1AJ6A

Novobiocin-resistant mutant (r136h) of the n-terminal 24 kda fragment of dna gyrase b complexed with novobiocin at 2.3 angstroms resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
194
Chain Sequence
VLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGGLHGVGVSVVNALSQKLELVIQHEGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Topoisomerase
molecule keywords GYRASE
publication title The entropic penalty of ordered water accounts for weaker binding of the antibiotic novobiocin to a resistant mutant of DNA gyrase: a thermodynamic and crystallographic study.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 194
sequence length 206
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1aj6A00
2JKIA 1Z5AA 4MPCA 2YE6A 3EKOA 1AM1A 2XJXA 4XTJA 2YKBA 4L91A 4MPEA 1KIJA 4HZ0A 2ZBKB 3C11A 4H7QA 2YEDA 2XDXA 3LPSA 5FNFA 2HG1A 3HEKA 2YKEA 5M4MA 3EHGA 2AKPA 4L8ZA 3EHHA 3MNRP 4CWQA 2YGEA 2ZDYA 5IDJA 3K98A 2XDSA 2YE7A 1YERA 1S14A 2WI5A 4AS9A 4EGIA 2HKJA 4KSHA 4KP4A 4HYPA 3T1KA 3OW6A 4HYMA 1UYLA 3G7EA 3RLRA 3T2SA 3HYZA 2IOPA 2XX2A 4EEHA 4EGHA 4PRXA 4K4OA 2E0AA 3QDDA 4L94A 5CPHA 2WI3A 4EFUA 2YI6A 2YKCA 3H4LA 4B7PA 3D0BA 2XHRA 1UY6A 4I3HA 1AH8A 2VCJA 3B27A 5M4PA 3TUHA 4CWNA 4CWOA 5FNCA 4XIQA 5M4NA 1GJVA 2QG2A 1ZW9A 2CCUA 2YEEA 2QFOA 3B26A 2WERA 3Q5KA 4HXZA 3D2RA 4R3MA 2YEAA 2YE4A 5D6QA 2EXLA 4JASA 3PEHA 4LWEA 3Q5LA 2IOQA 4ASGA 2H55A 4FPPA 1I5BA 4YKTA 2YE8A 5BOCA 1Y8NA 4XKKA 1EI1A 1GKZA 1YSRA 3U2KA 5F5RA 5GGZA 2YKIA 4GCZA 3ZXQA 2WI7A 2XDKA 4LWFA 4AWPA 2XX4A 4P8OA 4YKYA 2CCSA 3R4MA 2PNRA 4BIZA 1NHHA 1S16A 2XD6A 4ASFA 1MU5A 1R62A 3R4NA 1UYIA 3O0IA 1MX0A 2YE3A 3CGYA 5D7CA 4CE3A 1B63A 4BQGA 4HY1A 4QPJA 4WUCA 2VW5A 4WUDA 3ZXOA 1Z5CA 2XX5A 4P7AA 2K5BA 2IWXA 5J71A 1AJ6A 5CTXA 4LPBA 2YI5A 2CH4A 4O07A 2QG0A 1I5AA 3A0RA 4BQJA 4GT8A 4YKRA 1UYCA 1YC3A 1H7UA 2YEIA 1UY7A 2XJGA 3FV5A 4MOTA 4O0BA 4E01A 2BREA 3LNUA 1BYQA 4LWIA 2FWYA 2YI0A 5BODA 5C93A 3HHUA 4L93A 4I5SA 4KFGA 1UYHA 3B28A 4WUBA 2FXSA 4X9LA 3CRLA 2WI6A 1NHIA 3EHFA 3K97A 2YKJA 3R92A 2BU8A 2YI7A 3PEJA 3GIGA 1YC4A 2YECA 1ID0A 1TH8A 4KSGA 3INWA 3G7BA 4KQVA 2WEQA 2Q8GA 2JJCA 1UYFA 4QPKA 1TC0A 2YE2A 3RLPA 2BU2A 4LWHA 3T0ZA 4FCQA 3EHJA 2Q8FA 2VCIA 4MP2A 3IEDA 4DZYA 2XK2A 3CWVA 4FMTA 4MP7A 2YE9A 2QF6A 4O09A 5M4KA 1GKXA 4XCJA 5CTYA 2BU5A 4XIPA 3G75A 2XHXA 3A0TA 1L0OA 2YEJA 3FT8A 3CGZA 1OSFA 3ZM7A 3TZ0A 5D7DA 3B24A 3HYYA 3CRKA 3Q5JA 4U93A 4XKAA 1THNA 1Y8OA 1ZWHA 3B25A 1Z5BA 2BRCA 4UROA 4GQTA 3T10A 4YKZA 4FCRA 1U2OA 3K60A 3GIFA 4EFTA 2YEHA 1YSZA 4XD8A 3H80A 3OWDA 3A0YA 3WQ9A 2ZKJA 4L90A 4V26A 1YC1A 2O1VA 5CTUA 2O1UA 5L3JA 1TILA 4Q20A 2YK2A 1TIDA 4PL9A 1I58A 2IWUA 3NMQA 2YEBA 3A0ZA 4XIRA 3O2FA 1YT0A 4MPNA 2YJWA 3ZKBA 4JAUA 3EKRA 1KZNA 2O1WA 2WI1A 1BXDA 4HXWA 4XDMA 4PU9A 1Y8PA 4URMA 2CCTA 2XHTA 2XJJA 4ZVIA 3DGEA 5J6AA 1QZRA 2HCHA 1ZXMA 2YJXA 4YKUA 1TBWA 3JZ3A 4JAVA 1BKNA 1QY8A 4LP0A 3A0XA 1UYGA 3VADA 4E00A 4V25A 1YESA 3BMYA 1UYMA 3BM9A 2ZDXA 1QYEA 4E02A 3TZ4A 1Z59A 1ZXNA 2UWDA 2BYIA 4URNA 3KE6A 2VWCA 2IWSA 3RKZA 4H81A 3SL2A 3TZ5A 2YK9A 3HZ1A 4GEEA 4YKWA 2YEGA 3D36A 3ZKDA 4LWGA 1UY9A 2WI2A 4NH9A 3OMUA 4R1FA 2IORA 4XC0A 3GIGB 2YGAA 5M4HA 3VHCA 5CF0A 2GQPA 3O6OA 2Q2EB 4URLA 5D7RA 4CWSA 4XKOA 4MBCA 4ASAA 4BAEA 2YEFA 5F3KA 2BU6A 2Q8HA 4BXIA 4ASBA 1A4HA 4MB9A 1JM6A 3HZ5A 4HY6A 1YT2A 2BTZA 4PRVA 1I5DA 2FYPA 1UYKA 2GFDA 4U7OA 2YGFA 3R4OA 2CGFA 5IDMA 2XABA 2XCMA 2XDLA 3VHAA 1NHJA 4EM7A 1AMWA 2BZ5A 4XCLA 3C0EA 4CWTA 4O05A 4U7NA 4H85A 2Q8IA 3WHAA 3QTFA 3FT5A 4GFNA 4AWOA 1YETA 1BGQA 5CTWA 4DUHA 4W7TA 1UYDA 2BYHA 1U0ZA 3RLQA 4NH7A 4EMVA 4JQLA 3R4PA 4YKXA 2XDUA 3K99A 4FCPA 4R3AA 4CWRA 3U2DA 4B6CA 4EGKA 2BU7A 4NH8A 1US7A 1B62A 3R91A 2CG9A 2ESAA 4CWFA 2FWZA 3VHDA 3OPDA 4O04A 3U67A 2WI4A 3OWBA 5M4EA 1H7SA 1YS3A 3TTZA 4YKQA 2BSMA 1AH6A 4BIUA 2H8MA 5FNDA 1PVGA 2WEPA 1UY8A 4HZ5A 2BT0A 4CE1A 1I59A 1Y4UA 1I5CA 4GGLA 5FWKA 4XITA 4AWQA 3A0WA 4XE2A 2YE5A 1B3QA 1TC6A 3T0HA 2C2AA 1YT1A 4KTNA 1EA6A 4CE2A 3TZ2A 5IN9A 1UYEA 4ZKIA 3INXA 1Y4SA 3GIEA 4CWPA 5D6PA
chains in the Genus database with same CATH superfamily
2JKIA 1Z5AA 4MPCA 2YE6A 3EKOA 1AM1A 2XJXA 4XTJA 2YKBA 4L91A 4MPEA 1KIJA 4HZ0A 2ZBKB 3C11A 4H7QA 2YEDA 2XDXA 3LPSA 5FNFA 2HG1A 3HEKA 2YKEA 5M4MA 3EHGA 2AKPA 4L8ZA 3EHHA 3MNRP 4CWQA 2YGEA 2ZDYA 5IDJA 3K98A 2XDSA 2YE7A 1YERA 1S14A 2WI5A 4AS9A 4EGIA 2HKJA 4KSHA 4KP4A 4HYPA 3T1KA 3OW6A 4HYMA 1UYLA 3G7EA 3RLRA 3T2SA 3HYZA 2IOPA 2XX2A 4EEHA 4EGHA 4PRXA 4K4OA 2E0AA 3QDDA 4L94A 5CPHA 2WI3A 4EFUA 2YI6A 2YKCA 3H4LA 4B7PA 3D0BA 2XHRA 1UY6A 4I3HA 1AH8A 2VCJA 3B27A 5M4PA 3TUHA 4CWNA 4CWOA 5FNCA 4XIQA 5M4NA 1GJVA 2QG2A 1ZW9A 2CCUA 2YEEA 2QFOA 3B26A 1F51A 2WERA 3Q5KA 4HXZA 3D2RA 4R3MA 2YEAA 2YE4A 5D6QA 2EXLA 4JASA 3PEHA 4LWEA 3Q5LA 2IOQA 4ASGA 2H55A 4FPPA 1I5BA 4YKTA 2YE8A 5BOCA 1Y8NA 4XKKA 1EI1A 1GKZA 1YSRA 3U2KA 5F5RA 5GGZA 2YKIA 4GCZA 3ZXQA 2WI7A 2XDKA 4LWFA 4AWPA 4E72A 2XX4A 4P8OA 4YKYA 2CCSA 3R4MA 2PNRA 4BIZA 1NHHA 1S16A 2XD6A 4ASFA 1MU5A 1R62A 3R4NA 1UYIA 3O0IA 1MX0A 2YE3A 3CGYA 5D7CA 4CE3A 1B63A 4BQGA 4HY1A 4QPJA 4WUCA 2VW5A 4WUDA 3ZXOA 1Z5CA 2XX5A 4P7AA 2K5BA 2IWXA 5J71A 1AJ6A 5CTXA 4LPBA 2YI5A 2CH4A 4O07A 2QG0A 1I5AA 3A0RA 4BQJA 4GT8A 4YKRA 1UYCA 1YC3A 1H7UA 2YEIA 1UY7A 2XJGA 3FV5A 4MOTA 4O0BA 4E01A 2BREA 3LNUA 1BYQA 4LWIA 2FWYA 2YI0A 5BODA 5C93A 3HHUA 4L93A 4I5SA 4KFGA 1UYHA 3B28A 4WUBA 2FXSA 4X9LA 3CRLA 2WI6A 1NHIA 3EHFA 3K97A 2YKJA 3R92A 2BU8A 2YI7A 3PEJA 3GIGA 1YC4A 2YECA 1ID0A 1TH8A 4KSGA 3INWA 5JENA 3G7BA 4KQVA 2WEQA 2Q8GA 2JJCA 1UYFA 4QPKA 1TC0A 2YE2A 3RLPA 2BU2A 4LWHA 3T0ZA 4FCQA 3EHJA 2Q8FA 2VCIA 4MP2A 3IEDA 4DZYA 2XK2A 3CWVA 4FMTA 4MP7A 2YE9A 2QF6A 4O09A 5M4KA 1GKXA 4XCJA 5CTYA 2BU5A 4XIPA 3G75A 2XHXA 3A0TA 1L0OA 2YEJA 3FT8A 3CGZA 1OSFA 3ZM7A 3TZ0A 2C1GA 3LMMA 5D7DA 3B24A 3HYYA 3S5TA 3CRKA 3Q5JA 4U93A 4XKAA 1THNA 1Y8OA 1ZWHA 3B25A 1Z5BA 2BRCA 4UROA 4GQTA 3T10A 4YKZA 4FCRA 1U2OA 3K60A 3GIFA 4EFTA 2YEHA 1YSZA 4XD8A 3H80A 3OWDA 3A0YA 3WQ9A 2ZKJA 4L90A 4V26A 1YC1A 2O1VA 5CTUA 2O1UA 5L3JA 1TILA 4Q20A 2YK2A 1TIDA 4PL9A 1I58A 2IWUA 3NMQA 2YEBA 3A0ZA 4XIRA 3O2FA 1YT0A 4MPNA 2YJWA 3ZKBA 4JAUA 3EKRA 1KZNA 2O1WA 2WI1A 3CYGA 1BXDA 1IXMA 4HXWA 4XDMA 4PU9A 1Y8PA 4URMA 2CCTA 2XHTA 2XJJA 4ZVIA 3DGEA 5J6AA 1QZRA 2HCHA 1ZXMA 2YJXA 4YKUA 1TBWA 3JZ3A 4JAVA 1BKNA 1QY8A 4LP0A 3A0XA 1UYGA 3VADA 4E00A 4V25A 1YESA 3BMYA 1UYMA 3BM9A 2ZDXA 2C1IA 1QYEA 4E02A 3TZ4A 1Z59A 1ZXNA 2UWDA 2BYIA 4URNA 3KE6A 2VWCA 2IWSA 3RKZA 4H81A 3SL2A 3TZ5A 2YK9A 3HZ1A 4GEEA 4YKWA 2YEGA 3D36A 3ZKDA 4LWGA 1UY9A 2WI2A 4NH9A 3OMUA 4R1FA 2IORA 4XC0A 3GIGB 2YGAA 5M4HA 3VHCA 5CF0A 2GQPA 3O6OA 2Q2EB 4URLA 5D7RA 4CWSA 4XKOA 2HHIA 4MBCA 4ASAA 4BAEA 2YEFA 5F3KA 2BU6A 2Q8HA 4BXIA 4ASBA 1A4HA 4MB9A 1JM6A 3HZ5A 4HY6A 1YT2A 2BTZA 4PRVA 1I5DA 2FYPA 1UYKA 2GFDA 4U7OA 2YGFA 3R4OA 2CGFA 5IDMA 2XABA 2XCMA 2XDLA 3VHAA 1NHJA 4EM7A 1AMWA 2BZ5A 4XCLA 3C0EA 4CWTA 4O05A 4U7NA 4H85A 2Q8IA 3WHAA 3QTFA 3FT5A 4GFNA 4AWOA 1YETA 1BGQA 5CTWA 4DUHA 4W7TA 1UYDA 2BYHA 1U0ZA 3RLQA 4NH7A 4EMVA 4JQLA 3R4PA 4YKXA 2XDUA 3K99A 4FCPA 4R3AA 4CWRA 3U2DA 4B6CA 4EGKA 2BU7A 4NH8A 1US7A 1B62A 3R91A 2CG9A 2ESAA 4CWFA 2FWZA 3VHDA 3OPDA 4O04A 3U67A 2WI4A 3OWBA 5M4EA 1H7SA 1YS3A 3TTZA 4YKQA 2BSMA 1AH6A 4BIUA 2H8MA 5FNDA 1PVGA 2WEPA 1UY8A 2FTKA 4HZ5A 2BT0A 4CE1A 1I59A 1Y4UA 1I5CA 4GGLA 5FWKA 4XITA 4AWQA 3A0WA 4XE2A 2YE5A 1B3QA 1TC6A 3T0HA 2C2AA 1YT1A 4KTNA 1EA6A 4CE2A 3TZ2A 5IN9A 1UYEA 4ZKIA 3INXA 1Y4SA 3GIEA 4CWPA 5D6PA
chains in the Genus database with same CATH topology
2JKIA 1Z5AA 4MPCA 2YE6A 3EKOA 1AM1A 2XJXA 4XTJA 2YKBA 4L91A 4MPEA 1KIJA 4HZ0A 2ZBKB 3C11A 4H7QA 2YEDA 2XDXA 3LPSA 5FNFA 2HG1A 3HEKA 2YKEA 5M4MA 3EHGA 2AKPA 4L8ZA 3EHHA 3MNRP 4CWQA 2YGEA 2ZDYA 5IDJA 3K98A 2XDSA 2YE7A 1YERA 1S14A 2WI5A 4AS9A 4EGIA 2HKJA 4KSHA 4KP4A 4HYPA 3T1KA 3OW6A 4HYMA 1UYLA 3G7EA 3RLRA 3T2SA 3HYZA 2IOPA 2XX2A 4EEHA 4EGHA 4PRXA 4K4OA 2E0AA 3QDDA 4L94A 5CPHA 2WI3A 4EFUA 2YI6A 2YKCA 3H4LA 4B7PA 3D0BA 2XHRA 1UY6A 4I3HA 1AH8A 2VCJA 3B27A 5M4PA 3TUHA 4CWNA 4CWOA 5FNCA 4XIQA 5M4NA 1GJVA 2QG2A 1ZW9A 2CCUA 2YEEA 2QFOA 3B26A 2WERA 3Q5KA 4HXZA 3D2RA 4R3MA 2YEAA 2YE4A 5D6QA 2EXLA 4JASA 3PEHA 4LWEA 3Q5LA 2IOQA 4ASGA 2H55A 4FPPA 1I5BA 4YKTA 2YE8A 5BOCA 1Y8NA 4XKKA 1EI1A 1GKZA 1YSRA 3U2KA 5F5RA 5GGZA 2YKIA 4GCZA 3ZXQA 2WI7A 2XDKA 4LWFA 4AWPA 2XX4A 4P8OA 4YKYA 2CCSA 3R4MA 2PNRA 4BIZA 1NHHA 1S16A 2XD6A 4ASFA 1MU5A 1R62A 3R4NA 1UYIA 3O0IA 1MX0A 2YE3A 3CGYA 5D7CA 4CE3A 1B63A 4BQGA 4HY1A 4QPJA 4WUCA 2VW5A 4WUDA 3ZXOA 1Z5CA 2XX5A 4P7AA 2K5BA 2IWXA 5J71A 1AJ6A 5CTXA 4LPBA 2YI5A 2CH4A 4O07A 2QG0A 1I5AA 3A0RA 4BQJA 4GT8A 4YKRA 1UYCA 1YC3A 1H7UA 2YEIA 1UY7A 2XJGA 3FV5A 4MOTA 4O0BA 4E01A 2BREA 3LNUA 1BYQA 4LWIA 2FWYA 2YI0A 5BODA 5C93A 3HHUA 4L93A 4I5SA 4KFGA 1UYHA 3B28A 4WUBA 2FXSA 4X9LA 3CRLA 2WI6A 1NHIA 3EHFA 3K97A 2YKJA 3R92A 2BU8A 2YI7A 3PEJA 3GIGA 1YC4A 2YECA 1ID0A 1TH8A 4KSGA 3INWA 3G7BA 4KQVA 2WEQA 2Q8GA 2JJCA 1UYFA 4QPKA 1TC0A 2YE2A 3RLPA 2BU2A 4LWHA 3T0ZA 4FCQA 3EHJA 2Q8FA 2VCIA 4MP2A 3IEDA 4DZYA 2XK2A 3CWVA 4FMTA 4MP7A 2YE9A 2QF6A 4O09A 5M4KA 1GKXA 4XCJA 5CTYA 2BU5A 4XIPA 3G75A 2XHXA 3A0TA 1L0OA 2YEJA 3FT8A 3CGZA 1OSFA 3ZM7A 3TZ0A 5D7DA 3B24A 3HYYA 3CRKA 3Q5JA 4U93A 4XKAA 1THNA 1Y8OA 1ZWHA 3B25A 1Z5BA 2BRCA 4UROA 4GQTA 3T10A 4YKZA 4FCRA 1U2OA 3K60A 3GIFA 4EFTA 2YEHA 1YSZA 4XD8A 3H80A 3OWDA 3A0YA 3WQ9A 2ZKJA 4L90A 4V26A 1YC1A 2O1VA 5CTUA 2O1UA 5L3JA 1TILA 4Q20A 2YK2A 1TIDA 4PL9A 1I58A 2IWUA 3NMQA 2YEBA 3A0ZA 4XIRA 3O2FA 1YT0A 4MPNA 2YJWA 3ZKBA 4JAUA 3EKRA 1KZNA 2O1WA 2WI1A 1BXDA 4HXWA 4XDMA 4PU9A 1Y8PA 4URMA 2CCTA 2XHTA 2XJJA 4ZVIA 3DGEA 5J6AA 1QZRA 2HCHA 1ZXMA 2YJXA 4YKUA 1TBWA 3JZ3A 4JAVA 1BKNA 1QY8A 4LP0A 3A0XA 1UYGA 3VADA 4E00A 4V25A 1YESA 3BMYA 1UYMA 3BM9A 2ZDXA 1QYEA 4E02A 3TZ4A 1Z59A 1ZXNA 2UWDA 2BYIA 4URNA 3KE6A 2VWCA 2IWSA 3RKZA 4H81A 3SL2A 3TZ5A 2YK9A 3HZ1A 4GEEA 4YKWA 2YEGA 3D36A 3ZKDA 4LWGA 1UY9A 2WI2A 4NH9A 3OMUA 4R1FA 2IORA 4XC0A 3GIGB 2YGAA 5M4HA 3VHCA 5CF0A 2GQPA 3O6OA 2Q2EB 4URLA 5D7RA 4CWSA 4XKOA 4MBCA 4ASAA 4BAEA 2YEFA 5F3KA 2BU6A 2Q8HA 4BXIA 4ASBA 1A4HA 4MB9A 1JM6A 3HZ5A 4HY6A 1YT2A 2BTZA 4PRVA 1I5DA 2FYPA 1UYKA 2GFDA 4U7OA 2YGFA 3R4OA 2CGFA 5IDMA 2XABA 2XCMA 2XDLA 3VHAA 1NHJA 4EM7A 1AMWA 2BZ5A 4XCLA 3C0EA 4CWTA 4O05A 4U7NA 4H85A 2Q8IA 3WHAA 3QTFA 3FT5A 4GFNA 4AWOA 1YETA 1BGQA 5CTWA 4DUHA 4W7TA 1UYDA 2BYHA 1U0ZA 3RLQA 4NH7A 4EMVA 4JQLA 3R4PA 4YKXA 2XDUA 3K99A 4FCPA 4R3AA 4CWRA 3U2DA 4B6CA 4EGKA 2BU7A 4NH8A 1US7A 1B62A 3R91A 2CG9A 2ESAA 4CWFA 2FWZA 3VHDA 3OPDA 4O04A 3U67A 2WI4A 3OWBA 5M4EA 1H7SA 1YS3A 3TTZA 4YKQA 2BSMA 1AH6A 4BIUA 2H8MA 5FNDA 1PVGA 2WEPA 1UY8A 4HZ5A 2BT0A 4CE1A 1I59A 1Y4UA 1I5CA 4GGLA 5FWKA 4XITA 4AWQA 3A0WA 4XE2A 2YE5A 1B3QA 1TC6A 3T0HA 2C2AA 1YT1A 4KTNA 1EA6A 4CE2A 3TZ2A 5IN9A 1UYEA 4ZKIA 3INXA 1Y4SA 3GIEA 4CWPA 5D6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKI A;  1Z5A A;  4MPC A;  2YE6 A;  3EKO A;  1AM1 A;  2XJX A;  4XTJ A;  2YKB A;  4L91 A;  4MPE A;  1KIJ A;  4HZ0 A;  2ZBK B;  3C11 A;  4H7Q A;  2YED A;  2XDX A;  3LPS A;  5FNF A;  2HG1 A;  3HEK A;  2YKE A;  5M4M A;  3EHG A;  2AKP A;  4L8Z A;  3EHH A;  3MNR P;  4CWQ A;  2YGE A;  2ZDY A;  5IDJ A;  3K98 A;  2XDS A;  2YE7 A;  1YER A;  1S14 A;  2WI5 A;  4AS9 A;  4EGI A;  2HKJ A;  4KSH A;  4KP4 A;  4HYP A;  3T1K A;  3OW6 A;  4HYM A;  1UYL A;  3G7E A;  3RLR A;  3T2S A;  3HYZ A;  2IOP A;  2XX2 A;  4EEH A;  4EGH A;  4PRX A;  4K4O A;  2E0A A;  3QDD A;  4L94 A;  5CPH A;  2WI3 A;  4EFU A;  2YI6 A;  2YKC A;  3H4L A;  4B7P A;  3D0B A;  2XHR A;  1UY6 A;  4I3H A;  1AH8 A;  2VCJ A;  3B27 A;  5M4P A;  3TUH A;  4CWN A;  4CWO A;  5FNC A;  4XIQ A;  5M4N A;  1GJV A;  2QG2 A;  1ZW9 A;  2CCU A;  2YEE A;  2QFO A;  3B26 A;  2WER A;  3Q5K A;  4HXZ A;  3D2R A;  4R3M A;  2YEA A;  2YE4 A;  5D6Q A;  2EXL A;  4JAS A;  3PEH A;  4LWE A;  3Q5L A;  2IOQ A;  4ASG A;  2H55 A;  4FPP A;  1I5B A;  4YKT A;  2YE8 A;  5BOC A;  1Y8N A;  4XKK A;  1EI1 A;  1GKZ A;  1YSR A;  3U2K A;  5F5R A;  5GGZ A;  2YKI A;  4GCZ A;  3ZXQ A;  2WI7 A;  2XDK A;  4LWF A;  4AWP A;  2XX4 A;  4P8O A;  4YKY A;  2CCS A;  3R4M A;  2PNR A;  4BIZ A;  1NHH A;  1S16 A;  2XD6 A;  4ASF A;  1MU5 A;  1R62 A;  3R4N A;  1UYI A;  3O0I A;  1MX0 A;  2YE3 A;  3CGY A;  5D7C A;  4CE3 A;  1B63 A;  4BQG A;  4HY1 A;  4QPJ A;  4WUC A;  2VW5 A;  4WUD A;  3ZXO A;  1Z5C A;  2XX5 A;  4P7A A;  2K5B A;  2IWX A;  5J71 A;  1AJ6 A;  5CTX A;  4LPB A;  2YI5 A;  2CH4 A;  4O07 A;  2QG0 A;  1I5A A;  3A0R A;  4BQJ A;  4GT8 A;  4YKR A;  1UYC A;  1YC3 A;  1H7U A;  2YEI A;  1UY7 A;  2XJG A;  3FV5 A;  4MOT A;  4O0B A;  4E01 A;  2BRE A;  3LNU A;  1BYQ A;  4LWI A;  2FWY A;  2YI0 A;  5BOD A;  5C93 A;  3HHU A;  4L93 A;  4I5S A;  4KFG A;  1UYH A;  3B28 A;  4WUB A;  2FXS A;  4X9L A;  3CRL A;  2WI6 A;  1NHI A;  3EHF A;  3K97 A;  2YKJ A;  3R92 A;  2BU8 A;  2YI7 A;  3PEJ A;  3GIG A;  1YC4 A;  2YEC A;  1ID0 A;  1TH8 A;  4KSG A;  3INW A;  3G7B A;  4KQV A;  2WEQ A;  2Q8G A;  2JJC A;  1UYF A;  4QPK A;  1TC0 A;  2YE2 A;  3RLP A;  2BU2 A;  4LWH A;  3T0Z A;  4FCQ A;  3EHJ A;  2Q8F A;  2VCI A;  4MP2 A;  3IED A;  4DZY A;  2XK2 A;  3CWV A;  4FMT A;  4MP7 A;  2YE9 A;  2QF6 A;  4O09 A;  5M4K A;  1GKX A;  4XCJ A;  5CTY A;  2BU5 A;  4XIP A;  3G75 A;  2XHX A;  3A0T A;  1L0O A;  2YEJ A;  3FT8 A;  3CGZ A;  1OSF A;  3ZM7 A;  3TZ0 A;  5D7D A;  3B24 A;  3HYY A;  3CRK A;  3Q5J A;  4U93 A;  4XKA A;  1THN A;  1Y8O A;  1ZWH A;  3B25 A;  1Z5B A;  2BRC A;  4URO A;  4GQT A;  3T10 A;  4YKZ A;  4FCR A;  1U2O A;  3K60 A;  3GIF A;  4EFT A;  2YEH A;  1YSZ A;  4XD8 A;  3H80 A;  3OWD A;  3A0Y A;  3WQ9 A;  2ZKJ A;  4L90 A;  4V26 A;  1YC1 A;  2O1V A;  5CTU A;  2O1U A;  5L3J A;  1TIL A;  4Q20 A;  2YK2 A;  1TID A;  4PL9 A;  1I58 A;  2IWU A;  3NMQ A;  2YEB A;  3A0Z A;  4XIR A;  3O2F A;  1YT0 A;  4MPN A;  2YJW A;  3ZKB A;  4JAU A;  3EKR A;  1KZN A;  2O1W A;  2WI1 A;  1BXD A;  4HXW A;  4XDM A;  4PU9 A;  1Y8P A;  4URM A;  2CCT A;  2XHT A;  2XJJ A;  4ZVI A;  3DGE A;  5J6A A;  1QZR A;  2HCH A;  1ZXM A;  2YJX A;  4YKU A;  1TBW A;  3JZ3 A;  4JAV A;  1BKN A;  1QY8 A;  4LP0 A;  3A0X A;  1UYG A;  3VAD A;  4E00 A;  4V25 A;  1YES A;  3BMY A;  1UYM A;  3BM9 A;  2ZDX A;  1QYE A;  4E02 A;  3TZ4 A;  1Z59 A;  1ZXN A;  2UWD A;  2BYI A;  4URN A;  3KE6 A;  2VWC A;  2IWS A;  3RKZ A;  4H81 A;  3SL2 A;  3TZ5 A;  2YK9 A;  3HZ1 A;  4GEE A;  4YKW A;  2YEG A;  3D36 A;  3ZKD A;  4LWG A;  1UY9 A;  2WI2 A;  4NH9 A;  3OMU A;  4R1F A;  2IOR A;  4XC0 A;  3GIG B;  2YGA A;  5M4H A;  3VHC A;  5CF0 A;  2GQP A;  3O6O A;  2Q2E B;  4URL A;  5D7R A;  4CWS A;  4XKO A;  4MBC A;  4ASA A;  4BAE A;  2YEF A;  5F3K A;  2BU6 A;  2Q8H A;  4BXI A;  4ASB A;  1A4H A;  4MB9 A;  1JM6 A;  3HZ5 A;  4HY6 A;  1YT2 A;  2BTZ A;  4PRV A;  1I5D A;  2FYP A;  1UYK A;  2GFD A;  4U7O A;  2YGF A;  3R4O A;  2CGF A;  5IDM A;  2XAB A;  2XCM A;  2XDL A;  3VHA A;  1NHJ A;  4EM7 A;  1AMW A;  2BZ5 A;  4XCL A;  3C0E A;  4CWT A;  4O05 A;  4U7N A;  4H85 A;  2Q8I A;  3WHA A;  3QTF A;  3FT5 A;  4GFN A;  4AWO A;  1YET A;  1BGQ A;  5CTW A;  4DUH A;  4W7T A;  1UYD A;  2BYH A;  1U0Z A;  3RLQ A;  4NH7 A;  4EMV A;  4JQL A;  3R4P A;  4YKX A;  2XDU A;  3K99 A;  4FCP A;  4R3A A;  4CWR A;  3U2D A;  4B6C A;  4EGK A;  2BU7 A;  4NH8 A;  1US7 A;  1B62 A;  3R91 A;  2CG9 A;  2ESA A;  4CWF A;  2FWZ A;  3VHD A;  3OPD A;  4O04 A;  3U67 A;  2WI4 A;  3OWB A;  5M4E A;  1H7S A;  1YS3 A;  3TTZ A;  4YKQ A;  2BSM A;  1AH6 A;  4BIU A;  2H8M A;  5FND A;  1PVG A;  2WEP A;  1UY8 A;  4HZ5 A;  2BT0 A;  4CE1 A;  1I59 A;  1Y4U A;  1I5C A;  4GGL A;  5FWK A;  4XIT A;  4AWQ A;  3A0W A;  4XE2 A;  2YE5 A;  1B3Q A;  1TC6 A;  3T0H A;  2C2A A;  1YT1 A;  4KTN A;  1EA6 A;  4CE2 A;  3TZ2 A;  5IN9 A;  1UYE A;  4ZKI A;  3INX A;  1Y4S A;  3GIE A;  4CWP A;  5D6P A; 
#chains in the Genus database with same CATH topology
 2JKI A;  1Z5A A;  4MPC A;  2YE6 A;  3EKO A;  1AM1 A;  2XJX A;  4XTJ A;  2YKB A;  4L91 A;  4MPE A;  1KIJ A;  4HZ0 A;  2ZBK B;  3C11 A;  4H7Q A;  2YED A;  2XDX A;  3LPS A;  5FNF A;  2HG1 A;  3HEK A;  2YKE A;  5M4M A;  3EHG A;  2AKP A;  4L8Z A;  3EHH A;  3MNR P;  4CWQ A;  2YGE A;  2ZDY A;  5IDJ A;  3K98 A;  2XDS A;  2YE7 A;  1YER A;  1S14 A;  2WI5 A;  4AS9 A;  4EGI A;  2HKJ A;  4KSH A;  4KP4 A;  4HYP A;  3T1K A;  3OW6 A;  4HYM A;  1UYL A;  3G7E A;  3RLR A;  3T2S A;  3HYZ A;  2IOP A;  2XX2 A;  4EEH A;  4EGH A;  4PRX A;  4K4O A;  2E0A A;  3QDD A;  4L94 A;  5CPH A;  2WI3 A;  4EFU A;  2YI6 A;  2YKC A;  3H4L A;  4B7P A;  3D0B A;  2XHR A;  1UY6 A;  4I3H A;  1AH8 A;  2VCJ A;  3B27 A;  5M4P A;  3TUH A;  4CWN A;  4CWO A;  5FNC A;  4XIQ A;  5M4N A;  1GJV A;  2QG2 A;  1ZW9 A;  2CCU A;  2YEE A;  2QFO A;  3B26 A;  1F51 A;  2WER A;  3Q5K A;  4HXZ A;  3D2R A;  4R3M A;  2YEA A;  2YE4 A;  5D6Q A;  2EXL A;  4JAS A;  3PEH A;  4LWE A;  3Q5L A;  2IOQ A;  4ASG A;  2H55 A;  4FPP A;  1I5B A;  4YKT A;  2YE8 A;  5BOC A;  1Y8N A;  4XKK A;  1EI1 A;  1GKZ A;  1YSR A;  3U2K A;  5F5R A;  5GGZ A;  2YKI A;  4GCZ A;  3ZXQ A;  2WI7 A;  2XDK A;  4LWF A;  4AWP A;  4E72 A;  2XX4 A;  4P8O A;  4YKY A;  2CCS A;  3R4M A;  2PNR A;  4BIZ A;  1NHH A;  1S16 A;  2XD6 A;  4ASF A;  1MU5 A;  1R62 A;  3R4N A;  1UYI A;  3O0I A;  1MX0 A;  2YE3 A;  3CGY A;  5D7C A;  4CE3 A;  1B63 A;  4BQG A;  4HY1 A;  4QPJ A;  4WUC A;  2VW5 A;  4WUD A;  3ZXO A;  1Z5C A;  2XX5 A;  4P7A A;  2K5B A;  2IWX A;  5J71 A;  1AJ6 A;  5CTX A;  4LPB A;  2YI5 A;  2CH4 A;  4O07 A;  2QG0 A;  1I5A A;  3A0R A;  4BQJ A;  4GT8 A;  4YKR A;  1UYC A;  1YC3 A;  1H7U A;  2YEI A;  1UY7 A;  2XJG A;  3FV5 A;  4MOT A;  4O0B A;  4E01 A;  2BRE A;  3LNU A;  1BYQ A;  4LWI A;  2FWY A;  2YI0 A;  5BOD A;  5C93 A;  3HHU A;  4L93 A;  4I5S A;  4KFG A;  1UYH A;  3B28 A;  4WUB A;  2FXS A;  4X9L A;  3CRL A;  2WI6 A;  1NHI A;  3EHF A;  3K97 A;  2YKJ A;  3R92 A;  2BU8 A;  2YI7 A;  3PEJ A;  3GIG A;  1YC4 A;  2YEC A;  1ID0 A;  1TH8 A;  4KSG A;  3INW A;  5JEN A;  3G7B A;  4KQV A;  2WEQ A;  2Q8G A;  2JJC A;  1UYF A;  4QPK A;  1TC0 A;  2YE2 A;  3RLP A;  2BU2 A;  4LWH A;  3T0Z A;  4FCQ A;  3EHJ A;  2Q8F A;  2VCI A;  4MP2 A;  3IED A;  4DZY A;  2XK2 A;  3CWV A;  4FMT A;  4MP7 A;  2YE9 A;  2QF6 A;  4O09 A;  5M4K A;  1GKX A;  4XCJ A;  5CTY A;  2BU5 A;  4XIP A;  3G75 A;  2XHX A;  3A0T A;  1L0O A;  2YEJ A;  3FT8 A;  3CGZ A;  1OSF A;  3ZM7 A;  3TZ0 A;  2C1G A;  3LMM A;  5D7D A;  3B24 A;  3HYY A;  3S5T A;  3CRK A;  3Q5J A;  4U93 A;  4XKA A;  1THN A;  1Y8O A;  1ZWH A;  3B25 A;  1Z5B A;  2BRC A;  4URO A;  4GQT A;  3T10 A;  4YKZ A;  4FCR A;  1U2O A;  3K60 A;  3GIF A;  4EFT A;  2YEH A;  1YSZ A;  4XD8 A;  3H80 A;  3OWD A;  3A0Y A;  3WQ9 A;  2ZKJ A;  4L90 A;  4V26 A;  1YC1 A;  2O1V A;  5CTU A;  2O1U A;  5L3J A;  1TIL A;  4Q20 A;  2YK2 A;  1TID A;  4PL9 A;  1I58 A;  2IWU A;  3NMQ A;  2YEB A;  3A0Z A;  4XIR A;  3O2F A;  1YT0 A;  4MPN A;  2YJW A;  3ZKB A;  4JAU A;  3EKR A;  1KZN A;  2O1W A;  2WI1 A;  3CYG A;  1BXD A;  1IXM A;  4HXW A;  4XDM A;  4PU9 A;  1Y8P A;  4URM A;  2CCT A;  2XHT A;  2XJJ A;  4ZVI A;  3DGE A;  5J6A A;  1QZR A;  2HCH A;  1ZXM A;  2YJX A;  4YKU A;  1TBW A;  3JZ3 A;  4JAV A;  1BKN A;  1QY8 A;  4LP0 A;  3A0X A;  1UYG A;  3VAD A;  4E00 A;  4V25 A;  1YES A;  3BMY A;  1UYM A;  3BM9 A;  2ZDX A;  2C1I A;  1QYE A;  4E02 A;  3TZ4 A;  1Z59 A;  1ZXN A;  2UWD A;  2BYI A;  4URN A;  3KE6 A;  2VWC A;  2IWS A;  3RKZ A;  4H81 A;  3SL2 A;  3TZ5 A;  2YK9 A;  3HZ1 A;  4GEE A;  4YKW A;  2YEG A;  3D36 A;  3ZKD A;  4LWG A;  1UY9 A;  2WI2 A;  4NH9 A;  3OMU A;  4R1F A;  2IOR A;  4XC0 A;  3GIG B;  2YGA A;  5M4H A;  3VHC A;  5CF0 A;  2GQP A;  3O6O A;  2Q2E B;  4URL A;  5D7R A;  4CWS A;  4XKO A;  2HHI A;  4MBC A;  4ASA A;  4BAE A;  2YEF A;  5F3K A;  2BU6 A;  2Q8H A;  4BXI A;  4ASB A;  1A4H A;  4MB9 A;  1JM6 A;  3HZ5 A;  4HY6 A;  1YT2 A;  2BTZ A;  4PRV A;  1I5D A;  2FYP A;  1UYK A;  2GFD A;  4U7O A;  2YGF A;  3R4O A;  2CGF A;  5IDM A;  2XAB A;  2XCM A;  2XDL A;  3VHA A;  1NHJ A;  4EM7 A;  1AMW A;  2BZ5 A;  4XCL A;  3C0E A;  4CWT A;  4O05 A;  4U7N A;  4H85 A;  2Q8I A;  3WHA A;  3QTF A;  3FT5 A;  4GFN A;  4AWO A;  1YET A;  1BGQ A;  5CTW A;  4DUH A;  4W7T A;  1UYD A;  2BYH A;  1U0Z A;  3RLQ A;  4NH7 A;  4EMV A;  4JQL A;  3R4P A;  4YKX A;  2XDU A;  3K99 A;  4FCP A;  4R3A A;  4CWR A;  3U2D A;  4B6C A;  4EGK A;  2BU7 A;  4NH8 A;  1US7 A;  1B62 A;  3R91 A;  2CG9 A;  2ESA A;  4CWF A;  2FWZ A;  3VHD A;  3OPD A;  4O04 A;  3U67 A;  2WI4 A;  3OWB A;  5M4E A;  1H7S A;  1YS3 A;  3TTZ A;  4YKQ A;  2BSM A;  1AH6 A;  4BIU A;  2H8M A;  5FND A;  1PVG A;  2WEP A;  1UY8 A;  2FTK A;  4HZ5 A;  2BT0 A;  4CE1 A;  1I59 A;  1Y4U A;  1I5C A;  4GGL A;  5FWK A;  4XIT A;  4AWQ A;  3A0W A;  4XE2 A;  2YE5 A;  1B3Q A;  1TC6 A;  3T0H A;  2C2A A;  1YT1 A;  4KTN A;  1EA6 A;  4CE2 A;  3TZ2 A;  5IN9 A;  1UYE A;  4ZKI A;  3INX A;  1Y4S A;  3GIE A;  4CWP A;  5D6P A; 
#chains in the Genus database with same CATH homology
 2JKI A;  1Z5A A;  4MPC A;  2YE6 A;  3EKO A;  1AM1 A;  2XJX A;  4XTJ A;  2YKB A;  4L91 A;  4MPE A;  1KIJ A;  4HZ0 A;  2ZBK B;  3C11 A;  4H7Q A;  2YED A;  2XDX A;  3LPS A;  5FNF A;  2HG1 A;  3HEK A;  2YKE A;  5M4M A;  3EHG A;  2AKP A;  4L8Z A;  3EHH A;  3MNR P;  4CWQ A;  2YGE A;  2ZDY A;  5IDJ A;  3K98 A;  2XDS A;  2YE7 A;  1YER A;  1S14 A;  2WI5 A;  4AS9 A;  4EGI A;  2HKJ A;  4KSH A;  4KP4 A;  4HYP A;  3T1K A;  3OW6 A;  4HYM A;  1UYL A;  3G7E A;  3RLR A;  3T2S A;  3HYZ A;  2IOP A;  2XX2 A;  4EEH A;  4EGH A;  4PRX A;  4K4O A;  2E0A A;  3QDD A;  4L94 A;  5CPH A;  2WI3 A;  4EFU A;  2YI6 A;  2YKC A;  3H4L A;  4B7P A;  3D0B A;  2XHR A;  1UY6 A;  4I3H A;  1AH8 A;  2VCJ A;  3B27 A;  5M4P A;  3TUH A;  4CWN A;  4CWO A;  5FNC A;  4XIQ A;  5M4N A;  1GJV A;  2QG2 A;  1ZW9 A;  2CCU A;  2YEE A;  2QFO A;  3B26 A;  2WER A;  3Q5K A;  4HXZ A;  3D2R A;  4R3M A;  2YEA A;  2YE4 A;  5D6Q A;  2EXL A;  4JAS A;  3PEH A;  4LWE A;  3Q5L A;  2IOQ A;  4ASG A;  2H55 A;  4FPP A;  1I5B A;  4YKT A;  2YE8 A;  5BOC A;  1Y8N A;  4XKK A;  1EI1 A;  1GKZ A;  1YSR A;  3U2K A;  5F5R A;  5GGZ A;  2YKI A;  4GCZ A;  3ZXQ A;  2WI7 A;  2XDK A;  4LWF A;  4AWP A;  2XX4 A;  4P8O A;  4YKY A;  2CCS A;  3R4M A;  2PNR A;  4BIZ A;  1NHH A;  1S16 A;  2XD6 A;  4ASF A;  1MU5 A;  1R62 A;  3R4N A;  1UYI A;  3O0I A;  1MX0 A;  2YE3 A;  3CGY A;  5D7C A;  4CE3 A;  1B63 A;  4BQG A;  4HY1 A;  4QPJ A;  4WUC A;  2VW5 A;  4WUD A;  3ZXO A;  1Z5C A;  2XX5 A;  4P7A A;  2K5B A;  2IWX A;  5J71 A;  1AJ6 A;  5CTX A;  4LPB A;  2YI5 A;  2CH4 A;  4O07 A;  2QG0 A;  1I5A A;  3A0R A;  4BQJ A;  4GT8 A;  4YKR A;  1UYC A;  1YC3 A;  1H7U A;  2YEI A;  1UY7 A;  2XJG A;  3FV5 A;  4MOT A;  4O0B A;  4E01 A;  2BRE A;  3LNU A;  1BYQ A;  4LWI A;  2FWY A;  2YI0 A;  5BOD A;  5C93 A;  3HHU A;  4L93 A;  4I5S A;  4KFG A;  1UYH A;  3B28 A;  4WUB A;  2FXS A;  4X9L A;  3CRL A;  2WI6 A;  1NHI A;  3EHF A;  3K97 A;  2YKJ A;  3R92 A;  2BU8 A;  2YI7 A;  3PEJ A;  3GIG A;  1YC4 A;  2YEC A;  1ID0 A;  1TH8 A;  4KSG A;  3INW A;  3G7B A;  4KQV A;  2WEQ A;  2Q8G A;  2JJC A;  1UYF A;  4QPK A;  1TC0 A;  2YE2 A;  3RLP A;  2BU2 A;  4LWH A;  3T0Z A;  4FCQ A;  3EHJ A;  2Q8F A;  2VCI A;  4MP2 A;  3IED A;  4DZY A;  2XK2 A;  3CWV A;  4FMT A;  4MP7 A;  2YE9 A;  2QF6 A;  4O09 A;  5M4K A;  1GKX A;  4XCJ A;  5CTY A;  2BU5 A;  4XIP A;  3G75 A;  2XHX A;  3A0T A;  1L0O A;  2YEJ A;  3FT8 A;  3CGZ A;  1OSF A;  3ZM7 A;  3TZ0 A;  5D7D A;  3B24 A;  3HYY A;  3CRK A;  3Q5J A;  4U93 A;  4XKA A;  1THN A;  1Y8O A;  1ZWH A;  3B25 A;  1Z5B A;  2BRC A;  4URO A;  4GQT A;  3T10 A;  4YKZ A;  4FCR A;  1U2O A;  3K60 A;  3GIF A;  4EFT A;  2YEH A;  1YSZ A;  4XD8 A;  3H80 A;  3OWD A;  3A0Y A;  3WQ9 A;  2ZKJ A;  4L90 A;  4V26 A;  1YC1 A;  2O1V A;  5CTU A;  2O1U A;  5L3J A;  1TIL A;  4Q20 A;  2YK2 A;  1TID A;  4PL9 A;  1I58 A;  2IWU A;  3NMQ A;  2YEB A;  3A0Z A;  4XIR A;  3O2F A;  1YT0 A;  4MPN A;  2YJW A;  3ZKB A;  4JAU A;  3EKR A;  1KZN A;  2O1W A;  2WI1 A;  1BXD A;  4HXW A;  4XDM A;  4PU9 A;  1Y8P A;  4URM A;  2CCT A;  2XHT A;  2XJJ A;  4ZVI A;  3DGE A;  5J6A A;  1QZR A;  2HCH A;  1ZXM A;  2YJX A;  4YKU A;  1TBW A;  3JZ3 A;  4JAV A;  1BKN A;  1QY8 A;  4LP0 A;  3A0X A;  1UYG A;  3VAD A;  4E00 A;  4V25 A;  1YES A;  3BMY A;  1UYM A;  3BM9 A;  2ZDX A;  1QYE A;  4E02 A;  3TZ4 A;  1Z59 A;  1ZXN A;  2UWD A;  2BYI A;  4URN A;  3KE6 A;  2VWC A;  2IWS A;  3RKZ A;  4H81 A;  3SL2 A;  3TZ5 A;  2YK9 A;  3HZ1 A;  4GEE A;  4YKW A;  2YEG A;  3D36 A;  3ZKD A;  4LWG A;  1UY9 A;  2WI2 A;  4NH9 A;  3OMU A;  4R1F A;  2IOR A;  4XC0 A;  3GIG B;  2YGA A;  5M4H A;  3VHC A;  5CF0 A;  2GQP A;  3O6O A;  2Q2E B;  4URL A;  5D7R A;  4CWS A;  4XKO A;  4MBC A;  4ASA A;  4BAE A;  2YEF A;  5F3K A;  2BU6 A;  2Q8H A;  4BXI A;  4ASB A;  1A4H A;  4MB9 A;  1JM6 A;  3HZ5 A;  4HY6 A;  1YT2 A;  2BTZ A;  4PRV A;  1I5D A;  2FYP A;  1UYK A;  2GFD A;  4U7O A;  2YGF A;  3R4O A;  2CGF A;  5IDM A;  2XAB A;  2XCM A;  2XDL A;  3VHA A;  1NHJ A;  4EM7 A;  1AMW A;  2BZ5 A;  4XCL A;  3C0E A;  4CWT A;  4O05 A;  4U7N A;  4H85 A;  2Q8I A;  3WHA A;  3QTF A;  3FT5 A;  4GFN A;  4AWO A;  1YET A;  1BGQ A;  5CTW A;  4DUH A;  4W7T A;  1UYD A;  2BYH A;  1U0Z A;  3RLQ A;  4NH7 A;  4EMV A;  4JQL A;  3R4P A;  4YKX A;  2XDU A;  3K99 A;  4FCP A;  4R3A A;  4CWR A;  3U2D A;  4B6C A;  4EGK A;  2BU7 A;  4NH8 A;  1US7 A;  1B62 A;  3R91 A;  2CG9 A;  2ESA A;  4CWF A;  2FWZ A;  3VHD A;  3OPD A;  4O04 A;  3U67 A;  2WI4 A;  3OWB A;  5M4E A;  1H7S A;  1YS3 A;  3TTZ A;  4YKQ A;  2BSM A;  1AH6 A;  4BIU A;  2H8M A;  5FND A;  1PVG A;  2WEP A;  1UY8 A;  4HZ5 A;  2BT0 A;  4CE1 A;  1I59 A;  1Y4U A;  1I5C A;  4GGL A;  5FWK A;  4XIT A;  4AWQ A;  3A0W A;  4XE2 A;  2YE5 A;  1B3Q A;  1TC6 A;  3T0H A;  2C2A A;  1YT1 A;  4KTN A;  1EA6 A;  4CE2 A;  3TZ2 A;  5IN9 A;  1UYE A;  4ZKI A;  3INX A;  1Y4S A;  3GIE A;  4CWP A;  5D6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...