1AJ6A

Novobiocin-resistant mutant (r136h) of the n-terminal 24 kda fragment of dna gyrase b complexed with novobiocin at 2.3 angstroms resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
194
Chain Sequence
b'VLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGGLHGVGVSVVNALSQKLELVIQHEGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GYRASE
publication title The entropic penalty of ordered water accounts for weaker binding of the antibiotic novobiocin to a resistant mutant of DNA gyrase: a thermodynamic and crystallographic study.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Topoisomerase
total genus 61
structure length 194
sequence length 206
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1aj6A00
2O1UA 2IWXA 4WUDA 2YKIA 4HY1A 3SL2A 3D36A 2YKJA 3G7BA 4YKTA 3CRLA 1QYEA 3LPSA 4LWIA 4BAEA 1AMWA 1TILA 2XHXA 4X9LA 3TZ2A 5M4PA 4ZVIA 3HYYA 3H80A 3GIGA 1TIDA 4E01A 2YEDA 4L93A 2YGFA 3EKRA 4ASAA 1Z5AA 1ZW9A 3ZXQA 2YE3A 5CTYA 3TTZA 3OW6A 3K97A 4H7QA 1UYCA 4AWOA 2ZDYA 3GIFA 1UYFA 3TZ0A 3CGZA 3LNUA 2XX4A 3FV5A 3U67A 2VWCA 5IN9A 2FYPA 2HKJA 2YJWA 4V25A 3U2DA 4DUHA 3A0XA 2C2AA 3R92A 3VHDA 3DGEA 5BOCA 4H81A 2E0AA 3QDDA 3H4LA 3RLQA 4CE2A 1KIJA 1TBWA 2Q8FA 1Y4SA 2XX2A 4XE2A 1Z5BA 5M4HA 3EHGA 3PEJA 4XTJA 2YI5A 1UY6A 4LP0A 2YE8A 2CCUA 1YC4A 4GEEA 2IOPA 2YEEA 3GIEA 3D2RA 2WI6A 4URLA 4Q20A 5BODA 2FWZA 2IWUA 1YC3A 2YE5A 2WEQA 4P8OA 3EHJA 1BKNA 4P7AA 2FWYA 3BMYA 3T2SA 5IDJA 4U7NA 1UYEA 4JAVA 3HYZA 2BSMA 3HZ1A 4QPKA 4LWEA 4W7TA 2ZBKB 2YEHA 2FXSA 4PU9A 2GQPA 2CGFA 1PVGA 1YT1A 3BM9A 2YKCA 1I59A 4L91A 2YK9A 4EEHA 3EHHA 4KSHA 4XD8A 3ZM7A 1EI1A 4LWFA 4ZKIA 3B24A 1OSFA 5D7CA 1BYQA 1ZXNA 4FMTA 5D7DA 4AWQA 4B7PA 2Q8GA 1BGQA 3GIGB 4CWSA 1YSZA 1B63A 3ZKBA 4YKXA 4YKQA 2YE4A 4V26A 5FNFA 5J6AA 2CG9A 4XC0A 4NH7A 2YE2A 1Y4UA 2YI6A 1ZWHA 4XKOA 5CF0A 3OWBA 2ESAA 5GGZA 2H8MA 2JKIA 4BIUA 4CWNA 1GKZA 3HHUA 4GFNA 4O0BA 1GKXA 1ZXMA 4O07A 3FT8A 3QTFA 1UYMA 4XDMA 3C0EA 2BU2A 2IOQA 4FCQA 4YKWA 4CWFA 3CWVA 2YI7A 3K99A 3T10A 1Z5CA 3CGYA 1Y8OA 4EGIA 4B6CA 3T0ZA 4YKZA 4XCLA 4HYPA 3RLPA 3EKOA 5CTUA 3T1KA 3B26A 2QG0A 2YECA 4WUBA 4HZ5A 3K60A 3ZKDA 2XJXA 2YEIA 3KE6A 3O0IA 4GCZA 1YESA 2BT0A 4BXIA 4XKAA 1YC1A 4URMA 4MP2A 4PRXA 1TH8A 2IORA 2AKPA 3TUHA 3K98A 4E02A 2CCTA 4XKKA 2XJGA 2WERA 2QG2A 2YEBA 4R3AA 2BREA 1I5DA 2YK2A 3R4PA 3R4NA 4JQLA 1I5CA 2YKEA 1H7UA 4MPCA 1NHJA 2WI7A 4R1FA 4HXZA 2ZKJA 1KZNA 4L94A 4BQGA 2BZ5A 4NH9A 3JZ3A 1TC6A 4UROA 2ZDXA 3INWA 4FCPA 4GGLA 4HZ0A 1QY8A 2IWSA 4URNA 4L8ZA 4O05A 2YGAA 2YE7A 4LWGA 3WHAA 5D6QA 1YS3A 1I5AA 3B27A 2WI5A 4AS9A 1MX0A 1S14A 2XDKA 4PRVA 3ZXOA 4JASA 4PL9A 4MPEA 3WQ9A 4XIPA 5FNCA 4FPPA 3VHCA 5FNDA 2WEPA 4KQVA 2XX5A 4BQJA 1YT2A 1UY8A 1JM6A 2YKBA 2CH4A 2BRCA 4KTNA 3R4MA 4XIRA 5M4MA 2YE9A 2YEJA 3Q5LA 3A0ZA 2JJCA 1NHHA 4DZYA 3VHAA 1NHIA 4ASBA 4EFUA 2Q8HA 3A0RA 4EMVA 4NH8A 4QPJA 2HCHA 2WI2A 5M4NA 5D6PA 5M4KA 1U0ZA 4MPNA 4CE3A 2QF6A 2XABA 4BIZA 4U7OA 4YKUA 1L0OA 1UYGA 4KFGA 4O09A 1THNA 2Q2EB 4XITA 5J71A 2EXLA 2YEAA 2XK2A 2YJXA 1R62A 2VW5A 1Y8NA 3OWDA 4CWRA 2O1VA 3HZ5A 1TC0A 2XHTA 4K4OA 4EGHA 3O2FA 3D0BA 3A0YA 1MU5A 2VCIA 2XDUA 1AJ6A 2UWDA 5M4EA 1YERA 2YGEA 3TZ5A 4EFTA 1UYIA 2YEGA 2BYIA 1B62A 2H55A 3CRKA 4XCJA 4XIQA 1S16A 4WUCA 3PEHA 2WI4A 4YKYA 3VADA 4KSGA 3EHFA 1Y8PA 4LPBA 2CCSA 4EGKA 1UYKA 4LWHA 4R3MA 4CWOA 2K5BA 1GJVA 1UYDA 1YETA 3RKZA 4MB9A 2QFOA 4ASFA 1AH8A 4I5SA 4O04A 4H85A 2XDLA 2YI0A 4EM7A 3INXA 2YE6A 3A0TA 2XDSA 4CWPA 2PNRA 4MP7A 3R91A 3O6OA 1BXDA 4ASGA 4AWPA 3R4OA 5IDMA 5C93A 3B28A 5D7RA 2XJJA 3OMUA 3MNRP 3RLRA 1Z59A 4YKRA 1U2OA 5CTXA 3G7EA 2BU8A 4KP4A 3Q5KA 2BU5A 3B25A 3TZ4A 2XD6A 3HEKA 4FCRA 4U93A 2VCJA 3FT5A 4I3HA 4CWTA 2BTZA 2BU6A 2HG1A 1B3QA 1YSRA 3OPDA 4HY6A 5F3KA 4L90A 3G75A 2WI1A 3A0WA 2BU7A 1QZRA 1ID0A 3Q5JA 4HYMA 4MBCA 2YEFA 4CWQA 2XCMA 3C11A 5CTWA 2BYHA 1US7A 1I5BA 2Q8IA 3T0HA 1I58A 1UYLA 5FWKA 4MOTA 1UY7A 5L3JA 2GFDA 3U2KA 4JAUA 4HXWA 2XDXA 4CE1A 2XHRA 3IEDA 2WI3A 1EA6A 2O1WA 5CPHA 1AM1A 1UY9A 1UYHA 4GQTA 4E00A 1H7SA 4GT8A 5F5RA 1AH6A 1YT0A 3NMQA 1A4HA
chains in the Genus database with same CATH superfamily
2O1UA 2IWXA 4WUDA 2YKIA 4HY1A 3SL2A 3D36A 2YKJA 3G7BA 4YKTA 3CRLA 1QYEA 3LPSA 4LWIA 4BAEA 1AMWA 1TILA 2XHXA 4X9LA 3TZ2A 5M4PA 4ZVIA 3HYYA 3H80A 3GIGA 1TIDA 2FTKA 4E01A 2YEDA 4L93A 2YGFA 3S5TA 3EKRA 4ASAA 1Z5AA 1ZW9A 2C1IA 2YE3A 3ZXQA 5CTYA 3TTZA 3OW6A 3K97A 4H7QA 1UYCA 4AWOA 2ZDYA 3GIFA 1UYFA 3TZ0A 3CGZA 4E72A 3LNUA 2XX4A 3FV5A 3U67A 2VWCA 5IN9A 2FYPA 2HKJA 2YJWA 4V25A 3U2DA 4DUHA 3A0XA 2C2AA 3R92A 3VHDA 3DGEA 5BOCA 4H81A 2E0AA 3QDDA 3H4LA 3RLQA 4CE2A 1KIJA 1TBWA 2Q8FA 1Y4SA 2XX2A 4XE2A 1F51A 1Z5BA 5M4HA 3EHGA 3PEJA 4XTJA 2YI5A 1UY6A 4LP0A 2YE8A 2CCUA 1YC4A 4GEEA 2IOPA 2YEEA 3GIEA 3D2RA 2WI6A 4URLA 4Q20A 5BODA 2FWZA 2IWUA 1YC3A 2YE5A 2WEQA 4P8OA 3EHJA 1BKNA 4P7AA 2FWYA 3BMYA 3T2SA 5IDJA 4U7NA 1UYEA 4JAVA 3HYZA 2BSMA 3HZ1A 4QPKA 4LWEA 4W7TA 2ZBKB 2YEHA 2FXSA 4PU9A 2GQPA 2CGFA 1PVGA 1YT1A 3BM9A 2YKCA 3CYGA 1I59A 4L91A 2YK9A 4EEHA 3EHHA 4KSHA 4XD8A 3ZM7A 1EI1A 4LWFA 4ZKIA 3B24A 1OSFA 5D7CA 1BYQA 1ZXNA 4FMTA 5D7DA 4AWQA 4B7PA 2Q8GA 1BGQA 3GIGB 4CWSA 1YSZA 1B63A 3ZKBA 4YKXA 4YKQA 2YE4A 4V26A 5FNFA 5J6AA 2CG9A 4XC0A 4NH7A 2YE2A 1Y4UA 2YI6A 5JENA 1ZWHA 4XKOA 5CF0A 3OWBA 2ESAA 5GGZA 2H8MA 2JKIA 4BIUA 4CWNA 1GKZA 3HHUA 4GFNA 4O0BA 1GKXA 1ZXMA 4O07A 3FT8A 3QTFA 1UYMA 4XDMA 3C0EA 2BU2A 2IOQA 4FCQA 4YKWA 4CWFA 3CWVA 2YI7A 3K99A 3T10A 1Z5CA 3CGYA 1Y8OA 4EGIA 4B6CA 3T0ZA 4YKZA 4XCLA 4HYPA 3RLPA 2HHIA 3EKOA 5CTUA 3T1KA 3B26A 2QG0A 2YECA 4WUBA 4HZ5A 3K60A 3ZKDA 2XJXA 2YEIA 3KE6A 3O0IA 4GCZA 1YESA 2BT0A 4BXIA 4XKAA 1YC1A 4URMA 4MP2A 4PRXA 1TH8A 2IORA 2AKPA 3TUHA 3K98A 4E02A 2CCTA 4XKKA 2XJGA 2WERA 2QG2A 2YEBA 4R3AA 2BREA 1I5DA 2YK2A 3R4PA 3R4NA 4JQLA 2C1GA 1I5CA 2YKEA 1H7UA 4MPCA 1NHJA 2WI7A 4R1FA 4HXZA 2ZKJA 1KZNA 4L94A 4BQGA 2BZ5A 4NH9A 3JZ3A 1TC6A 4UROA 2ZDXA 3INWA 4FCPA 4GGLA 4HZ0A 1QY8A 2IWSA 4URNA 4L8ZA 4O05A 2YGAA 2YE7A 4LWGA 3WHAA 5D6QA 1YS3A 1I5AA 3B27A 2WI5A 4AS9A 1MX0A 1S14A 2XDKA 4PRVA 3ZXOA 4JASA 4PL9A 4MPEA 3WQ9A 4XIPA 5FNCA 4FPPA 3VHCA 5FNDA 2WEPA 4KQVA 2XX5A 4BQJA 1YT2A 1UY8A 1JM6A 2YKBA 2CH4A 2BRCA 4KTNA 3R4MA 4XIRA 5M4MA 2YE9A 2YEJA 3Q5LA 3A0ZA 2JJCA 1NHHA 4DZYA 3VHAA 1NHIA 4ASBA 4EFUA 2Q8HA 3A0RA 4EMVA 4NH8A 4QPJA 2HCHA 2WI2A 5M4NA 5D6PA 5M4KA 1U0ZA 4MPNA 4CE3A 2QF6A 2XABA 4BIZA 4U7OA 4YKUA 1L0OA 1UYGA 4KFGA 4O09A 1THNA 2Q2EB 4XITA 5J71A 2EXLA 2YEAA 2XK2A 2YJXA 1R62A 2VW5A 1Y8NA 3OWDA 4CWRA 2O1VA 3HZ5A 1TC0A 2XHTA 4K4OA 4EGHA 3O2FA 3D0BA 3A0YA 1MU5A 2VCIA 2XDUA 1AJ6A 2UWDA 5M4EA 1YERA 2YGEA 3TZ5A 4EFTA 1UYIA 2YEGA 2BYIA 1B62A 2H55A 3CRKA 4XCJA 4XIQA 1S16A 4WUCA 3PEHA 2WI4A 4YKYA 3VADA 4KSGA 3EHFA 1Y8PA 4LPBA 2CCSA 4EGKA 1UYKA 4LWHA 4R3MA 4CWOA 2K5BA 1GJVA 1UYDA 1YETA 3RKZA 4MB9A 2QFOA 4ASFA 1AH8A 4I5SA 4O04A 4H85A 2XDLA 2YI0A 4EM7A 3INXA 2YE6A 3A0TA 2XDSA 4CWPA 2PNRA 4MP7A 3R91A 3O6OA 1BXDA 4ASGA 4AWPA 3R4OA 5IDMA 5C93A 3B28A 5D7RA 2XJJA 3OMUA 3MNRP 3RLRA 1Z59A 4YKRA 1U2OA 5CTXA 3G7EA 2BU8A 4KP4A 3Q5KA 2BU5A 3B25A 3TZ4A 2XD6A 3HEKA 4FCRA 4U93A 2VCJA 3FT5A 4I3HA 4CWTA 2BTZA 2BU6A 2HG1A 1B3QA 1YSRA 3OPDA 4HY6A 5F3KA 4L90A 3G75A 2WI1A 3A0WA 2BU7A 1QZRA 1ID0A 3Q5JA 4HYMA 4MBCA 2YEFA 4CWQA 2XCMA 3C11A 5CTWA 2BYHA 1US7A 1I5BA 1IXMA 2Q8IA 3T0HA 1I58A 1UYLA 5FWKA 4MOTA 1UY7A 5L3JA 2GFDA 3U2KA 4JAUA 4HXWA 2XDXA 4CE1A 2XHRA 3IEDA 2WI3A 1EA6A 2O1WA 5CPHA 1AM1A 3LMMA 1UY9A 1UYHA 4GQTA 4E00A 1H7SA 4GT8A 5F5RA 1AH6A 1YT0A 3NMQA 1A4HA
chains in the Genus database with same CATH topology
2O1UA 2IWXA 4WUDA 2YKIA 4HY1A 3SL2A 3D36A 2YKJA 3G7BA 4YKTA 3CRLA 1QYEA 3LPSA 4LWIA 4BAEA 1AMWA 1TILA 2XHXA 4X9LA 3TZ2A 5M4PA 4ZVIA 3HYYA 3H80A 3GIGA 1TIDA 4E01A 2YEDA 4L93A 2YGFA 3EKRA 4ASAA 1Z5AA 1ZW9A 3ZXQA 2YE3A 5CTYA 3TTZA 3OW6A 3K97A 4H7QA 1UYCA 4AWOA 2ZDYA 3GIFA 1UYFA 3TZ0A 3CGZA 3LNUA 2XX4A 3FV5A 3U67A 2VWCA 5IN9A 2FYPA 2HKJA 2YJWA 4V25A 3U2DA 4DUHA 3A0XA 2C2AA 3R92A 3VHDA 3DGEA 5BOCA 4H81A 2E0AA 3QDDA 3H4LA 3RLQA 4CE2A 1KIJA 1TBWA 2Q8FA 1Y4SA 2XX2A 4XE2A 1Z5BA 5M4HA 3EHGA 3PEJA 4XTJA 2YI5A 1UY6A 4LP0A 2YE8A 2CCUA 1YC4A 4GEEA 2IOPA 2YEEA 3GIEA 3D2RA 2WI6A 4URLA 4Q20A 5BODA 2FWZA 2IWUA 1YC3A 2YE5A 2WEQA 4P8OA 3EHJA 1BKNA 4P7AA 2FWYA 3BMYA 3T2SA 5IDJA 4U7NA 1UYEA 4JAVA 3HYZA 2BSMA 3HZ1A 4QPKA 4LWEA 4W7TA 2ZBKB 2YEHA 2FXSA 4PU9A 2GQPA 2CGFA 1PVGA 1YT1A 3BM9A 2YKCA 1I59A 4L91A 2YK9A 4EEHA 3EHHA 4KSHA 4XD8A 3ZM7A 1EI1A 4LWFA 4ZKIA 3B24A 1OSFA 5D7CA 1BYQA 1ZXNA 4FMTA 5D7DA 4AWQA 4B7PA 2Q8GA 1BGQA 3GIGB 4CWSA 1YSZA 1B63A 3ZKBA 4YKXA 4YKQA 2YE4A 4V26A 5FNFA 5J6AA 2CG9A 4XC0A 4NH7A 2YE2A 1Y4UA 2YI6A 1ZWHA 4XKOA 5CF0A 3OWBA 2ESAA 5GGZA 2H8MA 2JKIA 4BIUA 4CWNA 1GKZA 3HHUA 4GFNA 4O0BA 1GKXA 1ZXMA 4O07A 3FT8A 3QTFA 1UYMA 4XDMA 3C0EA 2BU2A 2IOQA 4FCQA 4YKWA 4CWFA 3CWVA 2YI7A 3K99A 3T10A 1Z5CA 3CGYA 1Y8OA 4EGIA 4B6CA 3T0ZA 4YKZA 4XCLA 4HYPA 3RLPA 3EKOA 5CTUA 3T1KA 3B26A 2QG0A 2YECA 4WUBA 4HZ5A 3K60A 3ZKDA 2XJXA 2YEIA 3KE6A 3O0IA 4GCZA 1YESA 2BT0A 4BXIA 4XKAA 1YC1A 4URMA 4MP2A 4PRXA 1TH8A 2IORA 2AKPA 3TUHA 3K98A 4E02A 2CCTA 4XKKA 2XJGA 2WERA 2QG2A 2YEBA 4R3AA 2BREA 1I5DA 2YK2A 3R4PA 3R4NA 4JQLA 1I5CA 2YKEA 1H7UA 4MPCA 1NHJA 2WI7A 4R1FA 4HXZA 2ZKJA 1KZNA 4L94A 4BQGA 2BZ5A 4NH9A 3JZ3A 1TC6A 4UROA 2ZDXA 3INWA 4FCPA 4GGLA 4HZ0A 1QY8A 2IWSA 4URNA 4L8ZA 4O05A 2YGAA 2YE7A 4LWGA 3WHAA 5D6QA 1YS3A 1I5AA 3B27A 2WI5A 4AS9A 1MX0A 1S14A 2XDKA 4PRVA 3ZXOA 4JASA 4PL9A 4MPEA 3WQ9A 4XIPA 5FNCA 4FPPA 3VHCA 5FNDA 2WEPA 4KQVA 2XX5A 4BQJA 1YT2A 1UY8A 1JM6A 2YKBA 2CH4A 2BRCA 4KTNA 3R4MA 4XIRA 5M4MA 2YE9A 2YEJA 3Q5LA 3A0ZA 2JJCA 1NHHA 4DZYA 3VHAA 1NHIA 4ASBA 4EFUA 2Q8HA 3A0RA 4EMVA 4NH8A 4QPJA 2HCHA 2WI2A 5M4NA 5D6PA 5M4KA 1U0ZA 4MPNA 4CE3A 2QF6A 2XABA 4BIZA 4U7OA 4YKUA 1L0OA 1UYGA 4KFGA 4O09A 1THNA 2Q2EB 4XITA 5J71A 2EXLA 2YEAA 2XK2A 2YJXA 1R62A 2VW5A 1Y8NA 3OWDA 4CWRA 2O1VA 3HZ5A 1TC0A 2XHTA 4K4OA 4EGHA 3O2FA 3D0BA 3A0YA 1MU5A 2VCIA 2XDUA 1AJ6A 2UWDA 5M4EA 1YERA 2YGEA 3TZ5A 4EFTA 1UYIA 2YEGA 2BYIA 1B62A 2H55A 3CRKA 4XCJA 4XIQA 1S16A 4WUCA 3PEHA 2WI4A 4YKYA 3VADA 4KSGA 3EHFA 1Y8PA 4LPBA 2CCSA 4EGKA 1UYKA 4LWHA 4R3MA 4CWOA 2K5BA 1GJVA 1UYDA 1YETA 3RKZA 4MB9A 2QFOA 4ASFA 1AH8A 4I5SA 4O04A 4H85A 2XDLA 2YI0A 4EM7A 3INXA 2YE6A 3A0TA 2XDSA 4CWPA 2PNRA 4MP7A 3R91A 3O6OA 1BXDA 4ASGA 4AWPA 3R4OA 5IDMA 5C93A 3B28A 5D7RA 2XJJA 3OMUA 3MNRP 3RLRA 1Z59A 4YKRA 1U2OA 5CTXA 3G7EA 2BU8A 4KP4A 3Q5KA 2BU5A 3B25A 3TZ4A 2XD6A 3HEKA 4FCRA 4U93A 2VCJA 3FT5A 4I3HA 4CWTA 2BTZA 2BU6A 2HG1A 1B3QA 1YSRA 3OPDA 4HY6A 5F3KA 4L90A 3G75A 2WI1A 3A0WA 2BU7A 1QZRA 1ID0A 3Q5JA 4HYMA 4MBCA 2YEFA 4CWQA 2XCMA 3C11A 5CTWA 2BYHA 1US7A 1I5BA 2Q8IA 3T0HA 1I58A 1UYLA 5FWKA 4MOTA 1UY7A 5L3JA 2GFDA 3U2KA 4JAUA 4HXWA 2XDXA 4CE1A 2XHRA 3IEDA 2WI3A 1EA6A 2O1WA 5CPHA 1AM1A 1UY9A 1UYHA 4GQTA 4E00A 1H7SA 4GT8A 5F5RA 1AH6A 1YT0A 3NMQA 1A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1U A;  2IWX A;  4WUD A;  2YKI A;  4HY1 A;  3SL2 A;  3D36 A;  2YKJ A;  3G7B A;  4YKT A;  3CRL A;  1QYE A;  3LPS A;  4LWI A;  4BAE A;  1AMW A;  1TIL A;  2XHX A;  4X9L A;  3TZ2 A;  5M4P A;  4ZVI A;  3HYY A;  3H80 A;  3GIG A;  1TID A;  4E01 A;  2YED A;  4L93 A;  2YGF A;  3EKR A;  4ASA A;  1Z5A A;  1ZW9 A;  3ZXQ A;  2YE3 A;  5CTY A;  3TTZ A;  3OW6 A;  3K97 A;  4H7Q A;  1UYC A;  4AWO A;  2ZDY A;  3GIF A;  1UYF A;  3TZ0 A;  3CGZ A;  3LNU A;  2XX4 A;  3FV5 A;  3U67 A;  2VWC A;  5IN9 A;  2FYP A;  2HKJ A;  2YJW A;  4V25 A;  3U2D A;  4DUH A;  3A0X A;  2C2A A;  3R92 A;  3VHD A;  3DGE A;  5BOC A;  4H81 A;  2E0A A;  3QDD A;  3H4L A;  3RLQ A;  4CE2 A;  1KIJ A;  1TBW A;  2Q8F A;  1Y4S A;  2XX2 A;  4XE2 A;  1Z5B A;  5M4H A;  3EHG A;  3PEJ A;  4XTJ A;  2YI5 A;  1UY6 A;  4LP0 A;  2YE8 A;  2CCU A;  1YC4 A;  4GEE A;  2IOP A;  2YEE A;  3GIE A;  3D2R A;  2WI6 A;  4URL A;  4Q20 A;  5BOD A;  2FWZ A;  2IWU A;  1YC3 A;  2YE5 A;  2WEQ A;  4P8O A;  3EHJ A;  1BKN A;  4P7A A;  2FWY A;  3BMY A;  3T2S A;  5IDJ A;  4U7N A;  1UYE A;  4JAV A;  3HYZ A;  2BSM A;  3HZ1 A;  4QPK A;  4LWE A;  4W7T A;  2ZBK B;  2YEH A;  2FXS A;  4PU9 A;  2GQP A;  2CGF A;  1PVG A;  1YT1 A;  3BM9 A;  2YKC A;  1I59 A;  4L91 A;  2YK9 A;  4EEH A;  3EHH A;  4KSH A;  4XD8 A;  3ZM7 A;  1EI1 A;  4LWF A;  4ZKI A;  3B24 A;  1OSF A;  5D7C A;  1BYQ A;  1ZXN A;  4FMT A;  5D7D A;  4AWQ A;  4B7P A;  2Q8G A;  1BGQ A;  3GIG B;  4CWS A;  1YSZ A;  1B63 A;  3ZKB A;  4YKX A;  4YKQ A;  2YE4 A;  4V26 A;  5FNF A;  5J6A A;  2CG9 A;  4XC0 A;  4NH7 A;  2YE2 A;  1Y4U A;  2YI6 A;  1ZWH A;  4XKO A;  5CF0 A;  3OWB A;  2ESA A;  5GGZ A;  2H8M A;  2JKI A;  4BIU A;  4CWN A;  1GKZ A;  3HHU A;  4GFN A;  4O0B A;  1GKX A;  1ZXM A;  4O07 A;  3FT8 A;  3QTF A;  1UYM A;  4XDM A;  3C0E A;  2BU2 A;  2IOQ A;  4FCQ A;  4YKW A;  4CWF A;  3CWV A;  2YI7 A;  3K99 A;  3T10 A;  1Z5C A;  3CGY A;  1Y8O A;  4EGI A;  4B6C A;  3T0Z A;  4YKZ A;  4XCL A;  4HYP A;  3RLP A;  3EKO A;  5CTU A;  3T1K A;  3B26 A;  2QG0 A;  2YEC A;  4WUB A;  4HZ5 A;  3K60 A;  3ZKD A;  2XJX A;  2YEI A;  3KE6 A;  3O0I A;  4GCZ A;  1YES A;  2BT0 A;  4BXI A;  4XKA A;  1YC1 A;  4URM A;  4MP2 A;  4PRX A;  1TH8 A;  2IOR A;  2AKP A;  3TUH A;  3K98 A;  4E02 A;  2CCT A;  4XKK A;  2XJG A;  2WER A;  2QG2 A;  2YEB A;  4R3A A;  2BRE A;  1I5D A;  2YK2 A;  3R4P A;  3R4N A;  4JQL A;  1I5C A;  2YKE A;  1H7U A;  4MPC A;  1NHJ A;  2WI7 A;  4R1F A;  4HXZ A;  2ZKJ A;  1KZN A;  4L94 A;  4BQG A;  2BZ5 A;  4NH9 A;  3JZ3 A;  1TC6 A;  4URO A;  2ZDX A;  3INW A;  4FCP A;  4GGL A;  4HZ0 A;  1QY8 A;  2IWS A;  4URN A;  4L8Z A;  4O05 A;  2YGA A;  2YE7 A;  4LWG A;  3WHA A;  5D6Q A;  1YS3 A;  1I5A A;  3B27 A;  2WI5 A;  4AS9 A;  1MX0 A;  1S14 A;  2XDK A;  4PRV A;  3ZXO A;  4JAS A;  4PL9 A;  4MPE A;  3WQ9 A;  4XIP A;  5FNC A;  4FPP A;  3VHC A;  5FND A;  2WEP A;  4KQV A;  2XX5 A;  4BQJ A;  1YT2 A;  1UY8 A;  1JM6 A;  2YKB A;  2CH4 A;  2BRC A;  4KTN A;  3R4M A;  4XIR A;  5M4M A;  2YE9 A;  2YEJ A;  3Q5L A;  3A0Z A;  2JJC A;  1NHH A;  4DZY A;  3VHA A;  1NHI A;  4ASB A;  4EFU A;  2Q8H A;  3A0R A;  4EMV A;  4NH8 A;  4QPJ A;  2HCH A;  2WI2 A;  5M4N A;  5D6P A;  5M4K A;  1U0Z A;  4MPN A;  4CE3 A;  2QF6 A;  2XAB A;  4BIZ A;  4U7O A;  4YKU A;  1L0O A;  1UYG A;  4KFG A;  4O09 A;  1THN A;  2Q2E B;  4XIT A;  5J71 A;  2EXL A;  2YEA A;  2XK2 A;  2YJX A;  1R62 A;  2VW5 A;  1Y8N A;  3OWD A;  4CWR A;  2O1V A;  3HZ5 A;  1TC0 A;  2XHT A;  4K4O A;  4EGH A;  3O2F A;  3D0B A;  3A0Y A;  1MU5 A;  2VCI A;  2XDU A;  1AJ6 A;  2UWD A;  5M4E A;  1YER A;  2YGE A;  3TZ5 A;  4EFT A;  1UYI A;  2YEG A;  2BYI A;  1B62 A;  2H55 A;  3CRK A;  4XCJ A;  4XIQ A;  1S16 A;  4WUC A;  3PEH A;  2WI4 A;  4YKY A;  3VAD A;  4KSG A;  3EHF A;  1Y8P A;  4LPB A;  2CCS A;  4EGK A;  1UYK A;  4LWH A;  4R3M A;  4CWO A;  2K5B A;  1GJV A;  1UYD A;  1YET A;  3RKZ A;  4MB9 A;  2QFO A;  4ASF A;  1AH8 A;  4I5S A;  4O04 A;  4H85 A;  2XDL A;  2YI0 A;  4EM7 A;  3INX A;  2YE6 A;  3A0T A;  2XDS A;  4CWP A;  2PNR A;  4MP7 A;  3R91 A;  3O6O A;  1BXD A;  4ASG A;  4AWP A;  3R4O A;  5IDM A;  5C93 A;  3B28 A;  5D7R A;  2XJJ A;  3OMU A;  3MNR P;  3RLR A;  1Z59 A;  4YKR A;  1U2O A;  5CTX A;  3G7E A;  2BU8 A;  4KP4 A;  3Q5K A;  2BU5 A;  3B25 A;  3TZ4 A;  2XD6 A;  3HEK A;  4FCR A;  4U93 A;  2VCJ A;  3FT5 A;  4I3H A;  4CWT A;  2BTZ A;  2BU6 A;  2HG1 A;  1B3Q A;  1YSR A;  3OPD A;  4HY6 A;  5F3K A;  4L90 A;  3G75 A;  2WI1 A;  3A0W A;  2BU7 A;  1QZR A;  1ID0 A;  3Q5J A;  4HYM A;  4MBC A;  2YEF A;  4CWQ A;  2XCM A;  3C11 A;  5CTW A;  2BYH A;  1US7 A;  1I5B A;  2Q8I A;  3T0H A;  1I58 A;  1UYL A;  5FWK A;  4MOT A;  1UY7 A;  5L3J A;  2GFD A;  3U2K A;  4JAU A;  4HXW A;  2XDX A;  4CE1 A;  2XHR A;  3IED A;  2WI3 A;  1EA6 A;  2O1W A;  5CPH A;  1AM1 A;  1UY9 A;  1UYH A;  4GQT A;  4E00 A;  1H7S A;  4GT8 A;  5F5R A;  1AH6 A;  1YT0 A;  3NMQ A;  1A4H A; 
#chains in the Genus database with same CATH topology
 2O1U A;  2IWX A;  4WUD A;  2YKI A;  4HY1 A;  3SL2 A;  3D36 A;  2YKJ A;  3G7B A;  4YKT A;  3CRL A;  1QYE A;  3LPS A;  4LWI A;  4BAE A;  1AMW A;  1TIL A;  2XHX A;  4X9L A;  3TZ2 A;  5M4P A;  4ZVI A;  3HYY A;  3H80 A;  3GIG A;  1TID A;  2FTK A;  4E01 A;  2YED A;  4L93 A;  2YGF A;  3S5T A;  3EKR A;  4ASA A;  1Z5A A;  1ZW9 A;  2C1I A;  2YE3 A;  3ZXQ A;  5CTY A;  3TTZ A;  3OW6 A;  3K97 A;  4H7Q A;  1UYC A;  4AWO A;  2ZDY A;  3GIF A;  1UYF A;  3TZ0 A;  3CGZ A;  4E72 A;  3LNU A;  2XX4 A;  3FV5 A;  3U67 A;  2VWC A;  5IN9 A;  2FYP A;  2HKJ A;  2YJW A;  4V25 A;  3U2D A;  4DUH A;  3A0X A;  2C2A A;  3R92 A;  3VHD A;  3DGE A;  5BOC A;  4H81 A;  2E0A A;  3QDD A;  3H4L A;  3RLQ A;  4CE2 A;  1KIJ A;  1TBW A;  2Q8F A;  1Y4S A;  2XX2 A;  4XE2 A;  1F51 A;  1Z5B A;  5M4H A;  3EHG A;  3PEJ A;  4XTJ A;  2YI5 A;  1UY6 A;  4LP0 A;  2YE8 A;  2CCU A;  1YC4 A;  4GEE A;  2IOP A;  2YEE A;  3GIE A;  3D2R A;  2WI6 A;  4URL A;  4Q20 A;  5BOD A;  2FWZ A;  2IWU A;  1YC3 A;  2YE5 A;  2WEQ A;  4P8O A;  3EHJ A;  1BKN A;  4P7A A;  2FWY A;  3BMY A;  3T2S A;  5IDJ A;  4U7N A;  1UYE A;  4JAV A;  3HYZ A;  2BSM A;  3HZ1 A;  4QPK A;  4LWE A;  4W7T A;  2ZBK B;  2YEH A;  2FXS A;  4PU9 A;  2GQP A;  2CGF A;  1PVG A;  1YT1 A;  3BM9 A;  2YKC A;  3CYG A;  1I59 A;  4L91 A;  2YK9 A;  4EEH A;  3EHH A;  4KSH A;  4XD8 A;  3ZM7 A;  1EI1 A;  4LWF A;  4ZKI A;  3B24 A;  1OSF A;  5D7C A;  1BYQ A;  1ZXN A;  4FMT A;  5D7D A;  4AWQ A;  4B7P A;  2Q8G A;  1BGQ A;  3GIG B;  4CWS A;  1YSZ A;  1B63 A;  3ZKB A;  4YKX A;  4YKQ A;  2YE4 A;  4V26 A;  5FNF A;  5J6A A;  2CG9 A;  4XC0 A;  4NH7 A;  2YE2 A;  1Y4U A;  2YI6 A;  5JEN A;  1ZWH A;  4XKO A;  5CF0 A;  3OWB A;  2ESA A;  5GGZ A;  2H8M A;  2JKI A;  4BIU A;  4CWN A;  1GKZ A;  3HHU A;  4GFN A;  4O0B A;  1GKX A;  1ZXM A;  4O07 A;  3FT8 A;  3QTF A;  1UYM A;  4XDM A;  3C0E A;  2BU2 A;  2IOQ A;  4FCQ A;  4YKW A;  4CWF A;  3CWV A;  2YI7 A;  3K99 A;  3T10 A;  1Z5C A;  3CGY A;  1Y8O A;  4EGI A;  4B6C A;  3T0Z A;  4YKZ A;  4XCL A;  4HYP A;  3RLP A;  2HHI A;  3EKO A;  5CTU A;  3T1K A;  3B26 A;  2QG0 A;  2YEC A;  4WUB A;  4HZ5 A;  3K60 A;  3ZKD A;  2XJX A;  2YEI A;  3KE6 A;  3O0I A;  4GCZ A;  1YES A;  2BT0 A;  4BXI A;  4XKA A;  1YC1 A;  4URM A;  4MP2 A;  4PRX A;  1TH8 A;  2IOR A;  2AKP A;  3TUH A;  3K98 A;  4E02 A;  2CCT A;  4XKK A;  2XJG A;  2WER A;  2QG2 A;  2YEB A;  4R3A A;  2BRE A;  1I5D A;  2YK2 A;  3R4P A;  3R4N A;  4JQL A;  2C1G A;  1I5C A;  2YKE A;  1H7U A;  4MPC A;  1NHJ A;  2WI7 A;  4R1F A;  4HXZ A;  2ZKJ A;  1KZN A;  4L94 A;  4BQG A;  2BZ5 A;  4NH9 A;  3JZ3 A;  1TC6 A;  4URO A;  2ZDX A;  3INW A;  4FCP A;  4GGL A;  4HZ0 A;  1QY8 A;  2IWS A;  4URN A;  4L8Z A;  4O05 A;  2YGA A;  2YE7 A;  4LWG A;  3WHA A;  5D6Q A;  1YS3 A;  1I5A A;  3B27 A;  2WI5 A;  4AS9 A;  1MX0 A;  1S14 A;  2XDK A;  4PRV A;  3ZXO A;  4JAS A;  4PL9 A;  4MPE A;  3WQ9 A;  4XIP A;  5FNC A;  4FPP A;  3VHC A;  5FND A;  2WEP A;  4KQV A;  2XX5 A;  4BQJ A;  1YT2 A;  1UY8 A;  1JM6 A;  2YKB A;  2CH4 A;  2BRC A;  4KTN A;  3R4M A;  4XIR A;  5M4M A;  2YE9 A;  2YEJ A;  3Q5L A;  3A0Z A;  2JJC A;  1NHH A;  4DZY A;  3VHA A;  1NHI A;  4ASB A;  4EFU A;  2Q8H A;  3A0R A;  4EMV A;  4NH8 A;  4QPJ A;  2HCH A;  2WI2 A;  5M4N A;  5D6P A;  5M4K A;  1U0Z A;  4MPN A;  4CE3 A;  2QF6 A;  2XAB A;  4BIZ A;  4U7O A;  4YKU A;  1L0O A;  1UYG A;  4KFG A;  4O09 A;  1THN A;  2Q2E B;  4XIT A;  5J71 A;  2EXL A;  2YEA A;  2XK2 A;  2YJX A;  1R62 A;  2VW5 A;  1Y8N A;  3OWD A;  4CWR A;  2O1V A;  3HZ5 A;  1TC0 A;  2XHT A;  4K4O A;  4EGH A;  3O2F A;  3D0B A;  3A0Y A;  1MU5 A;  2VCI A;  2XDU A;  1AJ6 A;  2UWD A;  5M4E A;  1YER A;  2YGE A;  3TZ5 A;  4EFT A;  1UYI A;  2YEG A;  2BYI A;  1B62 A;  2H55 A;  3CRK A;  4XCJ A;  4XIQ A;  1S16 A;  4WUC A;  3PEH A;  2WI4 A;  4YKY A;  3VAD A;  4KSG A;  3EHF A;  1Y8P A;  4LPB A;  2CCS A;  4EGK A;  1UYK A;  4LWH A;  4R3M A;  4CWO A;  2K5B A;  1GJV A;  1UYD A;  1YET A;  3RKZ A;  4MB9 A;  2QFO A;  4ASF A;  1AH8 A;  4I5S A;  4O04 A;  4H85 A;  2XDL A;  2YI0 A;  4EM7 A;  3INX A;  2YE6 A;  3A0T A;  2XDS A;  4CWP A;  2PNR A;  4MP7 A;  3R91 A;  3O6O A;  1BXD A;  4ASG A;  4AWP A;  3R4O A;  5IDM A;  5C93 A;  3B28 A;  5D7R A;  2XJJ A;  3OMU A;  3MNR P;  3RLR A;  1Z59 A;  4YKR A;  1U2O A;  5CTX A;  3G7E A;  2BU8 A;  4KP4 A;  3Q5K A;  2BU5 A;  3B25 A;  3TZ4 A;  2XD6 A;  3HEK A;  4FCR A;  4U93 A;  2VCJ A;  3FT5 A;  4I3H A;  4CWT A;  2BTZ A;  2BU6 A;  2HG1 A;  1B3Q A;  1YSR A;  3OPD A;  4HY6 A;  5F3K A;  4L90 A;  3G75 A;  2WI1 A;  3A0W A;  2BU7 A;  1QZR A;  1ID0 A;  3Q5J A;  4HYM A;  4MBC A;  2YEF A;  4CWQ A;  2XCM A;  3C11 A;  5CTW A;  2BYH A;  1US7 A;  1I5B A;  1IXM A;  2Q8I A;  3T0H A;  1I58 A;  1UYL A;  5FWK A;  4MOT A;  1UY7 A;  5L3J A;  2GFD A;  3U2K A;  4JAU A;  4HXW A;  2XDX A;  4CE1 A;  2XHR A;  3IED A;  2WI3 A;  1EA6 A;  2O1W A;  5CPH A;  1AM1 A;  3LMM A;  1UY9 A;  1UYH A;  4GQT A;  4E00 A;  1H7S A;  4GT8 A;  5F5R A;  1AH6 A;  1YT0 A;  3NMQ A;  1A4H A; 
#chains in the Genus database with same CATH homology
 2O1U A;  2IWX A;  4WUD A;  2YKI A;  4HY1 A;  3SL2 A;  3D36 A;  2YKJ A;  3G7B A;  4YKT A;  3CRL A;  1QYE A;  3LPS A;  4LWI A;  4BAE A;  1AMW A;  1TIL A;  2XHX A;  4X9L A;  3TZ2 A;  5M4P A;  4ZVI A;  3HYY A;  3H80 A;  3GIG A;  1TID A;  4E01 A;  2YED A;  4L93 A;  2YGF A;  3EKR A;  4ASA A;  1Z5A A;  1ZW9 A;  3ZXQ A;  2YE3 A;  5CTY A;  3TTZ A;  3OW6 A;  3K97 A;  4H7Q A;  1UYC A;  4AWO A;  2ZDY A;  3GIF A;  1UYF A;  3TZ0 A;  3CGZ A;  3LNU A;  2XX4 A;  3FV5 A;  3U67 A;  2VWC A;  5IN9 A;  2FYP A;  2HKJ A;  2YJW A;  4V25 A;  3U2D A;  4DUH A;  3A0X A;  2C2A A;  3R92 A;  3VHD A;  3DGE A;  5BOC A;  4H81 A;  2E0A A;  3QDD A;  3H4L A;  3RLQ A;  4CE2 A;  1KIJ A;  1TBW A;  2Q8F A;  1Y4S A;  2XX2 A;  4XE2 A;  1Z5B A;  5M4H A;  3EHG A;  3PEJ A;  4XTJ A;  2YI5 A;  1UY6 A;  4LP0 A;  2YE8 A;  2CCU A;  1YC4 A;  4GEE A;  2IOP A;  2YEE A;  3GIE A;  3D2R A;  2WI6 A;  4URL A;  4Q20 A;  5BOD A;  2FWZ A;  2IWU A;  1YC3 A;  2YE5 A;  2WEQ A;  4P8O A;  3EHJ A;  1BKN A;  4P7A A;  2FWY A;  3BMY A;  3T2S A;  5IDJ A;  4U7N A;  1UYE A;  4JAV A;  3HYZ A;  2BSM A;  3HZ1 A;  4QPK A;  4LWE A;  4W7T A;  2ZBK B;  2YEH A;  2FXS A;  4PU9 A;  2GQP A;  2CGF A;  1PVG A;  1YT1 A;  3BM9 A;  2YKC A;  1I59 A;  4L91 A;  2YK9 A;  4EEH A;  3EHH A;  4KSH A;  4XD8 A;  3ZM7 A;  1EI1 A;  4LWF A;  4ZKI A;  3B24 A;  1OSF A;  5D7C A;  1BYQ A;  1ZXN A;  4FMT A;  5D7D A;  4AWQ A;  4B7P A;  2Q8G A;  1BGQ A;  3GIG B;  4CWS A;  1YSZ A;  1B63 A;  3ZKB A;  4YKX A;  4YKQ A;  2YE4 A;  4V26 A;  5FNF A;  5J6A A;  2CG9 A;  4XC0 A;  4NH7 A;  2YE2 A;  1Y4U A;  2YI6 A;  1ZWH A;  4XKO A;  5CF0 A;  3OWB A;  2ESA A;  5GGZ A;  2H8M A;  2JKI A;  4BIU A;  4CWN A;  1GKZ A;  3HHU A;  4GFN A;  4O0B A;  1GKX A;  1ZXM A;  4O07 A;  3FT8 A;  3QTF A;  1UYM A;  4XDM A;  3C0E A;  2BU2 A;  2IOQ A;  4FCQ A;  4YKW A;  4CWF A;  3CWV A;  2YI7 A;  3K99 A;  3T10 A;  1Z5C A;  3CGY A;  1Y8O A;  4EGI A;  4B6C A;  3T0Z A;  4YKZ A;  4XCL A;  4HYP A;  3RLP A;  3EKO A;  5CTU A;  3T1K A;  3B26 A;  2QG0 A;  2YEC A;  4WUB A;  4HZ5 A;  3K60 A;  3ZKD A;  2XJX A;  2YEI A;  3KE6 A;  3O0I A;  4GCZ A;  1YES A;  2BT0 A;  4BXI A;  4XKA A;  1YC1 A;  4URM A;  4MP2 A;  4PRX A;  1TH8 A;  2IOR A;  2AKP A;  3TUH A;  3K98 A;  4E02 A;  2CCT A;  4XKK A;  2XJG A;  2WER A;  2QG2 A;  2YEB A;  4R3A A;  2BRE A;  1I5D A;  2YK2 A;  3R4P A;  3R4N A;  4JQL A;  1I5C A;  2YKE A;  1H7U A;  4MPC A;  1NHJ A;  2WI7 A;  4R1F A;  4HXZ A;  2ZKJ A;  1KZN A;  4L94 A;  4BQG A;  2BZ5 A;  4NH9 A;  3JZ3 A;  1TC6 A;  4URO A;  2ZDX A;  3INW A;  4FCP A;  4GGL A;  4HZ0 A;  1QY8 A;  2IWS A;  4URN A;  4L8Z A;  4O05 A;  2YGA A;  2YE7 A;  4LWG A;  3WHA A;  5D6Q A;  1YS3 A;  1I5A A;  3B27 A;  2WI5 A;  4AS9 A;  1MX0 A;  1S14 A;  2XDK A;  4PRV A;  3ZXO A;  4JAS A;  4PL9 A;  4MPE A;  3WQ9 A;  4XIP A;  5FNC A;  4FPP A;  3VHC A;  5FND A;  2WEP A;  4KQV A;  2XX5 A;  4BQJ A;  1YT2 A;  1UY8 A;  1JM6 A;  2YKB A;  2CH4 A;  2BRC A;  4KTN A;  3R4M A;  4XIR A;  5M4M A;  2YE9 A;  2YEJ A;  3Q5L A;  3A0Z A;  2JJC A;  1NHH A;  4DZY A;  3VHA A;  1NHI A;  4ASB A;  4EFU A;  2Q8H A;  3A0R A;  4EMV A;  4NH8 A;  4QPJ A;  2HCH A;  2WI2 A;  5M4N A;  5D6P A;  5M4K A;  1U0Z A;  4MPN A;  4CE3 A;  2QF6 A;  2XAB A;  4BIZ A;  4U7O A;  4YKU A;  1L0O A;  1UYG A;  4KFG A;  4O09 A;  1THN A;  2Q2E B;  4XIT A;  5J71 A;  2EXL A;  2YEA A;  2XK2 A;  2YJX A;  1R62 A;  2VW5 A;  1Y8N A;  3OWD A;  4CWR A;  2O1V A;  3HZ5 A;  1TC0 A;  2XHT A;  4K4O A;  4EGH A;  3O2F A;  3D0B A;  3A0Y A;  1MU5 A;  2VCI A;  2XDU A;  1AJ6 A;  2UWD A;  5M4E A;  1YER A;  2YGE A;  3TZ5 A;  4EFT A;  1UYI A;  2YEG A;  2BYI A;  1B62 A;  2H55 A;  3CRK A;  4XCJ A;  4XIQ A;  1S16 A;  4WUC A;  3PEH A;  2WI4 A;  4YKY A;  3VAD A;  4KSG A;  3EHF A;  1Y8P A;  4LPB A;  2CCS A;  4EGK A;  1UYK A;  4LWH A;  4R3M A;  4CWO A;  2K5B A;  1GJV A;  1UYD A;  1YET A;  3RKZ A;  4MB9 A;  2QFO A;  4ASF A;  1AH8 A;  4I5S A;  4O04 A;  4H85 A;  2XDL A;  2YI0 A;  4EM7 A;  3INX A;  2YE6 A;  3A0T A;  2XDS A;  4CWP A;  2PNR A;  4MP7 A;  3R91 A;  3O6O A;  1BXD A;  4ASG A;  4AWP A;  3R4O A;  5IDM A;  5C93 A;  3B28 A;  5D7R A;  2XJJ A;  3OMU A;  3MNR P;  3RLR A;  1Z59 A;  4YKR A;  1U2O A;  5CTX A;  3G7E A;  2BU8 A;  4KP4 A;  3Q5K A;  2BU5 A;  3B25 A;  3TZ4 A;  2XD6 A;  3HEK A;  4FCR A;  4U93 A;  2VCJ A;  3FT5 A;  4I3H A;  4CWT A;  2BTZ A;  2BU6 A;  2HG1 A;  1B3Q A;  1YSR A;  3OPD A;  4HY6 A;  5F3K A;  4L90 A;  3G75 A;  2WI1 A;  3A0W A;  2BU7 A;  1QZR A;  1ID0 A;  3Q5J A;  4HYM A;  4MBC A;  2YEF A;  4CWQ A;  2XCM A;  3C11 A;  5CTW A;  2BYH A;  1US7 A;  1I5B A;  2Q8I A;  3T0H A;  1I58 A;  1UYL A;  5FWK A;  4MOT A;  1UY7 A;  5L3J A;  2GFD A;  3U2K A;  4JAU A;  4HXW A;  2XDX A;  4CE1 A;  2XHR A;  3IED A;  2WI3 A;  1EA6 A;  2O1W A;  5CPH A;  1AM1 A;  1UY9 A;  1UYH A;  4GQT A;  4E00 A;  1H7S A;  4GT8 A;  5F5R A;  1AH6 A;  1YT0 A;  3NMQ A;  1A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...