WA 1BGQA 1S14A 4JAUA 5CTWA 4KFGA 3EHGA 3SL2A 4O09A 2HG1A 2ESAA 2YECA 4HY6A 4PRXA 5CF0A 1Z59A 1U2OA 1UYIA 2YKCA 1ZXNA 3B26A 2XX2A 4YKZA 1UYMA 1OSFA 1UYLA 1I59A 2QFOA 4CWRA 4EFTA 5IN9A 1TC6A 2YE8A 3RLRA 2QG2A 2YGEA 5BODA 2WI6A 3GIFA 3LNUA 5L3JA 3Q5KA 4CWFA 2BU2A 2BU6A 3K99A 4WUCA 2PNRA 4R3MA 4U93A 5F3KA 3T10A 2XJXA 3MNRP 3A0RA 4HYMA 3INWA 1QYEA 3TZ0A 3O2FA 4U7OA 3ZKBA 1ZW9A 2YK9A 4L93A 2YE9A 1MX0A 1YETA 2FWYA 5D7DA 3ZM7A 3TZ4A 5M4EA 2YK2A 3D0BA 5M4MA 3RLPA 1YSRA 2IWUA 4GFNA 3T1KA 4HXWA 2XDSA 4EM7A 2IOQA 3A0TA 2XDKA 4E01A 5M4KA 5D6PA 1GKXA 4CWOA 2WI4A 4ASAA 4DZYA 2XD6A 2YI5A 1B63A 4GT8A 3U2KA 2YE2A 4QPJA 1YSZA 2YJWA 2YEDA 1KZNA 1H7UA 4EGIA 1Y4UA 1UY7A 2ZBKB 4XTJA 4FCPA 2YEHA 1I5BA 4FCQA 5IDMA 2YI7A 1BYQA 3CWVA 4BQGA 2Q8IA 2YEIA 1B3QA 3VHAA 1YERA 3PEJA 4H85A 5FWKA 4NH8A 2XDLA 1YT0A 1AMWA 1S16A 3A0XA 2XDUA 1AM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BIU A;  1Y4S A;  3CGZ A;  2YKI A;  3G7E A;  2YEJ A;  2BYH A;  4YKU A;  4BIZ A;  3OWB A;  3GIE A;  5GGZ A;  2BU7 A;  2ZDX A;  3D2R A;  5D7R A;  4GCZ A;  4NH7 A;  2YEF A;  2XDX A;  2IWX A;  3NMQ A;  4YKR A;  1EI1 A;  4XDM A;  2VWC A;  2YE6 A;  4Q20 A;  4CE2 A;  4XCL A;  4P8O A;  4QPK A;  1R62 A;  2H8M A;  4XIQ A;  2XAB A;  4EEH A;  4LP0 A;  4P7A A;  4GGL A;  2YEG A;  1GKZ A;  1US7 A;  1I5A A;  4K4O A;  4I3H A;  2Q8F A;  2C2A A;  4ZKI A;  4LWE A;  1TBW A;  4LWH A;  4W7T A;  4LWG A;  2XHX A;  4KSG A;  2O1W A;  1PVG A;  3B27 A;  3FT5 A;  4XE2 A;  2YGF A;  4XIT A;  3HZ5 A;  4PRV A;  5CTU A;  1AH8 A;  3K97 A;  1KIJ A;  4CWN A;  2K5B A;  4KQV A;  3VHC A;  3WQ9 A;  3ZKD A;  2YKJ A;  4URM A;  4ZVI A;  2CGF A;  3QTF A;  4JAS A;  4LWF A;  3OPD A;  4NH9 A;  1QZR A;  2WI5 A;  2FWZ A;  2Q8H A;  4URL A;  4O0B A;  4PL9 A;  4FCR A;  4V25 A;  1GJV A;  2XK2 A;  4L94 A;  4HXZ A;  3O6O A;  2Q8G A;  1TC0 A;  4KTN A;  4AWQ A;  4L90 A;  4ASB A;  1UYH A;  1ZWH A;  5FND A;  3QDD A;  4KP4 A;  5CPH A;  3T0Z A;  3T2S A;  1YC1 A;  3BMY A;  4X9L A;  4XD8 A;  2BRE A;  3RLQ A;  2HKJ A;  4B7P A;  2HCH A;  3C0E A;  5CTY A;  3FT8 A;  2YJX A;  4DUH A;  3RKZ A;  5M4P A;  5BOC A;  2UWD A;  4MPN A;  4EGH A;  2H55 A;  3GIG A;  3T0H A;  3GIG B;  1U0Z A;  3EHJ A;  2BT0 A;  4CWS A;  2CH4 A;  2BRC A;  1TH8 A;  1UYK A;  2WER A;  3WHA A;  1NHJ A;  3K98 A;  4YKY A;  1UYD A;  2YEA A;  1UYE A;  3EHF A;  5D7C A;  4L91 A;  4U7N A;  3TZ2 A;  4MPE A;  3Q5L A;  2YKB A;  3HZ1 A;  4WUB A;  2YE3 A;  4YKT A;  3G7B A;  1YES A;  4E02 A;  2YEE A;  2JKI A;  2GQP A;  4LWI A;  4URO A;  3TTZ A;  4ASG A;  1YT1 A;  4H7Q A;  2WI1 A;  2YE5 A;  1Y8P A;  3Q5J A;  3OWD A;  3PEH A;  1AH6 A;  1QY8 A;  3B24 A;  4CWP A;  5M4H A;  3R4P A;  4CE1 A;  1Z5C A;  4MOT A;  4R3A A;  4MBC A;  3A0Z A;  4XKO A;  5D6Q A;  3U2D A;  4XIP A;  3VHD A;  4HYP A;  5J6A A;  2WEP A;  4ASF A;  4YKX A;  4O04 A;  4XIR A;  4GQT A;  3H4L A;  4EGK A;  2CG9 A;  2BZ5 A;  4BAE A;  3K60 A;  4AWO A;  4XKK A;  2YE4 A;  1YT2 A;  2BYI A;  5C93 A;  2FXS A;  4CWT A;  1TIL A;  4JAV A;  2XHR A;  3HYZ A;  1B62 A;  1JM6 A;  3HYY A;  4BXI A;  3KE6 A;  4AWP A;  2E0A A;  2YEB A;  2IOR A;  2O1V A;  3C11 A;  4HY1 A;  2XCM A;  2CCS A;  2BU5 A;  3EKO A;  4CWQ A;  2QF6 A;  4GEE A;  2BU8 A;  2ZKJ A;  3CRK A;  1UYF A;  2FYP A;  5FNF A;  1BKN A;  2YGA A;  2YKE A;  3DGE A;  2WI7 A;  2WI2 A;  2Q2E B;  1YC3 A;  3OMU A;  2WI3 A;  2YE7 A;  1H7S A;  4MPC A;  4MP7 A;  3CGY A;  1Z5A A;  4CE3 A;  3B25 A;  3ZXQ A;  2VW5 A;  1I5D A;  4R1F A;  2IOP A;  1YC4 A;  4PU9 A;  4O05 A;  2GFD A;  3ZXO A;  2XHT A;  4EFU A;  3TZ5 A;  1MU5 A;  4JQL A;  3R4O A;  1BXD A;  3TUH A;  1UYG A;  1Y8O A;  2VCJ A;  4YKW A;  2CCT A;  2EXL A;  1A4H A;  3A0Y A;  2QG0 A;  1I58 A;  1NHH A;  3U67 A;  5IDJ A;  4URN A;  4XC0 A;  1UY6 A;  4FMT A;  3G75 A;  3EKR A;  4XCJ A;  2CCU A;  4WUD A;  1L0O A;  4AS9 A;  2YI0 A;  2BSM A;  2VCI A;  1ZXM A;  2XX5 A;  5M4N A;  3R4M A;  3VAD A;  4BQJ A;  2JJC A;  3D36 A;  4MP2 A;  3JZ3 A;  4E00 A;  3CRL A;  3OW6 A;  4LPB A;  4L8Z A;  1UY9 A;  1UY8 A;  5F5R A;  3INX A;  2BTZ A;  1AJ6 A;  1TID A;  3O0I A;  2ZDY A;  3LPS A;  1UYC A;  1NHI A;  3FV5 A;  4MB9 A;  4HZ5 A;  2YI6 A;  4EMV A;  1THN A;  5FNC A;  4XKA A;  2XJG A;  3IED A;  2WEQ A;  4YKQ A;  3HHU A;  5J71 A;  4I5S A;  3EHH A;  1YS3 A;  3R4N A;  4KSH A;  4V26 A;  2O1U A;  1ID0 A;  2XJJ A;  3H80 A;  4B6C A;  1Y8N A;  1I5C A;  4H81 A;  3B28 A;  2AKP A;  3BM9 A;  4FPP A;  4O07 A;  3R91 A;  2IWS A;  2XX4 A;  3HEK A;  4HZ0 A;  5CTX A;  1Z5B A;  1EA6 A;  3R92 A;  3A0W A;  1BGQ A;  1S14 A;  4JAU A;  5CTW A;  4KFG A;  3EHG A;  3SL2 A;  4O09 A;  2HG1 A;  2ESA A;  2YEC A;  4HY6 A;  4PRX A;  5CF0 A;  1Z59 A;  1U2O A;  1UYI A;  2YKC A;  1ZXN A;  3B26 A;  2XX2 A;  4YKZ A;  1UYM A;  1OSF A;  1UYL A;  1I59 A;  2QFO A;  4CWR A;  4EFT A;  5IN9 A;  1TC6 A;  2YE8 A;  3RLR A;  2QG2 A;  2YGE A;  5BOD A;  2WI6 A;  3GIF A;  3LNU A;  5L3J A;  3Q5K A;  4CWF A;  2BU2 A;  2BU6 A;  3K99 A;  4WUC A;  2PNR A;  4R3M A;  4U93 A;  5F3K A;  3T10 A;  2XJX A;  3MNR P;  3A0R A;  4HYM A;  3INW A;  1QYE A;  3TZ0 A;  3O2F A;  4U7O A;  3ZKB A;  1ZW9 A;  2YK9 A;  4L93 A;  2YE9 A;  1MX0 A;  1YET A;  2FWY A;  5D7D A;  3ZM7 A;  3TZ4 A;  5M4E A;  2YK2 A;  3D0B A;  5M4M A;  3RLP A;  1YSR A;  2IWU A;  4GFN A;  3T1K A;  4HXW A;  2XDS A;  4EM7 A;  2IOQ A;  3A0T A;  2XDK A;  4E01 A;  5M4K A;  5D6P A;  1GKX A;  4CWO A;  2WI4 A;  4ASA A;  4DZY A;  2XD6 A;  2YI5 A;  1B63 A;  4GT8 A;  3U2K A;  2YE2 A;  4QPJ A;  1YSZ A;  2YJW A;  2YED A;  1KZN A;  1H7U A;  4EGI A;  1Y4U A;  1UY7 A;  2ZBK B;  4XTJ A;  4FCP A;  2YEH A;  1I5B A;  4FCQ A;  5IDM A;  2YI7 A;  1BYQ A;  3CWV A;  4BQG A;  2Q8I A;  2YEI A;  1B3Q A;  3VHA A;  1YER A;  3PEJ A;  4H85 A;  5FWK A;  4NH8 A;  2XDL A;  1YT0 A;  1AMW A;  1S16 A;  3A0X A;  2XDU A;  1AM1 A; 
#chains in the Genus database with same CATH topology
 4BIU A;  1Y4S A;  3CGZ A;  2YKI A;  3G7E A;  2YEJ A;  2BYH A;  4YKU A;  4BIZ A;  3OWB A;  3GIE A;  5GGZ A;  2BU7 A;  2ZDX A;  3D2R A;  5D7R A;  4GCZ A;  4NH7 A;  2YEF A;  2XDX A;  2IWX A;  2HHI A;  3NMQ A;  4YKR A;  1EI1 A;  4XDM A;  2VWC A;  2YE6 A;  4Q20 A;  4CE2 A;  4XCL A;  4P8O A;  4QPK A;  1R62 A;  2H8M A;  4XIQ A;  2XAB A;  4EEH A;  4LP0 A;  4P7A A;  4GGL A;  2YEG A;  2C1I A;  1GKZ A;  1US7 A;  1I5A A;  4K4O A;  4I3H A;  2Q8F A;  2C2A A;  4ZKI A;  4LWE A;  1TBW A;  4LWH A;  4W7T A;  4LWG A;  2XHX A;  4KSG A;  2O1W A;  1PVG A;  3B27 A;  3FT5 A;  4XE2 A;  2YGF A;  4XIT A;  3HZ5 A;  4PRV A;  5CTU A;  1AH8 A;  3K97 A;  1KIJ A;  4CWN A;  2K5B A;  4KQV A;  3VHC A;  3WQ9 A;  3ZKD A;  2YKJ A;  4URM A;  4ZVI A;  2CGF A;  3QTF A;  4JAS A;  4LWF A;  3OPD A;  4NH9 A;  1IXM A;  1QZR A;  2WI5 A;  2FWZ A;  2Q8H A;  4URL A;  4O0B A;  4PL9 A;  4FCR A;  4V25 A;  1GJV A;  2XK2 A;  4L94 A;  4HXZ A;  3O6O A;  2Q8G A;  1TC0 A;  4KTN A;  4AWQ A;  4L90 A;  4ASB A;  1UYH A;  1ZWH A;  5FND A;  3QDD A;  4KP4 A;  5CPH A;  3T0Z A;  3T2S A;  1YC1 A;  3BMY A;  4X9L A;  4XD8 A;  2BRE A;  3RLQ A;  2HKJ A;  4B7P A;  2HCH A;  3C0E A;  5CTY A;  3FT8 A;  2YJX A;  4DUH A;  3RKZ A;  5M4P A;  5BOC A;  2UWD A;  4MPN A;  4EGH A;  2H55 A;  3GIG A;  3T0H A;  3GIG B;  1U0Z A;  3EHJ A;  2BT0 A;  4CWS A;  2CH4 A;  2BRC A;  1TH8 A;  1UYK A;  2WER A;  3WHA A;  1NHJ A;  3K98 A;  4YKY A;  1UYD A;  2YEA A;  1UYE A;  3EHF A;  5D7C A;  4L91 A;  4U7N A;  3TZ2 A;  4MPE A;  3Q5L A;  2YKB A;  3HZ1 A;  4WUB A;  2YE3 A;  4YKT A;  3G7B A;  1YES A;  4E02 A;  2YEE A;  3CYG A;  4E72 A;  2JKI A;  2GQP A;  4LWI A;  4URO A;  3TTZ A;  4ASG A;  1YT1 A;  4H7Q A;  2WI1 A;  2YE5 A;  1Y8P A;  3Q5J A;  3OWD A;  3PEH A;  1AH6 A;  1QY8 A;  3B24 A;  4CWP A;  5M4H A;  3R4P A;  4CE1 A;  1Z5C A;  4MOT A;  4R3A A;  4MBC A;  3A0Z A;  4XKO A;  5D6Q A;  3U2D A;  4XIP A;  3VHD A;  4HYP A;  5J6A A;  2WEP A;  4ASF A;  4YKX A;  4O04 A;  4XIR A;  4GQT A;  3H4L A;  4EGK A;  2CG9 A;  2BZ5 A;  4BAE A;  3K60 A;  4AWO A;  4XKK A;  2YE4 A;  1YT2 A;  2BYI A;  5C93 A;  2FXS A;  4CWT A;  1TIL A;  4JAV A;  2XHR A;  3HYZ A;  1B62 A;  1JM6 A;  3HYY A;  4BXI A;  3KE6 A;  4AWP A;  2E0A A;  2YEB A;  2IOR A;  2O1V A;  3C11 A;  4HY1 A;  2XCM A;  2CCS A;  2BU5 A;  3EKO A;  4CWQ A;  2QF6 A;  4GEE A;  2BU8 A;  2ZKJ A;  3CRK A;  1UYF A;  2FYP A;  5FNF A;  1BKN A;  2YGA A;  2YKE A;  3DGE A;  2WI7 A;  2WI2 A;  2Q2E B;  1YC3 A;  3OMU A;  2WI3 A;  2YE7 A;  1H7S A;  4MPC A;  3LMM A;  3CGY A;  4MP7 A;  1Z5A A;  4CE3 A;  3B25 A;  3ZXQ A;  2VW5 A;  1I5D A;  4R1F A;  2IOP A;  1YC4 A;  4PU9 A;  4O05 A;  2GFD A;  3ZXO A;  2XHT A;  4EFU A;  3TZ5 A;  1MU5 A;  4JQL A;  3R4O A;  1BXD A;  3TUH A;  1UYG A;  1Y8O A;  2VCJ A;  4YKW A;  2CCT A;  2EXL A;  1A4H A;  3A0Y A;  2QG0 A;  1I58 A;  1NHH A;  3U67 A;  5IDJ A;  4URN A;  4XC0 A;  1UY6 A;  4FMT A;  3G75 A;  3EKR A;  4XCJ A;  2CCU A;  4WUD A;  1L0O A;  4AS9 A;  2YI0 A;  2BSM A;  2VCI A;  1ZXM A;  2XX5 A;  5M4N A;  3R4M A;  3VAD A;  4BQJ A;  2JJC A;  3D36 A;  4MP2 A;  3JZ3 A;  4E00 A;  3CRL A;  3OW6 A;  4LPB A;  4L8Z A;  1UY9 A;  1UY8 A;  2C1G A;  5F5R A;  3INX A;  2BTZ A;  1AJ6 A;  1TID A;  3O0I A;  2ZDY A;  3LPS A;  1UYC A;  1NHI A;  3FV5 A;  4MB9 A;  4HZ5 A;  2YI6 A;  2FTK A;  4EMV A;  1THN A;  5FNC A;  4XKA A;  2XJG A;  3IED A;  2WEQ A;  4YKQ A;  3HHU A;  5J71 A;  4I5S A;  3EHH A;  1YS3 A;  3R4N A;  4KSH A;  4V26 A;  2O1U A;  1ID0 A;  2XJJ A;  3H80 A;  4B6C A;  1Y8N A;  1I5C A;  4H81 A;  3B28 A;  2AKP A;  3BM9 A;  4FPP A;  4O07 A;  3R91 A;  2IWS A;  2XX4 A;  3HEK A;  4HZ0 A;  5CTX A;  1Z5B A;  1EA6 A;  3R92 A;  3A0W A;  1BGQ A;  1S14 A;  4JAU A;  5CTW A;  4KFG A;  3EHG A;  3SL2 A;  4O09 A;  2HG1 A;  2ESA A;  2YEC A;  4HY6 A;  4PRX A;  5CF0 A;  1Z59 A;  1U2O A;  1UYI A;  2YKC A;  1ZXN A;  3S5T A;  3B26 A;  2XX2 A;  4YKZ A;  1UYM A;  1OSF A;  1UYL A;  1I59 A;  2QFO A;  4CWR A;  4EFT A;  5IN9 A;  1TC6 A;  2YE8 A;  3RLR A;  2QG2 A;  2YGE A;  5BOD A;  2WI6 A;  3GIF A;  3LNU A;  5L3J A;  3Q5K A;  4CWF A;  2BU2 A;  2BU6 A;  3K99 A;  4WUC A;  2PNR A;  4R3M A;  4U93 A;  5F3K A;  3T10 A;  2XJX A;  3MNR P;  3A0R A;  4HYM A;  3INW A;  1QYE A;  3TZ0 A;  3O2F A;  4U7O A;  3ZKB A;  1ZW9 A;  2YK9 A;  4L93 A;  2YE9 A;  1MX0 A;  1YET A;  2FWY A;  5D7D A;  3ZM7 A;  3TZ4 A;  5M4E A;  2YK2 A;  3D0B A;  5M4M A;  3RLP A;  1YSR A;  2IWU A;  4GFN A;  3T1K A;  4HXW A;  2XDS A;  4EM7 A;  2IOQ A;  3A0T A;  2XDK A;  4E01 A;  5M4K A;  5D6P A;  1GKX A;  4CWO A;  2WI4 A;  4ASA A;  4DZY A;  2XD6 A;  2YI5 A;  1B63 A;  5JEN A;  4GT8 A;  3U2K A;  2YE2 A;  4QPJ A;  1YSZ A;  2YJW A;  2YED A;  1KZN A;  1H7U A;  4EGI A;  1Y4U A;  1F51 A;  1UY7 A;  2ZBK B;  4XTJ A;  4FCP A;  2YEH A;  1I5B A;  4FCQ A;  5IDM A;  2YI7 A;  1BYQ A;  3CWV A;  4BQG A;  2Q8I A;  2YEI A;  1B3Q A;  3VHA A;  1YER A;  3PEJ A;  4H85 A;  5FWK A;  4NH8 A;  2XDL A;  1YT0 A;  1AMW A;  1S16 A;  3A0X A;  2XDU A;  1AM1 A; 
#chains in the Genus database with same CATH homology
 4BIU A;  1Y4S A;  3CGZ A;  2YKI A;  3G7E A;  2YEJ A;  2BYH A;  4YKU A;  4BIZ A;  3OWB A;  3GIE A;  5GGZ A;  2BU7 A;  2ZDX A;  3D2R A;  5D7R A;  4GCZ A;  4NH7 A;  2YEF A;  2XDX A;  2IWX A;  3NMQ A;  4YKR A;  1EI1 A;  4XDM A;  2VWC A;  2YE6 A;  4Q20 A;  4CE2 A;  4XCL A;  4P8O A;  4QPK A;  1R62 A;  2H8M A;  4XIQ A;  2XAB A;  4EEH A;  4LP0 A;  4P7A A;  4GGL A;  2YEG A;  1GKZ A;  1US7 A;  1I5A A;  4K4O A;  4I3H A;  2Q8F A;  2C2A A;  4ZKI A;  4LWE A;  1TBW A;  4LWH A;  4W7T A;  4LWG A;  2XHX A;  4KSG A;  2O1W A;  1PVG A;  3B27 A;  3FT5 A;  4XE2 A;  2YGF A;  4XIT A;  3HZ5 A;  4PRV A;  5CTU A;  1AH8 A;  3K97 A;  1KIJ A;  4CWN A;  2K5B A;  4KQV A;  3VHC A;  3WQ9 A;  3ZKD A;  2YKJ A;  4URM A;  4ZVI A;  2CGF A;  3QTF A;  4JAS A;  4LWF A;  3OPD A;  4NH9 A;  1QZR A;  2WI5 A;  2FWZ A;  2Q8H A;  4URL A;  4O0B A;  4PL9 A;  4FCR A;  4V25 A;  1GJV A;  2XK2 A;  4L94 A;  4HXZ A;  3O6O A;  2Q8G A;  1TC0 A;  4KTN A;  4AWQ A;  4L90 A;  4ASB A;  1UYH A;  1ZWH A;  5FND A;  3QDD A;  4KP4 A;  5CPH A;  3T0Z A;  3T2S A;  1YC1 A;  3BMY A;  4X9L A;  4XD8 A;  2BRE A;  3RLQ A;  2HKJ A;  4B7P A;  2HCH A;  3C0E A;  5CTY A;  3FT8 A;  2YJX A;  4DUH A;  3RKZ A;  5M4P A;  5BOC A;  2UWD A;  4MPN A;  4EGH A;  2H55 A;  3GIG A;  3T0H A;  3GIG B;  1U0Z A;  3EHJ A;  2BT0 A;  4CWS A;  2CH4 A;  2BRC A;  1TH8 A;  1UYK A;  2WER A;  3WHA A;  1NHJ A;  3K98 A;  4YKY A;  1UYD A;  2YEA A;  1UYE A;  3EHF A;  5D7C A;  4L91 A;  4U7N A;  3TZ2 A;  4MPE A;  3Q5L A;  2YKB A;  3HZ1 A;  4WUB A;  2YE3 A;  4YKT A;  3G7B A;  1YES A;  4E02 A;  2YEE A;  2JKI A;  2GQP A;  4LWI A;  4URO A;  3TTZ A;  4ASG A;  1YT1 A;  4H7Q A;  2WI1 A;  2YE5 A;  1Y8P A;  3Q5J A;  3OWD A;  3PEH A;  1AH6 A;  1QY8 A;  3B24 A;  4CWP A;  5M4H A;  3R4P A;  4CE1 A;  1Z5C A;  4MOT A;  4R3A A;  4MBC A;  3A0Z A;  4XKO A;  5D6Q A;  3U2D A;  4XIP A;  3VHD A;  4HYP A;  5J6A A;  2WEP A;  4ASF A;  4YKX A;  4O04 A;  4XIR A;  4GQT A;  3H4L A;  4EGK A;  2CG9 A;  2BZ5 A;  4BAE A;  3K60 A;  4AWO A;  4XKK A;  2YE4 A;  1YT2 A;  2BYI A;  5C93 A;  2FXS A;  4CWT A;  1TIL A;  4JAV A;  2XHR A;  3HYZ A;  1B62 A;  1JM6 A;  3HYY A;  4BXI A;  3KE6 A;  4AWP A;  2E0A A;  2YEB A;  2IOR A;  2O1V A;  3C11 A;  4HY1 A;  2XCM A;  2CCS A;  2BU5 A;  3EKO A;  4CWQ A;  2QF6 A;  4GEE A;  2BU8 A;  2ZKJ A;  3CRK A;  1UYF A;  2FYP A;  5FNF A;  1BKN A;  2YGA A;  2YKE A;  3DGE A;  2WI7 A;  2WI2 A;  2Q2E B;  1YC3 A;  3OMU A;  2WI3 A;  2YE7 A;  1H7S A;  4MPC A;  4MP7 A;  3CGY A;  1Z5A A;  4CE3 A;  3B25 A;  3ZXQ A;  2VW5 A;  1I5D A;  4R1F A;  2IOP A;  1YC4 A;  4PU9 A;  4O05 A;  2GFD A;  3ZXO A;  2XHT A;  4EFU A;  3TZ5 A;  1MU5 A;  4JQL A;  3R4O A;  1BXD A;  3TUH A;  1UYG A;  1Y8O A;  2VCJ A;  4YKW A;  2CCT A;  2EXL A;  1A4H A;  3A0Y A;  2QG0 A;  1I58 A;  1NHH A;  3U67 A;  5IDJ A;  4URN A;  4XC0 A;  1UY6 A;  4FMT A;  3G75 A;  3EKR A;  4XCJ A;  2CCU A;  4WUD A;  1L0O A;  4AS9 A;  2YI0 A;  2BSM A;  2VCI A;  1ZXM A;  2XX5 A;  5M4N A;  3R4M A;  3VAD A;  4BQJ A;  2JJC A;  3D36 A;  4MP2 A;  3JZ3 A;  4E00 A;  3CRL A;  3OW6 A;  4LPB A;  4L8Z A;  1UY9 A;  1UY8 A;  5F5R A;  3INX A;  2BTZ A;  1AJ6 A;  1TID A;  3O0I A;  2ZDY A;  3LPS A;  1UYC A;  1NHI A;  3FV5 A;  4MB9 A;  4HZ5 A;  2YI6 A;  4EMV A;  1THN A;  5FNC A;  4XKA A;  2XJG A;  3IED A;  2WEQ A;  4YKQ A;  3HHU A;  5J71 A;  4I5S A;  3EHH A;  1YS3 A;  3R4N A;  4KSH A;  4V26 A;  2O1U A;  1ID0 A;  2XJJ A;  3H80 A;  4B6C A;  1Y8N A;  1I5C A;  4H81 A;  3B28 A;  2AKP A;  3BM9 A;  4FPP A;  4O07 A;  3R91 A;  2IWS A;  2XX4 A;  3HEK A;  4HZ0 A;  5CTX A;  1Z5B A;  1EA6 A;  3R92 A;  3A0W A;  1BGQ A;  1S14 A;  4JAU A;  5CTW A;  4KFG A;  3EHG A;  3SL2 A;  4O09 A;  2HG1 A;  2ESA A;  2YEC A;  4HY6 A;  4PRX A;  5CF0 A;  1Z59 A;  1U2O A;  1UYI A;  2YKC A;  1ZXN A;  3B26 A;  2XX2 A;  4YKZ A;  1UYM A;  1OSF A;  1UYL A;  1I59 A;  2QFO A;  4CWR A;  4EFT A;  5IN9 A;  1TC6 A;  2YE8 A;  3RLR A;  2QG2 A;  2YGE A;  5BOD A;  2WI6 A;  3GIF A;  3LNU A;  5L3J A;  3Q5K A;  4CWF A;  2BU2 A;  2BU6 A;  3K99 A;  4WUC A;  2PNR A;  4R3M A;  4U93 A;  5F3K A;  3T10 A;  2XJX A;  3MNR P;  3A0R A;  4HYM A;  3INW A;  1QYE A;  3TZ0 A;  3O2F A;  4U7O A;  3ZKB A;  1ZW9 A;  2YK9 A;  4L93 A;  2YE9 A;  1MX0 A;  1YET A;  2FWY A;  5D7D A;  3ZM7 A;  3TZ4 A;  5M4E A;  2YK2 A;  3D0B A;  5M4M A;  3RLP A;  1YSR A;  2IWU A;  4GFN A;  3T1K A;  4HXW A;  2XDS A;  4EM7 A;  2IOQ A;  3A0T A;  2XDK A;  4E01 A;  5M4K A;  5D6P A;  1GKX A;  4CWO A;  2WI4 A;  4ASA A;  4DZY A;  2XD6 A;  2YI5 A;  1B63 A;  4GT8 A;  3U2K A;  2YE2 A;  4QPJ A;  1YSZ A;  2YJW A;  2YED A;  1KZN A;  1H7U A;  4EGI A;  1Y4U A;  1UY7 A;  2ZBK B;  4XTJ A;  4FCP A;  2YEH A;  1I5B A;  4FCQ A;  5IDM A;  2YI7 A;  1BYQ A;  3CWV A;  4BQG A;  2Q8I A;  2YEI A;  1B3Q A;  3VHA A;  1YER A;  3PEJ A;  4H85 A;  5FWK A;  4NH8 A;  2XDL A;  1YT0 A;  1AMW A;  1S16 A;  3A0X A;  2XDU A;  1AM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...